1Q5XA

Structure of of rraa (meng), a protein inhibitor of rna processing
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
160
structure length
160
Chain Sequence
KYDTSELCDIYQEDVNVVEPLFSNFGGRASFGGQIITVKCFEDNGLLYDLLEQNGRGRVLVVDGGGSVRRALVDAELARLAVQNEWEGLVIYGAVRQVDDLEELDIGIQAMAAIPVGAAGEGIGESDVRVNFGGVTFFSGDHLYADNTGIILSEDPLDIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray Structure of Escherichia coli RraA (MenG), A Protein Inhibitor of RNA Processing.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase inhibitor
molecule keywords REGULATOR OF RNASE E ACTIVITY A
total genus 46
structure length 160
sequence length 160
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03737 RraA-like Aldolase/RraA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.40 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Ribonuclease E inhibitor RraA/RraA-like 1q5xA00
2PCNA 3K4IA 1Q5XA 1J3LA 2YJVA 3C8OA 3NOJA 1NXJA 1VI4A 2YJTA
chains in the Genus database with same CATH superfamily
4C9VA 3FEEA 4JZ0A 4NGRA 3SJFA 4C84A 4P44A 4TWEA 3I74A 1KC7A 4H1HA 3S9NA 2XEFA 2HROA 4J0NA 5IB9A 3TLBA 2B0AA 2GP4A 2MP0A 4IIYA 4X3RA 2XEJA 4E94A 1VBGA 4E5SA 4COGA 4P4FA 4IIXA 1R61A 4NGMA 1Y9ZA 4NGNA 4OC1A 3TLAA 1A9XB 4NGSA 2EZAA 1J3LA 2YJVA 1CE8B 2AUNA 3G23A 3BI0A 4C99A 4C8PA 4YN3A 3TLEA 5ELYA 3D7FA 3BXMA 4OC2A 4M8DA 2R82A 3ICUA 3T0TA 2D0OA 2OR4A 4P45A 4EYSA 4CZ1A 2PCNA 1T36B 1GGOA 4C8UA 3EZBA 1M6VB 3EIFA 4LQGA 4P4BA 4C9RA 2PVVA 4JYWA 3U1BA 3SJXA 1BXRB 2JBKA 5F5XA 3RBUA 3TLYA 4TJXA 5F09A 1NXJA 4C9UA 2X0SA 4MCRA 4CDKA 4C9AA 4C8FA 3FEDA 3T07A 1NBWA 3TLGB 3KRVA 1KBLA 4C9EA 4COBA 4MCPA 1V6CA 2CIJA 5JVLA 3EZEA 4CDJA 4P4JA 3EZAA 3D7DA 3FECA 3SJGA 3K4IA 4MJXA 4C8AA 2AUMA 2XEGA 4TJVA 1JDEA 3T05A 2EZBA 1VBHA 2JBJA 2EZCA 3NOJA 1ZYMA 3S9MA 4MCSA 3SJEA 1ZRSA 2C5QA 2C6GA 4C85A 4P4EA 4CO9A 2C6PA 3I6SA 2EK9A 3C8OA 3FF3A 1C30B 1JDBC 5D29A 3K9TA 4OC3A 2YJTA 3T5MA 1ZL0A 3KASA 4INJA 4P4DA 4JVOA 2FM4A 4C8TA 5K99A 2XEIA 4KNGE 1VI4A 1KEEB 3GJZA 2OOTA 1Z8LA 3IWWA 2D0PA 5JYBA 1Q5XA 1EZBA 2HWGA 3IIBA 4NGQA 4MI1A 3BI1A 1CS0B 1EZAA 3D7GA 3TLCA 2E28A 3BHXA 4W9YA 1DE4C 2PVWA 1XF1A 3VTAA 3TLGA 5F9MA 2DIKA 4C86A 4OC4A 1C3OB 3S9LA 4OC5A 5FD8A 2C6CA 4C8CA 1DIKA 5IR2A 4MCQA 1CX8A 4P4IA 2OLSA 5F1YA 3TLZA 4OC0A 1WVMA 4OMEA 3TYXA 2HI6A 3D7HA 4NGTA 3SR3A 2EK8A 4NGPA
chains in the Genus database with same CATH topology
2PCNA 3K4IA 1Q5XA 1J3LA 2YJVA 3C8OA 3NOJA 1NXJA 1VI4A 2YJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PCN A;  3K4I A;  1Q5X A;  1J3L A;  2YJV A;  3C8O A;  3NOJ A;  1NXJ A;  1VI4 A;  2YJT A; 
#chains in the Genus database with same CATH topology
 4C9V A;  3FEE A;  4JZ0 A;  4NGR A;  3SJF A;  4C84 A;  4P44 A;  4TWE A;  3I74 A;  1KC7 A;  4H1H A;  3S9N A;  2XEF A;  2HRO A;  4J0N A;  5IB9 A;  3TLB A;  2B0A A;  2GP4 A;  2MP0 A;  4IIY A;  4X3R A;  2XEJ A;  4E94 A;  1VBG A;  4E5S A;  4COG A;  4P4F A;  4IIX A;  1R61 A;  4NGM A;  1Y9Z A;  4NGN A;  4OC1 A;  3TLA A;  1A9X B;  4NGS A;  2EZA A;  1J3L A;  2YJV A;  1CE8 B;  2AUN A;  3G23 A;  3BI0 A;  4C99 A;  4C8P A;  4YN3 A;  3TLE A;  5ELY A;  3D7F A;  3BXM A;  4OC2 A;  4M8D A;  2R82 A;  3ICU A;  3T0T A;  2D0O A;  2OR4 A;  4P45 A;  4EYS A;  4CZ1 A;  2PCN A;  1T36 B;  1GGO A;  4C8U A;  3EZB A;  1M6V B;  3EIF A;  4LQG A;  4P4B A;  4C9R A;  2PVV A;  4JYW A;  3U1B A;  3SJX A;  1BXR B;  2JBK A;  5F5X A;  3RBU A;  3TLY A;  4TJX A;  5F09 A;  1NXJ A;  4C9U A;  2X0S A;  4MCR A;  4CDK A;  4C9A A;  4C8F A;  3FED A;  3T07 A;  1NBW A;  3TLG B;  3KRV A;  1KBL A;  4C9E A;  4COB A;  4MCP A;  1V6C A;  2CIJ A;  5JVL A;  3EZE A;  4CDJ A;  4P4J A;  3EZA A;  3D7D A;  3FEC A;  3SJG A;  3K4I A;  4MJX A;  4C8A A;  2AUM A;  2XEG A;  4TJV A;  1JDE A;  3T05 A;  2EZB A;  1VBH A;  2JBJ A;  2EZC A;  3NOJ A;  1ZYM A;  3S9M A;  4MCS A;  3SJE A;  1ZRS A;  2C5Q A;  2C6G A;  4C85 A;  4P4E A;  4CO9 A;  2C6P A;  3I6S A;  2EK9 A;  3C8O A;  3FF3 A;  1C30 B;  1JDB C;  5D29 A;  3K9T A;  4OC3 A;  2YJT A;  3T5M A;  1ZL0 A;  3KAS A;  4INJ A;  4P4D A;  4JVO A;  2FM4 A;  4C8T A;  5K99 A;  2XEI A;  4KNG E;  1VI4 A;  1KEE B;  3GJZ A;  2OOT A;  1Z8L A;  3IWW A;  2D0P A;  5JYB A;  1Q5X A;  1EZB A;  2HWG A;  3IIB A;  4NGQ A;  4MI1 A;  3BI1 A;  1CS0 B;  1EZA A;  3D7G A;  3TLC A;  2E28 A;  3BHX A;  4W9Y A;  1DE4 C;  2PVW A;  1XF1 A;  3VTA A;  3TLG A;  5F9M A;  2DIK A;  4C86 A;  4OC4 A;  1C3O B;  3S9L A;  4OC5 A;  5FD8 A;  2C6C A;  4C8C A;  1DIK A;  5IR2 A;  4MCQ A;  1CX8 A;  4P4I A;  2OLS A;  5F1Y A;  3TLZ A;  4OC0 A;  1WVM A;  4OME A;  3TYX A;  2HI6 A;  3D7H A;  4NGT A;  3SR3 A;  2EK8 A;  4NGP A; 
#chains in the Genus database with same CATH homology
 2PCN A;  3K4I A;  1Q5X A;  1J3L A;  2YJV A;  3C8O A;  3NOJ A;  1NXJ A;  1VI4 A;  2YJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...