1Q5XA

Structure of of rraa (meng), a protein inhibitor of rna processing
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
160
structure length
160
Chain Sequence
KYDTSELCDIYQEDVNVVEPLFSNFGGRASFGGQIITVKCFEDNGLLYDLLEQNGRGRVLVVDGGGSVRRALVDAELARLAVQNEWEGLVIYGAVRQVDDLEELDIGIQAMAAIPVGAAGEGIGESDVRVNFGGVTFFSGDHLYADNTGIILSEDPLDIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REGULATOR OF RNASE E ACTIVITY A
publication title The X-ray Structure of Escherichia coli RraA (MenG), A Protein Inhibitor of RNA Processing.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase inhibitor
total genus 46
structure length 160
sequence length 160
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03737 RraA-like Aldolase/RraA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.40 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Ribonuclease E inhibitor RraA/RraA-like 1q5xA00
2YJVA 1Q5XA 1NXJA 2YJTA 2PCNA 3NOJA 1VI4A 1J3LA 3C8OA 3K4IA
chains in the Genus database with same CATH superfamily
3EZAA 4OMEA 1EZAA 2MP0A 3EIFA 3T0TA 4JVOA 3C8OA 3SJXA 2D0OA 1C3OB 2XEGA 2D0PA 1ZRSA 5F09A 3S9LA 1ZL0A 5F5XA 1C30B 1A9XB 2OR4A 2HROA 1VBHA 1ZYMA 2C6PA 3BHXA 3SR3A 2DIKA 4MCQA 4OC4A 3T07A 3D7GA 4P44A 4LQGA 3FF3A 4OC5A 4W9YA 4IIXA 4NGTA 1CE8B 1Z8LA 4P4EA 3TLGB 3D7FA 4E94A 3KASA 3GJZA 1M6VB 3K4IA 3EZBA 4CDJA 2CIJA 4C9UA 5FD8A 2X0SA 4E5SA 1VI4A 3TLEA 3S9NA 3K9TA 5ELYA 1JDEA 2E28A 3FECA 4JYWA 3I6SA 5F1YA 1DIKA 2FM4A 4MJXA 2AUNA 3BI0A 3G23A 4NGSA 4TWEA 1KBLA 1WVMA 4TJVA 3D7DA 2XEFA 4P4FA 3FEEA 2GP4A 1CX8A 4CDKA 4TJXA 4CO9A 1NXJA 2EZBA 1KC7A 4OC3A 4C8CA 3TLGA 3TLCA 4C8PA 4X3RA 3BXMA 1V6CA 3IIBA 2EK8A 1BXRB 2PVVA 4P4IA 3D7HA 3BI1A 1T36B 2AUMA 2HWGA 4NGMA 2C6CA 3TLZA 3TLBA 4MI1A 3SJEA 1NBWA 1J3LA 3TYXA 2JBJA 4OC2A 5JVLA 4YN3A 4MCSA 1DE4C 2PVWA 3SJFA 3S9MA 4EYSA 3SJGA 2XEJA 1Y9ZA 4COBA 1JDBC 2HI6A 4IIYA 4MCPA 4P4DA 4NGRA 5D29A 4C9AA 4J0NA 4KNGE 4NGPA 2YJTA 3KRVA 4C86A 4H1HA 2B0AA 1EZBA 1KEEB 2EZCA 4C9VA 5K99A 3FEDA 4COGA 4C8TA 4C8AA 4C8FA 2PCNA 2XEIA 1CS0B 4OC1A 2OLSA 2EZAA 4C9RA 2EK9A 4C85A 2C6GA 3I74A 4NGQA 1GGOA 1XF1A 2YJVA 3IWWA 4C9EA 3U1BA 3TLYA 4M8DA 3ICUA 2C5QA 2R82A 3T05A 5IB9A 5IR2A 5F9MA 4CZ1A 1Q5XA 4JZ0A 1VBGA 4MCRA 4OC0A 2OOTA 1R61A 4INJA 5JYBA 2JBKA 4P45A 3NOJA 3T5MA 4P4BA 3TLAA 4C8UA 3RBUA 3EZEA 4C99A 4NGNA 4P4JA 4C84A 3VTAA
chains in the Genus database with same CATH topology
2YJVA 1Q5XA 1NXJA 2YJTA 2PCNA 3NOJA 1VI4A 1J3LA 3C8OA 3K4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YJV A;  1Q5X A;  1NXJ A;  2YJT A;  2PCN A;  3NOJ A;  1VI4 A;  1J3L A;  3C8O A;  3K4I A; 
#chains in the Genus database with same CATH topology
 3EZA A;  4OME A;  1EZA A;  2MP0 A;  3EIF A;  3T0T A;  4JVO A;  3C8O A;  3SJX A;  2D0O A;  1C3O B;  2XEG A;  2D0P A;  1ZRS A;  5F09 A;  3S9L A;  1ZL0 A;  5F5X A;  1C30 B;  1A9X B;  2OR4 A;  2HRO A;  1VBH A;  1ZYM A;  2C6P A;  3BHX A;  3SR3 A;  2DIK A;  4MCQ A;  4OC4 A;  3T07 A;  3D7G A;  4P44 A;  4LQG A;  3FF3 A;  4OC5 A;  4W9Y A;  4IIX A;  4NGT A;  1CE8 B;  1Z8L A;  4P4E A;  3TLG B;  3D7F A;  4E94 A;  3KAS A;  3GJZ A;  1M6V B;  3K4I A;  3EZB A;  4CDJ A;  2CIJ A;  4C9U A;  5FD8 A;  2X0S A;  4E5S A;  1VI4 A;  3TLE A;  3S9N A;  3K9T A;  5ELY A;  1JDE A;  2E28 A;  3FEC A;  4JYW A;  3I6S A;  5F1Y A;  1DIK A;  2FM4 A;  4MJX A;  2AUN A;  3BI0 A;  3G23 A;  4NGS A;  4TWE A;  1KBL A;  1WVM A;  4TJV A;  3D7D A;  2XEF A;  4P4F A;  3FEE A;  2GP4 A;  1CX8 A;  4CDK A;  4TJX A;  4CO9 A;  1NXJ A;  2EZB A;  1KC7 A;  4OC3 A;  4C8C A;  3TLG A;  3TLC A;  4C8P A;  4X3R A;  3BXM A;  1V6C A;  3IIB A;  2EK8 A;  1BXR B;  2PVV A;  4P4I A;  3D7H A;  3BI1 A;  1T36 B;  2AUM A;  2HWG A;  4NGM A;  2C6C A;  3TLZ A;  3TLB A;  4MI1 A;  3SJE A;  1NBW A;  1J3L A;  3TYX A;  2JBJ A;  4OC2 A;  5JVL A;  4YN3 A;  4MCS A;  1DE4 C;  2PVW A;  3SJF A;  3S9M A;  4EYS A;  3SJG A;  2XEJ A;  1Y9Z A;  4COB A;  1JDB C;  2HI6 A;  4IIY A;  4MCP A;  4P4D A;  4NGR A;  5D29 A;  4C9A A;  4J0N A;  4KNG E;  4NGP A;  2YJT A;  3KRV A;  4C86 A;  4H1H A;  2B0A A;  1EZB A;  1KEE B;  2EZC A;  4C9V A;  5K99 A;  3FED A;  4COG A;  4C8T A;  4C8A A;  4C8F A;  2PCN A;  2XEI A;  1CS0 B;  4OC1 A;  2OLS A;  2EZA A;  4C9R A;  2EK9 A;  4C85 A;  2C6G A;  3I74 A;  4NGQ A;  1GGO A;  1XF1 A;  2YJV A;  3IWW A;  4C9E A;  3U1B A;  3TLY A;  4M8D A;  3ICU A;  2C5Q A;  2R82 A;  3T05 A;  5IB9 A;  5IR2 A;  5F9M A;  4CZ1 A;  1Q5X A;  4JZ0 A;  1VBG A;  4MCR A;  4OC0 A;  2OOT A;  1R61 A;  4INJ A;  5JYB A;  2JBK A;  4P45 A;  3NOJ A;  3T5M A;  4P4B A;  3TLA A;  4C8U A;  3RBU A;  3EZE A;  4C99 A;  4NGN A;  4P4J A;  4C84 A;  3VTA A; 
#chains in the Genus database with same CATH homology
 2YJV A;  1Q5X A;  1NXJ A;  2YJT A;  2PCN A;  3NOJ A;  1VI4 A;  1J3L A;  3C8O A;  3K4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...