1Q5XA

Structure of of rraa (meng), a protein inhibitor of rna processing
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
160
structure length
160
Chain Sequence
b'KYDTSELCDIYQEDVNVVEPLFSNFGGRASFGGQIITVKCFEDNGLLYDLLEQNGRGRVLVVDGGGSVRRALVDAELARLAVQNEWEGLVIYGAVRQVDDLEELDIGIQAMAAIPVGAAGEGIGESDVRVNFGGVTFFSGDHLYADNTGIILSEDPLDIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REGULATOR OF RNASE E ACTIVITY A
publication title The X-ray Structure of Escherichia coli RraA (MenG), A Protein Inhibitor of RNA Processing.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase inhibitor
total genus 46
structure length 160
sequence length 160
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03737 RraA-like Aldolase/RraA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.40 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Ribonuclease E inhibitor RraA/RraA-like 1q5xA00
2YJTA 1VI4A 1J3LA 1NXJA 3K4IA 3C8OA 2YJVA 2PCNA 1Q5XA 3NOJA
chains in the Genus database with same CATH superfamily
4P4FA 2CIJA 4OC5A 1JDBC 4JVOA 4MCPA 2JBJA 4J0NA 4COBA 3EIFA 2X0SA 3D7HA 3K9TA 3EZEA 3I74A 1J3LA 5F9MA 1VBGA 4OC2A 4M8DA 3S9MA 3C8OA 2C6PA 3IIBA 3SJGA 4JYWA 4C9RA 2C5QA 4H1HA 2EK9A 4LQGA 4P45A 1CE8B 1R61A 1XF1A 3SR3A 4C9EA 4NGNA 4OC4A 4TJVA 4NGQA 3TLAA 3TLGA 4NGSA 2DIKA 2EZAA 4NGPA 4C8UA 2AUMA 3TLEA 5IB9A 4C8FA 2PCNA 3U1BA 3G23A 2AUNA 1WVMA 2YJTA 4NGMA 3BI1A 1C30B 3GJZA 4CDKA 2XEJA 3S9LA 2OLSA 4NGTA 2D0PA 2B0AA 2JBKA 3D7DA 4EYSA 4P4DA 2EZBA 2EK8A 3I6SA 4W9YA 2PVWA 4OC3A 1KBLA 1JDEA 4P4EA 5FD8A 2OOTA 2XEFA 3EZAA 3T05A 4C86A 4P4BA 3T0TA 3FEEA 2XEGA 4C85A 5JVLA 3KRVA 4C9VA 1VBHA 1Y9ZA 1DIKA 4KNGE 3SJXA 3NOJA 3S9NA 3EZBA 5ELYA 4C9AA 1CX8A 3D7FA 3KASA 2FM4A 4C8TA 4P4JA 4IIXA 2XEIA 3D7GA 3TLZA 4OC0A 4OC1A 1A9XB 4IIYA 1VI4A 3FEDA 3TYXA 1EZBA 1EZAA 3K4IA 4C9UA 3FECA 4TJXA 3BXMA 3TLCA 2HI6A 4MCRA 5F5XA 4CZ1A 3SJFA 4JZ0A 4MJXA 4TWEA 2C6GA 4CO9A 1ZRSA 1ZYMA 4C84A 4MCSA 3TLBA 3BHXA 2YJVA 1NXJA 3BI0A 1T36B 5K99A 4NGRA 4C8PA 4P44A 3FF3A 3TLYA 2D0OA 4YN3A 1CS0B 1Q5XA 4COGA 3ICUA 3T07A 2EZCA 2E28A 3SJEA 2C6CA 3IWWA 4X3RA 4C99A 4E5SA 5D29A 4C8AA 5JYBA 2PVVA 1DE4C 4C8CA 4P4IA 4OMEA 1GGOA 4INJA 2GP4A 1Z8LA 3RBUA 1ZL0A 1V6CA 2MP0A 5IR2A 1NBWA 2HWGA 1BXRB 2OR4A 3VTAA 4CDJA 4E94A 1KEEB 4MI1A 2HROA 2R82A 4MCQA 3TLGB 1C3OB 1M6VB 1KC7A 5F09A 3T5MA 5F1YA
chains in the Genus database with same CATH topology
2YJTA 1VI4A 1J3LA 1NXJA 3K4IA 3C8OA 2YJVA 2PCNA 1Q5XA 3NOJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YJT A;  1VI4 A;  1J3L A;  1NXJ A;  3K4I A;  3C8O A;  2YJV A;  2PCN A;  1Q5X A;  3NOJ A; 
#chains in the Genus database with same CATH topology
 4P4F A;  2CIJ A;  4OC5 A;  1JDB C;  4JVO A;  4MCP A;  2JBJ A;  4J0N A;  4COB A;  3EIF A;  2X0S A;  3D7H A;  3K9T A;  3EZE A;  3I74 A;  1J3L A;  5F9M A;  1VBG A;  4OC2 A;  4M8D A;  3S9M A;  3C8O A;  2C6P A;  3IIB A;  3SJG A;  4JYW A;  4C9R A;  2C5Q A;  4H1H A;  2EK9 A;  4LQG A;  4P45 A;  1CE8 B;  1R61 A;  1XF1 A;  3SR3 A;  4C9E A;  4NGN A;  4OC4 A;  4TJV A;  4NGQ A;  3TLA A;  3TLG A;  4NGS A;  2DIK A;  2EZA A;  4NGP A;  4C8U A;  2AUM A;  3TLE A;  5IB9 A;  4C8F A;  2PCN A;  3U1B A;  3G23 A;  2AUN A;  1WVM A;  2YJT A;  4NGM A;  3BI1 A;  1C30 B;  3GJZ A;  4CDK A;  2XEJ A;  3S9L A;  2OLS A;  4NGT A;  2D0P A;  2B0A A;  2JBK A;  3D7D A;  4EYS A;  4P4D A;  2EZB A;  2EK8 A;  3I6S A;  4W9Y A;  2PVW A;  4OC3 A;  1KBL A;  1JDE A;  4P4E A;  5FD8 A;  2OOT A;  2XEF A;  3EZA A;  3T05 A;  4C86 A;  4P4B A;  3T0T A;  3FEE A;  2XEG A;  4C85 A;  5JVL A;  3KRV A;  4C9V A;  1VBH A;  1Y9Z A;  1DIK A;  4KNG E;  3SJX A;  3NOJ A;  3S9N A;  3EZB A;  5ELY A;  4C9A A;  1CX8 A;  3D7F A;  3KAS A;  2FM4 A;  4C8T A;  4P4J A;  4IIX A;  2XEI A;  3D7G A;  3TLZ A;  4OC0 A;  4OC1 A;  1A9X B;  4IIY A;  1VI4 A;  3FED A;  3TYX A;  1EZB A;  1EZA A;  3K4I A;  4C9U A;  3FEC A;  4TJX A;  3BXM A;  3TLC A;  2HI6 A;  4MCR A;  5F5X A;  4CZ1 A;  3SJF A;  4JZ0 A;  4MJX A;  4TWE A;  2C6G A;  4CO9 A;  1ZRS A;  1ZYM A;  4C84 A;  4MCS A;  3TLB A;  3BHX A;  2YJV A;  1NXJ A;  3BI0 A;  1T36 B;  5K99 A;  4NGR A;  4C8P A;  4P44 A;  3FF3 A;  3TLY A;  2D0O A;  4YN3 A;  1CS0 B;  1Q5X A;  4COG A;  3ICU A;  3T07 A;  2EZC A;  2E28 A;  3SJE A;  2C6C A;  3IWW A;  4X3R A;  4C99 A;  4E5S A;  5D29 A;  4C8A A;  5JYB A;  2PVV A;  1DE4 C;  4C8C A;  4P4I A;  4OME A;  1GGO A;  4INJ A;  2GP4 A;  1Z8L A;  3RBU A;  1ZL0 A;  1V6C A;  2MP0 A;  5IR2 A;  1NBW A;  2HWG A;  1BXR B;  2OR4 A;  3VTA A;  4CDJ A;  4E94 A;  1KEE B;  4MI1 A;  2HRO A;  2R82 A;  4MCQ A;  3TLG B;  1C3O B;  1M6V B;  1KC7 A;  5F09 A;  3T5M A;  5F1Y A; 
#chains in the Genus database with same CATH homology
 2YJT A;  1VI4 A;  1J3L A;  1NXJ A;  3K4I A;  3C8O A;  2YJV A;  2PCN A;  1Q5X A;  3NOJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...