1Q72L

Anti-cocaine antibody m82g2 complexed with cocaine
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
218
structure length
218
Chain Sequence
DIVMTQAAPSVPVTPGESVSISCRSSKSLLHSNGYTYLHWFLQRPGQSPQLLIYRVSNLASGVPDRFSGSGSGTAFTLRFSRVEAEDVGVYYCMQHLEYPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPQDITVSWKIDGAERSSGVLNSWTDQDSSDSTYSMSSTLTLTKDEYERHSSYTCEATHKTSTSPITKSFNRGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab M82G2, Light chain
publication title Diversity in hapten recognition: structural study of an anti-cocaine antibody M82G2.
pubmed doi rcsb
molecule tags Immune system
total genus 51
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2003-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q72L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q72L01
1F6FB 2VDNL 1MQ8A 3BX7C 4LIQL 5IJVB 4OCWL 3DX9A 4M6OL 4QOKB 3FRPA 3K2UH 4R7NA 5C0IB 3VDBA 4OLYL 4B5EA 4M6NH 2ZOKB 3PV6A 4F7TA 2CSPA 4HUMB 3U82B 3B3IB 4S10A 1IC7L 4K7PL 5FYJD 1S7RA 1WFUA 3MGOA 5IVXA 3MYJB 5C0GA 4UZGA 4OLWL 3TT1H 1KPRA 1TNMA 2Z9TA 4DAGL 4OM0L 4E41B 4TVPL 3MRRB 3O11A 5FA3B 3VFNB 5E08L 1EHAA 2R2EB 2AKRB 2R0KH 5EBMA 1O7VA 5GPRA 2BVYA 1LE5B 3H3PH 4QOKD 5C0JA 4NN6B 1G7PB 1YNLL 3NA9L 5C07B 3TH2T 2ZCKH 2FIKA 1T2XA 5AUMA 2QQNH 1P9MA 3FCTB 3GSNH 1RJLB 4P5MB 5IROC 2HT4C 5C08B 3UJTH 1A3RL 4YZFF 2P8LA 1A6TA 3SKMA 3V7MA 5I1CH 3OXSB 1YEHH 3KYAA 4O58H 2A38A 3WIFA 3PE9A 4Z77B 1JJUA 3KLHD 1D5BB 3RKPA 1DANT 5BW7A 3L3KB 4PJHF 4E41D 5CJQH 2CXGA 4M1GH 4XC1L 5IB3B 3B5GA 2OJEA 3AROA 1GZQB 1BGXL 2O5XL 2YKLL 4WTXA 1CF8H 4X8XA 3TA3C 3IDMA 1IAIL 1C7SA 3ZSTA 3CVIH 3TYFB 3VW3L 2X1PA 1Y6KR 4EN3A 2AJSL 5E24E 5FK9A 5C07D 2YZ8A 5CHNA 3TBVB 1QR1A 4UQ3A 2GYSA 5HHOE 4AL8L 3IDXL 3WXVH 3V7AE 4FXKA 5IR1A 3OMZA 1I7TA 4EDXA 4N9GB 5DHVA 5C08D 1OOAA 2G75B 4KZDL 1VACA 4EIGB 1RJYA 4HXBH 2FYYB 3ULVD 1UM5L 1ADQH 3CU7A 4RMUA 5DGRA 1U3ZA 2BSSB 3S97C 5JW4R 3VG9C 5F1NB 2WP3O 4HS3B 3GJFA 3MQIA 4OT1H 3V95A 2DLFH 2B20A 5FGCB 3GUTB 3S98A 2KZWA 3SGDI 1M4KA 2YPKA 3GMMA 4JANB 2B1HH 1JNNL 3CU1A 5D5MB 3CGTA 3AXLB 3FQNA 4Y5XB 3O4LA 2Y5TA 4R96B 3QXUA 4KKNA 3CDYA 4YWGH 1XH3B 5GSRA 5BV7H 3V6ZA 4E9LA 2GQHA 3I2CH 3LHPL 3G5XB 4YHOH 3JVGA 1XIWA 1QTYT 4DKEH 1G6RB 3BZDA 4KK8C 2CUMA 4PJEA 4JGMA 2FGZA 2X4OA 2UUDK 3T2NL 2YD5A 4AZ8A 1EVTC 5I1JH 5KS9A 2K9UA 5TJWK 2AJZB 4NOFA 4JO3H 4I18C 3DI3B 3MOQA 5CJOH 4IDLA 2NW2B 3IFOB 2DWEA 1YYML 2DS4A 3Q2CA 5D7JC 3EJZC 4YPGA 5ISZB 2VDOH 2WBJA 3WSQL 4XHQA 3OBAA 1KJ2A 4X8JA 3WFBH 3O2VL 3WFZA 4LLDA 3WHXB 3LKRB 5BJTA 4BSWA 3T0EB 2NY7H 4Z76B 2VN7A 1S5IH 5MEOA 1FNSH 3GRWA 4WWKB 1I7ZB 2DQCL 2O5ZL 2R1XA 1JYVA 3ILPA 3OR6B 2PYEA 1Q0XL 4MNQE 4NZUL 1SEBA 5ETUA 4GXVH 1RURH 3TPUB 4I2XE 2H3NA 3BN9C 1MVFA 1JMZA 1NCTA 3HMWH 5TDPA 2XTJD 2Y6SD 3SN6N 1RV6X 4XVJL 3G08B 4J8RA 5MENE 5ISZD 3T8XA 3SBWA 3ZDYE 3O6MH 2ZUYA 4WO4B 2A74A 3BP5A 5DJ8A 2XZZA 1F8TH 4MJ6A 5DK0B 2PR4H 1IAKB 2Z8SA 4TTGA 2AK4E 4Z7QF 5A1AA 4N0UA 2VUYA 1V3JA 1YEEL 1A47A 1ZS8A 1IEAB 4ZUTA 1FLTX 4WWKD 4JFXA 3JBG7 4LCCB 2ADFL 4LLMA 3T77A 3GGWA 3S8WA 2JCCE 1WZ1L 4R6UA 2ZNWA 5JR1L 2NX5E 5DSCA 5FGBC 4X80L 2AEPL 4FQJH 3P9MB 3UJIH 2OK0H 1AE6L 1ZE3C 2Y07H 1T04A 1V05A 4X6DE 3T3PE 1IFHL 4OF0A 3RWFA 2AXFB 5IMOB 1AGBA 1QA9B 4F15B 4NJAL 3RBGA 4BH8B 4Y0GA 2XY2A 4AEHH 4F3FA 5ICZB 2G5RA 3UZEA 2D3VA 5JUEH 2OSLA 1SJVA 4WO4D 2VQUA 3DV4B 4QRPE 2DWDA 1WZMA 4O4YL 2HLFC 4MAYC 5T3ZD 1T0NB 3HNVH 4P49A 1LNUB 3U7YL 4NQCA 3QJFA 3R0MA 1NLDH 1D9KC 2C3VA 4GAJH 4OGAD 4R97B 3FB8A 2AQ3A 3EGSB 4O9HH 5J7CC 2R9HC 3GMPA 1X5KA 3QEQE 1AGCA 1KC5L 2GTZA 1J0IA 4LLAA 3TT3L 1IBGL 1U36A 4YK4C 3PG2A 1XZ0B 2DKMA 4R26L 2HJLB 3QIUC 3RUGE 4AENB 4YXKH 5L0QB 1VEPA 4ZUVB 2R2HB 1AKJA 1FFRA 3C8HA 3OKKB 1D5XA 5E9DA 2OBGA 4JPWH 2AK1H 1QQDB 4OFIA 2BDNH 4Z7WB 3G04B 4FOMA 4NRXA 5IGXH 1U91B 3MV8B 5DQDH 5DTFB 5LAXA 4KDVA 4HHAA 3BP7B 4IJ3C 3WEXB 1FNEB 3PGDA 1H5BC 2QADB 3SO3C 3E8UH 1SJHA 3BT2H 4XNXH 3BHBB 5KZCB 2XWJB 2FHFA 5FUCC 5EU5A 4FQLH 3S4SB 4POYA 1IGYA 2DQFB 4Y4HB 3ZYIA 4WTWA 2Y36H 3AB0C 1OB1B 4LIQE 3BWAA 3S35X 5IEKA 1MH5B 2EXYD 1E4XH 3MV8D 1NJ9A 4HXAL 2I9TA 2IG2L 1F3RB 3VXMA 2IPKB 3CLEL 3MJ9A 5A2FA 2H2SC 2YUXA 1EHLL 3B5HA 3MO1A 1NMBL 2QADD 4K7FA 3QG7L 1NGXB 1S8DB 5KZCD 1TVDA 1A6VL 1I9RL 1EV2E 4PGDA 1CICA 3FQRA 3TPKA 4U05A 4XP4H 5FGSA 4JZOB 3RWEA 1T1YB 4LKXB 4Y4HD 4NKMA 3RX5A 4TVPE 5I2IA 1S7WA 2CMRL 2YD1A 1QG3A 4UB0H 4HULB 3O4OB 5FCSH 4C83B 1GPOL 3VRLE 1R24A 1T66C 5DD1L 3DX9B 1BP3B 3NFSH 4R7NB 5ILTL 4MGXA 4LRIC 4LBEA 1EGJA 4YFLF 4ELMF 3MLYH 4F7TB 1EBAA 4JFYA 1RU9L 2N1KA 4KROB 3ARWA 5AG8A 3RA7L 4KK5D 1AJ7L 1KB5H 3TO4D 1CGYA 2PTUA 3MGOB 1AXSA 3QQ9C 4MXQC 5C0GB 1CQYA 1VFUA 4HJGA 4G8GE 4B53A 5F9JA 2E6JA 1D6VH 1Z3GH 2E7BA 4OJFL 3WUWA 1ED3A 1ZA6A 2R1WB 2W59A 4BZ2L 4Z7VA 3N50A 4BQ9A 1EERB 5GS2D 5ID0B 1UWGL 2JJUA 1LK2A 1TCRA 1K9TA 2P24A 1GH7A 1AHWC 1DTUA 4G6KL 2FIKB 2P8MA 5JOPE 4ESKA 3SDYL 4KROD 2I26N 3LKQA 3NACL 2O93L 1A6TB 3NMEA 3BSZL 3GSXB 4OIIL 3WIFB 1QPXA 5BCAA 2W92A 1AR1C 3WHE0 2F5AL 5IW1B 3NZHL 3FB6A 1CFQA 1EBPA 4OZFB 4U6YA 3U46B 1JGEB 2RFXA 2YUZA 4TSBL 2OJEB 5DC4B 5ALBH 3TJEH 4Q74A 4O2EB 1GCFA 3IDMB 1RUAH 1MFCL 1NC4A 3D48R 4EN3B 5FK9B 1OAZH 4U1MA 1QR1B 3ZMRA 3WNMA 4FXKB 3S35L 5IR1B 1QRNB 1MWAB 1BWMA 1I7TB 4EDWL 4EDXB 3UJJH 1KEML 5E2VH 4U2ZA 5DJAB 3MA7A 2X4SA 4WDIA 1R3IL 3HNTH 3MRIB 1VACB 3EIFA 3DMMC 4X4ME 1XR8B 3CX2A 1T6WA 4XAKE 1X44A 4U31A 3L5XL 5KW9H 3GJFB 4QY8B 2UZIL 5FF6B 1IMHC 1C7TA 5JIKA 1W0YT 4OAWA 4KI5E 1UVQA 2YPKB 3GMMB 4TQEH 4FQ1H 5GISH 5MEQA 3MV01 3OAZK 2GAZA 1JNLH 4EN3D 5BW7C 3KLAA 2EE2A 3O4LB 3MSPA 5GSRB 4ODTL 4LPCA 3QUMA 4B41A 1QRND 4PRPE 1ODAA 4FS0A 1HXMA 1XIWB 4KKCC 4ONGH 3BRFA 4O2FA 2YD8A 2AJXL 3LIZL 3O6FA 4YHML 4KUCD 4ZAKA 4F2MA 2VE6A 2X4OB 4PUBH 3P0GB 3PWUA 3BKJL 1FPTL 5GJSL 5GRJH 3AS3A 2PW1A 5JW3L 3P4LA 5D1ZC 3DXAB 2NZ9C 4J12A 3KYKH 4M9PA 5I66B 2DWEB 3ALWA 4YPGB 5FA4A 4FFZL 3PJSA 2WBJB 1F4AA 1PSKL 4JR9L 1P69B 2ZUWA 3O4LD 3IDGA 1KJ2B 4X8JB 4B0MM 5ERWA 1UH3A 5BJTB 4BSWB 2RBLA 1PD6A 3DX6B 1XIWD 4X7SH 2LVCA 2XRAL 3VD5A 5MEOB 5TDOB 2XY1A 2APXA 1BEYH 1RULL 3GIVA 3T09A 2E7LA 2PYEB 4M8QB 5ADOL 1BWWA 1SEBB 5ETUB 4OCNC 3ZYZA 3BKYL 1G7QA 2WWKT 3DWTA 5D7SL 4UT7L 4MD0A 5CJXC 3U4AA 3DXAD 4FTVE 1R5WB 1S7TA 5L88H 3HLAB 3HCVA 3FN9A 4GMTH 4M1DL 4NM4L 4J8RB 4XMPH 3T8XB 2WBJD 5HGAB 1T89C 2A74B 3ZE2E 3BP5B 2AEWA 5DJ8B 4J1UA 4P3DA 4MJ6B 5FUZH 1LO4L 3GMRA 3LRSA 3WIHH 3RGVC 4PLJD 3K8LA 3N1MC 4LU5H 4ZS6C 1DCLA 1DFBH 4ZFGH 4ZUTB 4Z7NF 4JFXB 1VFAB 3T77B 4CDHA 3GGWB 5I6XC 5KVFL 3BAEH 1BJ1J 2PYED 3IDJA 3OZ9H 5DSCB 1DLHA 4HUXA 5CSBA 1CLZL 1MCRA 5IUSA 5JIHA 1IT9L 5DD0L 5E6IC 2IQAB 1OP5H 5KSBE 4PG9A 5CGMA 1BQLL 5HHOA 4Y4FC 3VFGH 2OSLB 1A7BA 2DWDB 4JM2A 5D6DC 2PF6A 3R1GL 4X7FC 2QHRH 1BD2E 3OKLB 4IMKA 1GGUA 5E8EB 1L7IH 1V7MH 2XKUA 4NQCB 3QJFB 4XCCH 3DLQR 4CJ0A 3SBWC 5FYKU 3BKMH 3VXQB 4DTGL 3GMPB 4BJLA 4M61B 3DTXA 4IRSA 4JREC 3W9DB 3IDUA 3QUXC 2GTZB 4LLUA 4FQHA 3Q1SH 5EO9A 3GJEA 4TULH 5LCVH 3EW3B 3ZSSA 3O2DH 4PRHE 3TVMB 4P0DA 1CLCA 1BJ8A 4M6NL 2NY6C 5JOEA 1N2RA 2EDYA 3EUUA 5LKNA 1AKJB 4KHTL 1D5XB 1J9CT 5E9DB 5FO9A 1CCZA 4BZYA 5CEZH 1EEYB 4FHBD 3L5HA 4ZNEE 2IC2A 3BI9X 3T1FA 2YD4A 2ZPKH 4NQCD 1N6QH 4OD2A 3LKNA 4PJIE 1FO0A 4PJBB 2BNUB 1B4JL 4XNUH 4JGJA 3UCRA 3SKNA 1DBKH 4HHAB 4M5ZH 2IANB 5E99L 1IGML 3PGDB 4JG0L 4LHJB 4RNRA 1KJVA 3IAPA 3F12A 4U1HA 3BD4A 1ZT1A 1OTTD 1SJHB 1ZLSH 2R29H 1ZHNA 4QXTB 5FHAL 4LDLB 1WJ3A 4KTDH 2V6HA 1HZHL 3TVMD 3QQ4A 2CD0A 2ZCKL 5EU5B 3IKKA 2FX8H 1ZA3B 1IGYB 3W5MA 5TQ0H 3PXJA 1AKJD 3VGGA 4N8VG 5E9DD 1NCUA 4JFHD 5J1AA 4QHMB 1YEHL 4X5XA 4QT5A 3U4EB 2F53B 5IEKB 1NJ9B 2AJ3A 5E03A 2I9TB 2B1AH 4ZNCD 3BDXA 4MNHB 3FKUS 1C5BH 3SCMB 2IAND 3KPPA 1AD9A 1RI8A 2GK2A 4BM7A 3MO1B 1WAAF 1CF8L 3NGBC 5B3JF 5I8OL 3DJ9A 5MENA 4AT6B 1F4XL 4PGDB 1CICB 3O9WC 3DURB 4XI5D 5KAQG 3VFVA 2DRUA 2AK4A 3MV9B 3RWEB 3WXVL 1M7DB 4F8QA 4NKDA 4GW1A 1S7WB 4UI2A 1YEIH 5BS0B 4WTZA 2JCCA 2NXYB 2NX5A 4HXBL 2F53D 5DUPH 4M6MH 1ADQL 4P57A 4A6YA 4FRWA 4X6DA 3IJHA 3SCMD 4KU1A 2DLFL 4WI2A 1A64A 1BX2A 4GBXA 3LOWA 3PWJA 3CZFA 4AH2A 3NCEB 4DGVH 2Q7YA 1I7RA 2B1HL 3OJDA 1MLBB 5EZOH 1QBBA 1CICD 2DLIA 1AXSB 1VFMA 2G60L 4QRPA 4YWGL 3VJ6A 4PJXE 5JTWA 4LHQB 3MV9D 3I75A 1XR9B 2H1PH 3I2CL 3V9FA 2EZ0D 4KDTA 5F9JB 3ZKXC 4HDIA 1E4WH 4OF6A 1NEZG 1TZGH 4DKEL 5BS0D 2APBA 3MUHL 3WUWB 1ED3B 3L6FB 4Q9QH 4Z7VB 2NXYD 4WU7B 1M05A 5KSAC 2Y25A 3LN5A 4XGZA 1TCRB 1JGUH 2P24B 3QEQA 4DGIL 5T3XL 1ES0A 4BFBD 1MRDH 4JO3L 3VE0A 1P7KB 4F7MB 4YHKL 4P23C 2CLVA 4L4TE 4NPYA 2EC9T 3L5WA 1FYTE 5DD6B 3OAUL 3RUGA 4YDJA 3I6KA 1RUPH 5DRWB 1DL7H 2A83B 4FN0A 4OCRL 3BPNB 4GKOA 5DJXA 3N9GL 1I8IB 3AFLA 4KWUA 4TNWF 4TTDD 3WFBL 2XQBH 4HBCH 4HQQH 3OKMA 4OGYH 2A9NH 2I9LA 2ZJSH 1CFQB 4U6YB 1S5IL 3ARFA 4QRUB 1X5IA 1A8JH 1YMHB 1FNSL 5IB2B 2RFXB 1T7XA 1T6VN 1U6AH 4LDEB 2GTWA 1CL7I 1CWVA 3X11B 1JF1B 5FYJH 4OCXH 1Q1JH 1PG7H 4JHWH 4N8VB 1BMGA 4U1MB 2WANA 2VB5A 4BK4A 3I3DA 4X6BB 1WCBB 4XNYL 1W0VB 1E4JA 3GSUB 5C0RL 5GRWA 1NLBH 5C9JB 3J8F7 2B7DT 2GUOA 1EFXB 3MNZA 4WDIB 3AU1A 2DQTH 5D96B 5E4EC 3KJ4C 3FRUA 3STZA 3MJ7A 1JUFB 4U6XB 3H9ZA 5EUOE 3QUKB 4OF5A 4QRRB 3FZUC 5HDBF 1LP9B 3MROA 3FT2B 2VXUH 1INDL 4YNYA 3BEVA 4QEGA 4HEME 1NC4D 2DTMH 3MUY1 2GAZB 5D1XB 4EI5C 3KLAB 4BSJA 4TN9A 4OZIF 1KLFA 3OSKA 1SJXA 4QHUB 1WLHA 5E00A 1T80A 4XH2A 4AEHL 4K8RL 1NCAL 2AABH 4O2FB 1EFXD 3HN3A 5EN2A 4ZAKB 3MGAA 2VE6B 3RVUC 3PWUB 3HNVL 2PW1B 4N90D 4QRRD 5HD8C 4G3YH 3EOTH 1NLDL 2B4CH 3HPJB 3QDJE 5EC1A 4OB5L 3IXAA 4P4RA 3TBYA 3CCHA 2ZP0T 5FA4B 5D1XD 4KQ3H 2UV3A 2RHEA 3BYTA 5EORH 4LCWE 2HJFA 3O41B 3TBWA 2X40A 3B9KC 4BK5A 4YXKL 2DAVA 3ZE0F 3KS0J 1DQDL 3LRHA 4WFEE 5TH2A 3GSVA 4ZAKD 3HAEH 5E5RB 4JPWL 2AK1L 3RVXD 3DSFH 1KJ3H 1OW0A 5IGXL 5DQDL 3EYQC 3PP3K 2QKIA 2NXZB 3PQYB 4MAUH 4PJDF 3QXVA 1S7TB 4K3DH 4HJJH 1ND0A 2ATKB 3HCVB 4DN3H 1F4WL 4E42A 4EEEA 2NLJA 4KGLA 2NYYD 1UG9A 3E8UL 2MQCA 3MLWL 4OZHB 1U2HA 4J1UB 4P3DB 4XNXL 3S36H 1T2QL 3WNNA 3NPSB 4KPHH 4FQLL 2CR6A 3OJMB 1XGPA 3JTSA 4JCLA 1TITA 4S2SA 1UJ3A 3CXDL 3NFPA 5D70L 2Y36L 1RAMA 3IDJB 1QSZA 4HUXB 3GSQA 1UZ6E 1A0QH 3EYFA 1E4XL 1T3FB 3GHBH 2NXZD 3PQYD 1HSAB 2IFFH 2BHYA 4PG9B 3KJ6H 5HHOB 4Z5RB 3T04D 2X4UA 4LQ1A 2VXVH 5EU6E 3ARYA 3S5LG 3SGDH 2IAMB 1F6LL 1A4JA 1U58A 4JM2B 1XF2A 1TJIL 4NZTH 1C12A 4A2LA 4P2OB 4XP4L 1MHCA 4X4MA 1CLYH 3OTTA 3EO1B 2DIAA 4FQXC 5IVXF 2KZ1B 1XGYH 4MJ5A 4P99A 4AIOA 5I16A 2WQRA 4JHAH 1MFDL 2VO5A 3C6LB 4RIRA 3ALPA 2GHWB 4IRSB 4JAMA 4LLUB 4FQHB 5IFAL 1Q9KB 4YX2H 2GITB 4F9PA 3QUYA 1VPOL 3O3DA 1KCUH 3VXPA 5HHOD 1IKFH 4KRPB 1N2RB 1SYVA 1MCQA 4PRPA 2IAMD 1QYGH 5IQ9B 2DKSA 3HI5H 3MZGB 4HT1H 1JRHH 5E6ZA 4EQ2A 5HHXH 4JY6A 4JM2D 1KB5L 1GOGA 5FO9B 5JNYA 1B2WH 1UQSB 1YUHA 2EDEA 4TRPH 3T1FB 4I1NB 4LF3A 4P2OD 4EUPG 5LXGH 1JWSB 1UWXK 4OD2B 3LKNB 1NL0L 2HYMA 3BH8B 1FSKC 3SKNB 4BSVA 2VAAA 2A9MH 3G6JE 5C09E 2E9IA 5E95B 3RP1A 3TFKD 3C6LD 4RNRB 4LQFL 4RGNC 1KJVB 1TJHH 4IRSD 4U1HB 1ZT1B 1TNNA 4FZ8L 5IKCB 5GGSY 1A22B 2JLLA 2B8OT 4Z0XB 4U7SA 1KIPA 3HZYA 2DQDL 4RQQA 1CGSH 2H32B 4KRPD 3T2PA 2QSCL 3TCLB 4HEPG 4W81A 2ADIA 4RBPK 1D5IH 2Y5EA 4IM8A 4XPFL 2UY6A 5J1AB 3WIIH 4OGXH 3KLDA 2WBKA 4MNQB 4XVUC 2OL3B 3IYLW 1KENL 1ORSA 3QXAA 2AJ3B 3IRZA 4I2XB 3SE4C 1B4RA 4UT6L 1RIUH 1MI5E 4FTVA 2ORBL 5D72H 3T2QA 5GGQL 3TJEL 5IB5B 4JHZA 3SDAC 4Y2DC 3JSSA 3WFHA 3X14A 5KVEL 4HJ0C 1I9IH 2H8PA 3NCYS 2YA0A 4ZXBB 3VFVB 1EO8L 2AK4B 4NOBA 5IW3A 4G5ZH 5I8EA 1TPXB 4GW1B 3UJJL 2HT3D 4UV7H 2K3TA 1MCCA 2MSPA 5EFIA 2YD6A 1BVLA 2O61A 2JCCB 2ZG1A 1WEJL 1F5WA 1CFVH 3LZFH 5EOQH 3V79C 4MNQD 2OTUB 3O0RH 3CZJA 4P57B 2J8OA 5CBAA 5ESQA 4PJEF 4J7RA 4X6DB 1I1CA 5ID1A 3ES6A 3IJHB 1OARH 3H6JA 1BX2B 1C5CH 5KSBA 3CZFB 4K94H 4AH2B 5J6HB 5KS9F 2Q7YB 3D87B 4BQ6A 4TQEL 4FQ1L 4M93C 4XPGH 2Z93A 4JE4B 2NY5C 3VI4F 1JNLL 4PJCA 4QRPB 1A3QA 3VJ6B 5J56B 2W0LA 4ZXBD 1BD2A 2AK4D 3VFSA 2BNRE 1J86A 1TVBA 1KN4H 2BMKB 5HHVL 4HDIB 1CD0A 1AO7E 4ONGL 4DFIA 3DV6A 1IKNC 3KLHC 2X05A 5KN5A 4JKPH 2R0LL 5J9PA 1EJOH 6FABH 2R1YA 3LN5B 5GJTH 4M7LT 4XGZB 4RMTA 3WXWH 3QEQB 2BZDA 4NC2B 2C26A 1ES0B 4WY7L 2HFTA 4PRHA 1NDGA 3FO0H 3KYKL 2CLVB 1CI5A 4Q9RH 1K2DB 3L5WB 3RUGB 1K4CB 4YDJB 2YPVL 4DKAA 2VL5A 5DI8A 4MCZA 4W6WB 5ACMA 3F7RA 4QRPD 4N0YH 5C0EA 4PJ9B 4ZNEA 3C09B 5DMJB 2QHLA 2VR4A 5SX4H 3KYOB 4M02A 1I8LA 3JV6B 4NC0B 1T7YA 4X7SL 4PJIA 1F3JB 4J3VA 5CUSH 1BEYL 3REWA 3CFEA 4UIMB 2GTWB 1LE9A 3QEQD 4H8WC 4UNVA 4UQ2A 5I15H 4AK1A 3KWWB 1KIRA 3QIBB 4R8WH 3TM6A 4NQSA 4G8EB 1RUKL 4NNPH 5CILH 4XMPL 1F42A 3FOMA 2GUOB 3MNZB 3QH3A 6CGTA 4N68A 4Y2OA 1BFVH 5GS2H 5KBNC 4PJ9D 3FRUB 2FR4A 3VGDA 5LBSL 1MJUH 5HI5C 3WIHL 2CR3A 3L3GA 2YD3A 2M8XA 2HTKD 4PJGA 2BVPA 1F02I 1DFBL 5EBWA 4ZFGL 3MROB 5JA8B 4JB9H 4TUJA 1ZMYA 2C3WA 5BVJB 3OZ9L 2A77H 5I1AA 1E6OH 5IFHH 4H20H 4HMDA 2M1KA 4RZCB 3LQMA 2BOCA 3SE8H 3QIBD 4U7KA 2ZUTA 1XF3B 3BPCA 5E00B 1CIDA 3VFGL 4JEGB 1RZKL 5E2UL 5D93B 2J8HA 5IFJA 4CVZB 2GCYB 2OZ4A 5FKAA 2ZSWA 3MCLH 1BQHA 3CAFA 3TBSA 5EN2B 1W2KT 4N0RA 5JXEA 4U1JB 2VWEE 2AXGA 4NHUA 1ZGLM 3PIQA 4YZFE 4XCCL 3L95A 4YHZH 3WJJA 5EC1B 2G9HA 3GMNA 4MZ2A 5KTEL 1B0RA 2YUVA 1GAFL 2HLAB 3HI1B 2AI0L 3IXAB 4P4RB 3F65A 3BKML 1QBLL 4PJHE 1T0MA 2Y6SC 4UTAH 1KLGB 2OLDA 4KH2A 2NW3A 3ZKQD 3Q1SL 5K59F 2JJWA 4X4ZA 3TBWB 4GRWF 4YBHA 1J0JA 2RGSA 3EO9H 4HFUH 1S9YA 5AWNH 4HLJA 4G8GB 2FECL 5EB9A 4RAVA 4CMHB 2EIBA 4Y19A 4TVPD 3LV3A 3T0EC 3I85A 4DN4L 5K9JL 5CEZL 3SEPA 1MCOH 3SGKC 1N4XH 3U0TB 3WJLA 1BOGA 1J7VR 1TDQA 4YHNA 4YBQC 5CD5C 4WRLA 1PLGH 4JPKL 2E3VA 2QKIB 3B8YA 4BZ1L 4DKFH 2FJGB 5E2TH 3EJJX 1ND0B 3QHZL 2BVQB 2PO6A 4JN2B 4PFEA 1CLOH 2W9EL 5DHVH 4M7ZC 1FYTA 2NLJB 3UPRB 1LO2L 1PKQE 3EHBD 4MWFA 3IDYB 4KJWD 3MXWH 2APWA 5LGHH 1CFTA 3QHTC 2QSVA 4WO4C 4IOIA 1BZ7A 1H8OA 3L3OA 4HF5H 4G8GD 1U41A 3MCKA 1TZIA 1FCCA 3GJFH 1XGPB 4GAFB 5DZOA 3AUVA 1EXUB 4S2SB 1UJ3B 4KTEH 2EDJA 3IFLL 3LN4A 4H0HB 1S7UA 1X5JA 4FQQA 1U8MA 4NT6A 1KNOA 1P7HL 4JKWA 2DM3A 1KELL 2V9RA 3EYFB 1GIGL 3J7HA 2B1AL 1RUML 5KVGH 5IIEA 1A9EB 1V8HA 3PABB 1MJ8H 3IS1X 3QO1A 4YDLC 1FCGA 2R2CA 3VGFA 2X4UB 2DQUH 3ARVA 5DUBB 3SGJC 4ORGB 5JOPD 1SEQL 4Z8FL 1I1FA 1EK3A 3O6LL 1U58B 3FMGH 3GI8H 3VFMB 4CVXA 1XF2B 3EOAA 1EEZB 1C12B 5TGBA 1FGVH 4N1EA 1BPVA 3I6LE 1YEIL 3V4UH 4XVSL 2WK2A 3K1DA 5I16B 3EKCA 4MZ3A 4RIRB 5TF1L 4OF8A 4NRYA 4M6ML 1ZANL 4LAQL 4U1NA 1KJ2H 2CRMA 3KPNA 3B4NA 3L5IA 3CNKA 4LVOB 1ZXQA 3VWJC 1F6AA 4PRPB 5CP3A 2WUCL 3GRWH 2VLRE 4DGVL 3MRPB 1BFOB 4XBPB 1C8PA 1H9VA 1HILA 1J0ZA 1CYGA 4JY6B 5D2LF 4C4KT 2EYSB 3PDGA 2GJZB 1F3DH 1LEGB 1UXWB 4JRWA 2H1PL 3PL6C 3ZTJH 4P59L 4XAKD 4Z9KB 1INQA 3QDJA 4L8DA 4Z7QE 2UVEA 4Q9QL 3K81A 2L7JA 3WDJA 4KI5D 3SPVA 1I1AA 2ZG2A 2FBOJ 2GJ6A 3JV0A 4YQXH 1KIPB 3HZYB 3B2VH 4V2BA 2MPAH 1IC5L 5SV4A 5FUOL 4Y1AA 1KIQA 4QXGL 4PRPD 4L9DA 4GG8A 4EBQL 2ADIB 4QRTA 5IWLC 1RUPL 2FO1A 4X99A 3I6GA 2VDPL 4C56A 1QFUL 2XQBL 4HBCL 4JFOA 2A9NL 4NFDA 4PD4J 3MLSH 3KYMB 4HH9A 4EI6A 4FTVB 2X4QA 5D6CA 3S9DB 3LH2H 3SJVA 2X41A 4PYGA 2JJSA 3FB7A 4UV4H 4LSRL 1OGTB 3WFHB 3FO9A 1MRCH 1Q1JL 4XCYA 3CK0L 4L8SA 2H8PB 4TSAL 3O2WH 2VC2L 4XB7A 4J4PC 2FEEL 1KTLA 3OKEB 1HSBA 1NLBL 2C3HA 2XTLA 2V2WA 4HIHA 1BVLB 2R69L 2O61B 2R15A 2XZQL 4WJ5B 1LMKA 5CJ5A 1X4XA 3WD5L 5CBAB 3JWOH 1DQTA 4UDTB 1IGJA 5DJDA 4H88H 4FTVD 4J3WA 2BK8A 2GJJA 3WO3B 4B50A 5KSBB 5F7FA 2YN5A 5EU6A 3K8KA 2Z93B 4R90L 4BQCA 3MRLA 4ODVH 1CTOA 5DEFB 3FL7A 3GBML 4KROC 1S78C 2BSTB 4R0LA 5E2WH 5AAMA 1BD2B 3C08H 2EKSA 2AABL 1G9MC 3DV6B 5KN5B 4RFOL 4GRWH 5J9PB 2J5LC 3U1SH 1KN2H 4FG6D 2XWBA 4GAYA 2R1YB 2EE6A 35C8L 3FFCB 2BVUA 3P9LA 3MNWB 4G9DB 4JY5H 3U48A 4JFZH 2OR9L 2H9GB 3WS6A 1CTNA 3HRZB 1NDGB 3CMGA 1YC7A 4JM4L 3FT3A 4LSPL 2IH3B 5DK2A 2FHBA 2D31A 3ULUF 4WEMB 2P8PA 4P4KC 2VL5B 3V2AR 2JELH 4ODSL 1GGIH 1BREA 5EORL 2Y7QA 3OQ3B 4HPYH 1NFDE 1BD2D 2E6QA 2IH1B 1HHIA 5HGBA 4U1LA 5IJKA 3T0DA 4WWID 4PJIB 3GO1H 1ZTXL 1MLCB 3MJ9H 4MXWH 3ESVF 3JV4A 5E94A 5SWSB 3G6JA 5C09A 3CFEB 1TQBB 3QWRA 4KK9C 3C8DA 1N3NA 3FFCD 1LE9B 5CZKA 3HE7A 4UQ2B 3V0WL 5GQBA 4EVNA 4JLRA 1KIRB 2DM4A 4PRHD 5HI3C 4HJJL 4NQSB 1RJCA 1IZJA 3IF1A 2COQA 2FATH 2EO9A 3FOMB 4U4BA 5DVNA 4IMLB 3QH3B 4ELME 1H3PL 2FR4B 5EBGA 2FNBA 1OP9A 2VRAA 5J12C 3L3GB 1KPUA 2OM5A 2BVPB 1EGJH 4K3EH 4D0DA 1MI5A 5SWSD 1U3HA 3OB0H 5F21B 2AJUL 5DHYA 2CGRH 3BPOC 1AGDA 5HYQA 5DDHA 2E7MA 1IC4H 1A0QL 2DIJA 3ARDA 3U7AA 3QPXH 3JWNC 4DQOH 1T83C 3GHBL 3W2DH 2IFFL 3BPCB 3D2UA 2Q3ZA 3BE1H 5L2JA 4X9FA 5IFJB 2E7CA 5FKAB 3MLVL 2XT1B 1BQHB 5CEZE 3RQ3A 4PRIA 2XXCB 3L1OL 4Y5YC 1YEJL 4JKKA 2Y06H 2AXGB 4NHUB 4KAQH 3PIQB 5DT1L 5DQJA 1HEZB 1J88A 2G9HB 3GMNB 3FQUA 5LGJA 2PN5A 2EXWD 1JNJA 3ROLA 1AY1H 3ZDXF 4JHAL 3MR9B 1S7VB 1T0MB 3CH8A 3WL9A 2QSTA 4PB9H 2NW3B 5DRZA 1OAYH 1YEGL 2MTPA 4LNVA 4XAWH 3QXTA 3F7PC 4YX2L 3VXOB 3SDDB 4PJXB 3MRQA 2BNRA 1HIMH 1YQ2A 5IBUG 3V6OE 1GGCL 4D3CH 5FFLA 5I75B 1AO7A 2RQ8A 1JRHL 4HT1L 5CCKH 4JRYE 5JXED 3M1BA 1B2WL 5I19H 5IMMA 4TRPL 3S96A 1BOGB 1ZT7B 2RJMA 1UGNA 4GS7B 4JDTH 5GS1A 3UBXI 1QACA 5KSVA 1VSCA 2A9ML 2PO6B 4POZC 1T5WA 4ONFH 2V2XA 1IGFH 4L4TB 1TJHL 1FYTB 4DEPB 1GXEA 4MWFB 3VXUE 1CFTB 3SDDD 3UBXB 1JHLL 1XF5A 2FBJH 1KIUA 1CGSL 1BZ7B 3L3OB 1EO7A 1TQCC 3OKDB 3MCKB 2XYCA 3IFPA 1TZIB 4HPOL 4MS8C 1CE1L 3CDFA 1SJEB 5GZOC 1CXIA 4HKBB 4KVNH 8FABA 3LN4B 1FDLL 3OPZH 1S7UB 3PNWB 2R56H 3WIIL 4OGXL 4NT6B 1U8MB 5F1IA 2VQ1A 3GK8H 5T5NF 5IBLD 4E0RB 5IW6B 3MGTA 1V3KA 1J87A 3QUMH 3A6OA 5IIEB 1A7NL 1RIUL 4XHJD 4UU9A 2PO6D 5D72L 3V0VA 4HMCA 1CXEA 4WUUA 1G0DA 4L4TD 3EDEA 1QRKA 1A2YA 1FYTD 1I1FB 2Q8BL 3SE3C 2FD6H 4X6DF 3UTPE 1VERA 4XPHH 4ODWB 1I9IL 4I9WD 5I71B 5AD0A 1UEYA 1SMOA 3EBAA 2ICWJ 5EUOB 1FE8H 2IEPA 2X2YA 4RAUB 4UV7L 3ZO0A 5TDNB 4M5YL 5HDOA 3H0TA 4P3WA 1CFVL 5EOQL 3GBNL 3V52L 4NRYB 2AS5M 4NZRH 4P5KA 2EDQA 3AC0A 1CDHA 3GMOB 3KPNB 3RWGA 3D18A 1T4KA 4JQXC 3VGAB 2XQYG 4K94L 3ARSA 4PS4H 2HFFB 2ZUUA 4L9LA 3TVMC 4F9LC 4HWUA 5CZVH 3SKOA 4XPGL 3MRKB 4W4OA 4XP1L 5F7EH 1CU4H 1FQ9C 4NKOA 4P9ML 5BMFH 2ADGB 3RUGF 1RIVL 2DQIH 3JWDH 3ULUH 1Q94A 2VLKE 3CC5A 1H8SA 1INQB 3QDJB 4JQVA 4L8DB 2X4PB 4ELKA 5DMGD 4M48L 1YDPA 1EJOL 3OX8B 6FABL 1MREL 4Z7NE 1Q9LB 4PJHA 4KHXH 3SPVB 3WXWL 3NAAH 3HZVA 1JPFA 3NZ8A 1MIEH 3TIDA 4MA8L 4LCWB 5L6YH 1UH2A 2NY0B 1KIQB 1K8IB 4GG8B 4XI5C 4Q9RL 4NNXA 1R3JB 3UTOA 3S5LA 1RZ7H 3QFDA 4QRTB 2A0LD 4I0PA 4PJFF 4KI1A 3WDHA 5F3HA 2F58L 4X99B 3E3QC 4M7KH 5AG9A 1HKLH 1JPTH 1O0VA 2E27L 1OP5K 3QZWG 4MSWA 4JFOB 1QPPA 5EU7C 2VABA 3QDJD 5JLZB 4HH9B 1NGYA 3KPOA 3QUZA 4PB0H 2X4QB 1YA5A 2GSIB 5D6CB 1QFWM 5CUSL 3WMSA 1FL6A 3FB7B 3W0WE 5EOCL 5A3ID 3FO9B 3FAWA 3FQWA 3NPZB 1PKQA 4XRCB 4LCWD 3RPKA 4UIKL 2NY0D 5I18L 5T1KA 1MCNA 4NGHH 3RZCC 1SVCP 1OTUD 4OCLC 1KTLB 1Z9OA 5CILL 3MRHA 1HSBB 5D4QA 5EWIH 1INEL 1I1AC 3IRPX 4WFED 2V2WB 4HIHB 3WNOA 1P4LA 2HT2D 4P3CH 1OAXH 4O2CB 5E8OB 5CWSA 4UINH 2VDQH 4EUPA 1IGJB 2D03H 5DJDB 1KCSL 4P46A 1EEQA 5CSZA 4FFYH 5DYOA 4X5WA 3VRLF 4AEIH 2EDOA 5EU6B 3MRLB 1E6OL 4O5LL 1NDMA 4MJ2A 5IP4A 4G6JL 2A73A 2ATPA 5B8CB 4R0LB 3VGEA 3E2HB 4QXUH 1FO0H 4IRJC 3VG0L 3U7WH 2EKSB 4S0SD 1MUJA 3MCLL 1DQMH 2DJUA 2O26U 4GAYB 4NCC1 4FFVD 5ICYA 3P9LB 1RQ5A 4XPTH 3WFDL 4YHZL 1IVLA 4JO4H 4JKMA 5D7IF 5L8JB 3S37X 5EO1A 4K23L 1FRGL 1I3VA 1WISA 1OVZA 2ARWA 2YSSA 5DA4A 5DK2B 5EU6D 3BQUB 1QFOA 4KZEH 4I3RH 2VLRA 2D31B 4JFDE 2IALB 1NUFA 2J6EH 1FIGH 2DLEA 3MRNA 2Y7QB 1WAAE 3HZMA 4LGSB 5B3JE 1E0OB 1S3KH 5D2NA 4NSKA 1E28B 1CXFA 3BPNC 1HHIB 3QNYA 5HGBB 2W60A 3EO9L 4ZD3H 5AWNL 2GFBA 3FB5A 2FZ3A 4ZG1A 3JV4B 3G6JB 5C09B 1MCOL 5B39G 3HE7B 1FG2A 2ERJB 1U8HA 4LFHG 4HS8L 1A7RL 4JLRB 4DKFL 5GGTL 5E2TL 1ZKAA 3MXVH 3DVNB 1CLOL 2A1WH 5DD5L 4Z0BL 1SBSH 1MELA 1MCPH 1LWRA 3MXWL 1OTSC 3QXDA 3O3UN 4A6YH 1MFAH 3UYRH 4UAOB 5D1QB 5F7DA 2VLLA 2IBBA 4GW5A 4D0DB 3NH7H 2X4NA 3MLRL 5B38G 1U3HB 5BXFB 5C09D 4DZ8B 4KTEL 1S5HA 3QWRD 2I5YH 5DHYB 5F9WB 3DO3A 5HYQB 4N0FA 5DDHB 3HE7D 2N7BA 2EH8H 2EDNA 1FNLA 3VCLB 1QLRB 4I77H 5E56A 3D85A 3LS5L 5KVGL 2AW2A 2NR6C 4HK3N 1M71A 5D1XC 3S3JA 1MJ8L 3H9SE 4KI5F 3D2UB 4NC1C 3MRCB 5T1DH 3BW9B 3CUPA 1EVUA 3AREA 3GI8L 3DIFA 3A0OA 4KRLB 4WV1A 1NC2A 1EPFA 3ARQA 5HJ3A 5DFVD 3BP6A 5D1QD 1IC1A 4H5SA 3GDBA 3MFFB 3BD5A 3FQUB 1Y6MR 4ODBD 1U3HD 1YNTA 1DLFL 3ROLB 4NUGH 3T65A 1FZKA 4M8VA 1QHOA 3SOBH 3O3EA 3RZWA 2ESVE 3UPCA 1DVFA 1MHHA 1HYSD 3SE9L 4K3HA 2WP3T 3D2UD 3MRQB 2D4FA 2BNRB 3BDYL 5C71A 4XBEH 4L5FL 1AO7B 4OIBA 2CDEA 5GIRA 4KKLC 4P5TA 4GKZA 5DFTA 3PP4L 5IMMB 1AI1H 3S96B 2HRPH 2C3GA 3S37L 5HBBA 4Q7DA 3Q5YA 4ZFZB 5FYKL 1IGCH 3N1PC 5FO8A 1GC1C 2V2TA 1DN0A 2GSGB 4JCMA 2PXYA 5FYLL 5KSVB 3U83A 3L3IB 1T5WB 1LDPL 2V2XB 4NN5C 5LVEA 1CZ8H 2UY7A 1BVKA 4R4NC 3DRTB 5M94B 4F57L 1OAQL 4U1SB 3VD4A 5KJRL 4CVUA 1ZLVH 3U6RA 5L7XH 3B2VL 3K4AA 2MPAL 1XF5B 5GGSA 1Z2KA 1NFDA 5GRUH 2ARJA 3ZYJA 2BNRD 1UENA 3V8OA 3IFPB 5FUCE 1OLLA 4OZIE 3NPSC 4OLYH 1AO7D 5DQ9A 3JUZA 3SDCA 8CGTA 2X9WA 1A1MA 5HGHA 2VUOA 5F1IB 1ZT4A 3L3HA 5JA9A 1IC7H 4K7PH 1MPAL 4G6AD 1P2CB 2F19L 2X1XR 5I8KL 2XZAH 3H8NA 2KBGA 4OLWH 4O02L 5C7XL 5IB1B 3QA3A 5DLML 3QI9B 5EPMB 4HZLA 3RVVD 1DBMH 4M3KB 4OM0H 4UV4L 2OS7A 3ZKND 3QFJE 3KDMA 3ZZ1A 5E08H 4UILH 1CGWA 3D3VE 5AD0B 1OGAE 3C6SA 2H6PA 4OLUH 1HCFX 2D0GA 5AZEH 3NA9H 2G2RB 2NTSP 4P2OC 3O45B 4LFHD 1TJGL 2MMXA 4PJCF 3VXSB 3K2MC 3BZ4A 4OI8A 4BH7A 3H0TB 3C8KA 1A3RH 3ZE0E 1AXTL 2WQ8A 4IHOA 4PPTA 5F3BB 5JHLL 4NBZB 1U8PA 3C6LC 4X5LA 4CNIA 5KOVC 3EYVA 2AV1A 3QT2A 1KCKA 3U30C 4QCIA 4E5XA 4H88L 4YHIB 3RWGB 3D18B 3O8XB 1T4KB 3QI9D 2NY1B 2JTDA 3QAZB 3EAKA 4XC1H 4XTRC 4PJDE 1BGXH 4KRPC 5A2IH 2WAHA 2YKLH 1K5NA 4ODVL 2L4OA 1IAIH 3VW3H 4NKOB 3VH8A 4M00A 5I1LB 2AJSH 3C08L 4S1RL 5IMLA 4KV5F 4LAJH 1RK0B 4RISH 3IDXH 4JVWA 3MJGX 4U2YA 3VXSD 2WV3A 3BXNA 4XC3H 1DBJH 1FN4A 1DBAH 1KN2L 1K4DA 4DCQA 3H3KA 4PJHB 1U95B 4KZDH 2YEZB 2X09A 3ZHDA 4JDVA 4LLQB 1QVOA 3HZVB 4JFZL 3NZ8B 1UM5H 3TIDB 1E4XI 4YO0A 1KFAL 3O8XD 3VI3F 2EE3A 2NY1D 1W0WB 3EYUH 4AG4H 2HKFH 3OGOE 3QIWC 4X6FB 1NBYA 3ZLQC 2E7HA 5F3HB 2JELL 1YMMA 4JRYA 2D7NA 1A02N 1JNNH 1W72A 2HT3C 3D0LB 4HPYL 4MD5A 4PREB 4Q9CA 2R8SL 5ADPH 4MSWB 4PJ8C 2VABB 5E1HB 1NGYB 1T1ZA 3KPOB 3QUZB 4YJZL 4MXWL 3MRJA 3CSPA 1CDGA 1FL6B 2LU3A 3RX7A 1R3LA 3NIDF 4TNVF 3KR3H 3O81A 4PJGF 5IVXE 4U1KB 3T2NH 3T4YA 3FQWB 2ZUQB 1PKQB 4S1DD 4XCFL 3VXUA 3DGGA 5T1KB 3TZVC 1Y0LA 3BO8A 1PZUB 1J05A 4IIQA 3S7GA 1CT8B 1A6PA 1HWHB 1OQXA 2FATL 1NAKL 1P4LB 5JPNB 4M7JL 1TPXC 1MHEA 1H3TA 1JFQL 5CWSB 4YUEH 3RKDC 1DE4A 3ME0A 3O2VH 4NN7C 1KEGL 5DVKA 3C9NB 3QUZD 4P46B 2DDQL 2R0WH 5CSZB 4OI7A 4X5WB 1I8KA 1OY3B 1TVHB 3ARUA 2DQCH 2O5ZH 1HHKB 1KB5B 4HV8A 1NMCB 1IC4L 2BERA 4LSVH 3RRQA 4BELD 4XXCA 4NZUH 1R3KA 1F90H 4TNWK 5I1HL 4DQOL 3QNZA 5T1KD 3Q6FA 4TYUA 4DFHA 4L29A 3BE1L 1J0YA 2G5BA 1MUJB 2LVEA 1M7IA 4XVJH 5F8RC 2VKXA 3VFWB 4JKLA 5ICYB 2Y06L 4MQXD 4S1QH 4DK6A 4KJYB 3C2SA 4LSQL 3PUCA 4P46D 4CW1A 3GMLA 4NJ9H 1YEEH 3H7BB 3KPTA 5EO1B 1BBJA 1WSST 1AY1L 3MJ8A 2YSSB 4HFWA 1WZ1H 5A16A 2VLRB 2Z0BA 2JJTA 3MLZL 2PTVA 4HKXA 4PB9L 4XAWL 1ZWIA 1S9WA 1AE6H 1WBYA 3QNYB 1IFHH 3FQXA 3MBXL 2GFBB 3I6LD 1HOCA 1HIML 4KXZI 5MERA 1GYAA 3IU3B 2VLKA 4D3CL 4XP5L 5CCKL 5KANI 1MCSA 1NBVL 4FABL 3V6BR 5INCA 4QTIL 3DHMA 4WHDA 1WBXB 1EDQA 4XXDB 1LO5A 2D7MA 2UYLB 5I30H 1FG2B 1FVDB 3KPRE 1JMXA 4MLIA 4RMWA 2P47B 3ARBC 4MVBD 5CP7A 3LEYL 1PEZA 3QIBC 4ONFL 5B4MD 1OF2A 2VLRD 1NEUA 3MMEA 4RA3A 5IHUL 1U3JA 5IROA 3ZL4L 3QXDB 4F58L 4D9RE 4LRNL 4QKXB 4GSDH 2Q76A 1H3VA 3VI4E 4KMQA 4NQVA 2HMIC 1QKZL 2VLLB 4R26H 5J11B 2VZOA 2X4NB 5CZXC 1KCVL 1S5HB 3OPZL 3THMH 3LEVH 5C3LD 3GK8L 3RDTC 4N0FB 4R4FL 2PNDA 1EA9C 1KACB 1R5VB 3TA3A 3D85B 1QSEE 3QUML 1M71B 2LAAA 1WTLA 3VRIB 4WW2A 3TJHD 3DVFA 3CVHL 2NTFA 1XGQA 4UT9L 5DRXA 5CGYC 1FVEB 5F7NC 3D9AH 1L6XA 4LVEA 2FHCA 2OMBA 2V7NA 3U0PA 5D7LE 3AREB 3DIFB 3FO2A 5C0NC 5C6WH 5FYKE 4GQPH 4MX7B 1NC2B 3DRQA 5HJ3B 3BP6B 2MOVA 5FYLE 1MVUA 4L4JA 2NZIA 4QRQA 4NBXB 1YNTB 1QLEL 1ZSDA 5CMAA 3T65B 1FZJA 1FZKB 5E1AB 4ZPTB 1MCDA 3WYRA 5ACZA 1DVFB 2YHGA 1MHHB 3D85D 2P49B 5FDYA 4HXAH 5J8OA 1V5JA 1WICA 4GQ9L 5I1EH 1ZK9A 4Y16C 2P5WE 2ENYA 1CDYA 4KJQC 1XF4B 2XN9E 2X4RA 2PETA 2IPUK 5GGVH 5CZVL 1UXSB 1EH9A 3HAEA 1EHLH 2CDEB 2XNAA 4P5TB 5GIRB 3ARED 4RRPG 5JO5A 4JRXB 2DL9A 3QG7H 1G7HA 1CU4L 5JW4M 4AMKL 1YPZE 1NC2D 1I9RH 2JE8A 3QRFM 4V2CB 1FFNA 4ZOEA 1OSPL 3ULUL 2DQIL 4JVUA 2V2TB 5EBLA 3V5DA 4Q6IC 2YPLA 4PRBA 2ICEA 5E4IA 1BQSA 3KHQA 1J8HE 2CLRA 1Q9WA 4I18A 2JK5B 2W0FA 1JK8A 1BVKB 2P5EE 4AEEA 2KDGA 3LRGA 5DZLA 4YIQA 1DVFD 4JFDA 3NAAL 1GPOH 5D7JA 3T0BA 1U8LB 1MEXL 4RWHA 1MIEL 3OKNA 1TIUA 3U6RB 4QTHB 1UC6A 1WAAA 5L6YL 5GGSB 5DD1H 2OI9C 5GS0C 2ARJB 5ILTH 1RJZA 5IT2H 2A6KB 5E8DL 1WVZA 5I73C 4Q58C 4P5TD 4JRXD 1T21A 4HK0A 1QO3A 1RU9H 2I25N 3OGCB 3RA7H 1ZT4B 2EDLA 1VHPA 4YFLI 5GZNC 3S34L 5HVWA 4P9HC 1PEWA 2R2BA 2H26A 2XV6B 3VXNA 4AQOA 3UAJD 2ID5A 3BMWA 3RVTC 1EO5A 4HZLB 4OJFH 2OZ4H 2R4RH 1MFBL 1WV7T 4RGMC 5D7KE 4OFKA 3B2UD 4ELMB 2PXYC 2F5BL 5HTSA 3C6SB 3QO0A 2H6PB 4D0BB 2Z4QA 4G6KH 1WBZA 4NGHL 5HYSG 5H94A 4F7EA 2FECI 3Q3GA 3DNKA 2FWOA 2OR7A 3BZ4B 3MJ6A 4BH7B 4P3CL 4L8BA 4H1LA 3C8KB 3REVB 3BSZH 2VLMD 1X6NA 2VDQL 3H9HA 1R6VA 2X4TA 1NUGA 1U8PB 5FGBA 4CNIB 1S9VA 3EYVB 2D03L 4E5XB 4QCIB 5C0DA 1KG0A 5DWUL 2F5AH 3D0VA 3NZHH 3H9SA 4GRLB 4CMMA 4EOWL 3GSWA 4AEIL 4JFQA 5DUML 3IS0X 1K5NB 4NQUA 2VZ3A 1MFCH 5HY9A 3IETB 3VH8B 3QEHB 4R2GC 5CKAA 4QXUL 1FO0L 1ZHKB 3LB6D 4MAYA 4WI8A 3QQ3A 2QQLL 4QXWA 2F15A 1JN6B 2QQQA 1UWXH 3U79A 5IB4B 1CQKA 1D9KA 4Z7UF 4EDWH 1DQML 5KAQF 1K4DB 1X7QA 4J23A 3LPFA 3QPQC 4XPTL 1RMFH 3GJFK 1H3GA 2ESVA 3TIEA 3CFDA 5IBTH 3NA4A 3G6JF 3UTQA 3L3JA 3DYOA 2OTWB 2Y72A 1DUZB 3HKFA 4GRLD 1G0YR 2UZIH 1CDJA 2ZUXA 3RHWF 1C5DA 4JQIH 4KZEL 3K4ZA 3W5NA 3QIUA 5CEZD 1UB5A 2J6EL 1U8KB 4JRYB 4GMSL 2W65A 1BZ9A 4MD5B 4RBPH 4D9QE 4LHUG 4MA1B 3MRDA 2NY5L 2BXZA 4IEFB 2OYPA 2DD8L 3VDCA 3MRJB 4HUUA 3OF6D 1WIPA 1SYSA 2FL5B 2AJXH 1A5FH 4YHMH 2NY3C 5DJ6A 1R3LB 3CSYA 5I1IL 1VKXA 4HUVA 3BKJH 1FPTH 1CS6A 2YA1A 1H5BA 3P11L 3VXUB 2IJ0C 4H25A 5JW3H 1FVCA 5H37H 2OR8A 1SY6A 4LPYA 1Y0LB 2BY3A 1N6UA 2AEIT 4IIQB 3VXRE 3C5SA 1SBSL 4CUCA 4ZS7L 1P84J 3ZT5A 4JRYD 4PD4K 3KPQA 4M1CD 5INDA 1MHEB 1UACH 4KMTH 2DQJL 4A6YL 1MFAL 1DQQB 5GRVL 2EDXA 4APQC 1OWWA 1DE4B 2DQEL 2KKQA 3INUL 4FG6C 5D2LE 4X9BA 2ENSA 2D4DA 4U33A 5A2JH 5FECB 1N5YL 2GT9B 5T33L 2D0FA 1WF5A 2XXMB 3MA9H 2LQRA 1RZJC 2XRAH 3HUJE 5CP3H 3QULA 3LKOA 4AM0A 2BCKA 4PLKC 3PWNA 5F88A 1J12A 2QJDA 1RULH 1II4E 4U49A 3NVQA 3QFJA 3T08A 3VXUD 5ADOH 1R3KB 4CVWA 1HKFA 4I77L 2VDLH 3D3VA 2KL6A 3Q6FB 5D7SH 1OGAA 4H8WL 2BY1A 4UT7H 3HB3D 1WT5C 1HWGB 2WINA 5T1DL 1G9NC 1M7IB 4NO3A 4PTTA 3VWKC 3QSKB 5SX5H 4JO2H 4PGBA 1KJMB 4KKBC 1NCDH 4PP1C 12E8L 3DUUA 2WWMD 4OBRA 1J18A 5K9OA 2ZCHL 4LRIA 4WU5A 5A16B 3L5JA 3SOBL 5KVFH 3UTPD 4PJDA 2F74B 4HKXB 1ZWIB 1S9WB 4ISVA 4W70A 3L7EA 1HDMA 3FQXB 1IT9H 5DD0H 4BKLA 5MERB 3UTTE 1HOCB 2D7OA 2VLKB 5JHDE 3KHOA 1BQLH 4PP2A 4XBEL 2FEEI 3L3DB 2KPNA 1N26A 5INCB 1AI1L 2HRPL 3R1GH 3UDWC 1E4KC 4POUB 3QDMA 5CP7B 2F8VA 1CFNA 5CKGA 1OWRM 1D5ZA 1AHWA 4LHUB 3VMNA 1NCCH 1CZ8L 4AEFA 1R5IB 4DTGH 5I74C 3MMEB 4OKVA 1MQKH 4HD9A 2BXYA 5JORA 3BGMB 1CDCA 5L7XL 4OLZH 2Q76B 5GRUL 4NQVB 4P2RE 5J0BA 2VLKD 1JF6A 1RSFA 4O00A 5A2KH 2JJTC 2IQ9L 3HE6C 1ZLWH 1PYWA 3NFNB 3LS4H 5C0AE 2PKDA 4KHTH 4PGZA 3E6FA 4HIXH 4WFHE 5FKPA 3BZFB 3W0WB 2EXWC 3PHSA 1UJTA 4GXUM 2BFVH 3QEGL 4NRZA 2XZAL 1WWAX 3TA3B 4P2YA 4UMGA 1B4JH 4LHUD 2AQ2A 1P7QA 1DBML 4PJ5E 1XCTA 4L8CB 3W39A 3IGAB 4LCUA 3PHQA 5E99H 1IGMH 1T7ZA 2YMXL 3U0PB 1L4IA 4JG0H 2XFXA 4YHPA 4UILL 4RSVA 2K1MA 3ULUE 3QR2A 5FHAH 3DRQB 4OLUL 1DUYA 5AZEL 1MHPH 3DMMA 1MVUB 1HZHH 1QFHA 5DHXB 1KCRH 4QRQB 5FDWA 3VG9B 3B9DA 3BRDA 5T3ZL 1ZSDB 5CMAB 1FZJB 5EULV 3W0WD 4NDMA 1WIOA 4FQIL 4RX4A 2YOCA 4MB3A 5ACZB 3TA3D 1G7LA 5MI0C 4CGTA 3WCYA 5IG7A 3TCXA 1FAIL 3QCTH 3SDDC 1LDSA 2X4RB 3P2TA 3HAEB 1LD9B 3OL2A 4HWEH 5JO5B 1TZHB 5I8OH 1G7HB 1L9NA 2VDMH 3TO2B 1HH6A 1F4XH 3QG6B 1FFNB 4HUKB 4WW2C 4HKJA 4TUKH 5EBLB 4RISL 3V5DB 5GGTA 4GS7C 2ICEB 4XC3L 1DBJL 2CLRB 5D1ZA 1DBAL 1Q9WB 2EIZA 2QSQA 5JW5A 5DMIL 3HMXA 1JK8B 4GXUN 3ABZA 4YIQB 5FOBB 1QHPA 3B83A 4RGNE 5D7JB 1BF8A 4UBDC 3VFPA 4EQ3A 3OB0K 3EYUL 3I02B 1B6UA 1RJZB 5GRZA 3SQBA 1QEWA 1D3CA 1WCQA 4NO2B 2H45A 4AG4L 2HKFL 3MBEC 1T21B 5GXBB 1QO3B 1CXLA 4JN1L 4NYLB 3FO1B 1NFIA 5ADPL 1VFOA 2G60H 2FH6A 5GS3A 2R2BB 3GSRA 2H26B 3T4AB 3VXNB 3KPRA 1JGLL 5E8PA 1FFOA 1GC1H 5CJXA 3N1QC 3KXFA 3FAXA 4AIZA 4S0TD 4KJPC 3KR3L 5D7JD 1CGTA 5FB8A 3EJZD 1ZHLB 3ZDXE 3A6CL 1T89A 4DGIH 4GG6F 1T03H 3QISA 2Z4QB 2GK0A 5T3XH 1AFVL 5DRNB 3WN5C 1WBZB 5H94B 4YHKH 4F7EB 3RGVA 3JXAA 3Q3GB 2XTJB 2BJML 4LDOB 3OAUH 1JI2A 1JRHI 4L8BB 4H1LB 4LLVB 4DVRL 2HN7A 4OCRH 5ACLA 4KRNA 3N9GH 4OFYD 3IJYA 4YUEL 2X4TB 1S9VB 1OM3L 5F1OB 3ZT6A 1EIBA 1QSEA 4JPVH 2X42A 1OSZA 2R0WL 3BN9D 1I3GH 5GGVY 4X98A 3D0VB 2E8YA 3H9SB 4CMMB 5E6IA 3GSWB 4G6ML 4JFQB 4C59B 4QOKE 5DO2C 2KQMA 4Y4FA 4CBPA 5TE7H 4LSVL 3NIFF 5EZJA 5D7LA 4FXLA 1S9KC 3S4SG 5HY9B 1F90L 5KSUA 3L7FA 4MNGA 4MAYB 5D6DA 4YR6A 3QQ3B 1H8NA 1IL1A 1XF1A 3LEXA 5CGTA 5EO0B 4U6TA 4XNYH 1P1ZA 2OMNA 1BVZA 1D9KB 5C0RH 5BVPL 1X7QB 2P44B 4S1QL 1KGCE 2EDRA 3FN0H 3LCYA 2ESVB 4MHHG 1B0GA 3CFDB 2FEDC 3SDXE 5A3IC 3QUXA 3UTQB 1GOHA 4NJ9L 3L3JB 5MEPA 3LKPB 3H9SD 3FHAA 4YK4B 2IPUG 2XPGA 2P5WA 1C5DB 1INDH 3BDBA 2XN9A 3QIUB 3BGFB 4G8FA 32C2B 4DZBA 2W65B 4G9FE 1BZ9B 4PRAA 1JYWA 3T1WA 2HLFD 4MAYD 1YPZA 2P42B 3P0YL 3VDAA 3KPMA 1D9KD 4K8RH 2NNAA 4HUUB 1KLUA 1NCAH 3WLBA 1J8HA 4I5BB 1G9ML 5IM7A 3FRPG 1FJ1B 2R9HD 2P5EA 4V1DE 4HUVB 5I30L 2ESVD 3KGRA 4HSQA 3AM8C 4H25B 5C0CE 1FVCB 1RY7B 3X17A 2J8UF 2RIKA 5FM4A 3H3BC 1Q0YH 4OB5H 3AAZA 5BQ7B 1X5FA 4J3OC 4OZIB 3C5SB 3C5ZB 3QIUD 1ACYL 1Q8MA 3GB7B 2VSCA 5INDB 1IGTA 1G1CA 4BFIB 4ALAH 3MREA 4GSDL 1I3RB 3A67L 2Q87A 3H9YA 3F5WA 4WHYH 1VGKB 2I07B 3ZDZE 2CO7B 1YNKL 3LKOB 1DQDH 1CR9L 3PWNB 3AY4A 4N5UA 3LEVL 3THML 3WBDA 1OLZA 2BHUA 3QFJB 3F6LA 4EZMA 1BLNA 2CK2A 3C60C 3D3VB 4XZUA 3MLXH 1OGAB 5ITBH 3D25B 1MOEA 2Z92A 1IEBA 3O9WA 5B8CC 5D5ME 5HHQA 2MKLC 2WINB 2MQ3A 3C5ZD 4GAGH 3SY0B 4NUJB 3CSGA 3D9AL 4PTTB 1F4WH 1YY8B 3MLWH 4OZFG 4PJFE 1MWAL 1HI6B 4D0CA 1T2QH 3HC0B 3QYCA 5SX4I 5DJ2A 5HPMA 1W8NA 5C92A 5T1MA 2CK0L 5EU4A 2YD2A 1J0KA 4MHHI 4JZNA 1T22A 4M9OA 5K9OB 4WU5B 2H2SD 3CXDH 3P4OA 5D70H 3QFJD 4PJDB 1JI1A 5I76A 4U3CA 4XCNA 3HC4H 4YGVB 3W11C 3BQUC 4LKCA 4TVSa 1AXIB 1OL0A 3D3VD 5C0FA 2UVFA 1ETZA 1OGAD 1YN7A 3E6HA 5H2BA 4M43L 4BKLB 5I1EL 3QXWA 3RVWD 1K85A 1NAML 1KSRA 4EXKA 5GGVL 3IVKB 3T0EE 1NFDF 1UA6H 3DARA 4MDJB 2FIRT 3TO4B 1TJIH 5KSAA 1A21A 3B6SA 4DGYL 1JWMA 5EUKA 5CIPA 5EZLA 2C1OA 1BBDH 5J6GA 1AHWB 2IBGA 3LAFA 1ZHBA 4KUZH 4P23A 1MFDH 3TN0C 5DD3L 4RMRA 5JORB 5IFAH 4LMQE 5DJCA 4EUPH 1VPOH 2EH7H 4HWNA 3QQ9D 4MXQD 3F7VA 3KYNA 1CXKA 3OB8A 5IT2L 4MXVE 4HCRL 3CFCH 5T3ZE 3PV6B 4TSCH 4UAOC 1PYWB 3NBNA 2YRLA 3E6FB 4OSUH 5FKPB 1S7RB 2V5MA 2ED7A 5IVXB 4NRZB 1TXKA 1L9MA 2ZG3A 4XX1G 1IE5A 1KPRB 5BV7C 1NL0H 2C5DC 1P7QB 3NABL 1XCTB 2OZ4L 3W39B 3VXRA 2R4RL 3PHQB 3O11B 4S11A 5D7IE 4LQFH 4OQ1A 3CFBA 4YHPB 3LD8C 4D94A 5EBMB 4FZ8H 4HIEA 2XG4A 1X5AA 5C0JB 4NP4L 2EIDA 2DQDH 5D2LA 3RU8H 2FCBA 2VIRA 5AUMB 1AR1D 2WIMA 3FJTA 2ZSVA 1HK6A 2QSCH 1QFWL 2BP3A 3DYMA 3HUJA 1JTOA 2ILLA 2P8LB 3ZTJG 4LGRB 1X5ZA 3SKMB 4XPFH 2LAGB 4JFEA 1A6AA 1ZGLP 1G7LB 2P1YA 1KENH 1DP0A 1PY9A 4EI5A 3VD7A 1P7QD 4UT6H 4PV9A 2ORBH 3K8MA 1A1NA 1X4YA 1FNHA 4RFNC 5GGQH 5JPMA 3P40A 2LTQB 4ZQKA 1VEOA 4CADA 1J1PL 4HMEA 5KVEH 1HH6B 2ICWA 4GH7B 1QFPA 4HIJA 5E6YA 1IAOA 1MCIA 2ED9A 4HKJB 5CHNB 4UQ3B 4KXZH 4QRSA 1EO8H 1MSPA 2C4FU 5C1MB 5IVNA 5D1ZB 3KNBA 1ONQA 3HNSL 2EIZB 5DHVB 5JW5B 4DUXA 1X5YA 5GRVK 4DJMA 4Q0XL 2C3XA 3ELAT 2JJVA 1WEJH 1JV5A 5JIIA 1RJYB 1RMFL 1FV1A 3G5YA 5IBTL 1KYOJ 3ZKNC 3SGEI 3K4DA 1T7VA 3PDOA 4YDKL 1QEWB 3MRBA 4OD3H 3UTTA 4WI7A 5F96H 5JHDA 4JQIL 3B9KA 3MNVA 4NWUL 2IF7A 2CRYA 4KKCD 1PBYA 1ZVHA 3FQNB 4GOSA 4TPRL 2Y5TB 1MCLA 1FL3A 3V6ZB 3KPRB 1F4YL 5E8PB 2BOBA 5HHVH 3UO1H 5D1ZD 1FFOB 5HYJA 1JYXA 3CVHA 4I4WA 4AIZB 4PJEB 2NZ9D 1W8OA 1A5FL 2R0LH 3ALXA 3QI9C 1JYNA 1CGXA 5FB8B 3MACL 5KS9B 4EJ1C 4WW1A 3JTTA 2WBWB 2GK0B 4MA3A 1P53A 3BPLC 3GNML 4WY7H 3UXFA 2F9BT 4P2RA 3RWIA 3WHE1 3ILQC 3RGVB 1BJ1H 1KXVC 1HINH 5GS0H 3RWCA 5I9QC 1FLRL 1P6FA 2YPVH 4QF1A 5C0AA 2HN7B 1UACL 3DOSA 4KMTL 4MLSA 3IJYB 4XPAH 4LLDB 3KPRD 4MQ7A 1MAML 3OG6B 1QSEB 1MY7A 3MA9L 4P9HH 5DVOA 2BC4A 2DI7A 3O8XC 4PJ5A 2R1XB 4ZO6A 3ILPB 4XP9H 2XOTA 2VDLL 1QR4A 4MMXC 2H3NB 4WFGE 4Y4KC 5TDPB 3LEXB 3EJYD 2Y1VA 3RGVD 1GHFL 1LQSR 3SQOL 1P1ZB 4ZS6D 4PTUA 2J2ZA 1RUKH 2AEQL 1YYLL 1G84A 2X9YA 1ZLVK 4FQXA 3QP3A 2V9TA 5D8JL 4JO2L 3U4BL 5LBSH 2YBRA 1TLKA 1B0GB 1U93A 4JREB 1QSED 1NCDL 3QUXB 4N0UB 3GSOA 5MEPB 4X4XA 3RY5A 1D6EA 1JZ2A 1ZS8B 2XPGB 3ORJA 4LLMB 1X5LA 3RL2A 1BZQK 4L3CA 4I3SL 2XN9B 2NY6B 5D7LD 4KGJA 4G8FB 3UYPA 2VZVA 4PRAB 1T04B 4RDQG 5FYKD 4ONHA 1YPZB 4LASL 3RWFB 1X6LA 5FYLD 3HFMH 1AGBB 4QHNA 1ZAGA 1MCBA 1RZKH 2NNAB 4QO1A 5E2UH 4F3FB 1KLUB 1G6VK 1J8HB 3QDAA 1N0XH 3QQNA 4NHCH 5IM7B 4PJCE 4ENED 3HZKA 3GKZA 3QUXD 2ICCA 4YC2C 1A6UL 2C3VB 1TFHA 4C54A 3UZVB 5KTEH 1YECL 5A40E 1NCCL 3AAZB 1GAFH 2AI0H 3FB8B 2XN9D 2NY6D 1CN4A 1QBLH 1MQKL 4LNRA 1AGCB 1MCFA 1AQDA 4WW2F 3MREB 4OLZL 2BVOA 3WUWG 4BUHA 5JOFA 2RCSH 5ESVA 4MQXC 1WC7A 5DS8A 1IILE 1Q38A 3SE4A 1J8HD 4ZYKA 4KV5E 3LS4L 2YR3A 1OP3H 4DN4H 1GRWA 4HIXL 4HWBL 4P48A 5GGRA 5K9JH 3VGHA 1MCHA 2BFVL 3NGBB 3SDAA 1AD0A 4XZUB 1V3LA 4X7EC 4Y2DA 5BO1H 4JPKH 4NRXB 1T1XA 2Z92B 3O9WB 5HHQB 5JZ7C 4QWWC 5LAXB 4N5EC 4BZ1H 1OPGH 5T5FH 3QHZH 3VI3E 2YUWA 1CFSA 2W9EH 4GRWB 3VA6A 1KXTB 1I4FA 1LO2H 4L1HA 1B9ZA 4OV5A 4D0CB 4MJIE 1MHPL 4XBGA 1UZ8A 1NGZA 2VKWA 1KCRL 1CL7L 5DJ2B 2Q8AL 4I0CC 3NTCH 3CH1A 4YHYB 5EU4B 5IJVA 1T22B 5ECJE 2HWZH 3P4OB 2D7TH 5D7KD 3IFLH 2J6EA 4QOKA 1RZJH 3DXAE 3BWAB 5I76B 4XCNB 1W72H 2GKIA 4LKCB 1I8MA 2ZOKA 3LQAC 1KELH 3NIDE 5C0FB 2W9DL 4MA7H 1ZGLA 1GIGH 4PJGE 3OJVC 3O9WD 3E6HB 5H2BB 1RUMH 5JDSA 3UYOD 1VENA 3QCTL 3VXMB 5TPWH 3AY4C 4YHLH 3RFZC 1TENA 3LY6A 3FOLA 4HWEL 1SEQH 4Z8FH 4K7FB 1LHZA 1IKNA 1U8IA 3O6LH 4OCSL 4HH8A 2VDML 4LLWA 3FQRB 5IHBA 5EUKB 4XVTL 4TUKL 3MRRA 3SDXA 5AYUH 2C1OB 4NKMB 5I0DA 3HG1E 5J6GB 2R2EA 5I2IB 2AKRA 5SWZE 4XVSH 3O6KH 3TJHC 5TF1H 3SKJL 4R3SA 1X5XA 1R24B 1A14L 1ZANH 4LAQH 4NM8L 4G9FA 4P5MA 3MX0A 3VXMD 4G8IA 5ALCH 1FH5L 4LBEB 7FABL 4PJ7F 5KVDL 2WUCH 4MDIA 4JFYB 1MAKA 5IQ7L 1YEKH 3VFTA 3L3KA 4V1DA 4LSUL 2FX7L 2MCG1 5IB3A 1H3XA 4K71C 4HJGB 5C0CA 1E6JL 4HAFA 4P2QE 2CDGA 4P59H 1A7QL 4Y19E 1GC1L 3GIZH 3TYFA 3VXRB 1ZA6B 4QHKJ 3NCMA 3U36A 3TBVA 1FBIH 1LK2B 3CFBB 5TQ2L 1CK0L 2EEBA 4HIEB 4HC1L 4D9QD 4U0QB 1T03L 4N9GA 5E4EB 3KJ4B 5DMYA 2HP4A 5D2LB 1IC5H 5FUOH 2VIRB 4QXGH 3U9PL 2FYYA 2CKBL 3HR6A 1FFQA 2P8MB 4EBQH 3HUJB 3LKQB 4OFDA 3HC3H 2DOCA 2OP4L 2VDPH 4H26A 1QFUH 5JXAL 3GUTA 2ICWI 1DZBA 1VEMA 3TV3L 4JPVL 4YBLB 1L0YA 4ZOCA 4EI5B 1I3GL 4JANA 5F6IC 3FB6B 5D5MA 5F7LB 3VXRD 3AXLA 4G7YH 1A1NB 1DEEA 3NN8A 9CGTA 5TE7L 4LSRH 5JQHC 4LEOA 3RY4A 1NC4B 2ICWB 3CK0H 1G6RA 2KQNA 4PJFA 3GKWH 4TSAH 4PY8J 1CBVL 3RNKA 4QRSB 2VC2H 4XT1C 4Y5VC 1YZZA 4RGOH 3FZUD 3KNBB 1I9EA 3MA7B 4KMLB 2X4SB 2R69H 4WFFE 3FN0L 2Z31C 2XZQH 2UZYB 3G5YB 2DL2A 2NW2A 3V7AG 4ETQA 3WD5H 3BH9A 1JNHA 4EI5D 3PDOB 3FHQA 3KS0H 2ZOLA 3UTTB 1MIML 4OAWB 1REIA 3MNVB 1UVQB 2QR0A 3BRGC 1NBQA 3LKRA 5MEQB 4R90H 3T0EA 4UOW1 4Z76A 4G7VL 2DQGH 3GBMH 1KULA 4LVHB 3SGKA 1FL3B 3QUMB 5HD8D 2BOBB 5CS7A 3G9VA 5EU7E 4J2XA 3OR6A 1HXMB 2F53E 1NQBA 2WUBL 3DECA 4URTB 5AEAA 2WM0A 3CVHB 2Z8RA 4YAQA 2HVJA 4RFOH 3O6FB 3TPUA 1I3UA 4F2MB 1FP5A 1QSFE 2FGWL 2FSEA 35C8H 4WW1B 3JTTB 3G08A 2OR9H 1NCWL 4NKIL 2ZUSA 4XWGL 3UTTD 4WO4A 1WWCA 1Q0YL 4M3JA 4P2RB 2CUHA 4JM4H 1CIUA 3RWCB 5J13C 5DK0A 4LSPH 5EA0L 1SM3H 4PG2A 4QF1B 3PJSB 5C0AB 4ODSH 2HH0L 4ALAL 2GJ6E 3IDGB 2DBLL 3ISWA 5BS0E 3MODL 3TH3T 5ERWB 2HTLD 1B6DA 4MQ7B 4Y1AE 2BNQE 1JZ4A 3ARGC 3P9MA 2MWCA 1ZTXH 3EYQD 3WNKA 3O6FD 2OL3L 4PJ5B 3GIVB 1WZKA 4GRLC 1XGUA 4C56E 3SGJA 5D7IA 2LU4A 1ULVA 4YFDB 1G7QB 5HI4C 1DQLL 5ICZA 3MLXL 3QCUL 3V0WH 4MD0B 5ITBL 2YWYA 1EX0A 4P2RD 3MLUL 3SJVE 4GAGL 4EKXA 3WLWC 2BVTA 3EFDH 5C0AD 4JZJC 4PGJA 3CFKA 1DN2A 1MNUL 2HFGL 1H3PH 4XNMA 4NCC2 4TNVK 1GGTA 1IGIL 3GMRB 3LRSB 1U93B 3R8QA 2R23A 4FQ2L 5D71L 3MPCA 3DETC 4PJ5D 4TUOA 3FQTA 4L3CB 2AJUH 3VWJA 1N7MH 1PZ5A 3HC4L 1DLHB 1EMTL 5T5NG 3EO0A 2X9XA 3ULUD 4AENA 4KTYA 4U1GC 1I1YA 4WTZG 4M1CC 4ZPVA 1P4BL 2I60L 4QHNB 1QSVA 3W81A 2Z8WC 5DF0A 3PL6A 5J3HD 1QQDA 1C08A 3MLVH 1ROWA 4Z7WA 4W6XB 1FSKB 1UA6L 2OX5A 2BHZA 3L1OH 1YEJH 4RGNB 2NY2B 2VYRE 5DT1H 2FLBT 3BP7A 4QYOA 1FNEA 3ARZA 1BBDL 1OT2A 1KOAA 1L6ZA 2ARJQ 3BHBA 5I1KL 4OZGF 4C58B 4KUZL 2JB6A 2XWJA 4H1LH 2EIEA 4LP4A 3DTXB 3FN3A 3KPLA 2VZTA 2WZPD 5IWLA 1YEGH 5EO9B 3GJEB 2K7PA 1IAMA 3RTQC 2EH7L 2BSRA 5JOFB 3M17A 1WC7B 4HW6A 1OB1A 3CFCL 1GGCH 1U8QA 4JFFE 4N0CC 4NNYA 4TSCL 4ZYKB 3TEUA 5A43C 4OCMC 1MH5A 4OSUL 1LP9E 4Z7UE 1JGDA 4RGND 2NY2D 2W9LA 2VISA 4X83A 4DK3A 5MP6L 4MMZC 3SDAB 4Y2DB 4AY0A 3NCYP 1FO0B 2VERN 1LILA 1YY9C 5I1DA 5DXWA 2J88L 3QDGE 4NC1E 3TNMA 4XWOC 4J4PA 3PXHA 3F12B 1I4FB 1T1YA 1I7UA 1ZHNB 5HDQL 2KH2B 1JHLH 4XBGB 1VFBA 4XVUD 3QQ4B 1NGZB 3RU8L 3TF7C 2J4WL 3BIBX 4OF7A 25C8H 1K3IA 4C83A 4HPOH 3CH1B 2WLZA 1FNGA 4HZAA 1CE1H 2WW8A 1DSFL 1JPSL 3BUYA 1FDLH 4X5XB 4QT5B 1I8MB 3SDAD 1ZVYA 4M93B 4Y2DD 2AGJH 1ZGLB 4HJ0D 4W6YB 4LSSL 2B0SL 5JDSB 1A7NH 1UYWH 5FXCH 3MOBL 5EU3A 2GEEA 3KPPB 5HVFB 1AD9B 1NFKA 5DC9B 3FOLB 5L9DH 3RIFF 5K93A 1AGFA 4X6CF 1WFNA 2Q8BH 5MENB 1MJ7H 1U8IB 4I0KA 3LDBC 4LLWB 5GGUA 3BJLA 2Q20A 3B9AA 2R1WA 1SY6H 3SDXB 5ID0A 1JZ5A 4NKDB 4PRIE 4M5YH 4GFTB 3PQYE 4F37F 2NX5B 3GBNH 5FYJU 4R3SB 3V52H 3EDJA 1FL5A 4A6YB 5T3XE 4G9FB 4P4KA 2AERT 1N59A 1QNZH 3I50L 4G8IB 4OZHE 4OD3L 5IEHA 2V5RA 4GBXB 5F96L 4XMLH 3PWJB 3GSXA 1CDBA 3ETBF 4MDIB 1I7RB 5MEND 2EDBA 3OJDB 4GJTB 4WI6A 3VFTB 1PGRB 4XP1H 5DJYA 3SHSA 1PDKA 3WNLA 5IW1A 1KGCD 4OZFA 4V1DB 4PLOB 4P9MH 3U46A 1JGEA 3MUGA 2VZ1A 3I75B 1RIVH 1EAPA 5C0CB 4HIIA 5LWYL 2CDGB 3LVEA 4O2EA 3UO1L 1JHKH 5F9OL 1G7MA 4F7CA 2FO4A 5SX5K 2XICA 4M48H 3U36B 2VN4A 1M05B 5F7HA 3C2AL 2NX5D 1MREH 1DEDA 5DVMA 4G9FD 1QRNA 1MWAA 4K07A 2AJVL 4MA8H 5DJAA 3VE0B 3MRIA 1Z0MA 4GBXD 4ZTPL 2DYPA 4NN6C 1HINL 5GS0L 1IARB 3G9AB 4NPYB 2B4CC 4MYWB 1TTUA 1CGVA 1XR8A 3I6KB 1SVZA 2F58H 5DJXB 1T7WA 4V1DD 4QY8A 5FF6A 4H26B 2E27H 2DLTA 4XPAL 1EFQA 1JZ6A 4YPJA 3OKMB 5C0CD 4HG4J 5JQ6L 2I9LB 3N1GC 3OJ2C 2F8OA 3ULVC 4P9HL 1T83A 3ARFB 1NAMA 1DANU 3WE6A 5IV2A 1DEEB 1A7PL 3NN8B 1HQRA 4XP9L 5EOCH 4LP5A 2LV4A 4LEOB 2P46B 1BQUA 1JP5A 15C8L 3VU2A 4Y5YA 4PJFB 5HI5D 4MJIA 4UIKH 4LSTH 3B9VA 4OFPA 3RNKB 5I18H 4WUUE 5C6TH 4U7MA 1NMAL 5HXMA 1INEH 1YPZF 4NZDA 3IJSA 3ARRA 3AU1B 3RAJL 1RK1A 1BAFH 3STZB 3DXAA 3MJ7B 4IDJL 4ETQB 1NUDA 2WSKA 5I66A 3R4DA 3BH9B 1JNHB 3GM8A 4QNPF 3TH4T 1ZLWK 4J3SA 4DVBA 4FNLH 3RX8A 1KCSH 3ARFD 2ZOLB 4HCRA 4ZTOL 2IPTL 1I1RA 3UROR 4YNYB 3BEVB 5IESH 2QR0B 3IFNL 1K3ZA 4O5LH 3DX6A 1QOKA 2X6MA 3F58H 4G6JH 5TDOA 2C4XA 3HFML 2XA8L 4LMQI 1ZEAH 4Y5XC 2LE9A 3VG0H 3UX9B 4XH2B 4M8QA 4G43A 1WIUA 4YAQB 2HVJB 3HG1A 4IRZL 1N0XL 4NHCL 5SWZA 3ZT7A 1R5WA 3NIGE 4M7ZB 2FSEB 2WLYA 5EOCJ 3WKNA 3HLAA 1AR2A 3WFDH 4OTXL 5HGAA 4ERSL 2IGFL 2OQJA 3TBYB 2A6JA 4K23H 1FRGH 3RWHA 5AZ2L 3CCHB 3WKML 4GKSA 4PIRF 3T0ED 4K2UL 2XTJC 4ZUUA 2X1OA 1IAII 3Q5OA 4FZEH 1VFAA 2HJFB 4NFBA 5CJ8A 4YGAB 2RCSL 2WIIA 4PV8A 4YBQD 1NSNL 3BISA 4MD4A 5CD5D 4XNZB 3CXHJ 4NQDE 4P2QA 4KDWA 3FTGA 5TH2B 3GSVB 3RHWK 4YDLB 3CDCA 1XGUB 3QBTB 2VR5A 2IQAA 5D7IB 4WWKC 3SE3A 2APFA 4HGKC 5BO1L 4HS8H 1A7RH 4NQEE 2DTSA 4ETYA 1OPGL 5T5FL 1HYRC 1UKTA 5GGTH 2DM2A 4WHTA 2VQTA 5DD5H 1U92A 3OKLA 4Z0BH 4E42B 3HMXH 1HCVA 5E8EA 2UWEF 3CFKB 4JG1H 1BIIA 5SWQA 1FC2D 4XNMB 2B5IB 2EEAA 2K7QA 3VXQA 1K6QH 2R23B 4JDZA 3RY6C 4M61A 3NTCL 4PG2C 1I85A 3JTSB 3W9DA 3MLRH 4TUOB 2B2XL 3FQTB 2HWZL 3BKCL 1T2JA 3NFPB 2D7TL 4JQXA 3VWJB 1RZJL 1PZ5B 4LCCC 1IQWL 2DI8A 4F9LA 4F80A 4OGAC 5E8NA 1W72L 1A4KA 3GSQB 3TVMA 3D5OF 3BGFC 3EO0B 3SGEH 4MA7L 1DR9A 1I1YB 3LS5H 4ZPVB 1G9EA 5TPWL 5FHBH 4YHLL 1EEYA 3BFOA 4LPTA 4GG6E 2VZSA 3PL6B 4MJ4A 2XACC 3MRFA 1C08B 4F15C 1EHNA 3P30L 2Z8VC 1QBMH 1G9NL 4LCIL 3BGAA 3MOAL 1A4JB 4PJBA 2BNUA 1ZVSA 4QYOB 2IANA 1MHCB 3PWPE 4OQTL 4ONOA 5AYUL 1V7NL 4K3GA 3BOVA 2OJZL 1MRFL 4QXTA 1DLFH 3O6KL 4MJ5B 3VWJD 2JB6B 4R97C 3KPLB 3EDDA 3C5ZC 4JAMB 1T1WA 1ZA3A 4FP8H 3CLFL 3QUYB 3O3DB 3NIFE 1FC1A 3SE9H 3NCBB 2BSRB 4X0KA 3M17B 3VXPB 5ALCL 5F7YC 3PL6D 3BDYH 2I27N 4QHMA 1SYVB 2IFGA 1U8QB 4NNYB 3U4EA 5M95B 2F53A 5FM5M 4L5FH 1YC8A 1BIHA 1YEKL 4K94C 3IXTA 5L0QC 1I9JH 2VH5L 5JNYB 1JGDB 1KF9B 1YUHB 4MNHA 3PP4H 3SCMA 5D2NE 2VISB 3K7UA 4LF3B 3CMOL 3S37H 1QSFA 1TETL 5FYKH 4ZUWA 4OZ4A 3AS0A 3EYSH 3HUJF 2YZ1A 3DVGA 4OUUA 5FYLH 3GIZL 5I1DB 4AT6A 4BSVB 2VAAB 2EXYC 4NWTL 2HKHL 3DURA 2IADA 3IU4L 3PDDA 1LDPH 3TNMB 3RZCA 3RVWC 1EAJA 1FBIL 3MV9A 4F57H 4PRNA 3ECBA 1OAQH 1M7DA 1I7UB 3ESUF 3QUYD 5KJRH 3I3EA 2QADC 1CVSC 5TFSL 5BS0A 1VFBB 4RQQB 5HVGB 5F8QC 4AQ1B 1R0AL 2BNQA 3GHEL 2NPLX 4PGEA 5E5MA 1DQJA 1FNGB 3M45A 2VXQL 4Y4HC 1BM3L 3BUYB 1CE6A 3HC3L 1JHTA 1MPAH 3S3PA 2JB5H 1LEIA 2F19H 5I8KH 1ORSB 3QXAB 4ZFFA 1HHJA 4X6EA 4O02H 2N7AA 5C7XH 2X1WL 1MLBA 4G7YL 5EU3B 5DLMH 1XCQA 4OLVL 4J4PD 4IRJA 1AGFB 1QBAA 2J8UE 4KFZC 1XR9A 3F8UB 2CJUL 3X14B 2L7UA 3G5ZA 4LCYA 5HYIA 2J5LB 5GGUB 5HVHB 3GKWL 3ZE1F 3V4PL 4KK5C 3L6FA 4WU7A 1PW3A 3TO4C 1F13A 5CFHA 5I8EB 2FRGP 4UNUA 4RGOL 1TJGH 2FJFA 5EFIB 4DKDC 2YRPA 3QB7C 3EZJB 4OGZA 2X70A 1P7KA 3ARXA 4F7MA 1AXTH 1FL5B 2MHAA 2X10A 2PYFA 5JHLH 3O4OC 1U8JA 4P4KB 5ESQB 1N59B 1X4ZA 5DD6A 1BQHG