1Q6MA

The structure of phosphotyrosine phosphatase 1b in complex with compound 3
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
289
structure length
289
Chain Sequence
KLEFMEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural Basis for the Selectivity of Benzotriazole Inhibitors of Ptp1B
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Protein-tyrosine phosphatase, non-receptor type 1
total genus 102
structure length 289
sequence length 289
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2003-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00102 Y_phosphatase Protein-tyrosine phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 1q6mA00
4JMKA 5K25A 5IBSA 2A8BA 1L8GA 1PXHA 1PTUA 2NLKA 3QCJA 1C87A 1U26A 1OHDA 1LARA 2P6XA 2AHSA 4WU2A 4QAHA 1OESA 4AZ1A 1PTVA 5BUGA 3S3EA 2I3UA 4GE6A 4GE5A 2NV5A 2HC1A 1EEOA 4QAPA 1PTYA 4QUMA 4YR8B 3S4EA 3QCEA 4R0SA 4ZRTA 2OC3A 1OHEA 1PA1A 4ERCA 2B4PA 1BZHA 1G1FA 3F41A 3QCGA 3V0DA 2G6ZA 3F9AA 3QCNA 4KI9A 4NYHA 4DGXA 3QCHA 1LYVA 3V0HA 3A5KA 2F46A 4YAAA 1FPZA 3MMJA 3ZM3A 2IMGA 3MOWA 4TVVA 1GFYA 3QKQA 3QCCA 4NWFA 4WTYA 2QDPA 2HNQA 3QKPA 1Q6SA 1RXDA 4Z6BA 3QCKA 4D3PA 1XBOA 1NNYA 2OZ5A 2YDUA 1WAXA 3S3HA 3S4OA 3EZZA 5EHRA 2FJMA 2Y96A 2HXPA 2CMBA 3V0GA 2F6ZA 2I4EA 3QCBA 2M3VA 2G59A 2QBRA 3MOZA 1ONYA 1I9TA 1EENA 4BPCA 3A5JA 4HJPA 2CMAA 3RGQA 3ZMQA 1ZCKA 1Q6NA 5K24A 1G7FA 5K9WA 1NL9A 1XXPA 2QBQA 5KABA 5HDEA 2CFVA 5K9VA 1P15A 2AZRA 2H02A 1ECVA 4GRZA 3V0EA 1RPMA 3NMEA 4QBWA 1JLNA 3QCLA 2C46A 3N0AA 3O5XA 3GXGA 5EHPA 1XRIA 2HNPA 2GWOA 1QZ0A 3O3LA 1M3GA 2WGPA 4GRYA 1C84A 2F6VA 2A3KA 1KAVA 2CJZA 4WOHA 1ZCLA 3SR9A 1OEVA 1YZ4A 2QCTA 1KAKA 3O4SA 5KACA 2OUDA 4WU3A 1QXKA 2VEWA 2VEYA 4RKKA 3BLTA 2J16B 3GXHA 1OEOX 3ZM2A 3EAXA 3SMEA 3V0FA 1LQFA 1MKPA 2NT7A 5KA8A 4KYRA 4NNDA 2CM2A 5IBMA 3PS5A 3V0JA 2I75A 1G1HA 3AWEA 3CWEA 3QCFA 1PA9A 4OHIA 1XXVA 2ESBA 2HY3A 2J16A 3D44A 1A5YA 1G4US 1U25A 1YGRA 5KADA 1YPTA 2QDCA 3BM8A 1Q6JA 1PYNA 4ICZA 2CNEA 4RH5A 3O4UA 5KA3A 1C86A 1ONZA 1Q6TA 2ZN7A 3V0IA 1NWLA 1ZZWA 2GJTA 2B4UA 1OETA 3RO1A 3M4UA 2I4HA 1BZJA 3F99A 1Q6PA 2CNFA 2GP0A 2BV5A 3ZMPA 3D1HA 2J17A 1OEUA 1XM2A 2I42A 2PBNA 3QCMA 1C83A 2BZLA 5MMZB 1G7GA 1SUGA 1ZC0A 4I8NA 2H4KA 1VHRA 2C7SA 2I6IA 5KA4A 5BX1A 1R6HA 3EB1A 2Q47A 4Y14A 5GTJA 5J8RA 2B4SA 2PI7A 2QCJA 1G1GA 4GFVA 4Y2EA 5KAAA 2CNHA 2QDMA 4ZI4A 3H2XA 1L8KA 2E0TA 3RGOA 4OHDA 5KA9A 1Q6MA 2FJNA 1X24A 3ZV2A 3D42A 2QBPA 1WRMA 2CM7A 4R30A 3D1QA 2B49A 1C88A 2CM8A 1V3AA 2B07A 2I5XA 4J51A 1YTSA 4D3QA 2NZ6A 4GE2A 1I9SA 1FPRA 3I80A 1AAXA 2HVLA 2HCMA 2PA5A 2CM3A 5KA2A 4B04A 4NWGA 1Q1MA 1T49A 4HJQA 5AWXA 2I6MA 1NWEA 2I3RA 2R0BA 2BIJA 2H04A 2F6TA 1BZCA 3BRHA 1NO6A 2HB1A 3D9CA 2Y2FA 3ZM0A 3D1OA 3CM3A 2I6JA 2JJDA 4RI5A 3F9BA 4GWFA 2VEUA 4KYQA 1YGUA 4JBCA 2CNIA 3ZM1A 2CNGA 5KA1A 1YWFA 1C85A 3U96A 3OMHA 4JNBA 4H34A 1FQ1A 4RI4A 1T4JA 1YTWA 1PH0A 5K23A 2H4VA 2NT2A 1WCHA 1J4XA 1NZ7A 5BZZA 5BZXA 3QCIA 2I1YA 4H1OA 1OEMX 2B4OA 3S3FA 4RHGA 2I4GA 1YTNA 3S3KA 2B3OA 5LXQB 4IKCA 2BGEA 4R0TA 4OHEA 4PYHA 2F71A 2DXPA 2PT0A 1PTTA 4ZN5A 2MBCA 4HRFA 5M43A 3F81A 4MBBA 2F6YA 4PVGA 4GS0A 4S0GA 3AWFA 4RDDA 2H4GA 2Q05A 3AWGA 2VEXA 2F6WA 4D3RA 4NX8A 2PQ5A 4OHLA 1JF7A 1YFOA 2CMCA 4QUNA 3LJ8A 2SHPA 4GFUA 4BJOA 1U24A 3I7ZA 1I57A 3I36A 2VEVA 1D5RA 4JMJA 2HC2A 4DGPA 4RH9A 2P4DA 3BLUA 3EMUA 5KA7A 1OHCA 2OOQA 2I6PA 2NTAA 5I6VA 3B7OA 2F70A 1T48A 2H03A 4QBEA 3EU0A 2I6OA 1GWZA 3OLRA 3RZ2A 2BGDA 2QBSA 1G4WR 2RF6A 2FH7A 2ZMMA 4OHHA 2PSZA 3O4TA 2F6FA 5KA0A 2QEPA 1YN9A 5K22A 3QCDA
chains in the Genus database with same CATH superfamily
4JMKA 5K25A 5IBSA 2A8BA 1L8GA 1PXHA 1PTUA 2NLKA 3N2AA 3QCJA 1C87A 1U26A 1OHDA 1LARA 2P6XA 2AHSA 4WU2A 4QAHA 1OESA 4AZ1A 1PTVA 5BUGA 4ZIYA 3S3EA 2I3UA 4GE6A 4GE5A 2NV5A 2HC1A 3MVNA 1EEOA 1E0DA 2JFHA 4QAPA 1PTYA 4QUMA 2GC6A 4YR8B 3S4EA 3QCEA 4R0SA 4ZRTA 2OC3A 1OHEA 1PA1A 4ERCA 2B4PA 1BZHA 2AM1A 1G1FA 3F41A 3QCGA 3V0DA 2G6ZA 2VTEA 3F9AA 3QCNA 4KI9A 4NYHA 4DGXA 3QCHA 1LYVA 3V0HA 1GQYA 3A5KA 4BUBA 2F46A 2GCAA 4YAAA 1FPZA 3MMJA 3ZM3A 2IMGA 3MOWA 4TVVA 1GFYA 3QKQA 3QCCA 4NWFA 4WTYA 2QDPA 2HNQA 3QKPA 1Q6SA 1P3DA 1RXDA 4Z6BA 3QCKA 2Y68A 4D3PA 1XBOA 1NNYA 1JBVA 1GG4A 1WAXA 2OZ5A 2YDUA 3S3HA 3S4OA 3EZZA 5EHRA 2FJMA 4BUCA 1J6UA 2Y96A 2HXPA 2CMBA 3V0GA 2F6ZA 2I4EA 4QDIA 3QCBA 2M3VA 2G59A 2QBRA 3MOZA 1ONYA 1I9TA 1EENA 4BPCA 3A5JA 2VORA 4HJPA 2CMAA 3RGQA 3ZMQA 1ZCKA 1Q6NA 5K24A 2GCBA 1G7FA 5K9WA 1NL9A 1XXPA 2QBQA 5KABA 5HDEA 2CFVA 5K9VA 3LK7A 3NRSA 1P15A 2AZRA 2H02A 1ECVA 4GRZA 3V0EA 1RPMA 3NMEA 4QBWA 1JLNA 3QCLA 2C46A 1E8CA 3N0AA 3O5XA 3GXGA 5EHPA 1XRIA 2HNPA 2GWOA 1QZ0A 3O3LA 1M3GA 2WGPA 2Y1OA 4GRYA 1C84A 2F6VA 2A3KA 1KAVA 2CJZA 4WOHA 1ZCLA 3SR9A 1OEVA 1YZ4A 2QCTA 1KAKA 3O4SA 5KACA 2OUDA 4WU3A 2UUPA 1QXKA 2VEWA 2VEYA 4RKKA 3BLTA 2J16B 3GXHA 1OEOX 3ZM2A 3HN7A 3EAXA 3SMEA 3V0FA 1LQFA 1MKPA 4HV4A 2NT7A 5KA8A 4KYRA 4NNDA 2CM2A 4CVKA 5IBMA 3PS5A 3V0JA 2I75A 1G1HA 3AWEA 3CWEA 3QCFA 1PA9A 4OHIA 1XXVA 2ESBA 2HY3A 2J16A 3D44A 1A5YA 1G4US 1U25A 1YGRA 5KADA 1YPTA 2QDCA 3BM8A 1Q6JA 1PYNA 1UAGA 4ICZA 2CNEA 4RH5A 3O4UA 2XJAA 5KA3A 1C86A 1ONZA 1Q6TA 2ZN7A 3V0IA 1NWLA 1ZZWA 1W7KA 4C13A 2GJTA 2B4UA 1EEHA 1OETA 3RO1A 3M4UA 2I4HA 1BZJA 1FGSA 3F99A 1Q6PA 2CNFA 2GP0A 2BV5A 2AM2A 2Y66A 3ZMPA 3D1HA 2J17A 2XPCA 1OEUA 1XM2A 2I42A 2PBNA 3QCMA 1C83A 2BZLA 5MMZB 1G7GA 1SUGA 1ZC0A 4I8NA 2H4KA 1VHRA 2C7SA 2I6IA 2VTDA 5KA4A 5BX1A 1R6HA 3EB1A 2X5OA 2Q47A 4Y14A 5GTJA 2F00A 5J8RA 2B4SA 3ZM6A 2PI7A 2QCJA 1G1GA 4GFVA 4Y2EA 5KAAA 2CNHA 2QDMA 4ZI4A 3H2XA 1L8KA 2E0TA 3RGOA 4OHDA 5KA9A 1Q6MA 2FJNA 1X24A 2WTZA 3ZV2A 3D42A 2QBPA 1WRMA 2CM7A 4R30A 3D1QA 2B49A 1C88A 2CM8A 1V3AA 2B07A 2I5XA 4J51A 1YTSA 4D3QA 2NZ6A 3PYZA 4GE2A 4QF5A 1I9SA 1FPRA 3I80A 1P31A 1AAXA 2HVLA 2HCMA 2PA5A 2CM3A 5KA2A 4B04A 4NWGA 1Q1MA 1T49A 4HJQA 5AWXA 2I6MA 1NWEA 2I3RA 4UAGA 1O5ZA 2R0BA 2BIJA 2H04A 2F6TA 1BZCA 3BRHA 1NO6A 2HB1A 3D9CA 2Y2FA 3ZM0A 3D1OA 3CM3A 2I6JA 2JJDA 4RI5A 3F9BA 2JFGA 4GWFA 2VEUA 3UAGA 3ZL8A 4KYQA 1YGUA 4JBCA 2CNIA 3ZM1A 2CNGA 5KA1A 1YWFA 1C85A 3U96A 3OMHA 4JNBA 2UAGA 1FQ1A 4H34A 4RI4A 1T4JA 1YTWA 3ZM5A 1PH0A 5K23A 2H4VA 2NT2A 1WCHA 1J4XA 1NZ7A 5BZZA 5BZXA 3QCIA 2I1YA 4H1OA 1OEMX 2B4OA 3S3FA 2WJPA 4C12A 4RHGA 5A5FA 2I4GA 2JFFA 1YTNA 3S3KA 2B3OA 1W78A 5LXQB 4IKCA 2BGEA 4CVMA 4R0TA 4OHEA 4PYHA 3QCZA 2Y67A 2F71A 4CVLA 2DXPA 2PT0A 1PTTA 2UUOA 4ZN5A 2MBCA 4HRFA 5M43A 3F81A 1JBWA 4MBBA 2F6YA 4PVGA 4GS0A 4S0GA 3AWFA 4RDDA 2H4GA 2Q05A 3AWGA 2VEXA 2F6WA 4D3RA 4NX8A 2PQ5A 1JF7A 4OHLA 1YFOA 2CMCA 4QUNA 3LJ8A 2SHPA 4GFUA 4BJOA 1U24A 3I7ZA 1I57A 3I36A 2VEVA 1D5RA 4JMJA 2HC2A 4DGPA 4RH9A 2P4DA 3BLUA 3EMUA 5KA7A 1OHCA 2OOQA 2VOSA 2I6PA 2NTAA 5I6VA 1GQQA 3B7OA 2F70A 1T48A 2H03A 4QBEA 3EU0A 2I6OA 1GWZA 3OLRA 3RZ2A 2BGDA 2QBSA 2GC5A 1G4WR 2RF6A 2FH7A 2ZMMA 4OHHA 2PSZA 5A5EA 3O4TA 2F6FA 5KA0A 2QEPA 1YN9A 5K22A 3QCDA
chains in the Genus database with same CATH topology
4JMKA 5K25A 5IBSA 2A8BA 1L8GA 1PXHA 1PTUA 2NLKA 3QCJA 1C87A 1U26A 1OHDA 1LARA 2P6XA 2AHSA 4WU2A 4QAHA 1OESA 4AZ1A 1PTVA 5BUGA 3S3EA 2I3UA 4GE6A 4GE5A 2NV5A 2HC1A 1EEOA 4QAPA 1PTYA 4QUMA 4YR8B 3S4EA 3QCEA 4R0SA 4ZRTA 2OC3A 1OHEA 1PA1A 4ERCA 2B4PA 1BZHA 1G1FA 3F41A 3QCGA 3V0DA 2G6ZA 3F9AA 3QCNA 4KI9A 4NYHA 4DGXA 3QCHA 1LYVA 3V0HA 3A5KA 2F46A 4YAAA 1FPZA 3MMJA 3ZM3A 2IMGA 3MOWA 4TVVA 1GFYA 3QKQA 3QCCA 4NWFA 4WTYA 2QDPA 2HNQA 3QKPA 1Q6SA 1RXDA 4Z6BA 3QCKA 4D3PA 1XBOA 1NNYA 2OZ5A 2YDUA 1WAXA 3S3HA 3S4OA 3EZZA 5EHRA 2FJMA 2Y96A 2HXPA 2CMBA 3V0GA 2F6ZA 2I4EA 3QCBA 2M3VA 2G59A 2QBRA 3MOZA 1ONYA 1I9TA 1EENA 4BPCA 3A5JA 4HJPA 2CMAA 3RGQA 3ZMQA 1ZCKA 1Q6NA 5K24A 1G7FA 5K9WA 1NL9A 1XXPA 2QBQA 5KABA 5HDEA 2CFVA 5K9VA 1P15A 2AZRA 2H02A 1ECVA 4GRZA 3V0EA 1RPMA 3NMEA 4QBWA 1JLNA 3QCLA 2C46A 3N0AA 3O5XA 3GXGA 5EHPA 1XRIA 2HNPA 2GWOA 1QZ0A 3O3LA 1M3GA 2WGPA 4GRYA 1C84A 2F6VA 2A3KA 1KAVA 2CJZA 4WOHA 1ZCLA 3SR9A 1OEVA 1YZ4A 2QCTA 1KAKA 3O4SA 5KACA 2OUDA 4WU3A 1QXKA 2VEWA 2VEYA 4RKKA 3BLTA 2J16B 3GXHA 1OEOX 3ZM2A 3EAXA 3SMEA 3V0FA 1LQFA 1MKPA 2NT7A 5KA8A 4KYRA 4NNDA 2CM2A 5IBMA 3PS5A 3V0JA 2I75A 1G1HA 3AWEA 3CWEA 3QCFA 1PA9A 4OHIA 1XXVA 2ESBA 2HY3A 2J16A 3D44A 1A5YA 1G4US 1U25A 1YGRA 5KADA 1YPTA 2QDCA 3BM8A 1Q6JA 1PYNA 4ICZA 2CNEA 4RH5A 3O4UA 5KA3A 1C86A 1ONZA 1Q6TA 2ZN7A 3V0IA 1NWLA 1ZZWA 2GJTA 2B4UA 1OETA 3RO1A 3M4UA 2I4HA 1BZJA 3F99A 1Q6PA 2CNFA 2GP0A 2BV5A 3ZMPA 3D1HA 2J17A 1OEUA 1XM2A 2I42A 2PBNA 3QCMA 1C83A 2BZLA 5MMZB 1G7GA 1SUGA 1ZC0A 4I8NA 2H4KA 1VHRA 2C7SA 2I6IA 5KA4A 5BX1A 1R6HA 3EB1A 2Q47A 4Y14A 5GTJA 5J8RA 2B4SA 2PI7A 2QCJA 1G1GA 4GFVA 4Y2EA 5KAAA 2CNHA 2QDMA 4ZI4A 3H2XA 1L8KA 2E0TA 3RGOA 4OHDA 5KA9A 1Q6MA 2FJNA 1X24A 3ZV2A 3D42A 2QBPA 1WRMA 2CM7A 4R30A 3D1QA 2B49A 1C88A 2CM8A 1V3AA 2B07A 2I5XA 4J51A 1YTSA 4D3QA 2NZ6A 4GE2A 1I9SA 1FPRA 3I80A 1AAXA 2HVLA 2HCMA 2PA5A 2CM3A 5KA2A 4B04A 4NWGA 1Q1MA 1T49A 4HJQA 5AWXA 2I6MA 1NWEA 2I3RA 2R0BA 2BIJA 2H04A 2F6TA 1BZCA 3BRHA 1NO6A 2HB1A 3D9CA 2Y2FA 3ZM0A 3D1OA 3CM3A 2I6JA 2JJDA 4RI5A 3F9BA 4GWFA 2VEUA 4KYQA 1YGUA 4JBCA 2CNIA 3ZM1A 2CNGA 5KA1A 1YWFA 1C85A 3U96A 3OMHA 4JNBA 4H34A 1FQ1A 4RI4A 1T4JA 1YTWA 1PH0A 5K23A 2H4VA 2NT2A 1WCHA 1J4XA 1NZ7A 5BZZA 5BZXA 3QCIA 2I1YA 4H1OA 1OEMX 2B4OA 3S3FA 4RHGA 2I4GA 1YTNA 3S3KA 2B3OA 5LXQB 4IKCA 2BGEA 4R0TA 4OHEA 4PYHA 2F71A 2DXPA 2PT0A 1PTTA 4ZN5A 2MBCA 4HRFA 5M43A 3F81A 4MBBA 2F6YA 4PVGA 4GS0A 4S0GA 3AWFA 4RDDA 2H4GA 2Q05A 3AWGA 2VEXA 2F6WA 4D3RA 4NX8A 2PQ5A 4OHLA 1JF7A 1YFOA 2CMCA 4QUNA 3LJ8A 2SHPA 4GFUA 4BJOA 1U24A 3I7ZA 1I57A 3I36A 2VEVA 1D5RA 4JMJA 2HC2A 4DGPA 4RH9A 2P4DA 3BLUA 3EMUA 5KA7A 1OHCA 2OOQA 2I6PA 2NTAA 5I6VA 3B7OA 2F70A 1T48A 2H03A 4QBEA 3EU0A 2I6OA 1GWZA 3OLRA 3RZ2A 2BGDA 2QBSA 1G4WR 2RF6A 2FH7A 2ZMMA 4OHHA 2PSZA 3O4TA 2F6FA 5KA0A 2QEPA 1YN9A 5K22A 3QCDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JMK A;  5K25 A;  5IBS A;  2A8B A;  1L8G A;  1PXH A;  1PTU A;  2NLK A;  3QCJ A;  1C87 A;  1U26 A;  1OHD A;  1LAR A;  2P6X A;  2AHS A;  4WU2 A;  4QAH A;  1OES A;  4AZ1 A;  1PTV A;  5BUG A;  3S3E A;  2I3U A;  4GE6 A;  4GE5 A;  2NV5 A;  2HC1 A;  1EEO A;  4QAP A;  1PTY A;  4QUM A;  4YR8 B;  3S4E A;  3QCE A;  4R0S A;  4ZRT A;  2OC3 A;  1OHE A;  1PA1 A;  4ERC A;  2B4P A;  1BZH A;  1G1F A;  3F41 A;  3QCG A;  3V0D A;  2G6Z A;  3F9A A;  3QCN A;  4KI9 A;  4NYH A;  4DGX A;  3QCH A;  1LYV A;  3V0H A;  3A5K A;  2F46 A;  4YAA A;  1FPZ A;  3MMJ A;  3ZM3 A;  2IMG A;  3MOW A;  4TVV A;  1GFY A;  3QKQ A;  3QCC A;  4NWF A;  4WTY A;  2QDP A;  2HNQ A;  3QKP A;  1Q6S A;  1RXD A;  4Z6B A;  3QCK A;  4D3P A;  1XBO A;  1NNY A;  2OZ5 A;  2YDU A;  1WAX A;  3S3H A;  3S4O A;  3EZZ A;  5EHR A;  2FJM A;  2Y96 A;  2HXP A;  2CMB A;  3V0G A;  2F6Z A;  2I4E A;  3QCB A;  2M3V A;  2G59 A;  2QBR A;  3MOZ A;  1ONY A;  1I9T A;  1EEN A;  4BPC A;  3A5J A;  4HJP A;  2CMA A;  3RGQ A;  3ZMQ A;  1ZCK A;  1Q6N A;  5K24 A;  1G7F A;  5K9W A;  1NL9 A;  1XXP A;  2QBQ A;  5KAB A;  5HDE A;  2CFV A;  5K9V A;  1P15 A;  2AZR A;  2H02 A;  1ECV A;  4GRZ A;  3V0E A;  1RPM A;  3NME A;  4QBW A;  1JLN A;  3QCL A;  2C46 A;  3N0A A;  3O5X A;  3GXG A;  5EHP A;  1XRI A;  2HNP A;  2GWO A;  1QZ0 A;  3O3L A;  1M3G A;  2WGP A;  4GRY A;  1C84 A;  2F6V A;  2A3K A;  1KAV A;  2CJZ A;  4WOH A;  1ZCL A;  3SR9 A;  1OEV A;  1YZ4 A;  2QCT A;  1KAK A;  3O4S A;  5KAC A;  2OUD A;  4WU3 A;  1QXK A;  2VEW A;  2VEY A;  4RKK A;  3BLT A;  2J16 B;  3GXH A;  1OEO X;  3ZM2 A;  3EAX A;  3SME A;  3V0F A;  1LQF A;  1MKP A;  2NT7 A;  5KA8 A;  4KYR A;  4NND A;  2CM2 A;  5IBM A;  3PS5 A;  3V0J A;  2I75 A;  1G1H A;  3AWE A;  3CWE A;  3QCF A;  1PA9 A;  4OHI A;  1XXV A;  2ESB A;  2HY3 A;  2J16 A;  3D44 A;  1A5Y A;  1G4U S;  1U25 A;  1YGR A;  5KAD A;  1YPT A;  2QDC A;  3BM8 A;  1Q6J A;  1PYN A;  4ICZ A;  2CNE A;  4RH5 A;  3O4U A;  5KA3 A;  1C86 A;  1ONZ A;  1Q6T A;  2ZN7 A;  3V0I A;  1NWL A;  1ZZW A;  2GJT A;  2B4U A;  1OET A;  3RO1 A;  3M4U A;  2I4H A;  1BZJ A;  3F99 A;  1Q6P A;  2CNF A;  2GP0 A;  2BV5 A;  3ZMP A;  3D1H A;  2J17 A;  1OEU A;  1XM2 A;  2I42 A;  2PBN A;  3QCM A;  1C83 A;  2BZL A;  5MMZ B;  1G7G A;  1SUG A;  1ZC0 A;  4I8N A;  2H4K A;  1VHR A;  2C7S A;  2I6I A;  5KA4 A;  5BX1 A;  1R6H A;  3EB1 A;  2Q47 A;  4Y14 A;  5GTJ A;  5J8R A;  2B4S A;  2PI7 A;  2QCJ A;  1G1G A;  4GFV A;  4Y2E A;  5KAA A;  2CNH A;  2QDM A;  4ZI4 A;  3H2X A;  1L8K A;  2E0T A;  3RGO A;  4OHD A;  5KA9 A;  1Q6M A;  2FJN A;  1X24 A;  3ZV2 A;  3D42 A;  2QBP A;  1WRM A;  2CM7 A;  4R30 A;  3D1Q A;  2B49 A;  1C88 A;  2CM8 A;  1V3A A;  2B07 A;  2I5X A;  4J51 A;  1YTS A;  4D3Q A;  2NZ6 A;  4GE2 A;  1I9S A;  1FPR A;  3I80 A;  1AAX A;  2HVL A;  2HCM A;  2PA5 A;  2CM3 A;  5KA2 A;  4B04 A;  4NWG A;  1Q1M A;  1T49 A;  4HJQ A;  5AWX A;  2I6M A;  1NWE A;  2I3R A;  2R0B A;  2BIJ A;  2H04 A;  2F6T A;  1BZC A;  3BRH A;  1NO6 A;  2HB1 A;  3D9C A;  2Y2F A;  3ZM0 A;  3D1O A;  3CM3 A;  2I6J A;  2JJD A;  4RI5 A;  3F9B A;  4GWF A;  2VEU A;  4KYQ A;  1YGU A;  4JBC A;  2CNI A;  3ZM1 A;  2CNG A;  5KA1 A;  1YWF A;  1C85 A;  3U96 A;  3OMH A;  4JNB A;  4H34 A;  1FQ1 A;  4RI4 A;  1T4J A;  1YTW A;  1PH0 A;  5K23 A;  2H4V A;  2NT2 A;  1WCH A;  1J4X A;  1NZ7 A;  5BZZ A;  5BZX A;  3QCI A;  2I1Y A;  4H1O A;  1OEM X;  2B4O A;  3S3F A;  4RHG A;  2I4G A;  1YTN A;  3S3K A;  2B3O A;  5LXQ B;  4IKC A;  2BGE A;  4R0T A;  4OHE A;  4PYH A;  2F71 A;  2DXP A;  2PT0 A;  1PTT A;  4ZN5 A;  2MBC A;  4HRF A;  5M43 A;  3F81 A;  4MBB A;  2F6Y A;  4PVG A;  4GS0 A;  4S0G A;  3AWF A;  4RDD A;  2H4G A;  2Q05 A;  3AWG A;  2VEX A;  2F6W A;  4D3R A;  4NX8 A;  2PQ5 A;  4OHL A;  1JF7 A;  1YFO A;  2CMC A;  4QUN A;  3LJ8 A;  2SHP A;  4GFU A;  4BJO A;  1U24 A;  3I7Z A;  1I57 A;  3I36 A;  2VEV A;  1D5R A;  4JMJ A;  2HC2 A;  4DGP A;  4RH9 A;  2P4D A;  3BLU A;  3EMU A;  5KA7 A;  1OHC A;  2OOQ A;  2I6P A;  2NTA A;  5I6V A;  3B7O A;  2F70 A;  1T48 A;  2H03 A;  4QBE A;  3EU0 A;  2I6O A;  1GWZ A;  3OLR A;  3RZ2 A;  2BGD A;  2QBS A;  1G4W R;  2RF6 A;  2FH7 A;  2ZMM A;  4OHH A;  2PSZ A;  3O4T A;  2F6F A;  5KA0 A;  2QEP A;  1YN9 A;  5K22 A;  3QCD A; 
#chains in the Genus database with same CATH topology
 4JMK A;  5K25 A;  5IBS A;  2A8B A;  1L8G A;  1PXH A;  1PTU A;  2NLK A;  3N2A A;  3QCJ A;  1C87 A;  1U26 A;  1OHD A;  1LAR A;  2P6X A;  2AHS A;  4WU2 A;  4QAH A;  1OES A;  4AZ1 A;  1PTV A;  5BUG A;  4ZIY A;  3S3E A;  2I3U A;  4GE6 A;  4GE5 A;  2NV5 A;  2HC1 A;  3MVN A;  1EEO A;  1E0D A;  2JFH A;  4QAP A;  1PTY A;  4QUM A;  2GC6 A;  4YR8 B;  3S4E A;  3QCE A;  4R0S A;  4ZRT A;  2OC3 A;  1OHE A;  1PA1 A;  4ERC A;  2B4P A;  1BZH A;  2AM1 A;  1G1F A;  3F41 A;  3QCG A;  3V0D A;  2G6Z A;  2VTE A;  3F9A A;  3QCN A;  4KI9 A;  4NYH A;  4DGX A;  3QCH A;  1LYV A;  3V0H A;  1GQY A;  3A5K A;  4BUB A;  2F46 A;  2GCA A;  4YAA A;  1FPZ A;  3MMJ A;  3ZM3 A;  2IMG A;  3MOW A;  4TVV A;  1GFY A;  3QKQ A;  3QCC A;  4NWF A;  4WTY A;  2QDP A;  2HNQ A;  3QKP A;  1Q6S A;  1P3D A;  1RXD A;  4Z6B A;  3QCK A;  2Y68 A;  4D3P A;  1XBO A;  1NNY A;  1JBV A;  1GG4 A;  1WAX A;  2OZ5 A;  2YDU A;  3S3H A;  3S4O A;  3EZZ A;  5EHR A;  2FJM A;  4BUC A;  1J6U A;  2Y96 A;  2HXP A;  2CMB A;  3V0G A;  2F6Z A;  2I4E A;  4QDI A;  3QCB A;  2M3V A;  2G59 A;  2QBR A;  3MOZ A;  1ONY A;  1I9T A;  1EEN A;  4BPC A;  3A5J A;  2VOR A;  4HJP A;  2CMA A;  3RGQ A;  3ZMQ A;  1ZCK A;  1Q6N A;  5K24 A;  2GCB A;  1G7F A;  5K9W A;  1NL9 A;  1XXP A;  2QBQ A;  5KAB A;  5HDE A;  2CFV A;  5K9V A;  3LK7 A;  3NRS A;  1P15 A;  2AZR A;  2H02 A;  1ECV A;  4GRZ A;  3V0E A;  1RPM A;  3NME A;  4QBW A;  1JLN A;  3QCL A;  2C46 A;  1E8C A;  3N0A A;  3O5X A;  3GXG A;  5EHP A;  1XRI A;  2HNP A;  2GWO A;  1QZ0 A;  3O3L A;  1M3G A;  2WGP A;  2Y1O A;  4GRY A;  1C84 A;  2F6V A;  2A3K A;  1KAV A;  2CJZ A;  4WOH A;  1ZCL A;  3SR9 A;  1OEV A;  1YZ4 A;  2QCT A;  1KAK A;  3O4S A;  5KAC A;  2OUD A;  4WU3 A;  2UUP A;  1QXK A;  2VEW A;  2VEY A;  4RKK A;  3BLT A;  2J16 B;  3GXH A;  1OEO X;  3ZM2 A;  3HN7 A;  3EAX A;  3SME A;  3V0F A;  1LQF A;  1MKP A;  4HV4 A;  2NT7 A;  5KA8 A;  4KYR A;  4NND A;  2CM2 A;  4CVK A;  5IBM A;  3PS5 A;  3V0J A;  2I75 A;  1G1H A;  3AWE A;  3CWE A;  3QCF A;  1PA9 A;  4OHI A;  1XXV A;  2ESB A;  2HY3 A;  2J16 A;  3D44 A;  1A5Y A;  1G4U S;  1U25 A;  1YGR A;  5KAD A;  1YPT A;  2QDC A;  3BM8 A;  1Q6J A;  1PYN A;  1UAG A;  4ICZ A;  2CNE A;  4RH5 A;  3O4U A;  2XJA A;  5KA3 A;  1C86 A;  1ONZ A;  1Q6T A;  2ZN7 A;  3V0I A;  1NWL A;  1ZZW A;  1W7K A;  4C13 A;  2GJT A;  2B4U A;  1EEH A;  1OET A;  3RO1 A;  3M4U A;  2I4H A;  1BZJ A;  1FGS A;  3F99 A;  1Q6P A;  2CNF A;  2GP0 A;  2BV5 A;  2AM2 A;  2Y66 A;  3ZMP A;  3D1H A;  2J17 A;  2XPC A;  1OEU A;  1XM2 A;  2I42 A;  2PBN A;  3QCM A;  1C83 A;  2BZL A;  5MMZ B;  1G7G A;  1SUG A;  1ZC0 A;  4I8N A;  2H4K A;  1VHR A;  2C7S A;  2I6I A;  2VTD A;  5KA4 A;  5BX1 A;  1R6H A;  3EB1 A;  2X5O A;  2Q47 A;  4Y14 A;  5GTJ A;  2F00 A;  5J8R A;  2B4S A;  3ZM6 A;  2PI7 A;  2QCJ A;  1G1G A;  4GFV A;  4Y2E A;  5KAA A;  2CNH A;  2QDM A;  4ZI4 A;  3H2X A;  1L8K A;  2E0T A;  3RGO A;  4OHD A;  5KA9 A;  1Q6M A;  2FJN A;  1X24 A;  2WTZ A;  3ZV2 A;  3D42 A;  2QBP A;  1WRM A;  2CM7 A;  4R30 A;  3D1Q A;  2B49 A;  1C88 A;  2CM8 A;  1V3A A;  2B07 A;  2I5X A;  4J51 A;  1YTS A;  4D3Q A;  2NZ6 A;  3PYZ A;  4GE2 A;  4QF5 A;  1I9S A;  1FPR A;  3I80 A;  1P31 A;  1AAX A;  2HVL A;  2HCM A;  2PA5 A;  2CM3 A;  5KA2 A;  4B04 A;  4NWG A;  1Q1M A;  1T49 A;  4HJQ A;  5AWX A;  2I6M A;  1NWE A;  2I3R A;  4UAG A;  1O5Z A;  2R0B A;  2BIJ A;  2H04 A;  2F6T A;  1BZC A;  3BRH A;  1NO6 A;  2HB1 A;  3D9C A;  2Y2F A;  3ZM0 A;  3D1O A;  3CM3 A;  2I6J A;  2JJD A;  4RI5 A;  3F9B A;  2JFG A;  4GWF A;  2VEU A;  3UAG A;  3ZL8 A;  4KYQ A;  1YGU A;  4JBC A;  2CNI A;  3ZM1 A;  2CNG A;  5KA1 A;  1YWF A;  1C85 A;  3U96 A;  3OMH A;  4JNB A;  2UAG A;  1FQ1 A;  4H34 A;  4RI4 A;  1T4J A;  1YTW A;  3ZM5 A;  1PH0 A;  5K23 A;  2H4V A;  2NT2 A;  1WCH A;  1J4X A;  1NZ7 A;  5BZZ A;  5BZX A;  3QCI A;  2I1Y A;  4H1O A;  1OEM X;  2B4O A;  3S3F A;  2WJP A;  4C12 A;  4RHG A;  5A5F A;  2I4G A;  2JFF A;  1YTN A;  3S3K A;  2B3O A;  1W78 A;  5LXQ B;  4IKC A;  2BGE A;  4CVM A;  4R0T A;  4OHE A;  4PYH A;  3QCZ A;  2Y67 A;  2F71 A;  4CVL A;  2DXP A;  2PT0 A;  1PTT A;  2UUO A;  4ZN5 A;  2MBC A;  4HRF A;  5M43 A;  3F81 A;  1JBW A;  4MBB A;  2F6Y A;  4PVG A;  4GS0 A;  4S0G A;  3AWF A;  4RDD A;  2H4G A;  2Q05 A;  3AWG A;  2VEX A;  2F6W A;  4D3R A;  4NX8 A;  2PQ5 A;  1JF7 A;  4OHL A;  1YFO A;  2CMC A;  4QUN A;  3LJ8 A;  2SHP A;  4GFU A;  4BJO A;  1U24 A;  3I7Z A;  1I57 A;  3I36 A;  2VEV A;  1D5R A;  4JMJ A;  2HC2 A;  4DGP A;  4RH9 A;  2P4D A;  3BLU A;  3EMU A;  5KA7 A;  1OHC A;  2OOQ A;  2VOS A;  2I6P A;  2NTA A;  5I6V A;  1GQQ A;  3B7O A;  2F70 A;  1T48 A;  2H03 A;  4QBE A;  3EU0 A;  2I6O A;  1GWZ A;  3OLR A;  3RZ2 A;  2BGD A;  2QBS A;  2GC5 A;  1G4W R;  2RF6 A;  2FH7 A;  2ZMM A;  4OHH A;  2PSZ A;  5A5E A;  3O4T A;  2F6F A;  5KA0 A;  2QEP A;  1YN9 A;  5K22 A;  3QCD A; 
#chains in the Genus database with same CATH homology
 4JMK A;  5K25 A;  5IBS A;  2A8B A;  1L8G A;  1PXH A;  1PTU A;  2NLK A;  3QCJ A;  1C87 A;  1U26 A;  1OHD A;  1LAR A;  2P6X A;  2AHS A;  4WU2 A;  4QAH A;  1OES A;  4AZ1 A;  1PTV A;  5BUG A;  3S3E A;  2I3U A;  4GE6 A;  4GE5 A;  2NV5 A;  2HC1 A;  1EEO A;  4QAP A;  1PTY A;  4QUM A;  4YR8 B;  3S4E A;  3QCE A;  4R0S A;  4ZRT A;  2OC3 A;  1OHE A;  1PA1 A;  4ERC A;  2B4P A;  1BZH A;  1G1F A;  3F41 A;  3QCG A;  3V0D A;  2G6Z A;  3F9A A;  3QCN A;  4KI9 A;  4NYH A;  4DGX A;  3QCH A;  1LYV A;  3V0H A;  3A5K A;  2F46 A;  4YAA A;  1FPZ A;  3MMJ A;  3ZM3 A;  2IMG A;  3MOW A;  4TVV A;  1GFY A;  3QKQ A;  3QCC A;  4NWF A;  4WTY A;  2QDP A;  2HNQ A;  3QKP A;  1Q6S A;  1RXD A;  4Z6B A;  3QCK A;  4D3P A;  1XBO A;  1NNY A;  2OZ5 A;  2YDU A;  1WAX A;  3S3H A;  3S4O A;  3EZZ A;  5EHR A;  2FJM A;  2Y96 A;  2HXP A;  2CMB A;  3V0G A;  2F6Z A;  2I4E A;  3QCB A;  2M3V A;  2G59 A;  2QBR A;  3MOZ A;  1ONY A;  1I9T A;  1EEN A;  4BPC A;  3A5J A;  4HJP A;  2CMA A;  3RGQ A;  3ZMQ A;  1ZCK A;  1Q6N A;  5K24 A;  1G7F A;  5K9W A;  1NL9 A;  1XXP A;  2QBQ A;  5KAB A;  5HDE A;  2CFV A;  5K9V A;  1P15 A;  2AZR A;  2H02 A;  1ECV A;  4GRZ A;  3V0E A;  1RPM A;  3NME A;  4QBW A;  1JLN A;  3QCL A;  2C46 A;  3N0A A;  3O5X A;  3GXG A;  5EHP A;  1XRI A;  2HNP A;  2GWO A;  1QZ0 A;  3O3L A;  1M3G A;  2WGP A;  4GRY A;  1C84 A;  2F6V A;  2A3K A;  1KAV A;  2CJZ A;  4WOH A;  1ZCL A;  3SR9 A;  1OEV A;  1YZ4 A;  2QCT A;  1KAK A;  3O4S A;  5KAC A;  2OUD A;  4WU3 A;  1QXK A;  2VEW A;  2VEY A;  4RKK A;  3BLT A;  2J16 B;  3GXH A;  1OEO X;  3ZM2 A;  3EAX A;  3SME A;  3V0F A;  1LQF A;  1MKP A;  2NT7 A;  5KA8 A;  4KYR A;  4NND A;  2CM2 A;  5IBM A;  3PS5 A;  3V0J A;  2I75 A;  1G1H A;  3AWE A;  3CWE A;  3QCF A;  1PA9 A;  4OHI A;  1XXV A;  2ESB A;  2HY3 A;  2J16 A;  3D44 A;  1A5Y A;  1G4U S;  1U25 A;  1YGR A;  5KAD A;  1YPT A;  2QDC A;  3BM8 A;  1Q6J A;  1PYN A;  4ICZ A;  2CNE A;  4RH5 A;  3O4U A;  5KA3 A;  1C86 A;  1ONZ A;  1Q6T A;  2ZN7 A;  3V0I A;  1NWL A;  1ZZW A;  2GJT A;  2B4U A;  1OET A;  3RO1 A;  3M4U A;  2I4H A;  1BZJ A;  3F99 A;  1Q6P A;  2CNF A;  2GP0 A;  2BV5 A;  3ZMP A;  3D1H A;  2J17 A;  1OEU A;  1XM2 A;  2I42 A;  2PBN A;  3QCM A;  1C83 A;  2BZL A;  5MMZ B;  1G7G A;  1SUG A;  1ZC0 A;  4I8N A;  2H4K A;  1VHR A;  2C7S A;  2I6I A;  5KA4 A;  5BX1 A;  1R6H A;  3EB1 A;  2Q47 A;  4Y14 A;  5GTJ A;  5J8R A;  2B4S A;  2PI7 A;  2QCJ A;  1G1G A;  4GFV A;  4Y2E A;  5KAA A;  2CNH A;  2QDM A;  4ZI4 A;  3H2X A;  1L8K A;  2E0T A;  3RGO A;  4OHD A;  5KA9 A;  1Q6M A;  2FJN A;  1X24 A;  3ZV2 A;  3D42 A;  2QBP A;  1WRM A;  2CM7 A;  4R30 A;  3D1Q A;  2B49 A;  1C88 A;  2CM8 A;  1V3A A;  2B07 A;  2I5X A;  4J51 A;  1YTS A;  4D3Q A;  2NZ6 A;  4GE2 A;  1I9S A;  1FPR A;  3I80 A;  1AAX A;  2HVL A;  2HCM A;  2PA5 A;  2CM3 A;  5KA2 A;  4B04 A;  4NWG A;  1Q1M A;  1T49 A;  4HJQ A;  5AWX A;  2I6M A;  1NWE A;  2I3R A;  2R0B A;  2BIJ A;  2H04 A;  2F6T A;  1BZC A;  3BRH A;  1NO6 A;  2HB1 A;  3D9C A;  2Y2F A;  3ZM0 A;  3D1O A;  3CM3 A;  2I6J A;  2JJD A;  4RI5 A;  3F9B A;  4GWF A;  2VEU A;  4KYQ A;  1YGU A;  4JBC A;  2CNI A;  3ZM1 A;  2CNG A;  5KA1 A;  1YWF A;  1C85 A;  3U96 A;  3OMH A;  4JNB A;  4H34 A;  1FQ1 A;  4RI4 A;  1T4J A;  1YTW A;  1PH0 A;  5K23 A;  2H4V A;  2NT2 A;  1WCH A;  1J4X A;  1NZ7 A;  5BZZ A;  5BZX A;  3QCI A;  2I1Y A;  4H1O A;  1OEM X;  2B4O A;  3S3F A;  4RHG A;  2I4G A;  1YTN A;  3S3K A;  2B3O A;  5LXQ B;  4IKC A;  2BGE A;  4R0T A;  4OHE A;  4PYH A;  2F71 A;  2DXP A;  2PT0 A;  1PTT A;  4ZN5 A;  2MBC A;  4HRF A;  5M43 A;  3F81 A;  4MBB A;  2F6Y A;  4PVG A;  4GS0 A;  4S0G A;  3AWF A;  4RDD A;  2H4G A;  2Q05 A;  3AWG A;  2VEX A;  2F6W A;  4D3R A;  4NX8 A;  2PQ5 A;  4OHL A;  1JF7 A;  1YFO A;  2CMC A;  4QUN A;  3LJ8 A;  2SHP A;  4GFU A;  4BJO A;  1U24 A;  3I7Z A;  1I57 A;  3I36 A;  2VEV A;  1D5R A;  4JMJ A;  2HC2 A;  4DGP A;  4RH9 A;  2P4D A;  3BLU A;  3EMU A;  5KA7 A;  1OHC A;  2OOQ A;  2I6P A;  2NTA A;  5I6V A;  3B7O A;  2F70 A;  1T48 A;  2H03 A;  4QBE A;  3EU0 A;  2I6O A;  1GWZ A;  3OLR A;  3RZ2 A;  2BGD A;  2QBS A;  1G4W R;  2RF6 A;  2FH7 A;  2ZMM A;  4OHH A;  2PSZ A;  3O4T A;  2F6F A;  5KA0 A;  2QEP A;  1YN9 A;  5K22 A;  3QCD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...