1Q5XA

Structure of of rraa (meng), a protein inhibitor of rna processing
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
160
structure length
160
Chain Sequence
KYDTSELCDIYQEDVNVVEPLFSNFGGRASFGGQIITVKCFEDNGLLYDLLEQNGRGRVLVVDGGGSVRRALVDAELARLAVQNEWEGLVIYGAVRQVDDLEELDIGIQAMAAIPVGAAGEGIGESDVRVNFGGVTFFSGDHLYADNTGIILSEDPLDIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray Structure of Escherichia coli RraA (MenG), A Protein Inhibitor of RNA Processing.
pubmed doi rcsb
molecule keywords REGULATOR OF RNASE E ACTIVITY A
molecule tags Hydrolase inhibitor
source organism Escherichia coli
total genus 46
structure length 160
sequence length 160
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03737 RraA-like Aldolase/RraA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.40 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Ribonuclease E inhibitor RraA/RraA-like 1q5xA00
1Q5XA 2PCNA 3NOJA 1VI4A 1J3LA 1NXJA 3C8OA 2YJTA 2YJVA 3K4IA
chains in the Genus database with same CATH superfamily
2FM4A 1M6VB 2C5QA 2R82A 2PVWA 5D29A 1NBWA 1V6CA 4NGMA 4MI1A 4CO9A 1CS0B 1XF1A 3TLGB 3FF3A 1VI4A 4OC0A 3TLBA 3BXMA 3T5MA 2DIKA 5F09A 3BI0A 4P4EA 1JDBC 4P4FA 1T36B 4E5SA 4NGQA 4COGA 2X0SA 4OC4A 3TLEA 1A9XB 1EZAA 4IIYA 3S9NA 1CX8A 2JBKA 4OC3A 4P4IA 1WVMA 1C30B 2E28A 3FEDA 3SJGA 3SR3A 4NGNA 2MP0A 5IR2A 1Q5XA 3BHXA 5F9MA 4P4DA 4P4BA 2C6GA 2EZCA 4TWEA 4NGPA 3SJEA 3T07A 3RBUA 4MJXA 3FEEA 3D7GA 4P45A 1DIKA 1KC7A 4C8UA 1JDEA 4C8CA 3GJZA 4MCSA 2XEJA 4P44A 4C85A 2XEGA 4C8PA 4E94A 4NGTA 5K99A 5ELYA 2PVVA 3SJFA 3TLCA 2HROA 2PCNA 3NOJA 4C86A 3K9TA 4OC1A 3FECA 2YJVA 3T0TA 5F5XA 3D7FA 1NXJA 2OOTA 2GP4A 1Z8LA 2D0PA 4J0NA 3BI1A 3K4IA 1CE8B 3EIFA 3G23A 4C9VA 4OMEA 4C9UA 2OR4A 2EK8A 2D0OA 4NGSA 3EZAA 5JYBA 4INJA 4C9EA 4C99A 4P4JA 1GGOA 4OC2A 3SJXA 3ICUA 2EZBA 4W9YA 3U1BA 4C9RA 1ZRSA 2HI6A 2EK9A 3D7DA 2XEIA 1J3LA 4JVOA 3I74A 2OLSA 4TJXA 3IIBA 4COBA 3TLAA 2C6PA 3D7HA 3KASA 4CDKA 1BXRB 4C8TA 4H1HA 1ZYMA 4IIXA 3I6SA 4C8FA 4LQGA 4TJVA 4X3RA 1DE4C 3TYXA 1R61A 2HWGA 1VBHA 3IWWA 2AUMA 2JBJA 4NGRA 3KRVA 4CZ1A 4YN3A 5JVLA 1C3OB 4M8DA 3S9MA 3EZBA 4C8AA 4JYWA 5IB9A 3C8OA 4KNGE 4OC5A 4JZ0A 2C6CA 3S9LA 1Y9ZA 4MCQA 3TLYA 4CDJA 2B0AA 2CIJA 1KEEB 4MCRA 4C84A 3TLGA 5F1YA 5FD8A 1KBLA 2XEFA 3EZEA 4MCPA 4C9AA 1ZL0A 2AUNA 2YJTA 3VTAA 4EYSA 2EZAA 3TLZA 1VBGA 1EZBA 3T05A
chains in the Genus database with same CATH topology
1Q5XA 2PCNA 3NOJA 1VI4A 1J3LA 1NXJA 3C8OA 2YJTA 2YJVA 3K4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q5X A;  2PCN A;  3NOJ A;  1VI4 A;  1J3L A;  1NXJ A;  3C8O A;  2YJT A;  2YJV A;  3K4I A; 
#chains in the Genus database with same CATH topology
 2FM4 A;  1M6V B;  2C5Q A;  2R82 A;  2PVW A;  5D29 A;  1NBW A;  1V6C A;  4NGM A;  4MI1 A;  4CO9 A;  1CS0 B;  1XF1 A;  3TLG B;  3FF3 A;  1VI4 A;  4OC0 A;  3TLB A;  3BXM A;  3T5M A;  2DIK A;  5F09 A;  3BI0 A;  4P4E A;  1JDB C;  4P4F A;  1T36 B;  4E5S A;  4NGQ A;  4COG A;  2X0S A;  4OC4 A;  3TLE A;  1A9X B;  1EZA A;  4IIY A;  3S9N A;  1CX8 A;  2JBK A;  4OC3 A;  4P4I A;  1WVM A;  1C30 B;  2E28 A;  3FED A;  3SJG A;  3SR3 A;  4NGN A;  2MP0 A;  5IR2 A;  1Q5X A;  3BHX A;  5F9M A;  4P4D A;  4P4B A;  2C6G A;  2EZC A;  4TWE A;  4NGP A;  3SJE A;  3T07 A;  3RBU A;  4MJX A;  3FEE A;  3D7G A;  4P45 A;  1DIK A;  1KC7 A;  4C8U A;  1JDE A;  4C8C A;  3GJZ A;  4MCS A;  2XEJ A;  4P44 A;  4C85 A;  2XEG A;  4C8P A;  4E94 A;  4NGT A;  5K99 A;  5ELY A;  2PVV A;  3SJF A;  3TLC A;  2HRO A;  2PCN A;  3NOJ A;  4C86 A;  3K9T A;  4OC1 A;  3FEC A;  2YJV A;  3T0T A;  5F5X A;  3D7F A;  1NXJ A;  2OOT A;  2GP4 A;  1Z8L A;  2D0P A;  4J0N A;  3BI1 A;  3K4I A;  1CE8 B;  3EIF A;  3G23 A;  4C9V A;  4OME A;  4C9U A;  2OR4 A;  2EK8 A;  2D0O A;  4NGS A;  3EZA A;  5JYB A;  4INJ A;  4C9E A;  4C99 A;  4P4J A;  1GGO A;  4OC2 A;  3SJX A;  3ICU A;  2EZB A;  4W9Y A;  3U1B A;  4C9R A;  1ZRS A;  2HI6 A;  2EK9 A;  3D7D A;  2XEI A;  1J3L A;  4JVO A;  3I74 A;  2OLS A;  4TJX A;  3IIB A;  4COB A;  3TLA A;  2C6P A;  3D7H A;  3KAS A;  4CDK A;  1BXR B;  4C8T A;  4H1H A;  1ZYM A;  4IIX A;  3I6S A;  4C8F A;  4LQG A;  4TJV A;  4X3R A;  1DE4 C;  3TYX A;  1R61 A;  2HWG A;  1VBH A;  3IWW A;  2AUM A;  2JBJ A;  4NGR A;  3KRV A;  4CZ1 A;  4YN3 A;  5JVL A;  1C3O B;  4M8D A;  3S9M A;  3EZB A;  4C8A A;  4JYW A;  5IB9 A;  3C8O A;  4KNG E;  4OC5 A;  4JZ0 A;  2C6C A;  3S9L A;  1Y9Z A;  4MCQ A;  3TLY A;  4CDJ A;  2B0A A;  2CIJ A;  1KEE B;  4MCR A;  4C84 A;  3TLG A;  5F1Y A;  5FD8 A;  1KBL A;  2XEF A;  3EZE A;  4MCP A;  4C9A A;  1ZL0 A;  2AUN A;  2YJT A;  3VTA A;  4EYS A;  2EZA A;  3TLZ A;  1VBG A;  1EZB A;  3T05 A; 
#chains in the Genus database with same CATH homology
 1Q5X A;  2PCN A;  3NOJ A;  1VI4 A;  1J3L A;  1NXJ A;  3C8O A;  2YJT A;  2YJV A;  3K4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...