1Q74A

The crystal structure of 1d-myo-inositol 2-acetamido-2-deoxy-alpha-d-glucopyranoside deacetylase (mshb)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
297
structure length
287
Chain Sequence
ETPRLLFVHAHPDDESLSNGATIAHYTSRGAQVHVVTCTLGEEGEVIGDRWAQLTADHADQLGGYRIGELTAALRALGVSAPIYLGGAGRWRDSGMARSQRRFVDADPRQTVGALVAIIRELRPHVVVTYDPNGGYGHPDHVHTHTVTTAAVAAAGVHPGDPWTVPKFYWTVLGLSALISGARALVPDDLRPEWVLPRADEIAFGYSDDGIDAVVEADEQARAAKVAALAAHATQVVVGPTGRAAALSNNLALPILADEHYVLAGGSAGARDERGWETDLLAGLGFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside
publication title The Crystal Structure of 1-D-myo-Inositol 2-Acetamido-2-deoxy-alpha-D-glucopyranoside Deacetylase (MshB) from Mycobacterium tuberculosis Reveals a Zinc Hydrolase with a Lactate Dehydrogenase Fold.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 101
structure length 287
sequence length 297
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.103: N-acetyl-1-D-myo-inositol-2-amino-2-deoxy-alpha-D-glucopyranoside
pdb deposition date 2003-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02585 PIG-L GlcNAc-PI de-N-acetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10320 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold LmbE-like 1q74A00
2X9LA 4XM2A 1Q7TA 5B2FA 4XM1A 4XM0A 2XADA 3DFMA 3DFIA 5B2EA 2IXDA 5BMOA 3DFKA 5CGZA 3WE7A 3WL4A 1UANA 1Q74A 4XLZA 4EWLA 3WL3A 3DFFA
chains in the Genus database with same CATH superfamily
2YV3A 2NUAA 3SIRA 2YY5A 2FRVA 4J0DA 4GYKA 4JNCA 5IAGA 1Q0LA 5COBA 4BJ6A 2GPTA 2XQKA 4U2KA 1EUDB 5KNBA 3OU7A 5FTKA 4B43A 1OH7A 2WTNA 4G0XA 4ZYWA 5AJWA 3B6ZA 1B00A 2R8RA 3HZZA 2FFQA 4OLHA 1Z26A 2RH4A 2QSUA 3QZUA 1LDBA 4UM8B 2XMRA 2PE5A 3TQHA 3V3TA 5HKKD 5ALOA 3TIGA 5KNLA 1NW4A 2QZ9A 4OG2A 3RV3A 3BBLA 4HQLA 1MC4A 3GA7A 3AFGA 3E48A 4NMHA 1I1QB 2JGMA 4U8HA 4ARIA 2RHTA 2J4CA 3FCOA 3IMFA 4MYRA 4W99A 1PBTA 3IVMA 4RTSA 4RDHA 2G17A 1GXSA 2V7BA 1UJ2A 2VDNB 2HRQA 1LB1B 2PD6A 2YXEA 1E5QA 1NPYA 4IUDS 4BX2A 9LDTA 1ZINA 5DM70 2FPXA 1A96A 4J91A 2QORA 2F59A 1DDOA 2PZLA 3RANA 2F1RA 1DBWA 3V8EA 1HH4A 3LP6A 1OJLA 4FBGA 4OQNA 4M8KA 1T2AA 1W1IA 3P2EA 2AJTA 3CUUA 5JNVA 2W2LA 1XTUA 2IYLD 4TV9B 4JSTA 2AXNA 3QYAA 1RI2A 2Q9UA 2K2QB 2JHPA 3IVAA 1VJDA 5JCOA 3PHIA 3QVVA 3ZBUA 4NYJQ 5ADHA 5MDHA 1T6BY 3H4VA 2EVWX 2CBGA 3BD6A 4NSNA 4YMTA 5EJ9A 4DYHA 2ZZNA 1UBMS 4CKCA 3IMEA 3OJWA 3BJIC 3H75A 3H99A 4FCTA 3DE2X 4FJ2A 4R1UA 1TJ3A 3PFGA 4Y2GA 3ENWA 3IP7A 4RF4A 1U0HC 4PF1A 1KE2A 3QVTA 3W5UA 1SC1A 2R1TA 3EZ2A 3OQBA 5CB4F 1PFYA 1FRQA 5AKZA 1MC1A 3DMFA 4IHJF 5E6RA 3ZCRA 1E7RA 2OCIA 1V5IA 4IIEA 2KLBA 4RZHA 3Q7QA 1R37A 4D98A 5BW8A 1N0WA 4RMIA 3WSVA 4JLWA 1C9MA 3LP5A 3JQ7A 3CNNA 4JR2A 1OT5A 1H3NA 2X6RA 1G1AA 1EJBA 2B0CA 4M8IA 3TFWA 3WB0A 1PK7A 3IPXA 3P9ZA 1CY4A 1DUSA 1MB2A 3THXA 3WDSA 1XDSA 1WQ4A 2E4WA 2PSHA 1KYTA 1YQUA 1XRMA 2PA0A 1ZWLA 4JLAA 3A4TA 1EM8B 5E1BA 5JNRA 3UB4A 1QHYA 3NIWA 4OJYA 3IIIA 3AK4A 3G0OA 4AG6A 1XSEA 4RVDA 1WUHS 1YHZA 4XLZA 3W6NA 3H9UA 3WQSB 3ZY2A 5HJ7A 1YRHA 3IEVA 4I1OA 7MHTA 2BGKA 1E18A 5AM5A 4JT8A 2DKFA 2Q2OA 3EK2A 3FG9A 3GPBA 3E1GA 1GQQA 2L69A 2QVBA 1JDJA 3IE0A 4QQRA 5BXQC 1IH8A 3F2VA 4FDUA 4EPVA 2R6GA 4IIGA 3I1YA 2OHJA 4FLMA 1Q17A 3F3KA 3FPLA 2SKDA 1F9AA 3WNVA 3FPFA 5HFNA 5BT9A 1WS6A 3UTCA 4B46A 1G5TA 3OJFA 2O5CA 3LDAA 3Q2IA 3U5TA 3B8EA 5ILQA 1A8PA 2HFKA 3LLUA 3ND5A 3O8DA 2WYHA 2FY8A 2Q49A 4PAMA 4Q6BA 3KD3A 4WVLA 1CUIA 4XX0A 3GGJA 1U2GC 1LTHR 3ZKWA 1P4RA 4B6FA 1ZJWA 4Z53A 3MJTA 1ORHA 1XJWA 5ALHA 2C04A 1U8FO 2XDQB 3DZFA 4PAWA 1NQOA 4EP1A 4YMVA 2Q3EA 2P2YA 1XQ6A 2J30A 1FLNA 1JSRA 1Q74A 2V45A 3NANA 4ENSA 5CH5A 3EQ2A 4X66B 8GPBA 3RSLA 2RIPA 5H4HA 1CB7A 3OOJA 4HDCA 4BCBA 5K9ZA 5KVAA 4ZHQA 1ZVMA 3CFYA 1DC6A 3FPSA 5D1NA 3ZVRA 2P68A 1BIFA 2WF7A 2ZRMA 3I5UA 3LV8A 2QL5A 3NBFA 3QKUA 2OORA 4OQ4A 5JZSA 4DLTA 1KNXA 3KYDB 4CL3A 4Q3KA 1CERA 2PGOA 2X6QA 1X80B 1AUOA 4HLDA 5ARDA 3VKHA 1YO6A 3E1SA 2X2OA 1RBYA 3VPXA 5EXTA 1PV2A 5B3LA 2C0PA 2JLSA 5BXYA 1KXJA 1XTSA 2O2DA 1UP7A 3AVUA 1JAXA 2SICE 4GU5A 3UTDA 2ODNA 1UK8A 3QX7A 4MQBA 4JZKA 2ZJYA 4DM3A 3UJAA 4Y18A 3EW9A 3DHYA 1KK2A 4NFYA 3L7LA 3NYWA 3OD5A 3L04A 4D9GA 1EUZA 2PN1A 4EVRA 5K3AA 4BO9A 4KXQA 4O63O 5A4MS 4PYQA 1KY4A 1XVLA 4UUQA 4KIWA 2NUPB 1JE1A 3NHZA 2YXBA 1N3IA 3KJEA 5BQPA 4HK4A 421PA 4E7PA 5AW7A 1B3RA 3MJDA 1YONA 1GZVA 1H1DA 1F3LA 2P6OA 2YJ6A 1JDNA 4R6XA 2WAAA 4XYEA 3RAGA 4EBBA 3PNLA 5CFQA 2YV5A 4L50A 2QTFA 2YS7A 3CHYA 1RFLA 3ICVA 3RT9A 5BRAA 3ZDYB 5JV5A 3WKEA 1JFSA 5FAKA 2OKGA 1H6CA 2JASA 4O02B 3FCUB 1I7SB 2N42A 3NLLA 4DSUA 2B35A 2C5HA 1PR4A 5LBTA 4CMHA 5FNVF 2HN9A 4NZMA 4L6CA 2PLFA 4KQWA 2WBLC 4L02A 1J9ZA 1EYZA 2XMBA 3NM6B 1C3EA 1VHDA 1AD2A 3R4VA 4RIGA 2BHSA 4MPDA 3GLHE 1NNI1 1QBKC 4YJHB 4EQ6B 3IAFA 5DGTA 4C08A 1E7YA 3ROEA 2D00A 3ENKA 2OBNA 1YQGA 2CLDX 2CNKA 1YJ5A 2RGDA 3B5IA 3KQOA 3QRWA 3H5LA 3A70A 3M4ZA 2VRCD 2ZVPX 3AB7A 3KT0A 5K0BA 4ALJA 3DWEX 3B13B 2OUKA 5DTMA 5EUBA 1I33A 3WWZA 5DU2A 1RAFA 1LDGA 4WGGA 4FYMA 5EMHA 5CVVA 4WBNB 1OFHA 2GF0A 4ZZ0A 2X5JO 2XWQA 1PVVA 2BI4A 4ZRDA 3AZOA 1YU9A 4KWHA 1EDZA 2EXXA 2P9HA 1CQIB 3V8MA 3TD9A 4F5YA 4A27A 3O94A 1JALA 3PJFA 4K3UA 3ZN2A 1SVWA 4XARA 3GYGA 3G1TA 2HU5A 2R7LA 1NNEA 4JENA 4UVDA 2XQFA 2E2WA 4ASUA 3QW4B 3IIMA 2IU6A 2C58A 4U7WA 3WLIA 4B9AA 2FV8A 4EO4A 5I5GA 5BV2P 4K9KA 3TI7A 2FOIA 1NFQA 2WVAA 1QJ4A 3GOQA 4LHYA 4PSKA 4CLRA 4C7OB 4J75A 2O4CA 3VDMA 7ABPA 4EHBA 1DB3A 4PNEA 3VPGA 5KYNA 1WM1A 2CVHA 3FLBA 1UT5A 4OHZA 2H4JA 3NBMA 2AC7A 4S1WA 2AXEA 4JCCA 3TLCA 4L16A 3WJAA 1YNOA 3STWA 1V4VA 3OQNA 4AM8A 3NBQA 3OZTA 2H0QA 2XI4A 4HS4A 2IHBA 2R1VA 3HO8A 3PJDA 1L8OA 2G83A 4TS9A 5AVTA 3K6JA 3KJHA 4FWBA 3UYKA 5BSFA 3C7KA 1BAPA 3PENA 4BBJA 5ES4B 5CLGA 3JQAD 2PNJA 2RHOA 1EXWA 1Z47A 3F8SA 3NPMA 4IO0A 4LJ8A 4N18A 4UC0A 1M2KA 5KTNA 1E9EA 1CE8B 3LY9A 4YP9A 1P7CA 1OAAA 2VHJA 2J3IA 1R8JA 3A28A 5JZOA 2HO4A 1CIVA 3E6AA 1QQ5A 2BZ1A 4BUCA 3B2EA 4MAMA 4B7CA 4KKXB 1S2IA 3EG9B 2H4YA 3W3AH 3GLIA 4ON9A 2VK8A 3QITA 2F9FA 4PICA 4XPIA 3R24A 4CM1A 1XX6A 4K9RA 1F3OA 4V0KA 1QG0A 1QF6A 3W77A 1YZGA 4ZPXA 4D8YA 2QGFA 1SCAA 2QRJA 4YASA 3R8XA 2WSBA 4N12A 1RHJA 2DKNA 3MVEA 2A0UA 4RORA 1VPDA 2G72A 4ZV7A 2Q99A 1E9BA 4ONEA 3T9DA 4A82A 1RBMA 1U1GA 3FUWA 3T3IA 2UYOA 2WB2A 1UM8A 1BDIA 1I7QB 5AJZA 2A57A 2X58A 2QX4A 3RRMA 2EFDB 4WKBA 2ZSDA 4CMEA 1VYVA 2WIBA 2PV0A 3D8UA 1H5UA 4MGIR 4R8KA 3ABQB 3S2IA 5BVGB 2EJUA 1FYXA 1KHHA 4J94A 1I1HA 1Q6ZA 3BSFA 3BIWA 4ZHSA 5B6IA 2Q2WA 2JFNA 3L93A 2QG4A 5AVOA 4CCSA 1LWOA 1OV6A 3D4LA 2PWPA 1SB9A 4ND4A 3FHTA 1R5OA 1TEVA 1WL8A 2IIQA 2WSLA 3NEYA 1L7DA 4N3CA 3TLYA 4U9IS 5DBIA 5IEJA 4JP8A 4HRXA 3S2ZA 3CZAA 9LDBA 3C14C 3AESA 4E5SA 2RMKA 3AY6A 3B9RA 5FHQA 2E3JA 5JAQA 3DMDA 1G20A 3AI3A 2DBVO 1E62A 3AKYA 3EZNA 4IDNA 4PC1A 4BWVA 2ETXA 1JFRA 2RG1A 3MUOA 3NP9A 3WA6A 5I7FA 2H52A 1QFSA 2OFXA 3QTLA 5HOQA 2PKQP 4UUMA 5FTJA 2YC4C 1S01A 2AKYA 5SYNA 2W2LD 2EOAA 3KALA 2GVNA 1N1MA 3BC1A 5FCDA 3I4LA 2H7CA 3NATA 4HAZA 2H1OA 2QMQA 2Z9BA 2G80A 4KLRA 2GD2A 3N7UA 4M1ZA 4W8GA 2H92A 1AT1A 2BKVA 3N2ZB 5AKXA 5TGTA 2VAWA 2X5KO 4S1PA 2E7ZA 4U63A 4NESA 3UXMA 5K45A 1SQ0A 1YFZA 5FYQA 1IOZA 2LWIA 3N6RA 4OOFA 4Q1AA 2VDPB 4DC0A 2AA3A 5CCXA 2B4AA 3UNXA 3WIEA 2WV9A 2H1CA 1M7GA 1FEZA 4MRSA 3RG8A 1A4RA 3UWDA 4CM5A 4IRXA 2GM5A 5B58C 4JFAA 3OLYA 4PR3A 1T9CA 2YBDA 5F2OA 3ED1A 1PLKA 5HCUA 4R1MA 1JEAA 4RX1A 4JROA 1TQHA 3T4XA 2O0KA 4BFUA 3AY3A 4NBRA 3UJ9A 1I13A 2GFHA 5E9WA 2N75A 1ZW1A 2O0LA 1DAPA 4RF2A 4NDZA 3NZEA 4KQHA 1IOVA 1PSWA 1KC1A 5DGDA 4HJRA 3P2MA 1K27A 4DQXA 1E2DA 4OPMA 1V7PC 2B4YA 2IP2A 1C4WA 3PNMA 3UFBA 3OZRA 3E5MA 1EIZA 1R3UA 1WKCA 1V25A 2CJWA 2ZTVA 4O4IA 4UFNA 3T7CA 1PYOA 3WLJA 4M0PA 4NTZA 5AKJA 3MXOA 3UKOA 4C9BA 3QE0A 3WTCA 1A9RA 4RY8A 2BH2A 2CFSA 2QX7A 3O93A 4UDNA 1WB9A 2QUHA 1IJBA 2R97A 1DSSG 3CX7A 2JA1A 3F9RA 3O2SB 1TMKA 4HSEA 3BGOS 1ORWA 1TM5E 3JD1A 4BZXA 3PT9A 3MSXA 4CWAA 2E55A 1FFCA 2D5BA 5SZKB 2J41A 1O94A 3T0IA 4D8WA 3F3SA 5BSWA 4MS1B 3DXZA 4PIVA 2OAEA 1NYQA 2DC1A 4K6FA 3R5TA 1KYXA 3EQ9A 3RWMB 4Q4LA 1OWNA 1MVOA 3G13A 1KP3A 3C48A 3IAUA 2O2JA 3PVCA 2R6JA 4S0ZA 1SC9A 3D5EA 4RW0A 3UFXA 5BN3A 2BFFB 2Y0CA 3QNMA 1E0AA 2Q6TA 1GN9A 3HVJA 5AXBA 4BV9A 2RGUA 2QY6A 1INLA 2X8LA 3MGBA 3ZY5A 3BWDD 2P9EA 3KKLA 5KKAA 4Y30A 3NB0A 3SHTA 2QQ0A 5D6OA 4XKJA 4QJ3A 2XWSA 2HGZA 3U4DA 4DLKA 2QLLA 1W35A 4Q7MB 3SD7A 2JLRA 3CN9A 3PDHA 5CNJA 2YASA 5SICE 3WGKA 3U26A 4H7PA 3OSUA 4OGGA 3UT0A 3NAZA 4OKIA 4B87A 4DDWA 3T3NA 1GY8A 2ZAYA 1JYSA 1OI2A 4FN4A 1KEEA 2RIRA 1J09A 3BFXA 5INTA 1HKUA 2H4WA 1HRKA 4GE0A 5TQ0A 3EWAA 4F60A 4UHHA 3O8RA 2VPPA 3W8DA 1JR3A 4ARZB 3KKNA 4LC1A 1IAVA 4C30A 2DM6A 1JJVA 3F7OA 1M2OB 2BONA 4ZVTA 2CJYA 4XJXA 4YUWA 2FSIA 3H6KA 3E2MA 4G1MB 1G66A 2FPPA 3GBVA 1HO3A 4ITRC 2JLVA 1V8BA 2ACEA 2AXPA 2V4UA 3ID6C 2DQSA 3NM5A 3DZGA 4I1SA 5TEVA 3EDYA 721PA 2CUTA 3LXMA 4I4TA 1KQGA 1M7HA 4Q3CA 4CQLA 1OGYA 2BBOA 2RGBA 4IGEA 4LYDA 3DZ8A 4Q66C 2P3QA 4YMSA 5DO9A 4JP1A 1W1WA 4DIMA 5HE9A 1G0OA 2FZ5A 2JRLA 1N2BA 3I30X 4GYJA 2QRVA 3CISA 2CDAA 4TS3A 1KSJA 2XJ4A 3ESRA 4PHTA 1F2TB 2BEVB 3CH4B 2OCKA 2QE6A 3HB4X 1EGHA 2Y6VA 1ANKA 2CEKA 5JW6A 2QTVB 3FSRA 5JXGA 1ZK0A 3EQ7A 5KDDA 1D0SA 1JZQA 1WSDA 2XMGA 3COZA 1I9CA 2KSQA 2HMVA 3CURA 4DCCA 4XFDA 3CRQA 2ZIVB 3A58B 3EOZA 2G63A 4E1AA 4MVJA 4QJ4A 2HMAA 4EZIA 3HJAA 1ENZA 4JA0A 3S0JA 1E3WB 5HBRA 3THSA 4REOA 5IWCA 1XNQB 3IHTA 3KXPA 3MEQA 4GPTA 1BJTA 4HMQA 2QTZA 3VO9A 3BQ9A 3A1VA 1FNDA 1QAQA 4R3UC 1OZFA 3K8YA 1I3KA 3ACCA 2P9FA 2RGCA 3D02A 4EG3A 1ISPA 2JNWA 2ZRIA 3ILYA 4ZU3A 1ZK2A 5LYYA 4F93B 3GX1A 4YROA 2R8ZA 1G8YA 2YVAA 3HYLA 1C41A 4C6HA 4BNMA 1V9LA 1MIOA 2P0YA 3HKBA 4QBGB 5E7JA 1T3GA 5AVJA 1SKAA 1O97C 1ZOPA 3V80A 1NWCA 4MP6A 3COSA 1DAOA 3G88A 1G3MA 4EKYA 3EPLA 2YQZA 5DLEA 4DWOA 1KBOA 2NVUA 3CTMA 3NVMB 2AHRA 5KSWB 3T1QA 4RAQA 3U2QA 4L2IA 4ZVOA 2QAJA 4Q01A 4LVOA 3DMTC 4A1FA 3ZD9A 1PJ2A 3O83A 4KHZA 5C1OA 4DBZA 4WE3A 3PTAA 1YRAA 3UJNA 4TSRA 3HJTA 3KQHA 1QIMA 3A4YA 4EA8A 4IDGA 1MA0A 3BREA 3LUFA 4HVTA 1ZLXA 4M9CA 2Z09A 5CIYA 3RCBA 1ZI6A 5FO1A 3VX3A 3RC8A 2N1MA 3EXHB 2R751 3GRFA 7ADHA 2FR1A 3C6MA 1N6HA 3V2GA 4HUTA 2HJSA 5D51S 3FMPB 4KQGA 3KQKA 1L9KA 1NMEA 3D6HA 5C81A 5AVRA 4FMCF 3KLOA 1O54A 1JSXA 2BM0A 2XIQA 4ENWA 4R9SA 3A4IA 3BERA 4G4SP 3T38A 4F9FA 3AI7A 5ILOA 1RXEA 2Y1DA 2OL4A 4XGIA 3LVBA 2P79A 3WOVA 4II7A 2WT4A 4ZHQF 2CE2X 4EX7A 2DWCA 4AJKA 3D64A 5DHPA 3RB8A 4WNAB 4ZU1X 5HMLA 3RSHA 4EVSA 2GCGA 2GARA 2H9IA 4GM1A 4MI9A 1S02A 1OMOA 1PFWA 5AI4A 1GIAA 2I6QA 1U2DA 4I5DA 1UMDB 1AMNA 1WOYA 1QIJA 2AF3C 3I5XA 3QNWA 4HGOA 3U0BA 3OKAA 2MYNA 3MRTA 1RAIA 4E6EA 1FP4A 2VOEA 3LDHA 1KS2A 3OQMA 1CZOA 1WVGA 3FZYA 1P61B 1ULAA 4P32A 2EKZA 1M2WA 3LX5A 3ND6A 2J0UB 3EMKA 3KR9A 1L4GA 3R7LA 1T0BA 4BXOB 4EG1A 1Y3HA 4K87A 4YFVA 5JMWA 3O8OB 2X3YA 3RJ5A 3FFAA 1JEYB 2PCLA 1RQ2A 4YNBA 4YCDA 1G1MA 1RE1A 3KEFA 3V3KA 5JAMA 4BU1A 3U4QB 2F8LA 3K09A 3WBBA 2JGEA 5A5VA 1YXMA 2VHYA 1PQYA 3QEBZ 4ZVMA 2WAOA 3NUQA 4O4JB 2H2DA 4MEBA 2IV7A 1TEZA 3T1TA 2R48A 1Z63A 1LDYA 2ZRDA 3DEKA 1N34B 2N47A 4PO1A 2QJTA 1YDWA 1X7WA 1KMNA 1CUSA 2H06A 4KUHA 2Y1EA 3AW9A 1Y6GA 1J2YA 1P77A 4FX5A 1DPFA 1CNEA 1B42A 2I80A 2PCJA 4R8MA 5EE0A 1N4DA 1IPFA 3F4BA 1J2RA 1RJFA 2C78A 3PQ3A 5HRAA 1TW3A 5KYYA 3ER9A 4J2OA 4QJ5A 4E5KA 4BZWA 3LRXA 3KFVA 4CLXA 1N3YA 2JEOA 3NFRA 2PIDA 5LR6A 3S1SA 5LD2C 2ZSFA 4N47A 2VBFA 3OFJA 3ZWVA 1LSSA 3DLTA 3LJKA 4BNGA 4JUDX 1J1IA 3F98A 5DM4A 1DCKA 1E1LA 1CK4A 1Y9DA 1YVDA 4G01B 4PZDA 5HFJA 1D1SA 1ABEA 4H0CA 4JHLA 3ZBPA 1FS4A 4WBSA 4LISA 4YUXA 3OFKA 4KLAA 3KTAA 1JGTA 4NK4A 3K92A 1RWMA 1VXRA 1M74A 4BCCA 1J25A 4ARCA 1UOQA 5BSMA 4KPEC 1YOVB 4V0OA 2YVUA 1CF9A 3DDCA 2ATCA 2XZTA 4L9SA 3ZQ4A 1PFKA 3ER8A 3EAGA 2WAMA 2QD3A 2JLQA 2H4HA 2VQ6A 1A5TA 3LCMA 3OOWA 4G26A 4XDZA 4X92A 5GJWC 4CMJA 2A59A 2EEPA 2HIMA 5HW0A 2O8FB 4F46A 3GV0A 3KVVA 4HGRA 2HBQA 2QGZA 1FDSA 1IMOA 4E70A 5JS1A 2VDQB 1XLUA 2BC9A 3C1TA 3UMCA 1AZWA 1VECA 3X1YA 1GNTA 4MYCA 2C0CA 4RQAA 1FU8A 5CM8B 1JHAA 1K7YA 1SU7A 2DE0X 3CRVA 5EZYB 4KBGA 3QVWA 4DUYB 3EQ6A 1JWAB 4FWIB 4HZUA 1KF0A 3DL7A 3OTIA 4HXYA 5DSTA 4KQJA 5D2CA 2YFKA 4HUQB 3EIXA 3PICA 4V3BA 1GAEO 1E32A 4M76B 4QOFA 5CR9A 5CAEB 1DX6A 4QQNA 2Y9MB 4TROA 2ISQA 4Z6KA 1RAEA 1LW6E 4B3IA 3N1UA 1NTRA 4OHMA 1E7WA 4MR9B 1DG9A 5KJ6A 1PFVA 3MNFA 3UAXA 4C07A 1TT5A 1J97A 5BN5A 2PGNA 2QW0X 5C8YB 3WBKA 3RRZA 4L75A 1ZEMA 3IB6A 5DBOA 1ZN2A 3DUFB 3S8MA 4EELA 1JIUA 4E5MA 2A84A 5KOHA 2Y4NA 3ZE7A 3OZFA 3QU2A 3F9IA 4RK0A 3EH1A 1JQJC 4FI3C 1W8IA 4W5QA 4JT2A 1M34E 4H0NA 1JFFB 2DETA 1L3IA 2ONKA 2FQWA 4O4HA 1K4YA 3DB1A 5JXIA 2OC9A 4AMUA 3PPXA 3H2JA 5J2UB 3R7DA 1Z8HA 3V7NA 1R4MB 4IJWA 4K7JA 5B64A 1MQ9A 3I72A 4Q9HA 3NHRA 4I50A 2XBMA 1TAGA 2ZUCA 3EDQA 2FZKA 3WKBA 1S0UA 2O9JA 1VZ3A 4B6OA 5TMPA 5KB3A 1FNSA 1PX2A 2J6BA 2NTYC 2QMHA 4LUCA 5BQOA 4EY4A 1V8DA 1P1FA 1ZGJA 1R6BX 2NOAA 2NSDA 2R11A 1YBMA 4L6AA 1JA9A 2P9BA 4M46A 3TIVA 1JR3D 1QE5A 1Q7RA 2G4CA 5UKDA 3OOEA 1ICIA 2G9UA 2XNKA 4JEMA 4ZI7B 1UMCB 2Y6UA 3OJCA 5BY2A 2WIDA 1Y3BE 1FQOA 3NOXA 3WBJA 1X42A 2W6QA 5ARBA 5IN4A 3H1FA 4A92A 1QCCA 4XUGB 4J1TA 1QORA 1XP8A 1F8XA 2X4IA 1LCIA 1QF9A 2TMGA 5EWJA 4M22A 1U9CA 4DR5B 1E6MA 2X8JA 5DT2A 2CVZA 1I51A 3E0QA 3BYZA 3KHTA 2COKA 3IR6A 3O3CA 5DBEX 1KPIA 3O2JA 5DCUA 4LOJA 3VU9A 1J23A 3CE9A 1W88B 4G0MA 2CNNA 2VUSA 1F1BA 1P0QA 2I2BA 4RQUA 4TVOA 4EY5A 5BWCA 3C6YA 1HEIA 1MH1A 3BEDA 5G40A 3CT6A 3G0HA 2VNSA 1ZOIA 1VG8A 1R10A 2E6UX 3GRPA 4PBTA 4BVBA 4E5VA 3EA5A 4JYPA 1YAJA 3D7KA 3L0YA 4YY3B 3PQ6A 1MOQA 3QHAA 2P2CA 3KKEA 1YR6A 1XBTA 3ONFA 4NZPA 4Q7JB 1N0IA 2LRHA 3K9NA 1RWBA 4N7MA 4M9XA 3DR3A 3F73A 1MB4A 5GP1A 3KWLA 1P0IA 5HWSA 5KYUB 3DDOA 4UREA 1HTTA 4QYIB 4GYYA 5EFOA 1NUPA 1S8AA 3DDZX 1AV7A 3CY6A 4ISBA 3L01A 1JEJA 4IDCA 2AL7A 2QMOA 3NYIA 4N01A 2N46A 4G8CA 2HQBA 3Q41A 1OJ7A 3E9ZA 3KAJA 1Z0IA 4LJAA 4B75A 1X14A 1DTSA 3KJGA 3WR5A 3MCUA 2PKYX 2HO5A 1QV9A 1YQWA 4IZIA 2GCIA 3UAGA 2JKZA 2HI0A 2ID7A 5CDUA 1FY2A 1U3UA 4PSVA 3WDLA 3SDBA 1FP7A 1EVJA 2NYAA 3RBZA 3U37A 4LZOA 3ZZMA 2H4ZA 2IHZA 3DTVA 4TWAA 4XVQA 4EJFA 4YT8A 5B4TA 5KTKA 1TECE 2VYVA 1ADJA 4C05A 2FW7A 5K20A 1WZEA 4XR9A 3RTCA 2WWWA 3UJCA 3D81A 4HQNA 4DA6A 4EL5A 3ITEA 4O5AA 1GCGA 1NOIA 3J80A 1V8PA 1P5ZB 4HB0A 1E3QA 1E1DA 1XMQB 2Z4SA 2NWQA 2P5YA 3DZDA 3QY0A 4O4IF 3RHSA 2ZPAA 1NBWB 4W5RA 3OCUA 2HXYA 1QR2A 2VBGA 1TDJA 2AJLI 4E09A 4MR7A 3QWBA 5LJLA 1C9JA 3DTTA 1JQKA 1N5OX 4BLWA 1U8YA 1ZN9A 5FAXA 3A7DA 4AYXA 2BE9A 3PDIA 5ELXA 2RHGB 3K0HA 2D2EA 3W8RA 3A04A 3LXXA 3NO4A 5LQAA 1LLDA 2B7CA 4QASA 3SLGA 3KQPA 3NKFA 1C3OA 2MU1A 1R12A 4PHHA 4X8HA 3VU0A 3IPAA 3FOBA 1J42A 1Q16A 3RC2A 2QNRA 1ADCA 4DLXA 2PYZA 1RYHA 3PQ5A 2P6UA 5IJ9B 2EZ4A 2WG0A 4JJAA 5CTAA 5E0OA 4KI0A 4NE2A 1AZLA 4QHYA 1NC3A 4KO1S 4D81A 3RWBA 1XU4A 3EARA 3SDZA 5P21A 4AZ0A 1C1DB 1A72A 1MABB 1S2GA 4X97A 3R7AA 1FMTA 3NS7A 2HRCA 2QXUA 4BVHA 4BCDA 1SKMA 4M1SA 1KZ7B 2XXAB 3BKWA 4RFLA 1OH5A 4LY0A 1AQIA 2X2EA 2XEXA 1QK4A 4QAJA 2ZT8A 3MJSA 4YUVA 1Z39A 3YASA 4D96A 2DXIA 3VJMA 3C24A 5AWFC 1IBRA 4O29A 4NV3A 2YV1A 3I2FA 5JRJA 2D2IA 1GZDA 3FFXA 4NE9A 1J8DA 4Z3DA 3W5VA 3W6PA 5IC5A 1UMKA 3PGVA 5LL6P 4XZ3A 3EB9A 3FPHA 3I2KA 2D7DA 3RYIA 4ZTZB 1O5IA 2B5WA 1SG9A 2GRUA 3H4MA 4N1AA 3AUJB 1FDIA 2P65A 2DERA 3VR0A 3B9PA 3ZGNA 4ZCPA 2ZB4A 1RM5A 1S5PA 2C1ZA 2I2DA 2I1QA 2HTEA 1SBHA 2JW5A 2XA2A 4KQCA 1HLFA 3PVZA 4OBBA 1NV9A 1J33A 3ULKA 3KXDA 3R6GA 3IB3A 3VI4B 2VDWA 4UNPA 4CDMA 1PNOA 3TIIA 1ZYUA 4M9QA 1HM5A 2Q45A 3MTJA 4YI5A 4O4LB 4YRGA 4RD6A 3JYPA 4EI8A 4EOGA 1XE3A 4I4TF 4B4DA 3TCKA 3M5PA 4K6KA 1PUXA 4ETNA 4FIZA 5FL3A 2AHOA 3T4PA 3VHXA 5KZMB 4UDXX 4E3ZA 2XUAA 2ZDQA 5CX1A 2YMMA 1GILA 3N8IA 3T7KA 1EMDA 3OEEA 2FFRA 2B4KA 2PGIA 2QRNA 2R47A 4PZEA 4EPTA 3HDYA 4RJ2A 1BVYF 3X1DA 3A9VA 3I01M 4N8DA 3I39X 3AYZB 3CRZA 1L7AA 2H7YA 4KXUA 2PEZA 3A1EA 1IPEA 4YRRA 3FYHA 2HAEA 2D0OB 4HDNA 2XUOA 5G3YA 2AK3A 3LU1A 4X00A 4DQUA 1ODIA 5FPHA 1WXGA 4MVJF 1Z4QA 2PQ6A 3GK3A 3K16A 1Q15A 3KZXA 2PGDA 4PM4A 2EBWA 2B2CA 2JBAB 2A67A 1NLZA 3NT4A 5K7SA 1ZI9A 2NW6A 2PZJA 3MN1A 4ER6A 1N6IA 2QOEA 3QMPA 2VN8A 1KYWA 2O6LA 1V6SA 4MWCA 4DLLA 4CEHB 2W93A 1UDRA 4RO0A 3O8BA 2B20A 1P2BA 4MQEB 1SBIA 2M1XA 1P18A 4DDKA 5JYDA 3WGJA 3T94A 4NOKA 1Z2AA 1A71A 3FJYA 3ROQA 4QLBA 1QQTA 4OI2A 4ZQFA 3U3DA 5A5DA 1HE5A 4E3WA 2WAXA 2ZI7A 4DMUB 2F9LA 1AB6A 3UBTA 3HCPA 3ANMA 5CK5A 3OQHA 1HWYA 1TU3A 2E6KA 3AEQA 1EEHA 5E2BA 2C5AA 4X24A 3T9BA 3L6DA 4C0HA 1E2MA 3SX2A 1O6BA 4QVKA 1UQUA 3UO8B 1I4EB 1QUFA 1YE5A 4EY7A 4WXYB 3LGXA 2X40A 1GPNA 4CVNA 1O6CA 1K4KA 1QDUA 2WKPA 3DO8A 3GRAA 4UW9A 2ORYA 1PDVA 3H5TA 3O7WA 1AKMA 2F64A 2QK4A 3FTDA 3GUVA 1IHXA 3AJEA 4OBEA 5ITWA 2O1WA 4MCHA 3LYAA 1SC6A 2O2IA 4ER5A 5JZVA 3T41A 1R0ZA 2UYHA 1CSEE 1H4VB 1W581 2FWRA 2XGSA 1DCFA 3JVVA 4GF5A 5EE3A 1AUQA 3LPLA 4V39A 2YWEA 2CMHA 4ZVPA 5EHGA 1DOHA 1FUEA 1WPQA 3KB6A 3ZLUA 5JZBA 4QGSA 1UDCA 4CV2A 1KZ6A 4FFLA 3UMSA 1G21B 3RRBA 3VDRA 4BE9A 3T5PA 4TMWA 2WP0A 4P35A 3WYAA 1VPLA 4BNVA 2QU8A 4FT2A 4EYQA 1NW5A 3M82A 1EFPA 1WP4A 2UXDB 3F9CA 1T9DA 4QGHA 4J4HA 5GONF 4BO3A 4KEAA 1Y5RA 1N9ZA 1QVZA 2EYQA 2QMUA 3TLXA 2ZJAA 3VZDA 4C04A 2I7CA 1ZUIA 2HA2A 2H7XA 3VJKA 3QU5A 4XOIA 3GJRA 2XZDA 3H3JA 1P44A 4UBOA 1N6OA 4XUCA 1KWKA 3L4KA 3FYUB 4BRSA 5H8WA 1N6NA 1XTKA 2G1AA 3Q3HA 4MEAA 5AW4A 4M54A 1F0YA 4NH4A 2FDXA 3I09A 1WUTA 4LHWA 3V55A 1BDBA 4QXPA 2RGWA 3AC0A 3WZ2A 5KTMA 3PWKA 2QX8A 1FYDA 3FRJA 3EAFA 4WK2B 1CY7A 3FNEA 3OM1A 4Q02A 3K5HA 4TT8A 4B7ZA 1A97A 2NU9B 2A94A 1LF0A 3WADA 4DLPA 3QA9A 4GX2A 1YS1X 1FVXA 3WGZA 3UJ6A 3LYLA 3BIJA 2W43A 2ORVA 3Q9UA 4TN5A 4QX6A 2OBLA 3GA0A 5H9VA 3WP0A 4TL6A 4GX1A 4FSXA 3UAOA 4P38A 1BEUB 1DS6A 1T5TA 2ZATA 4OB7A 3C15C 3B6KA 5KYWB 1P81A 1SXJA 1NJ2A 1PR3A 1VCNA 2IYQA 4H77A 1R8XA 4XWKA 1F5SA 2L17A 1SQSA 4UBKA 2AB0A 4RNDB 3U7QB 1J7KA 3ESCA 2AR7A 4FC6A 3OO1A 2OMEA 2GXAA 4J0GA 5EGSA 1QLHA 5C5CA 1FVOA 2G6TA 1V3VA 1HSZA 1VL8A 5FUYA 1EGMB 4NZ9A 2ATVA 1JG3A 1EBUA 1SVKA 3CJTA 4KPFC 4B85A 1TC1A 3BL8A 3L4JA 2QL6A 4FDVA 4B4KA 1M66A 3NUGA 1KH1A 2ZUUA 2A8YA 3EIHA 1G3UA 4JLSA 3WLTA 5JCXA 3BMXA 4RKEA 4URHA 2VUTA 3OE5A 1WHSB 3CIFA 3D3WA 4L9AA 1KEPA 2ZJ8A 4ZV9A 4RMNA 2I71A 2YDXA 3GUCA 5SV2A 4F4IA 4WCFA 3GNTA 3BZUA 3JQQA 1QH0A 1VKJA 1NW7A 4HCJA 3OPYI 1CB0A 1BWRA 3JQFA 3M9XA 4UOZA 4LVCA 2ZBDA 3RFTA 4BNLA 3FR8A 2IODA 1RPAA 4WA7A 3CG4A 3TMAA 3QPCA 4Q37A 3T9FA 1AKYA 1T2EA 3T12A 1MDBA 3IHKA 1CQXA 3IL2A 4EG5A 3TFQA 4WKNA 3V00A 3W1WA 2JFZA 3V1KA 3UVEA 3ZU6A 1P4GA 1DGQA 3TSZA 8ABPA 2HXSA 2UUOA 2J07A 1USKA 4J16A 3DTVD 4LMAA 4E6PA 4L9WA 1VRVA 1U0JA 3HLTA 1IUPA 2R6ZA 1M5UA 1WG8A 1WLYA 2VYVD 2WABA 3NHWA 4XQ0A 5FPTA 4BY9E 5B53A 2AOTA 4G4JA 3UCFA 2OZEA 5TC4A 1GSIA 2JLWA 1G38A 1KPGA 5DK4A 1NTOA 1ADBA 2EX4A 4MDHA 4UXHA 4Q3BA 3T0GA 4BFSA 1J2TA 5IZCA 4UEWA 5EJEA 3SX4A 3WFJA 5I8ZA 2H00A 4YLEA 1HBJA 3RUHA 1M5TA 2OCXA 4QGAA 3VU3A 4I1PA 1P39A 5H68A 1OKKA 3TOVA 5LVAA 3GVHA 4DY6A 4K6MA 2A7QA 3U13A 4F2DA 2JLXA 3Q9NA 4CIBA 3HU2A 1R6UA 3HCWA 2IE0A 4XSVA 1K75A 4QL3A 2W6MA 1DQRA 2DPHA 3IQXA 3MOGA 3C4VA 5AXAA 3A9SA 3PRKE 4UDYX 3WMGA 1P60A 4JYMA 2VH5R 5DYWA 4X6XA 2GSDA 3C7AA 2ZWIA 3BRQA 4QREA 1H8HA 4YRKA 1GPWB 5JAZA 4K6HA 3EISA 2A1TS 1WULS 4NU0A 4AL4A 5C4MA 4OHXA 6PFKA 3BIOA 3JR3A 4EUKA 5BMVB 2IHTA 3ZHUA 3W78A 1H3FA 4P0QB 1L2TA 3DE1X 3RC3A 2J3JA 3BIFA 4EKGA 1TCUA 1LUAA 4KAAA 1DG1G 3MQ2A 4LIPD 1K7CA 2GETA 4M9ZA 5HF8A 5AVVA 2D54A 3WLOA 4O4HF 2OZKA 4B48A 3I9OA 2PMKA 4L74A 3DYBA 3RYTC 1T4DA 1JAHA 3RT1A 4AYWA 4OKNA 4L5BA 1JKMA 4Y2RA 5L8VA 5IM4F 4I50F 2GHTA 1JAYA 2H54A 4EM6A 4URXR 2IHYA 4NAVA 3MB8A 3GC6A 5DNWA 1RHMA 1BA2A 3WJ7A 3MCWA 2DKOA 1XMIA 5LQUA 4D82A 1M6WA 3MIZA 1GT6A 2M6SA 3ODGA 3ZUGA 4G5HA 2C5GA 2W6CX 3KT6A 4GMFA 4TQGA 4ZXFA 2WMYA 5BYAA 2AEEA 2GAIA 3TRIA 2XE6A 1HDEA 1NKTA 4KCGA 4TN1A 4PQEA 3RI3A 1FUIA 4OSPA 3W6OA 5BSHA 3C3KA 3GPCA 1X87A 1IG3A 1DAHA 5JROA 2G04A 4KVGA 4DA4A 1P2SA 3RS9A 1Q12A 1JW9B 1UM9B 1EK0A 5L3SA 4IMPA 2VH1A 3G6WA 1SH7A 3RYFA 5IVKA 4W1PA 4NQRA 4O33A 2C61A 2ODBA 3CEJA 2WM2A 1D4ZA 3PFCA 1STOA 1NR5A 3FWKA 2UUCB 1NJ5A 4MUGA 3OEED 3TCXB 1PEKE 3CN7A 2WG2A 4BTLA 4II3A 1SXHA 4GI2A 4C5AA 4O5OA 4OK6A 2WHQA 5JQWA 2Y9PB 5T64A 2WTXA 4ZGBA 1N5RA 2FZGA 4RVSA 2IEYA 1O4VA 2K2WA 3R0QA 2GBIA 4ENRA 5EGNA 1PD1A 1LBSA 1T91A 3E22A 3KCNA 1KO8A 2OO3A 1MJGA 3QXJA 5CB4B 4AKHA 2H0RA 4NBTA 4ESOA 4IHJB 4D41A 4DMHA 2RI6A 4HDQB 4KIFA 1WAMA 4L0MA 3JQ6A 4MVJP 2W9XA 4NZZA 1YB6A 2JCXA 4W9NC 3DXXA 3OZWA 3LY5A 3FCAA 5B6JA 2QPAA 3P27A 1QH8A 4B6RA 3IAS1 3H9CA 4UEQA 4X1IB 4AICA 3EVTA 2XCRB 2E9SA 1Y1TA 3FCEA 3T52A 2WFLB 5CJJA 2EFCB 2W2MA 3AR6A 3N2GA 1ZD2P 1GQSA 4DTCA 1QQBA 1T6XA 4HH1A 2QLNA 2PHZA 2H5EA 3I37X 3EXG2 4BTVA 1M1YB 2AZ4A 4JI0B 1G3IA 2OHXA 2AG0A 4X85A 4I55F 3EHDA 3V4PB 1NBME 2OBMA 4FKMA 2YIMA 5AFSA 5IJ0A 5A04A 2VAPA 2P91A 3LUGA 1D1PA 1R9JA 2I4NA 3Q9SA 4B31A 3LOUA 3IJRA 3OPXA 2LNDA 3MJ4A 2CHVA 5SZHB 2DX7A 4EENA 1N8SA 2V6JA 3LBIA 4HVAA 4DBLC 2ONCA 2XWBF 4DV0B 1UUFA 1OX4A 3VKWA 4RPLA 5DXAA 1GYQA 1AXGA 2G67A 4AU1A 2KPOA 3TNFA 5I7VA 2P9TA 4TGLA 1QANA 2PNFA 5DIFA 3ZE6A 4FEAA 3B1XA 3KQYA 2ZE5A 3UHAA 3PVSA 1JIXA 4FQ7A 3EGDA 4GPAA 3OX2A 2GCPA 1IZYA 2QGNA 5CVEA 3SU8A 3VAYA 1RHUA 2QQEA 1EUCA 4N5DA 5TQVA 4QUAA 4ZANA 5EUCA 2MR6A 4RD4A 4J1NA 4KFUA 1XXLA 4PW0A 1NWHA 1LGYA 4QGFA 4FZJA 3VPDA 4A6XA 4A0FA 3OOHA 4DJDC 1O77A 3FRIA 6ABPA 1JEYA 1HI9A 5BT8A 3MINA 3PUIA 1IQRA 5EP3A 2BF7A 2Z2JA 3Q3IA 3BWBA 3UKDA 1G8PA 1N0UA 3E7WA 4QOHA 4B6EA 4DBLE 1GU1A 1A98A 3PU6A 3MUNA 1U4OA 2FK7A 1FW6A 3O1JC 4BNTA 1NVTA 1TVKB 2C8KA 3KU4A 4HAUA 3EIFA 1YVPA 3OE4A 2BHRA 4KZKA 1FQWA 4PPFA 2VTVA 3GH1A 2AZDA 4XIJA 4MVJI 5DNVA 5B5SA 3ORSA 1AO0A 4Z7NB 5ICCA 1XYYA 5KTTA 4ISCA 2OOSA 1YZTA 1YE8A 1E2JA 1SVMA 4OU5A 3KSDO 3DOEA 1OX6A 1KDZA 4I1VA 1XK6A 3RG2A 1AMOA 5LQCA 4U4AA 3QPAA 3L4SO 4UDOA 1LS1A 3I5MA 1JH8A 4EI7A 2XCSB 4KQXA 2JLUA 1MT3A 2TSYB 3PJRA 4XJVA 4MUNA 1F14A 1G5FA 5IT9A 3GLFE 2BTEA 4YPOA 1AH2A 2ZJ6A 4OYRA 1KJNA 5G0TA 3PE3A 4ARUA 4WUTA 3K1JA 1TMGE 2OLKA 3WK6A 2GZHA 2I8AA 3GFFA 1UKBA 4ZA2A 5E7MA 5FNVB 5K05A 3KSAC 3LPDA 3K70D 4M0MA 5F5XA 3GEMA 3DE5X 4C4XA 5D1HA 2GD6A 4C3VA 5CUQA 5GZ1A 1GFWA 1SXJD 1NSTA 2I2FA 4RVFA 4MW9A 2NYVA 1HNZB 3CUSA 1PZMA 1F4VA 2HJWA 5CA0B 3IVGA 3UXHA 4ERNA 4D26A 1ID8A 4YRDA 3GRZA 5CLLA 1P80A 5L6LB 1HFWA 2Z0MA 3PCRB 4D0RA 2O3JA 1FFSA 1LKZA 3KYIB 5EXDA 3I53A 2GAJA 3TK1A 3TX6A 1XEAA 2G5PA 3ANLA 4YS6A 4MP3A 1NXSA 3CXRA 2ZFUA 1E2QA 5H83A 1XZ8A 3ZYCA 3A6GA 1O5TA 3C5HA 1U3TA 2I2CA 1Z6PA 1X9HA 3U3JA 5DYNA 4MTCA 2JIZA 2Q4OA 2G09A 3QBDA 3AG5A 4MKGA 4CKYA 1YF3A 4RHYA 3RT7A 2G6BA 5KSOA 1GARA 1CRZA 2ON6A 2IS4A 5FTNA 5A7GA 3FCXA 1LSJA 1H4TA 3SF0A 1UXGA 3DW1X 3I05A 5LQJA 5BWNA 2VPQA 2ZBFA 2XX3A 1H8EA 4U7TB 3RJ9A 1NJFA 1MQAA 2FPGA 1E0JA 5LP1A 2YTZA 2PQ2A 2PRZA 2RH9B 4XQ9A 1VLZA 4CQMA 1JIKA 3IODA 4HGQA 4TPKA 3TB4A 2RJ3A 1W76A 3HP1A 3K6RA 3UEOA 3WZLA 2W58A 3HJRA 2D13A 1PT9A 3N7AA 4DGSA 1W25A 1DTWA 2BLNA 1QIHA 4I6EA 5FBKA 5LP6C 3J7AC 4Z1OA 5F5LA 1R8YA 2GB4A 1OC4A 1OKKD 4R1SA 3M1LA 1YH3A 5BVHB 3CR8A 3QV2A 2II6A 1NFFA 3O4VA 3L41A 4U3JB 4XD2A 3FNBA 5GOZA 3PQ4A 4C2AA 1H93A 4YQFA 3GJZA 4PNPA 1P6UA 4G5XA 2XHEA 5THXA 4M6WB 5LQDA 1I8TA 1OYOA 2BZ0A 5CIQA 2W0SA 2NTVA 1MX5A 1MOSA 4WLUA 2GT1A 1JPUA 4FEEA 1J99A 4YI3A 3NEAA 5B37A 3UK7A 2YXDA 1OREA 4NYJR 2OVFA 4U7GA 2Q0HA 2O3RA 1VL2A 3RBXA 4C0AC 1PBNA 4G9EA 4GBMA 1K86A 3W9SA 3O74A 4LQLA 5F3DA 2B8NA 2CDRA 4DNQA 5JNSA 1G6Q1 4CEJA 4RZUA 1R9MA 3VC7A 5JQGF 2DFVA 3IV9A 3JRNA 1EVEA 1U9IC 1WMDA 1Y5MA 2FSUA 3L8FA 4MKRA 2B8EA 2IUSA 2ACVA 2HXGA 5AHOA 3U1TA 2C59A 5L4NA 2FI1A 2PJRA 3TLAA 1LI4A 1KJJA 1KTVA 2JD0A 4FNOA 4MARA 4CLHA 4ABTA 2P6RA 3AI1A 1PL8A 4E46A 1H9AA 2PZ8A 4HLNA 1TA0A 2SCUA 4WASA 4QXQA 4BIMA 1HURA 4B09A 2AEMA 1OW3B 2P4EA 4LDZA 5AO9A 1ORVA 3DC2A 1Q0TA 1L6RA 1TM2A 2LE0A 3O0DA 2IPLA 2ADMA 2FPKA 3NHLA 4L8GA 4NEQA 2W2KB 5ALPA 1M6YA 2PL5A 3FDIA 3K5WA 1GG8A 4XDHA 3B1ZA 3EPJA 5KNDH 3S99A 5T8KA 3KJQA 1T36A 2PS0A 1AU9A 1E79D 1P62B 4MGKR 4JL8A 4YA6A 1IEVA 3VSBA 4LK3A 2PL3A 4PNHA 2WUDA 3B1FA 2AYYA 3VI3B 4CTNA 1ISGA 1BRTA 4MQ4A 1J07A 1ECJA 4IVRA 3TW0A 2HLNA 4QDJA 2P9ZA 4MKFA 4AJ9A 3ASYA 4BE7B 1ZQ1A 2ZPUA 5CNIA 1RMYA 1FRFS 2HA5A 1GTSA 1A5ZA 1FUKA 3JARB 3LT1A 3TI9A 1FTYA 3BJEA 2A9RA 1M33A 4BRWA 3AUTA 1KR2A 2XKJE 3IESA 3VV3A 3A7EA 5DSXA 2F3PA 2J46A 3PA8A 1FCJA 1XRSB 3CO0S 5FF9A 3VZQA 1KI9A 3KKOA 1DCMA 1OZ0A 2VI5A 1V8FA 2Y4OA 3QG1A 3MW8A 4QWWA 4ZZ1A 1A8IA 3WNDA 5TE9A 4CG2A 4CLOB 2YBEA 3IAXA 3O95A 1CVIA 2CXXA 1NVDA 2GCOB 4OX9B 3RTAA 1OFGA 2C4NA 1VHLA 3CRW1 3AUKA 4H35A 4BUZA 5KQSA 1NQVA 4TMVA 4UHKA 5KTPA 1T9ZA 1QS0A 1PP4A 3DVRX 3AVTA 1NQXA 3I62A 5D86A 2O50A 1Z4MA 3H13A 1TIKA 4UJ3A 1F06A 3E82A 3LHDA 4IPTA 3RYHB 5K8IA 1V1RA 5DM0A 1FW8A 1XV5A 4ESVA 4IDFA 4QPZA 4BBPA 4N5NA 1XZLA 4JQYA 2IP4A 1BWSA 3OCVA 2QBYA 3MWEA 4H4DA 5KNBH 4X63A 2OZPA 4B4OA 3DFIA 1XIVA 5JJBA 3DO6A 4RETA 1Q0UA 4IYJA 3DQPA 3VPFA 4P84A 3GNSA 1CEEA 2XMCA 3KYBA 2Z8YM 5EP4A 5CXXA 3EPKA 4NPAA 3UOAB 1M6VA 5EYPA 1OTXA 1T13A 1Y1PA 2AE2A 2WJ3A 1LWNA 3TDMA 5EKUA 3ZD6A 3U1BA 1QX3A 1ZVJA 3DV2A 1ORRA 1S2DA 1DARA 4M53A 4H3KB 3ZZTA 4XYLA 2HMUA 1VSVA 1EXNA 2F1KA 2X41A 2P7IA 4IIYA 4M60A 5IH7A 1CEXA 2EYUA 4DARA 1QYXA 4IX1A 1T9KA 3ORQA 3PDCA 2Y0PA 3E23A 2J6HA 3KT3A 4B40A 2XE4A 4XWWA 1RAGA 1Z68A 4IZOA 3N2YA 1BKYA 4M7WA 2ZIWB 4L7QA 3RKSA 3ZE9A 1NG1A 4EHDA 5IDXA 3PC4A 5FOVA 2ZIAA 3UJPA 4LGMA 3PA6A 1VLVA 3JQAB 4JBXA 4P58A 4Z7OB 1A4IA 1FUUA 1X9GA 4QU5A 3GFVA 3QKWA 2VTBA 2DMRA 1Q1BA 3EGWA 1YZUA 3EXIA 1CZUA 2DY1A 1BCRA 1YUNA 1JQBA 1YE3A 2XUGA 4QECA 4R9NA 4XIFA 4BECA 4LFCB 1KHTA 2Z95A 1WQ1R 1J6UA 1O03A 4BB9A 3IKMB 3SQXA 4ESHA 5FPQA 2Q6OA 4U6NA 1KAQA 2HQOA 2HCRA 3BMOB 3C7DB 3BPSA 2R7KA 3FY4A 4KQIA 1REQA 2XDYA 2WJIA 1SCUB 3I64A 4LDPA 4R16A 2XAUA 1HZJA 2V65A 4TLBA 3UV3A 4GXNA 1DBPA 3C3BA 5AW9A 2EATA 3HZRA 5K3FA 4F3YA 3P0FA 5FV7A 3RWOA 2O6HA 3IA7A 1NF3A 5F2KA 3KM0A 1QFMA 3ZTYA 2FZEA 4OVKA 2YOFA 1YS7A 4I99A 2NUAB 1DDIA 1V2HE 2GGSA 1BA3A 2V98A 1NLFA 2BGIA 3QEMA 2YJ4A 3HBAA 3MS7A 4AN0A 1VL6A 1AQUA 5ITZA 3E5RA 5KU7A 3EASA 4JH0A 1ZXLA 3NIGB 4FGUA 4MAFA 5GGXA 1GO2A 1WDTA 5A0TA 4ZO4A 1L5WA 1T1RA 1JU4A 1ZD8A 1TRHA 4M1YA 4IQ4A 4AY3A 1RRMA 1T3SA 4HYYA 4LSZA 4CIVA 2R00C 4MCAA 5JARA 2ORIA 4B33A 4CMIA 4MXDA 2VNJA 2EFHB 4P4SA 1FXWA 3NM4A 3UCXA 3HXQA 4JLKA 1PR0A 4IXNA 4N49A 1YV9A 4H3HB 1GNQA 2IJGX 5HIKA 5KJ1A 3KB1A 3P2OA 1WB4A 3I1IA 2AI2A 1UZLA 1HT2E 3NC1C 1GQ2A 2IUEA 4EDHA 2XB6A 4UOEA 1Y9AA 3IO5A 3FOCA 1J5XA 5CVDA 4JKOA 1Z4LA 4YJKA 1MEJA 1AGPA 1T8YA 3DYIA 4ZAZA 3HJCA 3VDQA 2GK3A 5EFZA 3IJPA 4X94A 5DMHA 2JVJA 3OCWA 1GTJ1 3NHKA 3CU5A 3VU1A 4ZOCA 4OOEA 4BQPA 4CT0A 4POOA 2FMTA 1W5BA 2PH5A 4RTLA 1OZAA 3HZOA 2I76A 4Q3DA 3RGGA 4KOEC 2BELA 2VWGA 3TKLA 1H42A 1SCNE 1F5NA 3LVQE 4FR2A 3OEYA 4ZTBA 3MFQA 1JQAA 2YJGA 4QTZA 1YZFA 3OFND 2DSTA 4CKCB 1NYLA 4FK8A 1OR8A 4DS3A 4DDUA 2RGRA 3HGTA 1W96A 1ZMXA 1FDRA 2J4DA 3C5WP 2HEIA 2WSIA 5F51A 5LZ9A 4RULA 2R1TB 4Q03A 3QE2A 4RFSA 4LPSA 2NZXA 4KE7A 5LXTA 5E6UA 3AW8A 5H16A 2Q3LA 1TM4E 4UOQA 3IYLW 2N1BA 5DYGA 2ZIZA 4E08A 3DKVA 1TE2A 2PO5A 4WFQA 6REQA 3TVDA 3JQ7B 2ZAIA 1N2CA 2P8SA 5E2IA 1XPOA 4MAAA 1H8ED 1YQQA 3MWYW 2DH6A 4C3UA 3THXB 1JEOA 1ZJ6A 3B1KA 4X91A 3A6EA 4AQDA 1SA0A 3GQBA 4FDLA 4CQMD 1GN8A 2VT7A 4HNRA 1CBUA 3C43A 3HB7A 4NV0A 5ELLA 5AW0A 4COOA 5JXHA 5CT5A 2JH9A 3IBFA 3U4IA 3O4RA 4MPTA 4P53A 2JANA 1RKBA 1QK5A 4TKVB 1K6IA 5K3BA 3HADA 2ERXA 2BMEA 1K06A 4JLOA 4IFTA 1Y6FA 2O8DA 1HQCA 3MG9A 3Q7EA 1QV6A 2WIFA 3SSNA 1II9A 1Z4IA 2W98A 1VLHA 4RHEA 3M4JA 5CLQA 4LAFA 1U0TA 4KXFB 1P6XA 4NJMA 3WJ2A 1Q3TA 4YP6A 2ODPA 4XX0B 4G0NA 3R7FA 1V1MA 2HUPA 4ZXPA 3ZKWB 4X84A 1KMHA 1GGJA 1G8KA 4P7FA 1YCFA 3EIOA 4U2DA 2G9RA 4QEDA 5JJKA 1HDGO 3F47A 2LCQA 1X38A 5BORA 2IXEA 1GKLA 1U6KA 2C9CA 1ZNYA 4NOLA 3GVXA 1JLLA 3R7WA 2BIFA 4U02A 3WWDA 1Z7GA 3I2IA 4ES6A 4ZHQB 2CSUA 4PS0A 1R0CA 2HGSA 5FRDA 3H2YA 4WLOA 2R60A 4D0LB 2H1LA 3O84A 4IJKA 1N0VC 4R1OA 3RD5A 1U0SY 3VMFA 5JI3E 1K6XA 4LRUA 2DTEA 2O20A 5FUVA 2JFXA 3ZHQA 3A11A 2VEOA 3I58A 6YASA 1ZGGA 3MQ4A 1OIXA 3EYAA 1LBQA 4HLUC 4B6JA 2R5FA 3T5MA 5I8PA 4P86A 4GP9A 4DLRA 5L7WA 4P3YA 1E2FA 2OXIA 4DUGA 1DKPA 1JMYA 5EIWA 4FLEA 2GMWA 3ZCTA 1VBFA 4LOAA 4TTRA 3IKTA 1E6KA 4C87A 1GA6A 2AJ8A 3HFSA 4H18A 4E1BA 3CPJB 3KEGA 4PSUA 1XZKA 2NAFA 4HDAA 2C3MA 3EZGA 3UUGA 5JEDA 1S8FA 1YGPA 4G37A 4ZC1A 4MB2A 4L95C 2AN1A 4LF8B 2J3QA 1T0PA 3ILVA 1U2RA 2MT9A 2PPLA 1H6BA 2OCAA 1CZNA 3HJBA 4DIEA 2GDJA 3PSHA 4MUEA 3D4PA 3EODA 5A9SA 1PDOA 5GIPE 2VPYA 4RLSA 3FWPA 4UBLA 1W4CA 1QV7A 2B92A 3ABSB 3T3GA 1CUZA 3GOHA 3W1EA 3U9SA 4UMVA 4F11A 2FFAA 5EOVA 3TSOA 2FKAA 2I29A 3EXAA 4PQGA 3A2NA 4IRMA 4Q48A 1EGQA 1JKIA 1P2TA 1TMOA 5DX0A 1N6LA 2ODAA 5IP5A 4XVUA 1IU9A 1QIKA 3H87A 1C9DB 4RV4A 4LHSA 1MA3A 4NCIA 5IFKA 5A05A 2NO9A 2X1LA 4I1RA 4IY1A 2QKYA 2VBIA 4WDRA 3DXFA 1UBSB 1P7VA 3L43A 3S6JA 4TRNA 2VS1A 5AJTA 3GCZA 3HJUA 3TSWA 3FFTA 4GUAA 4L4SA 3NJ4A 4N0MA 4LDNA 5FTMA 2OTCA 5REQA 4DCPA 1DEXA 1ZJJA 2P90A 3D6UA 2BH9A 2Z8XA 3PGXA 4FMPA 2HT6A 2PUTA 1AM4D 3WAJA 1XEFA 1JLMA 2FN7A 2VA9A 2YZ2A 3JATA 3QBJA 1ABBA 4H6XA 1UAAA 4PGFA 2IZZA 4JBWA 5F3RA 2ZRJA 4RZXA 1DWQA 4AJHA 2Z2YA 3BSSA 2DAPA 2X19A 2GBPA 1BFKA 2B8JA 3R6WA 4V0LA 1SWWA 1JSCA 1W0KA 3K0CA 3GN1A 2FWAA 2V9PA 1OQAA 1DBQA 3BFKA 1JDTA 3K0AA 3SZLA 2ZJOA 5H4GA 1D07A 3OCZA 2AG6A 3BZBA 3A31A 5IAEA 1EVKA 3D8RA 4I66A 5FB3A 1UEXC 4G2TA 3AF1A 1UPAA 3OX3A 4UPVA 4PSDA 2ZI6A 3WLNA 2XUQA 3F5SA 3JVUA 4S05A 3FXAA 2CHGA 3NORA 3TJRA 3WAGA 1YIAA 1VCIA 2BKXA 3AR8A 4PYOA 1P19A 3FDZA 4FUTA 2NU7A 2W70A 3P71T 4ZCRA 2JI4A 1CX9B 2I6SA 1PTKA 1ZNQO 4O2BA 3TZLA 3VPHA 1W36D 2GA9A 1GNSA 3MLAA 2CB0A 1VHJA 2GA8A 1BN6A 2RBGA 1Q0HA 4M0KA 1M2EA 2HMSA 4CDGA 4WERA 4KU4A 1KI6B 1ADYA 1E1CA 3N86A 1R5NA 1A0OA 4H1WA 3QVLA 5EJ8A 5JJLA 5JZ9A 5LWQA 1V0JA 2DLNA 4Q82A 2DFDA 3AG6A 2RONA 1WXXA 5BVHA 2W5UA 3T1NA 2PWZA 2GAAA 1GZ7A 3JAMA 2VUHB 2X0DA 2ECOA 4G1CA 3EIQA 3WS7A 1H05A 3CVYA 5AJYA 1HUQA 1L3BA 3ZDEA 1PEYA 5ADUS 5AD1A 5IUJC 3WYCA 2O8EA 4G09A 5KHLB 2O54A 1OXMA 5LZ2A 4M98A 4X71A 2G40A 1PAUA 2X4GA 2G9NA 4BO6A 3GLIB 2Q50A 1JBKA 1L5ZA 1EDOA 4RDCA 4XPIB 2RGNC 3CLRD 4PQYA 3DMTA 1BW9A 1Z4PX 4RENA 4LX8A 1NC1A 3B52X 3DBRB 3DFKA 3MF4A 1L1FA 3MTGA 1F7VA 1M76A 1PJ4A 2RAVA 3QQPA 3TDNA 2IEGA 3V34A 3U3KA 3ZDAA 4MA4A 3HB1A 2WD9A 1IZ0A 4QPPA 5KYVA 1ZD3A 1P0PA 3TGWA 4RDXA 1B6RA 1FS5A 5K6AA 3CLSC 5LQRA 3SVLA 3DBOB 1GPLA 2AG8A 2KMLA 4PR0A 5DNYB 1N8KA 2FUG1 1IOWA 5AI9A 1IY1A 1D6NA 1OVMA 5IJXA 2Z2XA 3BMCA 3IUSA 1I80A 3KP1A 2IIPA 2ZBQA 5DGIA 4ZK6A 4Y1GA 1DAMA 2JFBA 5AESA 4Y6SA 2LZ0A 5JUWA 1SXPA 3DAFA 1HF3A 1JU3A 3BL6A 3GEPA 4KFRA 1EFCA 4WOBA 3ZS8A 3EZ7A 3M4YA 1IN6A 1B4DA 2A35A 3I32A 1EINA 3OE7A 2NUTB 3DAGA 2FZWA 3U61B 2IYFA 4JB2A 1A9OA 2Y1FA 3CH7A 4LV5B 2HQ1A 2MTBA 1ESNA 2FFHA 3AESB 1XTPA 1EVQA 1G20B 2G7ZA 1KY3A 2G08A 3DBVO 3QBVA 5HKLA 5LMZA 1XQWA 3W2EA 3IAEA 3RS3A 1G3QA 3CLUD 1GLVA 5FUWA 1XQ1A 3DHVA 4IDHA 5B1SA 4DDHA 5BURA 4OHBA 5I8WA 3I9FA 4X61A 1EQAA 4ZQHA 2BMAA 3DZBA 5MN5A 1CETA 1T9AA 1XJCA 5ESWA 4LDQA 3BK2A 3MTEA 3ZK8A 1P31A 3BG5A 1GUYA 3TZKA 1KY2A 5IBRA 5IT0A 1ODFA 1LQUA 2BDTA 2CHUA 3TBHA 3ZJYA 4HRYA 2NSHA 2DY0A 4ZDWA 1XCOA 2DQ4A 1Y7LA 3PQ8A 4BVJA 5DBHX 3N0WA 1IBLB 2G36A 3ND9A 1G7CA 3GFTA 4QUGA 3X0DA 3U5ZB 2LIVA 3NOVA 4PX9A 4E1VA 3FMIA 3T06B 2F1OA 1CLEA 4YC7A 2FSFA 4MWZA 5AKKA 4BPBA 1WX1A 2IQ5A 1NJ8A 4DIFA 4IICA 4AO8A 5HXAA 2D5AA 2EU8A 4GQIA 4DANA 1L7VC 1U04A 3L7JA 4RU1A 3IEMA 2WUVA 3NHJA 2NO4A 5HG0A 1JHZA 2Z30A 1MEOA 2IY7A 1FMFA 4WGFA 3KSUA 1O57A 2FGKA 5IYZF 1WDMA 1IQ0A 3G0BA 4QT0A 4GZ5A 1J21A 4B83A 3ET4A 1FA9A 2YH2A 4NFLA 4CODB 5JMTA 3D7SA 1EJ6A 1V47A 2C29D 1W9MA 2W0MA 2YCBA 3P9SA 4WAUA 2C7GA 3KQQA 1FPMA 2HJ9A 1CY1A 3O0TA 1O8CA 4RPCA 3C41J 4F8JA 2P5SA 3E61A 3AUSA 5IJAA 3R8FA 2GF2A 3QF7A 4Q3AA 4TMFA 3UGQA 1H22A 4O4IB 2CJWB 3MCVA 5E0KB 3UAWA 2P0EA 4I4LA 4AXXA 4IR7A 4Z0PA 4LRWA 2HEGA 4R2IA 1NOJA 4JOSA 1CV2A 4HDKA 3WWOA 2PH1A 4MDFA 4YUAA 1SQ5A 3QX3A 4WXHA 4E4RA 4WFJA 3RVOA 4OL0A 2ZT5A 5DASA 1AKNA 1CULC 3U17A 1R6AA 3X3HA 1ZR2A 3AR3A 5DN9A 1RM3A 3GRUA 1LBIA 1NM5C 4AC9A 4GI1A 4JNKA 4BMZA 2ZYSA 3CCFA 4OI4A 4US2R 3OX4A 1A8UA 1P6QA 3KAQA 2XYGA 2COUA 3ZXYA 3F4KA 4RK4A 4CIXA 4CL2A 3B51X 5FDFA 5BWBA 2IZ0A 4MVJH 1H4QA 1GFIA 2GK6A 2J3HA 3E1KA 4JJFA 3UFXB 3U81A 5CNKA 2Z5LA 4G0YA 3KIPA 3L9XA 1M34A 2XYPA 1O95C 5FD8A 1UWLA 4OUDA 4WSOA 2XGJA 4JI6B 5JPIA 2MWMA 2Q9CA 4X1KB 2B25A 3VR4H 1DT3A 2BFNA 3NHPA 1DXYA 1GZ4A 5EIFA 2NZYA 2L0XA 2CF6A 2FPIA 3BEOA 1AF4A 4DUGD 5KWEA 3HK2A 2YJTD 2P4SA 1QGAA 3C3AA 3RE1A 1QH1A 4FFDA 4N82A 4UM5A 3DDSA 2YINC 4KMMA 2VT6A 4TUYA 3OZDA 4ZEOA 2PWBA 3D4BA 1KEEB 1BE0A 3L8EA 4LDJA 4RQBA 4B6QA 5H7XA 2V55B 4LYYA 2DPYA 4PLFA 3SE7A 1L5OA 2WJGA 4D4MA 3SJBA 2FE4A 4AF8A 4ETWA 5BO5A 3VKGA 1FYFA 4EYKA 1ZMTA 2D06A 4LYAA 1QGDA 3P9QA 4ZO6A 4W1SA 2X0NA 3TWOA 3AVXA 1G17A 4B3GA 1BXZA 1SUWA 2FPPB 4K46A 4UNNA 4XIYA 4D56A 2IPOA 2ZYWX 2IXGA 3USZA 2Q46A 2PUFA 1Y34E 3ODPA 2YXPX 3HDGA 1Z35A 2GYUA 3A9UA 4IDOA 1F7UA 3HI6A 1N1EA 1KP2A 3MA0A 5EMJA 1FXWF 1JV2B 2UVPA 3O1IC 4Y98A 4I4TB 3INRA 4DADA 4CQLB 1TJPB 1AURA 1PGNA 1YK0A 2P9QA 3DHNA 4FGKA 3V1NA 5KSZA 3H6GA 3N28A 3W04A 4DPKA 5F33A 1KYQA 2QRVB 3L6BA 2QU7A 1I0ZA 5HFAA 3K9HA 3UN1A 3HLYA 5FBRB 3CRMA 1T5OA 1P3DA 4RD1A 4ERXA 4JC0A 1C1YA 4P33A 2HH9A 3V1UA 3ZX4A 1O7JA 3G9UA 3N2LA 4KWTA 4JJEA 1H2AS 1II8A 2VQSA 1NY6A 3EVBA 4G5YA 4MVYA 4Y3UA 1NDQA 1GP2A 1X8LA 1X9IA 5G53C 4DZTA 4WOPA 2CLCX 5KSYA 5KTRA 2BSAA 5A4JA 1II0A 2AVNA 4KR7A 1X0XA 1F38A 4GOXA 4R2KA 3OQVA 4Q1BA 1K5GA 2EDCA 2XITA 2J08A 3VC1A 3EEOA 2OYSA 3DP7A 4LRTB 3WKAA 2N3ZA 3K5IA 4B6PA 5F21A 4QNNA 3MWFA 4XFKA 2HW8A 3BJRA 3OZSA 3EPHA 1G3RA 5IAAA 1T6YA 2W11A 2GAFA 2GJKA 2NG1A 1DIHA 5DNAA 2W42A 1MIOB 3HKBB 4OFWA 4MLZA 4QO8A 5A4AA 1KBQA 2FPMA 1BHSA 3DTYA 4M9RA 3O92A 4JLVA 1C50A 5IMBA 5IVIA 2QW1A 3N2EA 1UC4B 3R3VA 1VHTA 2W22A 2ZBVA 3LL7A 1GCIA 4GS5A 4MYSA 2Z2ZA 4RESA 2NVUB 3L8CA 3VR6A 1U8AA 3U7RA 1XD9A 4L2IB 4EVIA 3RTBA 4KITB 3HY4A 4MP8A 2VJLA 1XMSA 1BDMA 2WPNA 2K7ZA 3AR9A 4R68A 3SI7A 2OFPA 1SOWA 3UY4A 1T6ZA 2E4XA 2H2AA 4KNWA 4Z1MA 1CT9A 2CBXA 3P0HA 3RNOA 2O3SA 3NTUA 4PXYA 1HORA 4LE2A 3ZIAA 1M0SA 4MJ7A 2PIAA 1GEEA 1KAEA 1NATA 4Q16A 1G7TA 1J9EA 4G5FA 1FTNA 1OI3A 1MC8A 1GRCA 1P1JA 4LXQA 5G1NA 5K1ZA 4BJ3A 5TQJA 3PXUA 4B3HA 3KU1A 3EVNA 5E1MA 3ASZA 5FI1B 1HQDA 4MLCA 5ESDA 1G63A 1U3GA 3EGIA 2YFYA 3GLVA 4KQ1A 5EHZA 3SOZA 4CXMA 5GADl 1C2YA 1E3EA 3UMMA 1QG4A 1UFRA 3NONA 2C9YA 1WB6A 3NG1A 1O97D 1Z37A 2VAVA 2XCQA 1BTOA 4LRSB 3R5FA 1DRUA 4GD3Q 1W2WB 4OHPA 1QO9A 2JF0A 3C8MA 2JLCA 1SC4A 4U2FA 4KGDA 1E1RA 1LRLA 3WGMA 1Y1LA 3JCZA 4AB1A 4HMPA 4AJIA 1P2VA 2QQGA 2VXOA 3CZMA 4I5EA 3T99A 5C52B 2H08A 3HHPA 4UUNA 4WV3A 1YHNA 1XCPA 4QFCA 3SFTA 1E94E 1DAEA 2I7DA 1MCZA 1YB7A 2QLFA 4ZOLA 1DXQA 1SEPA 1T5IA 2BKEA 2J5RA 2WKRA 1FP4B 1TIBA 2YN2A 7YASA 2FPRA 3ESDA 3IJEB 3QVGA 3TQIA 4OD0A 1C4OA 1X7YA 4GHWA 2Q6IA 2IZ5A 1G42A 2YUIA 1CR1A 3DEIA 4J7UA 1UC9A 1HLPA 3J7TA 1J70A 1RXYA 4P9NA 3VSEA 4HJXA 5B7GA 2A9VA 4P0PB 3GU3A 2UYYA 4MGZR 1UOPA 4HVCA 3MWKA 3ZJ4A 1W0JA 2HYDA 1O87A 1L7NA 1M75A 1PYDA 3OE7D 2HA0A 3ZDXB 2B21A 2DFLA 4N3GA 1TQ8A 2UXCB 2NNWB 1Z12A 4RTJA 1QYCA 2HIAA 2NZ8A 1VYUA 2QXYA 1BMQA 4WNIA 3U39A 1QOPB 2CCGA 2HJRA 4CHTA 3EG5A 4B2IA 3OBIA 1C7QA 1PFUA 4JB3A 3W2HA 2EDAA 4US1R 1X7WB 1YZHA 3S2SA 5C5IA 2JB9A 4REMA 1XTZA 1Z6ZA 1QAOA 3IDQA 4L4ZA 2W37A 4MA5A 3M89A 3KUCA 1TYDE 4NLLA 4EUSA 5M7EA 1UXKA 1EIWA 2E85A 5B36A 3I9V1 5KYYB 4JP5A 3WK7A 5ALVA 1GDTA 2QVZX 4K9SA 4LMRA 2UUPA 3P5SA 1YL6A 2ZVQX 4N6NA 1WTCA 4Z51A 1WVMA 2EFJA 1XJ5A 3H2SA 3UG7A 3CKKA 1NY5A 3L05A 4TXMA 1GUFA 4BE4A 1H2EA 2VHWA 4LZWA 4HLQB 5A3SA 4MRPA 1XQXA 4XEHA 1CUGA 1QRRA 3ILSA 3O4GA 2DULA 3PKIA 4WOKA 1ISIA 3C5EA 3NGMA 1MXHA 2YIVX 3KTAB 5EVJA 3O4HA 4QARA 1K7EB 4NP6A 4RV5A 3TZEA 1KWGA 1ZI8A 5IAJA 4FQ5A 4GSYA 2BBWA 3L6OO 2JH8A 3L7IA 1T3ZA 4L0DA 1U0LA 2GO7A 5JYEA 4QRDA 4K8RB 5LQMA 1Q20A 1HL3A 1XZAA 1L7OA 1QZZA 2ZP1A 4LZJA 3TRJA 1AXEA 2ZKIA 5K3SA 1AS0A 2IXDA 4CU5A 1JJAA 3TE7A 3ADKA 2FLWA 1WHTA 2EJWA 3G49A 3OM0A 4HDMA 5NLLA 2H5LA 4TZ6A 4PLTA 4G1EB 4OHKA 4MPPA 3GP3A 4W8OA 1OB5A 2ORWA 1E6EA 2QTMA 1ML4A 3K96A 2VSXA 3PLRA 4YREA 2QI9F 5K0JA 3WJ1A 2VCHA 1LEHA 2C4VA 3W6ZA 4XLTA 2XTNA 5AK5A 3TSYA 3SVZA 1UWCA 1RHQA 4JUIA 1XFAA 1AK2A 2JIDA 5AI0A 4HZUB 3KRTA 3GPLA 2ZUTA 3D31A 1GGEA 1R64A 3FWYA 2VJYA 3IERA 1U5BA 4O2BF 2MYTA 2WVJA 1Q1NA 5EL0A 4IWXA 4KE8A 1MAWA 4FC7A 3C3MA 4TV8A 3ZG6A 2F3RA 2VATA 3CNEA 5E9QA 3UAVA 2W2TA 3VH2A 3VA7A 2WR8A 2J1LA 1TT5B 1UAGA 3HUTA 4YH1A 2OAQ1 3ZPXA 4AMYA 2DFKB 4DRZA 1WXQA 1UDAA 5U4XA 2ZB3A 4E2YA 3SCZA 5EIEA 2P62A 1ZM9A 2GD0A 4DIKA 2M32A 3PNKA 3AM5A 3EN0A 5KUTA 3D3NA 5KOHB 3CO5A 5AUPB 2ISCA 4NAUA 3Q10A 2MMGA 1ZCBA 3AZPA 3KHSA 1L4FA 1GPYA 3ND7A 3OU6A 4D0GA 1ULTA 4Z7QB 1DWUA 4QRHA 2VQ3A 2O1XA 1YJAA 4JLUA 1U9JA 1J0CA 1T10A 5K4HA 2FEAA 3ELUA 1X1RA 3L1VA 3GRYA 3OO0A 3TR6A 5E8JA 2JAXA 1G64A 1ZBDA 3DCJA 4NPCA 1WUIS 4J8PA 2ZIEA 4I50B 1BEZA 4L9RA 2DTXA 3AVOA 1NJ1A 1SWVA 2DJ5A 2E48A 2P40A 3EOBI 4LNAA 4CEIA 2PUAA 1Q3KA 1NZDA 3OHMA 2HLDA 1OE0A 5ARCA 1XPUA 1OU0A 1TM1E 3AQ4A 3C2QA 5EWMA 3NU1A 4A91A 1Z33A 1XB2A 1DMSA 3INYA 1WMAA 4K6GA 5E9JA 1XL1A 1Z25A 4DEVA 1UPCA 1YDHA 3BM5A 3KDPA 3QX8A 2O7SA 4RIEA 4DJEC 3LBNA 1E59A 3V8VA 1AVTA 3FKQA 4INJA 4NHOA 5LC1A 1IAQA 5CCDA 5JSHA 1N92A 4IOKA 1EDBA 2V4ZA 3QXSA 3CWCA 2CLKB 3MLEA 5EWJB 1P3Y1 1CXZA 2FPWA 3QW2A 2X8JB 1A5AB 5CHYA 2JGLA 1PGJA 4NBLA 4AP6A 4N76A 3QJGA 1CJSA 2Q8PA 2WMNB 3OHSX 2OWEA 1NX9A 4IFBA 3VU9B 5CCBA 1XTRA 2AMFA 3BFJA 4ZC8A 1V5FA 1Q77A 3D59A 2AFHE 2NO0A 2PFSA 2HFJA 2ZB2A 4MITA 2NU8A 3ZNNA 1T1IA 2I7TA 1VSQA 5DYIA 2ZB8A 2ZSIA 3DVAA 4A6DA 3KUUA 3SEFA 5AUOB 2W48A 1U7UA 2G1KA 5AVZA 5TS2A 3NH9A 3O38A 3T95A 1PJ3A 1PZNA 1XVAA 4NJOA 4O8CA 4DR4B 4RKRA 3LIPA 3LK7A 4CRWB 1CLUA 2VEDA 3QFRA 4LJYA 3EEFA 3FVVA 3Q5DA 3DV0A 1JJ7A 3E58A 4LRQA 3CWQA 2G9QA 5F1PA 2FWBA 3K8QA 3KCQA 5EMKA 1E0DA 3DKIA 1H6DA 1WF3A 4BNZA 4DV1B 1EJ2A 4HHEA 3IIKA 3FVWA 1Z0DA 3ENZA 3VYWA 2GERA 4QQ8A 5AKYA 4MJ3A 2FE1A 1RLMA 1KI3A 1CD5A 3L1HA 1Z75A 4OXXA 3W05A 4B47A 3SQLA 4FB5A 2O8VA 1OSNA 3NEJA 4MVXA 4BNIA 1T1GA 2IYPA 1NW6A 1QPBA 3JYQA 5CPBA 1WXIA 3FN4A 2XMZA 3F90A 4D6PA 3HN7A 1YZVA 4V02A 3CPSA 4G1UC 3KEOA 4AMZA 4DIDA 2RBEA 1Z8FA 2Q3FA 1ZH4A 1LLCA 4C88A 4JVNA 1WLSA 1RYEA 2EX0A 4UHEA 3DTVB 3VR6D 2JFOA 3QEJA 4BQIA 2Q0SA 4N54A 1E4OA 2IX9A 4KBFA 5B1IA 1OH8A 3W3AD 2FQXA 4OP3A 4GNKA 1V16A 1C8BA 3ZIAD 2FPUA 3IALA 2DGDA 4J4BA 3IO3A 2JH3A 2JCVA 1ZK3A 3CUTA 4QBHA 2PJUA 3TE6A 2JC3A 1R16A 3ME5A 4UARA 1RZVA 3B53X 3GVPA 3V42A 1S96A 5DF1A 5E3IA 1IZ8A 1HE3A 2QAGA 2QT1A 4JVMA 1XRPA 3V8RA 1RKUA 2R68A 1C3VA 4MUIA 5CM9C 3FOEC 3HNOA 1GL9B 1QHSA 3ACDA 4DLVA 5KNCH 1SBZA 3GVCA 3RLFA 3D7MA 2FVYA 3PDIB 4GX0A 1SXIA 5JI2E 4RS3A 3TTXA 3D3EA 3M3DA 1L5YA 3R3YA 2AQKA 1IY8A 1GZ3A 2IEZA 3D6JA 3DE6X 1C3OB 1W5AA 1MQSA 5JD5A 3CNHA 1UKAA 3Q98A 3FE2A 4IYRA 1RU3A 1DDGA 1E1RD 4JCOA 3IEKA 3THWA 3GBPA 4NF2A 4KHPB 2IA5A 1DZIA 4O0LA 3OWOA 1HYGA 1SHTX 3AHGA 3KOYA 5HF9A 5ECDA 3WNZA 5IHPA 3JQBA 3W5BA 1MV5A 1EB9A 2QV0A 4AZ0B 1RWVA 3KK0A 3K2QA 4NCAA 1LF5A 1X1BA 3CNBA 5AP9A 5CLFA 3F67A 1APBA 1CQPA 1JA1A 3OC0A 4XUEA 4CKWA 2G9ZA 1CEYA 5BUSA 3GT7A 5JT1A 3JTEA 3VYSB 3I4CA 3ZJ5A 3WLPA 4RL6A 5AUNB 1BD4A 5JCPA 2HSEA 4N5LA 1EUQA 4YMGA 1C5KA 3I3SR 1T0HB 4TUYF 2IHVA 4OMUA 3R9WA 3WSWA 2QZZA 4DKXA 3BDIA 3OY7A 1WJGA 1BD3A 3K35A 2ZULA 5F5NA 2A4KA 3RYIB 4ZYZA 3O9ZA 4DV5B 4FYXA 4KE6A 3DGFC 2OFFA 1XDWA 1QZ3A 1TNDA 1VIMA 2FSPA 1D6SA 1XUOA 4EFKA 1L8XA 1POXA 2C2YA 2FUKA 2IPAB 4NCHA 3IBGA 1M54A 3WYGA 4UUOA 2VDWB 4RVUA 1J1ZA 4DL9A 3OCYA 5I9BA 5C46F 5CB0A 2QJRA 3NKVA 5EKSA 3BGIA 5FOUA 3GMIA 4HI0E 4UVGA 4EFMA 2ZJ2A 3WHKA 4CDNA 2ZTUA 3KOMA 4AVYA 3F6EX 1SXQA 1JHVA 1SJ9A 3VHXB 3ILHA 4KDCA 5DVZA 3N6VA 3TJMA 4YV7A 4H15A 2GNPA 3AERA 5CX1B 5IM5A 3EZ9A 1QGYA 2R66A 4YQZA 1UPXA 2I6XA 2O5RA 3BH7A 2HU8A 4NVRA 3UGJA 2ERCA 1G6OA 5J5AA 3DDWA 5YASA 1ZOOA 3V1LA 3AZQA 3PI7A 1M2VB 3DLIA 3F6RA 1GG5A 3GZ4A 3VHRA 5KQRA 4EA9A 3EZLA 1OXTA 2A1UA 3ZDCA 1D4OA 2VLBA 1ZD9A 4HDNB 4H2DA 3MUEA 3WIUA 1UIRA 2HCFA 4H3VA 3SC2A 2RGXA 5LB4A 4BIIA 4PN3A 3KYJB 2N9UA 3HWWA 4PLYA 1EWVA 3U9LA 1XCMA 4F45A 3OWHA 4I5IA 1PCXA 3AHHA 2RB4A 2ESRA 3AL3A 1BX3A 3FMVA 2QTTA 2YZMA 5BYBA 3JD2A 4I19A 4IV8A 3FUTA 2VHUA 4ZZ3A 3QU4A 4RA9A 2YVLA 4JYAB 3ESQA 1TFRA 4OF4A 5LJIA 4MB0A 3HN2A 3IPRA 4L6IA 1C0PA 3PF8A 5CVUA 1IK6A 1XNHA 4G0QA 4YP1A 2FPLA 3R76A 1R8QA 4GX5A 4M89A 3RPEA 5KC9A 3H3FA 3O9MA 4J0KA 4JY7A 4QFMA 2HU7A 3WGTA 4JJKA 2FB9A 2ZITA 1KQOA 2EKPA 2O2EA 4B3FX 1KZHA 4DV4B 1WMEA 3PG5A 1C2TA 3ED5A 1V6CA 2CXPA 2HIHA 1JDZA 1RXVA 1TZKA 4LN1A 4A8HA 4DC9A 5C8VA 5KQPA 2ZREA 4M55A 3RTDA 4UAVA 3IP1A 3AEQB 1L5MA 3I01A 4ZVUA 1VB5A 3V8QA 2AR0A 4W9NA 4E2ZA 5ECYA 3VAAA 4PG5A 1UPFA 3NBAA 4URYR 3RS4A 1B8OA 4C7KA 3I6MA 2XZOA 5DP2A 3OTWA 1EFKA 4J29A 4MWSA 3UATA 2KJQA 3B60A 3BXFA 3FZEA 1Q2UA 1FSGA 3KEMA 3M6IA 3F1KA 3O3OB 4IJ6A 1NBEA 4RY9A 5CIWA 3SYTA 3ZU4A 1W5SA 3GGPA 1P9OA 3O26A 4PWZA 4TTIA 4RBNA 2HK6A 1JU9A 1I10A 1PQUA 2AMJA 2UZ0A 3DAYA 1R8SA 4I8DA 5H82A 3PXBA 4X9XA 2EJBA 2ODWA 1NZJA 3IC5A 3NIDB 3AJ9A 4M7PA 1DO2A 3K9WA 4L4YA 4RANA 4R71A 3TD2A 1A7KA 4F3RA 2QD5A 1L5GB 1EVLA 1TCBA 2BI8A 4C4ZA 3SGLA 3T5BA 4YBZA 2GJ9A 2PJZA 3PGKA 4G5RA 3AU8A 5FWDA 5I9NA 2YVQA 1VE7A 3FDJA 1S7GA 2AV6A 4F6CA 7REQA 4BVGA 1EFPB 3E7XA 4WK4B 3TD6A 1CUHA 1NMYA 1TCAA 1OFTA 4N8SA 1VSTA 4FYIA 5ED4A 1AZTA 1I3OA 3KDSE 1JFTA 2DLDA 4O25A 5I01A 1H5NA 1RKXA 1BJKA 4FM9A 3N2NA 2DG2A 2IYVA 2JZNA 2NT4A 3LUDA 4ZOLF 3ZQKA 4IWNA 3QUSA 4OQYA 1N1GA 5E3HA 2H6EA 3UW3A 4F2PA 1Y5NA 1KI4A 3H5WA 4NOMA 3Q8LA 4OATA 3ZCUA 1JEDA 1HDOA 1YU6A 1I36A 2XTJA 4DTIA 3GLFA 1WCXA 2P69A 2OUIA 4UTXA 1TAQA 1E96A 2WQ6A 1R0RE 4MGYR 3ZDDA 3FTQA 2JD2A 1WKBA 4TXHA 4L4RA 4DGQA 3ROGA 3G85A 3K70B 5FBQB 3H0KA 3D6FA 2C1XA 1AX9A 2PUJA 2BEWA 2EHJA 1OFVA 1SXJB 1NI4A 3D2AA 4X7BA 2X0FA 4BFVA 4HAWA 2WDZA 2OPHA 1I14A 4F3KA 2BFBA 2VPIA 1R15A 5BUQA 3LPCA 1UKVY 3LTEA 1PG2A 1A88A 2C3YA 1EEXB 4DE5A 2V7WA