1Q5XA

Structure of of rraa (meng), a protein inhibitor of rna processing
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
160
structure length
160
Chain Sequence
KYDTSELCDIYQEDVNVVEPLFSNFGGRASFGGQIITVKCFEDNGLLYDLLEQNGRGRVLVVDGGGSVRRALVDAELARLAVQNEWEGLVIYGAVRQVDDLEELDIGIQAMAAIPVGAAGEGIGESDVRVNFGGVTFFSGDHLYADNTGIILSEDPLDIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray Structure of Escherichia coli RraA (MenG), A Protein Inhibitor of RNA Processing.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase inhibitor
molecule keywords REGULATOR OF RNASE E ACTIVITY A
total genus 46
structure length 160
sequence length 160
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03737 RraA-like Aldolase/RraA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.40 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Ribonuclease E inhibitor RraA/RraA-like 1q5xA00
1VI4A 1J3LA 1Q5XA 2YJTA 1NXJA 3K4IA 3C8OA 2PCNA 2YJVA 3NOJA
chains in the Genus database with same CATH superfamily
1DIKA 4NGPA 2CIJA 4C8UA 4P4BA 4JVOA 4OMEA 1JDBC 4TJVA 1JDEA 1KEEB 3GJZA 4C9VA 3S9LA 2XEFA 4MCPA 3TLCA 2MP0A 3TLAA 4P4EA 2FM4A 2HROA 4C86A 2C6CA 3D7HA 2PVVA 4C9UA 4NGMA 1ZRSA 4NGSA 4OC0A 5F9MA 5IB9A 3ICUA 3TYXA 2HI6A 5IR2A 1V6CA 4P4IA 3RBUA 3T05A 4C84A 4C85A 2AUNA 3TLZA 2X0SA 3IIBA 3FEEA 3FEDA 3T5MA 4OC2A 3C8OA 3BXMA 4CO9A 3KASA 4W9YA 4IIXA 4C9AA 2C5QA 3S9MA 3K4IA 1VBGA 1WVMA 3TLBA 2OOTA 4YN3A 4KNGE 4P45A 4M8DA 2XEJA 3SJGA 2JBJA 4C8PA 5K99A 1ZYMA 4E5SA 3D7DA 3EZAA 4MJXA 4P4DA 3TLGA 2D0PA 2AUMA 4MCRA 4NGTA 3K9TA 4JZ0A 3SJFA 2R82A 3TLYA 4OC3A 2C6GA 4OC5A 1VI4A 4JYWA 3T0TA 1KBLA 4C8TA 1Q5XA 3SR3A 3BI0A 3TLGB 4EYSA 1R61A 3BHXA 1M6VB 4C8AA 3D7GA 5F5XA 3BI1A 4H1HA 3D7FA 4TJXA 2YJTA 3SJEA 3T07A 1EZBA 4MCQA 1T36B 4J0NA 2E28A 4COGA 3FECA 3VTAA 4COBA 1XF1A 5F09A 4C9RA 4P4FA 5FD8A 2DIKA 3TLEA 2EK9A 2PCNA 3SJXA 3EZEA 4IIYA 1Z8LA 2XEGA 4MCSA 4OC1A 1C30B 1NXJA 3EIFA 1VBHA 3S9NA 1ZL0A 2EK8A 3NOJA 3I6SA 4NGQA 3EZBA 4INJA 3IWWA 1NBWA 2EZAA 4P4JA 1KC7A 1DE4C 4LQGA 4NGRA 1EZAA 4E94A 4TWEA 2GP4A 4X3RA 1CX8A 5JYBA 4NGNA 2EZCA 4C99A 1A9XB 2XEIA 4CZ1A 4P44A 3FF3A 1BXRB 2OLSA 3G23A 1GGOA 2JBKA 5ELYA 2B0AA 1J3LA 4CDKA 1CE8B 1Y9ZA 1CS0B 5D29A 5F1YA 2D0OA 2OR4A 4C9EA 2PVWA 2HWGA 3KRVA 3I74A 4CDJA 2EZBA 1C3OB 4C8CA 3U1BA 5JVLA 4OC4A 2C6PA 4MI1A 2YJVA 4C8FA
chains in the Genus database with same CATH topology
1VI4A 1J3LA 1Q5XA 2YJTA 1NXJA 3K4IA 3C8OA 2PCNA 2YJVA 3NOJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VI4 A;  1J3L A;  1Q5X A;  2YJT A;  1NXJ A;  3K4I A;  3C8O A;  2PCN A;  2YJV A;  3NOJ A; 
#chains in the Genus database with same CATH topology
 1DIK A;  4NGP A;  2CIJ A;  4C8U A;  4P4B A;  4JVO A;  4OME A;  1JDB C;  4TJV A;  1JDE A;  1KEE B;  3GJZ A;  4C9V A;  3S9L A;  2XEF A;  4MCP A;  3TLC A;  2MP0 A;  3TLA A;  4P4E A;  2FM4 A;  2HRO A;  4C86 A;  2C6C A;  3D7H A;  2PVV A;  4C9U A;  4NGM A;  1ZRS A;  4NGS A;  4OC0 A;  5F9M A;  5IB9 A;  3ICU A;  3TYX A;  2HI6 A;  5IR2 A;  1V6C A;  4P4I A;  3RBU A;  3T05 A;  4C84 A;  4C85 A;  2AUN A;  3TLZ A;  2X0S A;  3IIB A;  3FEE A;  3FED A;  3T5M A;  4OC2 A;  3C8O A;  3BXM A;  4CO9 A;  3KAS A;  4W9Y A;  4IIX A;  4C9A A;  2C5Q A;  3S9M A;  3K4I A;  1VBG A;  1WVM A;  3TLB A;  2OOT A;  4YN3 A;  4KNG E;  4P45 A;  4M8D A;  2XEJ A;  3SJG A;  2JBJ A;  4C8P A;  5K99 A;  1ZYM A;  4E5S A;  3D7D A;  3EZA A;  4MJX A;  4P4D A;  3TLG A;  2D0P A;  2AUM A;  4MCR A;  4NGT A;  3K9T A;  4JZ0 A;  3SJF A;  2R82 A;  3TLY A;  4OC3 A;  2C6G A;  4OC5 A;  1VI4 A;  4JYW A;  3T0T A;  1KBL A;  4C8T A;  1Q5X A;  3SR3 A;  3BI0 A;  3TLG B;  4EYS A;  1R61 A;  3BHX A;  1M6V B;  4C8A A;  3D7G A;  5F5X A;  3BI1 A;  4H1H A;  3D7F A;  4TJX A;  2YJT A;  3SJE A;  3T07 A;  1EZB A;  4MCQ A;  1T36 B;  4J0N A;  2E28 A;  4COG A;  3FEC A;  3VTA A;  4COB A;  1XF1 A;  5F09 A;  4C9R A;  4P4F A;  5FD8 A;  2DIK A;  3TLE A;  2EK9 A;  2PCN A;  3SJX A;  3EZE A;  4IIY A;  1Z8L A;  2XEG A;  4MCS A;  4OC1 A;  1C30 B;  1NXJ A;  3EIF A;  1VBH A;  3S9N A;  1ZL0 A;  2EK8 A;  3NOJ A;  3I6S A;  4NGQ A;  3EZB A;  4INJ A;  3IWW A;  1NBW A;  2EZA A;  4P4J A;  1KC7 A;  1DE4 C;  4LQG A;  4NGR A;  1EZA A;  4E94 A;  4TWE A;  2GP4 A;  4X3R A;  1CX8 A;  5JYB A;  4NGN A;  2EZC A;  4C99 A;  1A9X B;  2XEI A;  4CZ1 A;  4P44 A;  3FF3 A;  1BXR B;  2OLS A;  3G23 A;  1GGO A;  2JBK A;  5ELY A;  2B0A A;  1J3L A;  4CDK A;  1CE8 B;  1Y9Z A;  1CS0 B;  5D29 A;  5F1Y A;  2D0O A;  2OR4 A;  4C9E A;  2PVW A;  2HWG A;  3KRV A;  3I74 A;  4CDJ A;  2EZB A;  1C3O B;  4C8C A;  3U1B A;  5JVL A;  4OC4 A;  2C6P A;  4MI1 A;  2YJV A;  4C8F A; 
#chains in the Genus database with same CATH homology
 1VI4 A;  1J3L A;  1Q5X A;  2YJT A;  1NXJ A;  3K4I A;  3C8O A;  2PCN A;  2YJV A;  3NOJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...