1Q74A

The crystal structure of 1d-myo-inositol 2-acetamido-2-deoxy-alpha-d-glucopyranoside deacetylase (mshb)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
297
structure length
287
Chain Sequence
ETPRLLFVHAHPDDESLSNGATIAHYTSRGAQVHVVTCTLGEEGEVIGDRWAQLTADHADQLGGYRIGELTAALRALGVSAPIYLGGAGRWRDSGMARSQRRFVDADPRQTVGALVAIIRELRPHVVVTYDPNGGYGHPDHVHTHTVTTAAVAAAGVHPGDPWTVPKFYWTVLGLSALISGARALVPDDLRPEWVLPRADEIAFGYSDDGIDAVVEADEQARAAKVAALAAHATQVVVGPTGRAAALSNNLALPILADEHYVLAGGSAGARDERGWETDLLAGLGFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of 1-D-myo-Inositol 2-Acetamido-2-deoxy-alpha-D-glucopyranoside Deacetylase (MshB) from Mycobacterium tuberculosis Reveals a Zinc Hydrolase with a Lactate Dehydrogenase Fold.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside
total genus 101
structure length 287
sequence length 297
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.103: N-acetyl-1-D-myo-inositol-2-amino-2-deoxy-alpha-D-glucopyranoside
pdb deposition date 2003-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02585 PIG-L GlcNAc-PI de-N-acetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10320 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold LmbE-like 1q74A00
4XM1A 4XM2A 3WL4A 1Q7TA 3WL3A 3DFKA 5CGZA 5B2FA 3DFIA 1UANA 4XLZA 2XADA 5BMOA 1Q74A 2IXDA 5B2EA 4XM0A 2X9LA 3WE7A 4EWLA 3DFFA 3DFMA
chains in the Genus database with same CATH superfamily
2M6SA 2V3VA 3ZD9A 4YRMA 3QEMA 5KWIA 4ENRA 2AOTB 1DBPA 3B8EA 3LTNC 2WFAA 4RUKA 1N8SA 5LU8A 1ND6A 1KMHA 3SJBA 2D4AA 3ISVA 1CFZA 4XFJA 3VNAA 2W6ZA 2I67A 3A4NA 3O74A 2Z5GA 2IEGA 5A3SA 3D02A 4LNUA 5E6UA 4P54A 1ZIYA 3P97A 5GJWC 1V9LA 1A2KC 4ZVVA 3AF1A 4MZXA 2G07A 5L95A 3DMYA 5AW6A 4U0KA 3HB1A 3BCSA 1E3SA 1D2MA 1MPXA 3D2LA 5DP1A 3TYXA 2P41A 4LZJA 4QQKA 3T61A 4L27A 3JWPA 3O7MA 4JT9A 4ZI2A 3CRRA 1VBFA 1AMUA 3H2GA 1SU7A 3OIVA 3ZDYB 3KR1A 1E0JA 3L8YA 5FLEX 1XZQA 1RJ9B 5GTDA 2AX4A 1ELOA 1OYOA 2OFWA 4QDJA 5CA0B 4FGWA 2JI4A 1CUHA 2UZIR 3K5IA 3INGA 2A59A 2PS9A 2LIPA 1K8ZB 4I9FA 4E03A 5B4VA 4EY6A 2JFGA 1EFDN 4CEHB 4FDAA 4PPGA 3RYHA 4YO7A 5KQSA 4MB6A 1AG9A 4LN1A 4U2EA 3TGPA 3AM4A 1GPJA 1JJBA 1NU8A 3HCFA 4GX5A 2V0NA 4XE5A 1DOAA 3UFXB 2IYSA 3ICWA 4QHSA 5C1DA 5H9WA 2VJBA 1U7TA 2H1LA 1N5RA 4FGZA 5HJ7A 4BMCA 1SU8A 3FGOA 3O38A 2JIQA 2XT0A 1Z25A 4FBLA 1P17A 3RK4A 2GGSA 4Z7QB 1A9TA 4I1RA 2C2GA 4M0KA 4AU1A 3MUNA 2QUAA 1TVCA 3DMTC 4LSMA 4DPKA 2P9FA 3GPCA 4IDNA 4Y2YA 4B44A 1YSCA 3CUKA 3T0GA 3RSCA 5YASA 1AUPA 1MMFB 4FUQA 1CRPA 4ZCSA 4N3GA 4JP5A 2G76A 2JLUA 1X77A 1MTZA 1PNVA 2A4MA 4GMHA 4C5AA 4FNAA 5AUPB 4A0GA 5EJGA 3Q0EA 4OU4A 3TPCA 4C06A 1M2OA 2Q2NA 4GGPA 2UYOA 3UA3A 3FZYA 2FN3A 4OK6A 5BWBA 4Z3OA 1OLOA 3WYEA 3NWPA 2O3SA 4AKSA 2LV8A 1DBSA 5HGXA 1PRYA 1GIAA 1LV7A 1U3UA 3LPNA 2BGTA 2GZAA 1RKVA 1X15A 2VPIA 1IN4A 2ZPTX 2ZU6A 1N6RA 5I9LA 1M1YA 2I9PA 4U7DA 5A0TA 1SY7A 2AOVA 1Z0FA 2BIFA 4DSTA 3TIIA 3BCHA 1J49A 1K3FA 1QFSA 2P2SA 4XUCA 5GINE 3UMRA 4U2BA 2XUKA 2EX0A 3DV9A 3OLQA 1H42A 2CVZA 3D0KA 3IO3A 3QELB 4RY8A 4KQ6A 4LF7B 1MEOA 4JX9A 3ODPA 1RP7A 3ZLVA 1JDVA 1AXEA 3C7TA 1DIBA 4RK0A 4E30A 1CE8B 5KTTA 4CFSA 4IJKA 2C98A 2YN4A 4JI8B 3WYNA 4EEXA 1TT5B 3PF9A 5FX2A 4XYLA 1DUSA 1UFRA 2CLDX 3SC6A 3OO0A 1XNRB 1I32A 1XX6A 4ENSA 5JPCA 2XGGA 3LYUA 4FGKA 1ZW1A 1H4SA 4YI5A 2COEA 2OPBA 2EW8A 2YOGA 2R1ZA 1VRWA 3S3TA 1ILEA 2RE8A 1SZJG 2GVDC 4JS0A 4ZT7A 1KMMA 1RPZA 2PYDA 3CZCA 3KEQA 3CVYA 4WBXC 2EXXA 4RHEA 1YA6A 3W4IA 1IM5A 1Y3DE 2EBUA 2BZ0A 3F3SA 4J94A 1ETHA 2BFWA 1UP6A 2JIBA 1GEGA 1NW4A 4JR1A 4LYHA 5HOEA 1D6SA 1RI1A 3F74A 4XUDA 3WJAA 4QQRA 4DJFC 1B43A 1P8AA 4P58A 3BB4A 2OPHA 2VYQA 2BFBB 1AX9A 3OE5A 1ICIA 5E3JA 5SZHB 3WRWA 3PNQA 4D5GA 3D0QA 4WZBE 3LH5A 3ZCVA 3GA7A 4O4JA 4C0JA 3ZYCA 1Q7TA 2P6NA 4JYCA 1U0EA 1X7GA 2IK8A 3KYIB 2J0EA 4ZCLA 4HUQA 4KFRA 4YP7A 3KSZO 5C8ZA 3I6QA 2PE5A 4Q1VA 4NG5A 4W8OA 4Q9HA 1BHSA 3ZTYA 4M6WB 4B7AA 3EBPA 2QN7A 2NMVA 2FOLA 1RMQA 4UCFA 5BYKA 2GN8A 1V4NA 2O4CA 1JS1X 3W5SA 2DCUA 2HK9A 2NYUA 3GGJA 3GUHA 3QSGA 4AZTA 4CZ2A 4C14A 1S4QA 4KOEC 4BNZA 2I1QA 1T5HX 2B3TA 3LOUA 4HC4A 1IPHA 4GKAA 4QUEA 2CCGA 3H65A 3K1JA 2ZSEA 4C3VA 2IPAB 2Q6VA 4HNAB 1YRYE 2WKPA 1FE8A 2VAMA 4URZR 4C4XA 3VZRA 5B64A 1JKMA 4FMBB 4R9VA 5JJBA 5K0CA 1WLYA 1JSZA 3B52X 3HY4A 1ITZA 2F1HA 4QHYA 5KWSA 3SNKA 4XFKA 2JJ1D 1SXGA 3TTXA 1YJ5A 4TV8B 2B8WA 3KG2A 2Q1UA 1ZXXA 2J4DA 2OMKA 3LP5A 3T3DA 2QUIA 3SHTA 4J29A 2FN8A 3PLAE 2UZ4A 3U44B 4GFDA 1QGYA 1E60A 2JCGA 3LQFA 2XWBF 1XKXA 4M49A 4J7CA 5A4DA 2ET6A 4URVR 3GT0A 3INTA 1OJ7A 3M1IA 1JLSA 3P27A 2IHVA 1Z5ZA 2HSDA 4B2LA 5LA6A 4WINA 2XPCA 3M8KA 4H3HB 3OCJA 3HG7A 2EKDA 3JQ8B 3P9QA 4GG1A 2ZUFA 4BFCA 1X0VA 4LNHA 2TS1A 2KJQA 3LLVA 5C80A 1PE0A 2NZJA 2YNMD 4NONA 4F4JA 1PVOA 2J7PD 2VXBA 2PWPA 2QTVA 1BS1A 1I80A 4M9RA 4A9AA 2GXAA 4BYMA 3HKEB 1QLHA 4J3JA 1O54A 4Z9AA 1ZEJA 2DSNA 4PC7A 2P4HX 3MW8A 2HMTA 4BMSA 1J0AA 2WWYA 1VGVA 2YHBA 4MA0A 5A7GA 3DDZX 4Z1MD 5JROA 2ODWA 1GU0A 1TZCA 1QGUA 1OD6A 2XWSA 2OHGA 1SBHA 1UFVA 1OREA 1XAGA 3H05A 3PTLA 2CUTA 4LKOA 3MFYA 1H8EA 2YKGA 2PGLA 2W37A 3OBBA 2GERA 4DMGA 3LY7A 3T1HB 4G1FA 2NWQA 1NNI1 2XGJA 4ONEA 4B6RA 4N0MA 1Q1ZA 2X0EA 3KQNA 2GDZA 2FPGB 5JZVA 1USWA 3G79A 3LYHA 1E1CA 2ADMA 2FUKA 3PUXA 3JSXA 2PQMA 4EA9A 4Z4CA 4G5FA 3K0FA 3MSXA 4HWGA 4RVGA 4C7VA 1WS6A 3K30A 4LV8B 3OM9A 4MVJD 3LXRA 4Q37A 5HILA 2O8EB 4S35A 1M8PA 4OMUA 3IFSA 1BKDR 4MR7B 4RELA 5LB2A 5DWDA 1IMJA 4LBYA 4YPFA 5TC4A 3RFFA 3GJ4A 4ZVTA 2A9OA 3ZK9A 2CJWB 1UDRA 3AGPA 4RKEA 7YASA 5CH5A 3UGQA 1YS9A 4MVJF 4DCCA 2DVMA 1MB0A 3DV2A 3L8EA 4UM9D 4W5JA 4IVPA 2HMSA 4CJXA 1R6TA 3HM2A 2GA8A 2C82A 3ZBQA 1IB6A 3U1TA 7ADHA 4DLRA 4NG4A 2ES4A 4LECA 4QYIB 4G41A 2A9FA 3ZTWA 5HS6A 5JZSA 3IKJA 1GL6A 2B8EA 1W0KA 2PNFA 2ZRIA 3CS3A 3QXJA 4JVSB 2QMHA 1XHEA 1H93A 2R5NA 4RLFA 3BH7A 4YALA 5TDHA 2PD3A 3TXYA 1U94A 2FMKA 4PO8A 4B4WA 4TVSA 1UFOA 3U4IA 4DMHA 4ZZ3A 2Q7OE 4RIGA 1TI7A 2AZMA 4RZUA 1H9BA 5FUXA 3SS8A 4D4MA 5FI1B 5D6NA 3CO5A 4EVQA 3FDXA 2AQIA 2AI3A 5REQA 5LNK1 1RWQA 2HNAA 4KK3A 3SZGA 3M49A 3JWJA 3KJGA 1NVMB 4FHGA 1ST3A 5ICFA 3IQGX 4ZO6A 4B3MB 2Y0BA 4CCYA 4NH0A 2J07A 1SWVA 3QLUC 1ZVQA 2WSYB 2VQSA 1NXQA 2WZBA 4HMOA 2I62A 2GBIA 1HKHA 3TTSA 4BZZA 2WAYA 1XZDA 2IXEA 2QMYA 2Q5FA 2EJWA 3B9BA 4E5UA 2ZS8A 4Q3EA 3H9BA 3DTNA 2JZOA 3CJQA 2Y1LA 3L5KA 4GXNA 4GM1A 3L41A 2X3UA 4G0XA 3WWDA 1ZUHA 4GRAA 5A05A 2XXAA 1KMQA 1BA2A 2G77B 2JDIA 1G2OA 2NT4A 3PCRB 3KJXA 3ICCA 2E5WA 4ZT6A 1XVTA 4D7AA 2A7XA 3H2ZA 4CFZA 1JKFA 3EB9A 1CTQA 2WWTA 3L7MA 4J9UE 4TKZA 2FMXA 3I9LA 5L3ZA 5FIUA 4LPKA 4BO2A 3HNPA 5JYEA 1D4FA 1ULUA 1VE1A 3HVIA 2CFIA 2C29D 2UXDB 2ZBFA 1Z4QA 3O9ZA 1AXGA 4E51A 5HOQA 1ZGHA 4BO5A 1PBTA 4C3UA 1Z62A 4ZREA 5B3LA 1M2VB 1SC9A 1P91A 1UJ2A 2IHBA 3UMFA 1K5GA 4QVIA 1EFPA 2ZVPX 1NG9A 2UU9B 4PLZA 4TXJA 3GJ6A 4UMDA 1PDVA 3N28A 2OGZA 2NZUG 2B2NA 4PINA 1GG5A 2X5JO 5EQJB 3UKOA 3VSEA 1H3EA 5B2ZA 2OM2A 1Y3FE 1PGJA 2UAGA 3C6KA 4D8VA 2H8GA 4EHFA 2NO4A 1RJ9A 4RL6A 3CISA 2QJOA 1OI7A 3FB4A 2X0IA 3E9QA 3ROXA 5EJ5A 5C8YB 4B5KA 1EFRD 1DC5A 3AIKA 3I5AA 3THWA 1KXJA 5T4BA 2C07A 3EDYA 3VH4A 2P9BA 3CRNA 3D4BA 3AF5A 2XUDA 1Y1KE 4HNGA 2Y9MB 1FFAA 3U7IA 4D25A 5T6BA 2KS6A 2ZJ6A 1JWLA 1IEQA 3O31A 3VI4B 5AVUA 4C0BA 1SXQA 3F3YA 4Y2VA 1R5JA 3LC2O 3KXKA 1XJWA 2OHVA 3GRFA 1IOZA 4GLBA 5FOUA 3MRTA 2PM8A 3QX3A 2F55A 3CF4A 4FXPA 3DQZA 1L9XA 1PFKA 3GLHB 4U9UA 3KEFA 3QXCA 1OLXA 1RHRA 2XE8A 3IKLA 4MRRA 1KEPA 1SU6A 5IK2D 4O63O 2BJVA 2EFGA 3MCWA 4FHCA 1G3MA 5AI6A 1J56A 3RFCA 3W7VA 2MR5A 3KKKA 1PZMA 4D92A 1RC8A 2XQIA 3U3RA 5IHXA 4EG0A 1B2LA 5FTNA 5A0FA 2AQ8A 4QJ5A 4OXIA 4CG1A 4CGZA 3IUNA 1HZJA 3G9ZA 3WMRA 1BYUA 1LWNA 1O77A 4MRVA 4D2IA 2IYOA 4L50A 3OTWA 4AMUA 4Y1FA 2BD0A 4YMWA 4JLMA 3CBGA 5DYIA 2DKFA 3D1LA 3E05A 2WD7A 4W6ZA 3V4FA 5KOYA 4RVOA 3CX6A 1LVUA 2WJJA 3P45A 4HH0A 4MJ7A 3W2EA 4BN5A 3OJ0A 1BWPA 4CU2A 1FU4A 2AFIE 2G0NA 3TEMA 2D8AA 2ODPA 4A0HA 2XOKD 3DDSA 3X1KA 1ZNZA 4MUHA 2XB8A 3HKDB 1I4WA 3WGLA 4EYQA 3TOZA 2AUNA 5AP9A 5FPKA 2GPWA 4G1BA 4UUOA 3U62A 5ICMA 2W7TA 1J0XO 3F67A 3N8IA 1HE5A 1RFGE 3QLEA 2H1WA 1CY7A 4X44A 1R0KA 4FZJA 1Z82A 4BMDA 2PS1A 3CCFA 5JZ9A 2YMLA 1AVTA 4HAXA 3LF1A 3GBSA 4N65A 3EQ2A 1CT9A 3ELYA 4AP5A 4YMLA 2VDLB 4BAUA 1P0FA 3T5MA 4FDMA 5CFZA 4PBTA 5IJXA 3OIGA 4DS3A 1L3CA 3PL5A 5BUSA 2VUUA 4DANA 5DNUA 4L76A 3ZH2A 1H94A 5CB4F 4XUEA 4BFTA 1GTMA 4MVJG 3T52A 3Q85A 1ORIA 3LSTA 4ZAYA 4UU7A 3FWYA 1E98A 1SVIA 2WUFA 4NZZA 4YCSA 2IPOA 3Q98A 5LSAA 3HXTA 3OUTA 1Q6ZA 3ETDA 5CB0A 2NUPA 4OHBA 5C5DA 4TUYB 3NIFB 4NBLA 1W30A 1YVUA 1NE2A 1EWKA 4G0PA 3DMDA 3R3VA 4TWAA 5TPZA 2P77A 2CVPA 5PNTA 3RSZA 2JJMA 4DXDA 4AM8A 1VB3A 2KMLA 1QP7A 1U1FA 2IEZA 3ZCTA 2QG9A 3AMVA 3QEMB 4MGKR 4Y2HA 1KI3A 4XQGA 4EB0A 4TWJA 1RI2A 1SIUA 5ALEA 4PC6A 3CYFA 1NQWA 1C9EA 4GM4A 1FIUA 1GZ4A 2PUTA 1XG5A 2FSIA 4G1MB 1KY3A 1U6JA 3D7LA 4RGQA 3CMMA 5T57A 5GONF 3BM5A 1VPLA 1IRXA 1HDCA 1Y4AE 3G2JA 2VPTA 5GGYA 3UK0A 2DQ4A 3KS9A 3WTBA 2N3ZA 1LA2A 3LUPA 4Q9DA 5BV2P 2VNHA 3Q10A 1V16B 4ZP1A 3R74A 1FP4A 4JOSA 4AZ0A 1RHJA 2BW0A 1MJ5A 3UB2A 2IYAA 4FNGA 1QWOA 4QT4A 4ZKEA 3GV0A 1JHPA 1OY1A 3FG9A 3FSEA 3L7KA 3I5MA 2ONCA 4TXHA 3SX4A 5AVTA 3E9CA 5IHPA 2EEZA 3FI9A 2RGRA 3PPWA 1QQ5A 2BLNA 1PT8A 3GJZA 3PPXA 1RI5A 4MEJA 4E3WA 3ZHRA 2IYTA 1F7UA 3Q7RA 2Z5VA 5L6LB 4IR7A 2B20A 2R44A 3KELA 1HNNA 4FEYA 1QP8A 1J8FA 1S5PA 4UE3S 3PYMA 4HXEB 4TYPA 4F9EA 5ED4A 3DXFA 1LRKA 5EJIA 1W5TA 4J0FA 2ZR7A 1R9MA 2XSZA 4O59O 4JBNA 3UY4A 2NO6A 2VDKB 4KN9S 5HF8A 2J0UB 4DEYA 2GT1A 1JQ5A 3TQFA 3AVXA 3KOWA 3KCQA 3M1LA 1ETUA 1U9ZA 1UT6A 3BFVA 1YQGA 2BP7B 1BWQA 2PA3A 2PAAA 3CXRA 1ML4A 3M4NA 2QROA 4TWZA 3I1YA 4UUPA 5B2FA 5B7PA 2WMOB 3B51X 5JQWA 4F6CA 5L9AA 5ERXA 3CO0S 3F7MA 3ZN2A 1MGPA 3LXXA 4JUAA 3L93A 1SEVA 2V4MA 3ACDA 4X1IA 4OP1A 4KJZA 1FJ2A 2J3KA 4EB3A 4ZEVA 4PFQA 1X9GA 1M2FA 4AX8A 3WNVA 4R31A 2ZYHA 4C2TA 4HD8A 3U80A 2AMVA 1GSOA 1OBCA 2F64A 2VT6A 3DZDA 4L57A 4UTZA 1SKYB 1VJ0A 5IH7A 4K46A 4MVYA 1N0IA 5EKXA 1FFHA 1M6WA 2P5TB 3T1OA 2WPDA 5AHRA 4TLMB 3LV8A 1T6YA 2FVXA 2PQ6A 3DCNA 3IQXA 5FTLA 3U7HB 2A94A 3EAFA 3SG0A 1ESMA 5G53C 3RSGA 1GNSA 4N0EA 2OESA 4C7KA 4KMMA 3DZBA 3TR6A 1TECE 4GPAA 3H2KA 3G8YA 5F2KA 2ZCUA 3RFTA 4L22A 4MAMA 5JBNA 5AKZA 3DSRA 5TS3A 3TSZA 3RYFB 2ONZA 3CEMA 2B8JA 4OD0A 4BC1A 1VJDA 1ZNWA 3SGLA 2J9XB 5JCOC 4MWBA 1L4UA 1CRZA 2YHAA 4POAA 5KIAA 3VKVA 2O54A 1P9OA 4CQMB 1E9SA 1W4LA 2OV4A 2W2TA 2PZLA 1UDWA 1NI4A 2B9EA 4JD5A 5HUHA 1GRNA 3D2BA 3H9EO 1GYPA 1WXQA 3ET5A 3QA3E 1P1KA 1XMVA 4RTMA 1T9CA 1VP3A 4NE2A 1FZQA 1U9IA 4PYLA 2OV6A 4JBXA 4G3XA 5C1BA 4UM5A 1I9CA 1JDJA 1ZVJA 2C4VA 2AG0A 5BSTA 3UAXA 4GDMA 3RIXA 3NBXX 1O94D 5E3IA 3RSLA 5CT5A 3C16C 4CT5A 1RZVA 1OFUA 4H31A 5DTRA 5D5PA 2HMAA 5BSWA 1X9IA 2B36A 2VRCA 2ZB8A 3F98A 2XCQA 4WIAA 5T8KC 4E88A 3VPFA 1BW9B 1VKZA 2Q2QA 2ZYSA 1XWWA 1N8TA 2FK8A 3WDKA 1MAAA 4L5BA 5HGJA 4DUGA 1USKA 2XKJE 3FPAA 4QAJA 4UUAA 5E9AA 4BEBA 5LUAA 4JI2B 2B0JA 3T5BA 3DEHA 2D06A 1ZJ4A 3D7RA 3WO0A 3N2NA 3DCYA 1PYOA 3KVOA 4PSVA 2D2FA 3VKWA 1A5AB 5KUTA 1C4WA 2BFPA 2A0FA 2G5GX 2SCUB 3IKVA 3E3LA 3IJRA 4XIJA 2ZIXB 4ITUA 5BNFA 4F1WA 1DBRA 4WY8A 5KPDA 1O6GA 2WQZA 3ZV4A 4TMYA 4R1PA 4US2R 2WP8J 3VC3A 3WBFA 1P0QA 1D2CA 3C2QA 3DDCA 3DCJA 4BTEA 3NHPA 4REQA 4MV9A 3O95A 4DPMA 3U4CA 2I22A 5IM4F 4KL8S 5EJMA 1EZ1A 4MB2A 3D4LA 2CMGA 3PFNA 3L0ZA 1YBMA 4W8GA 3KV3O 1T91A 1V25A 2BCEA 1CYDA 1ZIXA 4YCDA 2RGNC 5AI9A 3T94A 4BLUA 4M0DA 1WSDA 4ZI7F 2Q27A 5ER9A 4F9GA 2BYTA 1ISSA 2P9YA 3E82A 3HVRA 3EA4A 1QF6A 4BRUA 1X1DA 1SUAA 2F59A 1US8B 1Y9EA 3GHYA 3K94A 1ADYA 3UJBA 1EFRA 2YV2A 4DLKA 4KKVA 2A9KA 4TOIA 4TVOA 5DDIP 4NMMA 5AUQA 5TPWB 4AY6A 5DBEX 2VATA 2Z9CA 4JR0A 3WK9A 4UDNA 4EHDA 1C9NA 2XX3A 1KA9H 5MN5A 2VZEA 1WMSA 4X71A 5CDFA 1T10A 4PANA 5A2QA 4W5QA 4CEIB 5KX5B 3T7JA 3O47A 2DHEA 4WXHA 3MGGA 3KQMA 5L7YA 4M0UA 4WLNA 1TDJA 2DR3A 2Q9AA 3BMCB 2DM6A 5JE8A 4F8EA 4NZNA 3Q8KA 4XIYA 5IJ9B 2DPYA 4URYR 2FPMA 4GPZA 4XWWA 2DR2A 2Z56A 1QGED 3O8NA 1K06A 1DT5A 4IIVA 3EN0A 4M1OA 1PK7A 4CQMD 3NPMA 3O2NA 2O8FA 3PR2B 1C1YA 4Q6WA 3PVSA 1P62B 4LXTA 4PZ0A 3PEWA 1F3OA 3K1YA 3KU4A 1G1AA 2EU8A 2E6KA 1AGNA 1JMVA 1Y8RA 3C1AA 1RPTA 3R6GA 4BKPA 3QVKA 4OJMX 2JI9A 2YASA 2GYVA 2Y2VA 3G7SA 4YP0A 5TGTA 1EVYA 1ZI8A 4C04A 1OFTA 3EVEA 1E1DA 2JAQA 2YFYA 1JFVA 5JFGA 4XD7A 2C96A 1LF0A 1Y33E 1CUWA 1SQGA 2G28A 1NF2A 3OBIA 4FW9A 4KDCA 4P80A 5E9QA 5FD8A 2Z8XA 4D6YA 1E32A 2IOFA 3KTFA 1OXXK 5K0NA 4V0NA 3R7FA 2G4LA 1GWNA 1TVEA 4P4SA 3K96A 3OETA 1T6XA 4GLFA 2XAUA 3ENQA 3NGLA 4RH1A 2Q2OA 1FMFA 4TMZA 4YRIA 3LYLA 5KCZA 1NJFA 1EUQA 3A4TA 3NATA 1BD3A 5H7XA 4EJSA 4N0PA 3DNFA 1IL0A 1J9ZA 2UYQA 1G3RA 1G20A 1HFJA 3PWSA 4ALMA 4K0KB 3DXZA 3HPRA 4P0PB 2FR8A 1YH3A 5IJWA 1BQ3A 4RE5A 5EMJA 4P1ZA 1AURA 3H5AA 5DK6A 4HFNA 1MJFA 1Z06A 3FWNA 3I23A 3ICOA 3STTA 4CGYA 5HF6A 3UUEA 4PYOA 2GYWA 5TMDA 4BV3A 1N2IA 4PNHA 2QTHA 3L6RA 4M89A 4H1UA 5EAIA 5EZQA 4AYWA 1SUEA 3JZIA 2YWEA 4EW2A 1XK7A 3KBBA 3ROKA 2QSYA 4KE9A 1CJUC 4KACA 4L5JA 4J1TC 1VJTA 3ZGYA 3NTOA 4Q01A 3EGVA 4A4DA 5AW8A 2WF9A 4S2UA 4TZ0A 1Q6YA 3Q87B 3UWDA 3AY3A 1OXSC 1B16A 1UBRS 1BMFD 1V7ZA 2XZTA 3AEUB 1K1EA 1QB7A 3KWFA 4GPIB 3DOIA 3FIJA 2RC6A 2I78A 3KDAA 2W6IA 5M5BA 5HDQA 1I6MA 5LQCA 2GB4A 3VJMA 1FRZA 2ZIUB 4G4IA 3L1IA 3N2EA 3WDSA 1AQNA 3W2IA 3FYUA 1XWIA 1XRQA 2CFOA 3MCUA 2A2ZA 4PCUA 4QUJA 4D98A 5CT6A 3DTVB 4F4HA 3SQOA 2X6RA 4E1VA 1CQIA 1X8LA 5KNDD 1AO3A 3L0SA 1H6BA 1UXIA 2D5AA 4ID3A 4R0VA 1TVKA 1Q95A 1KXZA 2LRHA 3O3CA 3QEBZ 1HM5A 4X61A 3H5NA 4LXXA 4I8DA 4MVXA 5DBFA 3THYB 4HQNA 1E2EA 1OKKD 2V7PA 4MYDA 4R1OA 5DWVA 1ZR2A 4ARCA 1JHYA 2B1IA 2FPIA 1Y5IA 3AUUA 3ES9A 4NEHB 2FEMA 3CRW1 3WRXA 1WXDA 4LX8A 2HLDA 4NXNB 3R20A 4V0RA 4HB2A 1J7JA 1LLUA 1KZHA 1XD8A 1TYBE 3CZ4A 2WTUA 3W2GA 5CA1F 1C7RA 2FMUA 2KBFA 4ZOBA 3JZMA 2SCUA 3AR2A 4UE2A 1P5JA 2PNJA 1Z33A 1LBSA 4RY9A 1PN3A 4LDPA 4AZ3A 3ZY5A 3MMSA 1BN6A 3ESBA 4GBJA 1N1GA 4NCJA 5NULA 4OQZA 4PRKA 2ZYIA 3G89A 4HDKA 1EG2A 3MYYA 1EFPB 3DOEA 5EXXA 3HZRA 3MQ2A 1ZESA 1W2HA 2BMFA 1CNFA 4ZK6A 1B23P 4B45A 3VH2A 4YI3A 3P9CA 4IIXA 1I5EA 4YH1A 1C4XA 2W6PA 3BICA 4PLVA 4DWWA 3ZLJA 1W6UA 3AEQB 2QIPA 4QNNA 1ECPA 4UNIA 4XJSA 3ILHA 1MRZA 1E96A 3AEXA 4LRTB 2WIBA 4WUVA 2NT3A 4W5HA 3WAGA 3QQ5A 5BT9A 1EINA 1WZUA 2OSBA 2NYRA 1H3FA 1JIQA 3GDOA 2Q46A 3BULA 1V11A 2EJUA 4L8GA 1QHGA 4JLPA 1YB2A 4NMXB 1O8BA 3IXLA 5I7VA 1UKCA 1SQ5A 2FFQA 3KTOA 3QBTA 5AM1A 5H68A 4O6VA 1DQYA 1APBA 1QZTA 5I7UA 3L8GA 2ZSAA 4D8YA 3EQ6A 1D6JA 4DIDA 4D0SA 4B3TB 1E5DA 3IEUA 1GVNB 3KCNA 1HDXA 1OQAA 1N5LA 1QNLA 5GM1A 5DIFA 2O5EA 1LX6A 2JGDB 1MA0A 2FFRA 3QEAZ 1TNDA 2YQ4A 5JFTA 3V1NA 4YRAA 1NFRA 4C1BA 3S81A 2DLCX 1M6EX 2IDZA 1I13A 1VOTA 3HKDA 3K6KA 5D51S 3P4YA 2W0SA 5E8JA 1F6BA 2FFAA 3RUCA 4IHAA 4DLTA 1PW7A 1FX0A 5LZ8A 2O06A 2HCJB 1G1MA 3IIIA 1CJKC 4XJXA 2NU8A 3GC6A 1Q77A 5BUCA 5FPQA 2WWGA 3ONDA 3LUCA 5EERA 2Z09A 4LMAA 2J6BA 3CLSC 4ARVA 2I7XA 3AEKB 1Z6GA 2EEPA 4NP6A 5I8ZA 3WMXA 3VAYA 4GSLA 4RTLA 1J20A 1I9GA 1T9GR 3MMPA 5IW8A 5C53B 3VU1A 3GD7A 3BHMA 3DMNA 4EQZA 1LI4A 3GYGA 4EW3A 2MSWA 4UCWA 2H7CA 3K6JA 3LUFA 3I76A 2YHSA 1ANKA 5BMOA 1YUNA 2PTHA 1QYRA 4PRZA 4QOJA 1JFFB 3E18A 2ATIA 2WFMA 1NW9B 3V4OA 1U0TA 2FP4B 5DX0A 4NXMB 2XMQA 3PXCX 1R0BA 3GF4A 4WFKA 1SHLA 2XE6A 5A06A 1EFAA 3VR3A 2D5IA 5FOQA 2VNKA 5FNVB 3I04A 5A04A 1SA0B 2ID8A 4MSUA 2EZ4A 3NHWA 3I6MA 3Q72A 1QV7A 4WSOA 3TLYA 3RIMA 2CV0A 2L82A 1IZ9A 3GEDA 5HTOA 1LGYA 1AN9A 3MWEA 5J1TB 2JGIA 4HYQA 3QVGA 5EEGA 1KOJA 1U7UA 4AJ4A 2G40A 4BNDB 1DV2A 5KYXA 1JR3D 4JUCA 1KWGA 5JSUA 5LOVA 2NNLD 5C8YA 4R41A 2JLXA 3ZIAD 1P5FA 1ZA1A 3EQZA 3R0XA 1G21B 4ZGWA 2MMGA 3CGGA 3OVMA 3PFBA 1EIZA 2QLBA 5HK8A 3V33A 4RDCA 1DAFA 1NBMA 1I0LA 1KI7A 3E81A 3NEJA 3Q5EA 4HLUC 5KO2A 3NEAA 1CY4A 3KEMA 1XZLA 1EHYA 4D4IA 2C8KA 2OGTA 4TKLA 3D8RA 3R7NA 2Y93A 1F60A 2GTIA 2SHKA 4FYHA 4EARA 5ECDA 5J2UF 4X94A 3MD9A 2HJGA 1S0UA 3DFIA 3R8XA 3ZG6A 1A82A 3Q7EA 3Q15C 3HZHA 1QONA 5AKLA 1HT3A 2AWOA 3G17A 5EJ9A 3PCTA 1KQFA 1GVHA 5HNKA 3A06A 1R0RE 3QEOA 3IH5A 4G0OA 4M8IA 4Z86A 1AHPA 1TUBA 4BGUA 2Y1OA 5KSWB 3O75A 4GC9A 4LQCA 2VZ9A 2RHWA 2XA2A 4X91A 1ZOOA 3PGJA 4HRVA 3QWAA 2Z9BA 4PICA 4RNCA 4KWHA 3WE7A 4D9JA 1LDNA 2OHIA 2R7NA 3S8EA 4EG3A 2KM1A 2NXEA 1WDWB 3LW7A 3IUQA 1F9AA 5CJ2A 2WG2A 1E2UA 2X2FA 1R64A 5LWQA 4L2IA 3GLQA 3HHEA 3PUWA 1QHYA 1WTAA 3RCBA 1E6WA 1JDPA 3CT4A 3UT5B 1YKGA 2JHGA 5JU6A 3A6PC 1KP2A 1X8JA 5A1TA 2C4MA 4WOKA 5AXAA 3ZUGA 4JJAA 1RRVA 4E94A 2ZYTX 1JIUA 2JIOA 2OGUA 2YV3A 2FOXA 1VSUA 4F4FA 4M88A 3F5DA 4PBRA 2E1RA 4L15A 1TEVA 1O5TA 2A3RA 3CKKA 4BCCA 1J06A 1GUBA 1JQDA 1LQ2A 2QP3A 1QH1B 1UP4A 1CUIA 1PR4A 1Y7TA 3GLKA 3IAHA 4JASB 3RTEA 2ZYUX 3T7TA 2WJAA 4OATA 4AY3A 5C34B 4G4GA 3GMSA 4N5MA 3W5IA 2DULA 1Q15A 3O4RA 5CLLA 4XM1A 3I2GA 3B1KA 4B4OA 4CUKA 1K6EA 2GPAA 4RSHA 2JFZA 4L95C 4BDSA 2X19A 4Q1AA 4EG6A 5KSPA 3F4BA 3RFUA 2XNHA 4OF4A 1USVA 2H06A 4B3GA 1AY0A 1SCBA 1GJRA 4B8ZA 4JYAB 4M0LA 1DCTA 2O19A 1HURA 3NVAA 4HGYA 2JBHA 1DPGA 1P0CA 1T3TA 1N2CA 1OGIA 2QQEA 4Y7DA 4QTXA 4BP3A 5I48A 3EXFB 1MBZA 3NTXA 1PJAA 4UNNA 4XDYA 4DLWA 4YJKA 1EBUA 5JSFA 2RGBA 3CNEA 3W3AH 3W3AD 5KYVA 3F5SA 2V8OA 1IHDA 4CLHA 1YB7A 2IS1A 3NYWA 1DC7A 3SE0A 4UM7A 2H2HA 3LOQA 1E1MA 1WHSA 3NTRA 1T3ZA 2PMWB 1IZ7A 1SUWA 2Y8EA 4UTNA 4FOLA 1G0OA 1JFLA 1T3SA 3OE7D 2YQ5A 5AVZA 5AW1A 3HU3A 2R84A 4JI6B 5K09A 2BH2A 4DMRA 2F1OA 1GUDA 1NGSA 2PH1A 3GG9A 5LXTF 2Q3CA 4H1HA 3FGPA 3FFTA 4HWSA 1XVUA 3L7YA 3PI6A 4WZAB 1Y4SA 1E79A 5HEKA 1WZ2A 4CM9A 3NNDA 1PJTA 3E7PA 2XR1A 1U0HC 2RHJA 3SZLA 3STYA 3C3EA 3DE2X 2Q8PA 1ZN9A 4B4DA 3F78A 4I55B 3L7IA 1IBCA 5HIAA 4CKCA 1KQOA 2UKDA 2HW8A 3KAQA 3MJTA 4PTYA 4ZEWA 5B30A 5BY2A 1CR2A 1N57A 4DA6A 1IZYA 4GE3A 1ZI9A 3A1WA 4QIHA 3RVRA 1WCXA 2YWBA 4X3PA 5CCEA 1E7QA 4L4UA 3MCZA 4MLCA 3GD5A 3B53X 5AI0A 3V34A 3A2MA 3R5TA 1EB9A 3QG5A 1UZUA 4GP9A 5CYOA 5IM4A 1NQ5A 1W29A 2YRXA 1M76A 3T06B 5EYPB 4Z7JA 1YJ8A 3ME5A 5I8PA 1WPQA 5HMLA 3UAWA 1KK3A 2DQKA 3CX7A 3DF7A 4QTTB 3VV3A 4B71A 5GOZA 4I6GA 2ZIAA 1FP2A 5HF9A 2XT6A 1ZRSA 2OG2A 3L7CA 4KV9A 4YIKA 3X1DA 2E4VA 4B73A 4XJTA 2JFYA 4N6NA 1T2NA 4IH9A 1HT0A 1DKPA 2AG1A 2AR0A 3KJIA 1SVKA 4HAUA 2F8TA 1K7SN 1CR6A 1FRQA 1S1CA 1FJXA 1TU4A 1VTKA 4RHFA 2HHJA 1RNLA 1C0PA 5JLJA 4MYTA 5DBIA 4MO2A 2WU4A 4TTVA 1XA0A 3ZZ1A 4GRDA 5TR9A 2B82A 3VNVA 2CL0X 2H9AA 3N75A 3QJYA 3ZU6A 1J22A 5M29A 3UO8B 4W9MC 4R4JA 3VV2A 4QZVA 2G17A 4TVKA 2IGTA 4LZOA 1ZOLA 3TL3A 5EIWA 3ETGA 3HYLA 3BFXA 5A5FA 3B3QA 3NOOA 1RQNA 4QGBA 5K9ZA 2Q8QA 5EKUA 4XFDA 2ZS9A 4B4VA 3HBFA 5GZ3A 1CIVA 5AOVA 2G5CA 3WOHA 1NRJB 1FYXA 4EZBA 4YMVA 1C81A 2VT3A 5EGSA 3F7TA 4MQEB 2O2IA 1E8NA 3P0IA 2D0PB 2JK1A 3E4DA 4YMGA 3I4FA 4ZFNA 3V46A 3FVTA 1PS9A 3W78A 3O0TA 5IDQA 3GCZA 2CYBA 2JGRA 4V39A 3MT7A 3MTJA 3DEZA 3E5MA 1UJCA 2RGUA 4PU0A 1M54A 1ORTA 2CXRA 4NOMA 5JAPA 3AIOA 2P4UA 1J1ZA 1A4XA 4G85A 4M1MA 3Q11A 4DNOA 4ER7A 2RK4A 4M36A 4PQRA 1V6CA 3JCZA 4M0CA 4PZEA 3VOSA 4Z1OA 1RZRA 4G0MA 2NXWA 2A5YB 2E2WA 2ISCA 4GMFA 4CMKA 3ZWCA 4JI4B 2J0QA 1BWSA 4Q19A 4OLFA 1CEEA 1TQ8A 3LM8A 1CK4A 3G82C 5C32A 2ZBEA 5BQFA 2HQBA 2FXIA 2J45A 4KGZA 5AXBA 1JW9B 2XNSA 3ANLA 3QHAA 5B3AA 2NN3C 3RVMA 4HFMA 2WKSA 1QO9A 2FN9A 2YVQA 2JS7A 3AUTA 3DLBA 2I65A 4MQFB 1Z2NX 1JBQA 1L5VA 5E9JA 2B21A 2JIDA 3TINA 5B3JA 1RIFA 3ND7A 3VAAA 3MLEA 4C2UA 4XYGA 4GUAA 1EJ6A 4QXAA 3N7AA 3GNTA 1RJGA 2GJKA 4YO8A 4D0RA 3BK1A 2ZPAA 2NNWB 4LMRA 1RAIA 5ED0A 5TQVA 3THXA 2PUEA 1CUGA 2PWYA 5CVJA 2VDWB 4UDYX 4XYBA 4B43A 1U8XX 3H7IA 1MX9A 4CEJB 2Q4RA 1ULTA 4OIFA 1L7RA 3WFIA 3WS7A 2DFNA 4LF8B 5EKDA 5C46F 4PX5A 3OIFA 4BMXA 1T36A 4D9EA 4YUXA 5FLYA 2BMVA 1QIFA 4KV7A 1E7WA 1NSFA 5DEOA 1WBDA 3FFWA 1QBKC 4R0MA 3G1TA 5DLQC 1STOA 3V7WA 3F2IA 2FPGA 1JKXA 1X13A 3BQNB 3ZOZA 4RTJA 2Z4TA 3EVGA 3T3OA 2WWVD 3A4LA 1ORHA 1NXOA 2CL5A 2ZT5A 2O2ZA 3CM0A 1VHQA 2YYSA 3GFSA 3KZOA 4MWZA 2BGJA 1XKLA 2HJ9A 2YFKA 1MB2A 3KAKA 2G4VA 1LTKA 1QZ3A 3CKMA 4ZZ0A 1E9DA 1OFHA 2CVHA 4OTZA 3WGJA 4FYKA 2H1FA 1E9AA 1KK1A 4OA5A 4WGFA 3F4LA 3ZHUA 8ADHA 5I4CA 3NMUF 1XOIA 2GHRA 4JUFA 1YT5A 3JWHA 2DWUA 4UC0A 2BEUA 4DQVA 3FPKA 2C59A 1KMCA 5TIIA 2VLIA 5AHWA 1NN5A 1MF7A 1Q1EA 5H4HA 3R0JA 3ZKWB 3QRWA 4EZIA 2C9MA 2MCFA 4JMLA 2QRZA 1MTOA 4J3FA 4Q6BA 1TGYA 1PEYA 1Y37A 3TB6A 5FA8A 5KYUA 4ENWA 2PUJA 4WTOA 4AFNA 5ALVA 2XRZA 1CQJB 4UVEA 4Y98A 2CHQA 3VOBA 1L8OA 2ZRGA 4XXHA 2GEDA 2XVYA 3KD3A 4OI4A 3D6TB 4TQGA 4UUNA 3MIIA 4EYOA 4MCAA 2GN2A 1I1OA 4E31A 3G0OA 1IBKB 3QFRA 2B7LA 3S4YA 1OIWA 3IPYA 1NJ5A 4KR7A 2WKRA 4QYTA 4I5IA 5B7NA 2WF7A 2ECQA 2Y77A 1X38A 1R8XA 2KLHA 5FPTA 3ZHZA 1XO1A 4RHUA 4CKWA 1M0SA 5JWOA 4RWEA 4AG3A 4MS1B 3ER8A 5A0VA 2RHOA 4CLDA 1CLEA 2SKDA 3HYRA 2YOFA 2R0QC 1LQUA 2GN6A 3QTTA 5J3JA 2HU2A 2YV4A 1O96B 1UBJS 3S1LA 4JJKA 1X1QA 1IPEA 2V9PA 3AI7A 3LBAA 2G4CA 4NCXA 1H66A 1NBMD 4JQOA 2J7KA 1XZCA 3AEQA 1MENA 3M9XA 3QW4B 4TS3A 4Y6PA 1VHTA 2R5FA 1EK0A 3BEOA 4OHCA 2AG6A 4BO7A 1EWVA 3PDCA 4XUGB 1NT4A 1L7AA 1SKYE 4I08A 4RPCA 2E55A 2A0UA 2JKVA 2G83A 4N47A 1L5FA 2QLJA 4FC6A 4EG4A 1JEQA 1U2PA 1GA4A 2V9ZA 4ZICA 1GZSA 3JTEA 4FMPA 4KIUA 4AF7A 2BKAA 3LNCA 4KR6A 4C89A 4RKYA 2LTAA 5J2TA 1F2DA 3K73O 3OWOA 1HDIA 4ER5A 3J7TA 5JW6A 2JRCA 4S1VA 2NX2A 3K0KA 1HE3A 2P40A 4RXTA 4ZAGA 2GVNA 1QVZA 4R1MA 3N58A 3LIIA 1A1VA 2QRVA 1DADA 3Q1LA 3PEUA 2XMBA 4YCAA 3E3OA 2EIHA 4ZVQA 2Q29A 2CMFA 1M6YA 3JVEA 4NDAA 1F2TB 1QP4A 1TMOA 2FUG1 1P1CA 2IYYA 4ARZA 1ZM9A 2P3LA 1NVXQ 3GXOA 3IBGA 2EYQA 3EXHC 3IDZA 4IHJA 3QVMA 4RZ3A 4YASA 1N3IA 3PSHA 4CF6A 1CIJA 4NABA 3JD4A 2WNSA 3AVYA 5JMOA 1K4KA 1XD2A 1CX9B 2X15A 4QBHA 3WGKA 1EGAA 1KGSA 4BJ3A 4IH4A 3STWA 2PFKA 3Q6IA 4Q5IA 5GGXA 3C15C 1FXWF 3KV1A 4R5MA 4BVJA 1O95D 2CCKA 2V03A 3NKFA 3MWLA 3CUWA 1Q14A 3AETA 1RJWA 2CEKA 4FOPA 2CNLA 4U6QA 1S4MA 3OOSA 4YRNA 5LP6B 1AB6A 2EKQA 4FP9A 1Y5RA 1BEZA 3BDIA 4EFMA 1YZTA 4AN0A 4XZ3A 1UQUA 1YD7A 1TAUA 5EN4A 4QICA 5LJIA 1NNUA 2OB2A 1AA9A 5AVJA 4X6XA 5HDBB 4L6AA 1MOZA 5EINA 1A4IA 3DUWA 3K71B 2PSFA 3FWKA 1ZQ9A 1F8UA 4RK6A 3K8OE 3T3NA 5E6UB 4JL8A 2BGRA 4GECA 3OEHD 3VSBA 1T9BA 3WIBA 2G6BA 2JGMA 1COZA 2NU8B 3SLGA 3AVTA 1P2VA 1BAPA 3ZC3A 2CV2A 3HEAA 5LQAA 5ADWA 1QU3A 2F8LA 4O25A 1KIFA 1RE0A 4IDEA 3PHGA 1KPGA 2R1TB 3KYDA 5AHXA 4Z99A 4C4AA 4CKBB 4ME6A 4X6YA 3WHKA 2DHQA 2HMYB 2L42A 1FYFA 1MN6A 5DYYA 3GQBB 1GT91 1PWXA 4AJ1A 4IJ6A 1JU9A 4X24A 1A2QA 5AI5A 4EX6A 4F5DA 4PQYA 4PGAA 2C5GA 2O0KA 4X8LA 5J58A 2IEIA 3FETA 1Z34A 4MWDA 1VYHA 1PR2A 4HAYA 1HEUA 1S2DA 3WZ2A 4BO6A 3O2SB 3IJPA 3I39X 2J33A 3JWIA 4L5IA 4BO3A 4HNHA 2W11A 3HA5A 1UKBA 3B60A 4HVAA 3FTQA 4R2LA 3OPQA 1N7GA 4Q34A 4RMGA 4BEJA 3W5CA 3FHOA 2QQFA 4GE0A 4LHVA 4Q03A 5D8DA 3GJ5A 3EHEA 5KSZA 3GOQA 1Y9ZA 1JHRA 4FMCF 5LP6C 5ILOA 4RJJA 3IXQA 3JRXA 3HR8A 4H0CA 4X84A 3ZU4A 2A0XA 4U39A 3AM1A 3V3KA 3S2FA 3ZR4B 3JQAD 4E6PA 1UPCA 3P9XA 3GEEA 5KEIA 2C8VA 5KMGA 1DRUA 5BORA 3L0IB 3NZEA 3UUFA 1Y5LA 3IP8A 3MVEA 3A6FA 4NYMQ 3P9KA 2CNKA 4DSUA 4F45A 3JAKA 3FMOB 4UZSA 2AXEA 4IRXA 1LK5A 1OTXA 3UMJA 5M3BA 2REQB 3Q3GE 3K3PA 5CCDA 5E6RB 5KJCA 1W88A 1MAVA 1H2FA 3T9FA 1D1QA 4I50B 2IT1A 3RUDA 2C0QA 2L17A 4I0WB 4RD6A 3FPSA 3OZRA 1E3JA 2QS9A 3FOWA 4K2HA 2Z2ZA 1IXZA 3F5MA 4MUNA 2IXGA 1J2TA 4KSBA 1KY5A 2ZBQA 4ZEXA 4BIMA 5CG1A 4UU1A 1W5FA 1QFJA 3DOUA 4IUCS 4QU5A 4MRSA 3JX9A 3KFXA 2CYCA 1JJAA 3FXAA 4GR5A 1BRMA 5I3CA 2FE4A 3GT4A 5F1OA 4OB6A 3D4NA 3W7BA 1NJ6A 4DZRA 5KYWB 4OHUA 2HA2A 5HYVA 1WXEA 4AZ0B 1GZUA 1SNYA 3L06A 4ZHQF 3SQXA 1FNMA 1Z8HA 3UKDA 3HYNA 1JJ7A 2QRNA 4A27A 3CF0A 1ZOSA 3F7NA 4X60A 3C14C 2YWXA 3OQ6A 1BQEA 5GVRA 5A4JA 3HKCB 1NBEA 3KJQA 4TWIA 4HO1X 3SMVA 4HP8A 4ZJUA 1RAEA 3BRWD 5L3QB 3EGOA 3ZDBA 1CG6A 2H9YA 4OQMA 4NI5A 4ZTBA 1JLRA 3AR4A 3F6BX 5LDGA 2WSBA 1TKCA 1R0XA 2QGNA 2W6QA 1C3EA 2JIZA 4S12A 4US0R 2H17A 421PA 4BB0A 6REQA 4DCNA 1VKOA 3LHIA 3JAKB 4W1QA 1LZLA 2BDTA 4L75A 4EP1A 1PD1A 3AUKA 3RSQA 1HE8B 3HDYA 3ZHXA 4DVJA 5JALA 1LY1A 1CJBA 3BUSA 3KYJB 3O9VA 1IRIA 1VXRA 1KYWA 1F4VA 4XGIA 1I33A 1MW9X 3EC2A 3PJFA 4ZIRA 1B2RA 3A10A 4B3BA 4M9QA 3BE4A 4YJGA 2R87A 3BYZA 1XP8A 4PO9A 2VDOB 1R15A 3BS4A 1VI5A 2AJBA 4CN8A 2Q1TA 4GH5A 4LHXA 3LQKA 1WKCA 1Q16A 4OJQA 4BUJA 3UJ9A 4PCAA 5ALIA 3AJEA 4IIJB 1P1FA 3I52A 2C83A 3GJSA 2W4QA 3O3MB 3PICA 5F78A 3EF1A 2BUAA 1PSWA 5IS2A 5A3JA 3L05A 4ID9A 3KZMA 1CUSA 4XYMA 1UDXA 5C7OO 2H63A 3AF3A 3KRTA 3LO8A 1PX2A 2DPGA 4RFVA 2OCXA 1H0SA 3N2GA 1MO2A 1JHUA 5IULC 4D96A 1PJ8A 1Z6PA 3KQSA 1G3UA 3OX2A 1A7AA 3PENA 3I2FA 3GLFA 1WXXA 1H2HA 3MGKA 5TT0A 1RCUA 6Q21A 4BRSA 3HN7A 4O8ZA 1V35A 4OG2A 4Q7KA 2V7EA 3V4SA 4E4TA 2P9CA 2BZ1A 5KNCH 3A14A 3EX7C 1GDDA 1ZJJA 3OA2A 1T8WA 1O89A 3WRYC 4IDQA 3M6UA 2P6RA 5BUZA 2EW2A 2BV3A 1FTYA 3QVXA 1H2AS 4BATA 1UJ5A 1HZZA 2NTEA 2R11A 2ZRCA 4PC2A 4WZBA 3VTAA 4DDUA 4RK7A 4UTPA 5GZ6A 3KHKA 2QRLA 4BL5A 3BJMA 3GFQA 1EFCA 3AJ8A 3RJ9A 3UT6A 3TFOA 1S7GA 4OQPA 4CG2A 3RC3A 2JHCA 4NZ9A 4HDNA 1IH8A 3K0BA 5HQ3A 3FLBA 5BYAA 3NHYA 2D54A 2OTCA 1EHIA 1KDRA 3BXGA 1PT5A 2JFQA 3ELWA 3IQIX 3L8FA 3PDUA 1E1RD 4NICA 4TN1A 3U4DA 3GNLA 3GARA 2IEAA 4GX0A 3UAVA 3HMKA 3U17A 5CFMA 2XOEA 5HE8A 5AW9A 3TLJA 4KJXA 3UHPA 1V43A 5DMXA 3P9SA 3VNSA 1G63A 1N0UA 1J5XA 1MKYA 5ALMA 2PMBA 3A1VA 3IHKA 2XF8A 2XQGA 1ZU4A 1YOBA 4AS2A 2Q4BA 1W76A 1EUCA 1Z37A 2HZBA 3CEHA 2QLNA 1KEUA 1SOWA 4LXQA 1R2QA 5FEMA 2EP5A 4O2BA 4BWVA 3RQSA 2A67A 1GZ3A 2V65A 3FYUC 3STXA 1NYQA 3QNMA 2GNAA 1KIMA 3OUUA 4MWEA 3VBEA 4DN6A 2Z98A 4QDUA 3RD5A 1MX3A 3AHEA 5HKKD 1P73A 3A26A 3ZGZA 3VM6A 3S44A 2VPPA 5HFJA 4XYEA 1NUHA 3IP9A 3I45A 3GEPA 3D31A 4RH0A 5CGZA 1BCRB 5ESXA 2PRSA 1BX3A 3I0ZA 4UQLA 4F93B 1GCUA 2VSOA 2GLXA 4G0QA 1NULA 3THYA 3CXUA 1E6UA 1AH2A 3VR2D 3GEBA 2BH9A 4B17A 1JECA 1EFVB 3FNFA 2G3YA 4HG2A 4QDZA 2XUOA 2CL6X 3EZYA 3JQRA 5IANA 4F6RB 3K0SA 2E5LB 2Z2XA 1QG6A 2ZIWB 2FSGA 1KO5A 4GP6A 4CLOB 1ZMOA 3G0HA 3NFRA 1ZMRA 5IMSA 4H7PA 3T5CA 1NI5A 1O94A 5CLJA 4TYNA 2EF1A 1J1IA 5C51B 2R1VA 4DCVA 5A4FS 2NUAA 3Q7SA 4RTQA 1OHHA 1V1MB 1KOFA 5FWNA 3QP9A 3RADC 3COJA 1W19A 1XTRA 3M34A 3OECA 4AWBA 1TYEB 3BMQA 4G37A 5I7RA 3I28A 2GH1A 1J5EB 2ORVA 5I7FA 2FI1A 3SXPA 3TAUA 2JVKA 3COSA 1OHHD 4C01A 1NV8A 3DXYA 5JYDA 2XB2A 2KPOA 2VYNA 3DVLA 5EJEA 2W2OA 2BKEA 2P6MA 3PIDA 1QHFA 3C98A 5EJAA 3RVPA 5ALNA 4ILKA 1XMSA 4O2BB 2I2CA 5ALWA 1KYVA 5AM4A 1KVRA 5D1NA 4HQOA 4MROA 2GOYA 1KJYA 4AZVA 2GO7A 2X1VA 1SOAA 3QOWA 4UJ3A 1P2TA 1V8ZA 3DQQA 4PAGA 1TJ4A 4ICIA 2IIBA 4WKGA 4ZI7B 3R6LA 5CT8A 3SJUA 1A8IA 3KKMA 1JJIA 3DE5X 4BB6A 2BFBA 3OJLA 3S6JA 2LZ0A 4IQFA 1ZM7A 2ZIFA 3HFJA 3OC6A 3QVUA 4OBEA 2X7XA 4H2DA 2FUCA 4K6GA 3CONA 3CLRD 3UATA 4GYKA 1GNPA 4DIUA 5JH7F 4KRYA 3IKMB 2ZE8A 2ISSD 5H16A 5IC6A 2HF7A 3ZIUA 1CUYA 4YP9A 2QJFA 4LYGA 1GRCA 1PBNA 1AF4A 1K86A 1FS4A 3EYWA 5IH3A 2WWWA 2H5JA 1MAUA 2PU7A 3EDOA 4MRMB 4Y1GA 1W8IA 4LXUA 1DC6A 3UXYA 1QKKA 3DGEC 1Q0TA 2B7BA 2FGKA 4B3FX 3M2PA 2RHRA 1OX4B 1Q2UA 3GGPA 3UXMA 3BTOA 4F3CA 5I8WA 3DMGA 1OIXA 1U2RA 2YWJA 2ZIZA 3L7LA 3LX5A 4MQMA 4QVGA 2NU7A 2CHFA 1A2BA 2Z1DA 1W6RA 1K8XB 4RS4A 5EIXA 3FPCA 2DBQA 1HQCA 4H3VA 4JQSA 1YAHA 4LOLA 1WEHA 4KUGA 4OKSA 2O8DB 4KUHA 1D3AA 1KAHA 1KFKB 2XUIA 3DUFB 2EKBA 2IU3A 1JSCA 1UMBB 3E9MA 3HUUA 3MTDA 1E6EA 3HCOA 1SC6A 3HL4A 1KAMA 2L18A 3OWXA 5I9NA 1VE6A 2GPJA 2XAAA 3AK4A 4HJRA 1NP6A 2IPXA 3E9NA 4MR9B 4R9SA 4ZCPA 1EEXB 4BFUA 5IXJA 4LCJA 3VU0A 4UAGA 4MW5A 3OJFA 1JWAB 5J4HA 3DPUA 3OMXA 2RKWA 4AJNA 4BWGA 3M4ZA 4CMEA 1Q1BA 2DAPA 3F2VA 4Q21A 2ZUSA 2ZTLA 1RZ3A 4JYZA 3WMGA 5IARA 3V9AA 5CD1A 1XQ1A 2QW8A 3KOOA 1HT2E 3ZJ4A 1B73A 5K3FB 1SHKA 4D9FA 2ZZMA 3TVTA 1N2XA 1OWMA 1ZRNA 3OKPA 3R5KA 3ZOKA 4UOEA 2W70A 2BFFA 2QX6A 4KPEC 4Z8XA 2XVXA 1RMTA 3IIKA 3ACBA 2HU5A 4L02A 1UDBA 3EWSA 4YQYA 1Q0PA 3PPVA 3QU9A 3HZOA 4M1QA 2B94A 3Q3IA 4RMNA 3QPUA 3WQHA 1ISPA 4H6VA 4IG9A 2B34A 4HGNA 3ZZUA 1ZFNA 5I9TA 5BN4A 2C7PA 1XJQA 3CCCA 2GQ0A 4EPVA 1GGNA 2E6UX 3IOMA 5TPZD 1M5TA 4X95A 2NVUB 3EF0A 2NQ2C 4KXMA 4WBNA 1CQZA 1T5IA 3FVQA 2WF5A 2LDXA 2I2XB 2JKZA 2JAXA 4R3UC 4BWYA 4I1UA 2IS4A 4IXNA 5AK4A 4RD2A 3SS9X 4EGQA 3BIJA 2REBA 3L6DA 2I29A 1R5BA 2XBLA 4ALIA 1YZGA 1ESCA 3MWKA 3NFYA 3G8CA 1AGRA 1L4FA 3R7LA 3RRXA 3VMFA 3WXBA 4D42A 5DOVA 4CMGA 3GL9A 4IIDA 4YV1A 3BRSA 3V4RA 2M98A 4Z4QA 2CMDA 1SXHA 1ONBA 2RHBA 3DV0B 3GLIA 2AN3A 4CLRB 8OHMA 2OO7A 4J0QA 1DCFA 4BQQA 4FGLA 2YV1A 3O4IA 4OMFG 3V8VA 3TCNA 2ICAA 1H69A 1KRHA 3S1AA 3COZA 5AKYA 1I36A 1YV9A 4KXYA 3MJ4A 4JJZA 3KAPA 1JF8A 2BR5A 4OHKA 4QARA 4QEDA 3UXEA 2V98A 2CHEA 2CJWA 2IDKA 3ZBPA 3D0RA 2WSMA 4EKDA 2C4UA 1V2HE 3RU9A 2PBRA 3UXHA 1G7RA 4PQGA 1Q1AA 1T5DX 4QGHA 3EQ9A 1C4OA 3IMGA 3BMOA 3PSAA 3IKTA 2G36A 2WB4A 3JVIA 5IRCD 2OBBA 1A8SA 8MHTA 2IIQA 5C4GB 1ENZA 3R41A 3JQ7B 4IZIA 1U0SY 4OMDA 3V7YA 4S1OA 1FRVA 3TXAA 1WU8A 3C5HA 2WEKA 4CE6A 1J21A 4Q3OA 3RODA 3WBKA 3TDKA 1JQKA 5ITZB 2P9GA 1PT6A 2NLOA 3BBPA 4N1AA 1MIOA 2NXJA 5HJ5A 1H2RS 1Z0KA 2J3MA 2ZRAA 3EWIA 5JAOA 4KITB 5HBGA 3IDQA 2HGSA 3PQ5A 5JO9A 1NVTA 3CFYA 3BXHA 2ZWVA 1RYYA 1YAJA 2B37A 1FU8A 2JCVA 2XOKA 2Z8YM 1K9SA 1X14A 2NZXA 3AUFA 3D6UA 4FN4A 4JGIA 1QGUB 1ZHOA 1E66A 2ZLBA 2V6GA 3WL7A 2C95A 1E5XA 1Y98A 2G88A 2A1UB 3B1XA 1B42A 5EMMA 1GQSA 3S2EA 2B98A 1XNGA 1G41A 4HS4A 4OEHA 3OAAA 4U02A 2ZTVA 5GONB 1E2DA 3IVCA 1DKRA 4OSEA 1SHUX 3SBXA 4RY2A 3F73A 4WFQA 5HBRA 4CV2A 3H16A 1XVVA 2C5FA 4XGNA 3UHJA 4GKJB 1XCJA 4LWQA 3KLBA 1YWGO 1DAKA 3H97A 2YFQA 4MCHA 3BAFA 2BOVA 3LK6A 4LSZA 4X41A 1QFMA 1W4CA 3K53A 4JAVC 1PT7A 2WI8A 2X1MA 3HYCA 3LX6A 3AHCA 3L0BA 5CYPA 3U3MA 5C18A 1XQ9A 2NVWA 3L9XA 2GM4A 1J5PA 3ED5A 3ESXA 3A9VA 3EG9A 1W59A 2PX0A 2VZLA 5DO9A 3RIYA 1YHNA 1NJ8A 2AYYA 3EXHB 4BN4A 1WXFA 1NBAA 3QX7A 5K99A 1PUIA 5A6SB 1LBIA 4G65A 3FMVA 5DBOA 1SM4A 4XX0B 4I6EA 1BCSB 4MI1A 1J42A 1OZAA 4C7JA 1OB2A 1NM5C 1QRUA 4LISA 1ZGJA 1Q1GA 3UMVA 2B78A 4DA9A 4MUXA 1P5ZB 16PKA 1XZJA 1RKUA 2BT4A 2H48A 2IEBA 2WD9A 3A6HA 2H54A 1JU3A 4KREA 1SIOA 1CU1A 3H04A 4NBTA 1QBGA 3G7UA 3V55A 1YRLA 3ZYZA 1IVYA 3QI2A 4QFBA 3UWPA 4EY7A 1SURA 1KETA 1EVIA 2G25A 4G8DA 2R5WA 2UZ0A 1X7YA 3G1WA 3NHFA 3VYWA 5HJEA 2Y0CA 5JCJA 1GNRA 4FI3F 4XTCS 3LBHA 3TLXA 3ADDA 5LKAA 4P5PA 1GN9A 5K8TA 2O8DA 2D6FA 4ZU6X 4QEKA 1P0MA 3BGWA 2A1TR 1BFDA 1NT2A 1T29A 1VHJA 1WMBA 2PGNA 1XAIA 3FRIA 3K8QA 3NCTA 4RVHA 1Z5UA 1DIOB 3R7DA 4AJIA 1OCEA 2NO1A 2RHMA 4LQLA 4AQYB 4MKFA 2QTTA 1P2BA 1OTYA 2A88A 4MI6A 3LGXA 3GP5A 1R7RA 1ZD8A 1IK6A 4M99A 5CLIA 2VKQA 3SBDA 3II6X 3UV3A 1KS9A 1YR8A 3JAWA 4DWOA 2ZYDA 3M5CA 4LG1A 1SCUB 2VYND 4C0AC 4DDKA 1GT6A 4QHTA 1KI1A 4PGFA 4ND1A 1PGNA 3EGWA 3KQUA 2GEBA 1P6QA 1TK3A 1JLHA 4JENA 2OSVA 4FWTA 4E5YA 4BLRA 3SVZA 2ZBGA 4P3OA 5DYTA 2QDKA 5T7BA 4LZAA 3PE6A 3BD8A 5IUNC 1WCWA 3C85A 1EGMB 3FWPA 2ZROA 5D2CA 1JR4A 4OM8A 4FJ2A 4RF2A 1RWBA 2FY8A 2DWQA 5F7JA 1DAPA 1EWYA 2FSHA 3N7UA 3RSFA 3HI6A 3KVNA 2I3BA 1TRKA 3IAM6 5I7OA 4QEZA 3D3EA 1VZ2A 4YAWA 5KHAA 1NAIA 1VG8A 2VR1A 5KNDH 4LMBA 1TYZA 2C77A 4DREA 3JQGB 3L1UA 4JB8A 3PUIA 1E2HA 2PUHA 2PK3A 3A9WA 3C5EA 3EYAA 5JD4A 5TMBA 3DKRA 3BT7A 4KAFA 3OZBA 2MINA 4G9BA 3GBVA 4U6NA 3GDWA 1DC3A 3HDVA 4FEGA 4M8NE 2FSPA 4N01A 2ZXUA 1G9XA 2ZB7A 4V0QA 3V42A 4DLPA 3OURA 4P2GA 3CUYA 2WU3A 2TMKA 5DCYA 1ZH2A 2DLNA 1JG7A 1WCIB 3NANA 4UHEA 3WV4A 3EVDA 1UZNA 1WW2A 1F4LA 2ASEA 1YC5A 1YR7A 3IAAA 2IU0A 1KU6A 2FW9A 4MTCA 1HG1A 4CG3A 4CKEA 3V8BA 2AWNA 5JEDA 3SF8A 2ODNA 4J0CA 1IUNA 5CW1A 1OPRA 1YR9A 2BMJA 3QXSA 5EE3A 5EPUA 3VI3B 1TM7E 2DJIA 4RFSB 2B4KA 2BCGY 3L0PA 1Y1SA 1XRMA 5K4GA 1X80B 2UVPA 1IM2A 4TMVA 2EFHB 4H4EA 1T1JA 4OXRA 1MA3A 4II3A 3M4XA 2NG1A 1HTWA 3BRCA 1QB8A 4ENQA 2RDMA 3TFWA 3HTXA 2WE8A 2MDTA 3DD5A 5GQSA 2JH8A 3R5FA 2OD7A 4X66B 1VIAA 1RSZA 1SZCA 1V3TA 3L6UA 2DBZA 4GVLA 5ER6A 1ACJA 1K4YA 2RKBA 2IP1A 1M73E 1M0WA 1K3UB 1W35A 1ZCAA 3OPMA 1GTZA 1VHDA 1GQOA 1WM1A 4QRDA 2GK4A 4F5ZA 2OOKA 1SC4A 4E5MA 2R6CA 3DE3X 1CE8A 2WU1A 5CR9A 4TQAA 1UC5B 2H5LA 5ALXA 3NJ8A 1MU0A 2D1QA 3GELA 2GJ4A 3CR3C 1V1RB 4CCWA 3ZHTA 4DFDA 3ER9A 4NV3A 4DCMA 1YGPA 1WEKA 3KLPX 4LF4B 5FNVF 1GUFA 2CD7A 3KQVA 1EJBA 3LT1A 3OC0A 4D3XA 4EVSA 3U5TA 2BSQA 3C8UA 4CIVA 4TM8A 5CXXA 1AQYA 4PGGA 1C8LA 4NCKA 4YJFB 2Q4OA 3R24A 1LPNA 4KVGA 1XFAA 3IP5A 4N9QA 3ROFA 1XLTA 3U6KA 2PLWA 2V3WA 4CL3A 5KX5A 1SGWA 1G6OA 1NPTO 4UOZA 1Q7BA 2J1LA 1CDOA 3BMXA 4UUQA 1VE5A 3ZHBA 2ZI5A 2VF5X 1W5AA 1OU0A 5JYBA 4ZZIA 4KPGA 3H5IA 5DRTA 3V1LA 2HNKA 5C37A 1NXTA 5AVSA 1C8KA 3DEFA 4OYYA 2IOHA 2G8LA 1DJOA 1QX4A 3HKCA 5K0BA 4XWGA 4NBRA 4CM3A 4OGWA 4O4HA 3QMVA 1ZY2A 1CR1A 4D3FA 3Q3JB 2N75A 2GCPA 4MOWA 2BGWA 3W6UA 4CM1A 4H17A 1PR6A 4YJHB 3LHFA 3HL0A 2FG5A 2D2VA 3LUAA 1X94A 5DLDA 3S5UA 4E5PA 3OIDA 3BXEA 4ENVA 5E4TA 4RKFA 4BQSA 3E3MA 4F92B 5JZOA 3G0IA 1Y81A 2PHZA 3FAZA 3B2NA 4CVNA 2Q1YA 2DTXA 2VRNA 1Y80A 2IWRA 3ZNQA 2AW5A 5AVXA 1G20E 1YFZA 5HS4A 4J0EA 2BR3A 2YL2A 4TV9F 2CHUA 4IJQA 3G2QA 2XQVA 1ZOIA 4JFRA 2PUAA 1RW4A 2C5AA 1XEWX 1DMRA 4D0LB 3HBJA 1HBJA 1L7BA 4JB3A 3R7AA 2JAHA 4O4IB 3TGLA 2YTZA 1ZJ5A 4AVYA 1B6TA 2ZRMA 4C0WA 2C84A 2BJWA 2FN7A 2QAIA 4RW0A 3C8HA 1EAYA 2QIOA 4QT0A 2XEDA 3E35A 1TYAE 2ORIA 3DPIA 3L8CA 3FZQA 2G8NA 4DIEA 1CZUA 5BN3B 1LSOA 1PCXA 3FLEA 3Q1KA 4CWAA 3KXIA 3OM0A 5BSFA 5E8RA 2R8XA 2ZRPA 4WEOA 1YR6A 1Z0DA 3LPAA 3PBKA 4IMRA 2O5CA 2XE4A 1XXLA 4B3RB 3TZKA 2PMEA 1GZ7A 3MJEA 3NHBA 5FFMA 4R1NA 4URWR 5DI3B 3SKXA 1RZRD 4LX0A 5A03A 4UHFA 3S2GA 1BG6A 2QBYA 1NP3A 1VKRA 3L7JA 4A10A 3QKIA 3D8HA 4UHKA 4B2IA 3LMKA 5HP4A 4PN7A 4UD2A 3GRUA 2OECA 3BORA 3WHIA 3WVNA 3JQBC 4F1KA 1R9NA 2R25B 5JXWA 2RGYA 4N8EA 3EH2A 4QAQA 5DN6D 2C97A 5DGCA 3FUUA 3SLKA 1Q74A 2PL1A 1LBEA 2J5KA 3ZV5A 3AESB 2JCSA 1FLDA 1FUEA 1KYZA 3LP6A 2GN4A 2QX8A 3LCCA 6ABPA 2GRUA 3CVJA 2PQ2A 4LOJA 6YASA 1FUIA 4LBWA 4X1KA 4ETMA 3NUZA 4P33A 2PIDA 2ZTUA 3C4JA 1J99A 4PBSA 4LF9B 1GA1A 4MQ6A 3FBGA 1IXRC 3RKUA 1FP7A 1E1CB 1YQUA 5L40A 1C2YA 2XB4A 5LQNA 1R6XA 4ZT5A 4XD2A 621PA 1PWYE 1SK8A 1T9HA 4JHXA 3FSRA 3PV0A 5HKLA 3SQNA 4BS9A 2DMRA 4QYMA 2NZYA 1F8FA 2CHGA 3O03A 1N2ZA 1S9HA 4NAVA 4URFA 1NL3A 4DBZA 1UIMA 5E1BA 1R4MA 2TMDA 3PC6A 4H0NA 2BM9A 1GQYA 4QPCA 2AHOA 4DYDA 3C43A 1J2UA 2XNDA 5C52B 3GUVA 1OAOA 4LGCA 4EI2A 3A0UA 3ERCA 2GF0A 3BXZA 3H8VA 2YZGA 4U9IS 1M33A 1X3SA 2NV2B 2VCHA 4H08A 3EY9A 4V2UA 5AJXA 4C6TB 1W36D 2H08A 1TKRA 3E1GA 3O8QA 1PYGA 4K3VA 4F3KA 3GGOA 1AZSC 1EWTA 3GZNB 4EG1A 1BU5A 1MHPA 4UBLA 5LYJB 2NU6A 1RMYA 1VIMA 1UBLS 4LKRA 5FO1A 1DRJA 4KFSA 2GUWA 5FDFA 3H4MA 3PTAA 1HFEL 3UH0A 5IN5A 2J46A 3RG8A 5JH7B 3UWSA 1Y7IA 4QPPA 3R5SA 3LD9A 4QDTA 5BVGB 5IBQA 2B35A 4JFAA 1HT1E 4YT8A 3TTVA 2XYQA 1EK5A 4YTEA 3BIXA 1SB8A 1GPAA 2ZXFA 1Z2AA 3VPAA 3H2SA 4IQ4A 3KO8A 2O05A 1SVOA 2H4FA 4U7HA 1OOEA 5CPFA 5C1IA 2W42A 3CH5A 3VPCA 4EL0A 2H31A 4MA4A 4C0HA 3MIZA 3RQIA 2WHPB 4UEKA 3ZWMA 2EL7A 1U4NA 3PUYA 3ZCRA 5JRDS 3W8RA 3VDMA 3NBMA 4MB0A 5IBCA 1DDOA 2VEOA 3KKEA 4R8SA 1P7WA 2IYFA 3BJRA 1XZAA 3TLKA 2AZDA 4KO3S 1Z6XA 3TSYA 1QYCA 2YV5A 4RZIA 4X64B 1TA9A 2F43B 4MXDA 3HHPA 3OU2A 2R8EA 4U5QA 6LDHA 3K1AB 3L0YA 2YUTA 4CTNA 1EQ2A 2X5OA 2XA1A 1MXFA 3M82A 1LI5A 1X7WA 4MGZR 5BW6B 3FRJA 2MSKA 2Y67A 5G02A 1OROA 1ZQ1A 3DEKA 3D64A 4RVSA 1LVGA 1YZFA 3TF5A 1JX6A 1MR3F 2AZ4A 3RHTA 1EAMA 1RVV1 4IDDA 3UWMA 2DUMA 2ST1A 5FNZA 4C4SA 1Z74A 2HWWA 2QPLA 3KKNA 5ADUS 1KEKA 1XGKA 1Z9BA 1ZOPA 3BGIA 3DZHA 4FDTA 2AKYA 1USIA 2IHYA 2Y0DA 3WIVA 1A7KA 5CNJA 2FMIA 1L3IA 1G8SA 4KQXA 2ZS7A 5FUBA 3T5PA 4E09A 4PQFA 4Q66C 4KWIA 4Z9BA 4DNFA 1I5OA 3CLSD 3PITA 5HQ3B 3EF3A 2WMNB 2IH5A 1TUGA 2W71A 3JQ9A 1RLJA 3KOMA 1X7XA 3P5SA 1T13A 5KDOA 1RAHA 1UMBA 1H5NA 2ENWA 2IVFA 5F5LA 2QTAA 2QYTA 4Q3DA 4C76A 3VHQA 2Z3ZA 1ISGA 3D81A 2IUEA 2EP7A 4IX9A 3HR7A 4RA9A 4QELA 2HHAA 3KJNA 3SQMA 1N2JA 1PU2A 4AJ2A 1IUKA 4ISBA 5ABPA 4ZYTA 3A9CA 1Z12A 5LOVB 4AT1A 9MHTA 3DF9A 5DNCA 1MO3A 1U99A 4W5WA 4GF5A 2O8FB 4S3MA 2H8KA 3MB5A 3U3XA 1UQTA 3AU9A 1YCHA 5I9SA 1XE3A 2WWHA 3OQ1A 3GIDA 1OWOA 1RP1A 2PZAA 4J91A 4YC7A 1MFPA 3BTUA 3AM3A 1X2BA 1Q92A 2GVZC 1U8TA 3VJRA 3ZLUA 4RH3A 1H1DA 2DFPA 2ZSHA 1TB4A 1DTWB 3LKVA 3LQQA 3A9UA 1YCFA 2W0MA 1PNOA 1V7CA 3A6LA 4D9IA 4UE6A 5JANA 1JSLA 4L4RA 2ZDGA 1KFBB 1JHDA 2XZDA 3IPLA 3JY6A 3LUDA 4Y2UA 3T38A 3RUAA 4B6SA 1NUTA 3ZKAA 1V2GA 2R2GA 3DH0A 5JVDB 2H52A 1L5SA 5JPDA 2VG8A 5BW5A 1EX9A 2GCIA 1G8YA 3AERA 3KDPA 3M5PA 3KP1A 5C2JB 4IX1A 5K3SA 3OM8A 3SD7A 1GKYA 2Z4SA 2AFIB 5CFPA 1BE6A 1W25A 1E0AA 1NVGA 4EUNA 1G3QA 3GLFE 3DDWA 1PSZA 4MUEA 4AUKA 4RD3A 1TK2A 4I4LA 1C2TA 3HH8A 3OFKA 1OH5A 5MFZA 1PTJC 4H1TA 4N0DA 4PRLA 4YYEA 5K3CA 5K0GA 3ADBA 3OEED 4KKXB 3IQHX 1ZISA 4BBZA 4YRBA 3HI4A 1LJUA 3WO1A 4HX9A 4QDKA 4F1JA 5D85A 2M2IA 1G59A 5F52A 2A5LA 5U4XA 1QYXA 1W48A 2NV0A 2VAPA 2WIAA 3KZ1E 3OKCA 4J76A 5EWMB 3MGBA 1NUAA 2DECA 3Q0TA 2D5BA 4R8RA 3G5AA 1FNDA 5J43A 4HQFA 3DW1X 3QYFA 5JCPA 1KEVA 1E0KA 1WE2A 2ID4A 1TL7C 3TLAA 3ROMA 1AB5A 4Q7MB 4PM4A 2Q5CA 2I91A 3AKEA 4EPTA 1II8A 4MH0R 3O8CA 4IFTA 5FQNA 2BTOA 4M9ZA 1J23A 4YFYA 1NVVQ 3HFSA 4HRYA 2X58A 3L01A 4ZYWA 5KB3A 3K7EA 4KQ2A 4UDXX 5DSXA 3S55A 1RQXA 3ZE6A 3LBYA 4HPJB 4N9WA 1K7EB 1CJSA 1JHAA 3OLYA 3UCXA 4MWCA 2HF8A 2WSSA 3FNEA 4BQPA 3NONA 5HJ2A 1I4LD 3QLVC 3K0FB 5FBLB 2VTDA 3REGA 3RGGA 3W05A 1DXYA 1G7CA 8ATCA 2GZSA 2WAMA 4LW8A 5AICA 1N34B 1UJMA 1A0OA 5DKFA 4F21A 4AMZA 1SVLA 4I4CA 4EHLA 1LVHA 4RJ2A 1Y3HA 3HWWA 3S2UA 3NVMB 4P3NA 3U3KA 3K2BA 4FS8A 3A7EA 3MYRA 4LJ7A 4LDQA 5A6VA 1XTBA 5LOVF 1CZNA 1BS9A 3MPOA 1A5SB 5EHXA 2YXPX 4YROA 3OQJA 3MCAA 3RE1A 1J2RA 2JLSA 4TT3D 2D1YA 1COWD 3LUKA 3PXGA 1F06A 5I47A 5A62A 3RFXA 1JVBA 3SP1A 1VKHA 1Z07A 4Z9XA 3W79A 4JIMA 4I9GA 5KWJA 3NAZA 4JNKA 4KFCA 2ZRJA 4LRQA 1Y34E 2HOQA 2GUGA 2PPLA 3RWMB 4Q3KA 3ABIA 3K9LA 1FPMA 4IFBA 2JK0A 2NZ8A 3JQ8A 3WGIA 4MKIA 4HYEA 2PUDA 1GOTA 1H5QA 5KOJB 4ESVA 3UB3A 2AJCA 2PMCA 3DNPA 3DKIA 2QI9F 4RFSA 4MUAA 5LA6B 3RANA 4D6XA 3DDUA 3F8WA 4K03A 1WZEA 1AF7A 4YYZA 2HJHA 4DV3B 3IJ5A 1NUQA 4ECAA 2HWXA 1SBYA 1HOXA 5BV8A 3UGJA 4QUGA 3GP8A 4K9KA 4REMA 4UOQA 3AEYA 4U2FA 4B6OA 4F85A 3V6LA 2FFHA 3GEMA 4TLBA 3SYKA 3WWCA 2Z5FA 1U3CA 4X1IB 3SYLA 4OJKA 1BJKA 3ZNNA 4YCJA 4EK9A 1J97A 3OLXA 3W5HA 2HMUA 2YJGA 5LFAA 3HXQA 2V1XA 1EBBA 4PVCA 5K3EA 2I71A 1N9GA 4N0QA 3ZDCA 3ZD7A 4QFCA 5EZ6B 4BKOA 2Q07A 1T2VA 1XMPA 3EGEA 1F2UA 1N5MA 4IIJA 3KQTA 3SXUB 4B34A 5K0TA 5J4LA 2ZRDA 3IBYA 5JG7A 2VFAA 3VPGA 1DXQA 1X1BA 3K5WA 1MOQA 3LFHA 2VHJA 4KN8A 3RS5A 1REQB 4AQ7A 2D7JA 2C1EA 3ZY4A 2D0OB 3CNBA 3U3DA 3G2IA 4OV6B 3H5WA 2X41A 2CHVA 4HDSA 1ZDMA 2IUUA 1R0WA 3R4VA 2ZJ7A 1ADGA 2GMWA 3HFGA 3K2IA 5F12A 1QYIA 4YJ3A 2HDOA 5EOVA 5L3RA 4EUSA 3IDOA 4HEHA 5TEWA 3QFCA 3LHKA 3KXDA 3PC3A 2BTQA 4M8SA 4QUDA 4RKQA 3QF7A 1R4NA 1XQ6A 4R2XA 1BEUB 2ZVQX 3TSWA 2W2KB 4C0KA 2ZETA 2GAIA 4PG5A 4DV6B 1T25A 1I4EB 4ZJYA 3G8AA 4BE9A 4AO8A 2VDVE 4K1LA 3RS4A 1RJFA 1TIPA 3I9KA 3PZRA 3QMPA 1CDZA 5FYQA 5TVKA 2FWJA 5FOWA 1P81A 3H1BA 3B1FA 1MCZA 1N6OA 2QRVB 1L5OA 1MO5A 3WSVA 1Z17A 4IFIA 1G19A 1ZP6A 2Y1EA 3EPLA 4RESA 4A1OA 3H87A 3PYXA 4RLHA 5K05A 4KCGA 1O6FA 3NBZC 4JC5A 1MVLA 4PFKA 1NRXA 5JAZA 4IMJB 1VECA 4NF2A 4ZYUA 3MT8A 5TY0A 5LXTA 1Z0ZA 3QUSA 4DCJA 4CQJA 4J16C 1NWCA 4MW7A 4YECA 3MPUA 1AS2A 4QUBA 1P80A 3QYJA 1EDOA 1XVAA 1QHIA 1Z15A 4AS3A 4I8IA 4D8UA 1E0DA 1Z88A 2O8BA 1UJNA 1YQTA 2F3TA 3OPNA 4XIIA 1SELA 4KQEA 1NDHA 1SIBE 4BZWA 1RJEA 1Y7LA 2KLBA 3B9PA 2FW6A 2FWRA 2VA9A 3PD1A 4ZQBA 1A98A 5A1JA 4FGSA 2B5VA 2D3TA 1O03A 4O4LA 2FTKE 3KPVA 3OFND 2R62A 3R6TA 4QULA 3EXFA 4TKVA 1VL1A 4Q7QA 1YUBA 1AKNA 2J9FB 3ADKA 2X86A 2HUPA 3GVPA 3CSSA 3KQOA 3PNBA 4PX9A 1M2OB 4E70A 3NIWA 4DM4A 4WNAA 1OH8A 3FGZA 2M32A 1CEQA 1Z68A 2QD5A 1M34E 4UM9B 1VC2A 4WQMA 5JJLA 1SXJB 1RXCA 2ZGVA 3QM1A 1UPFA 5LNK6 4EYKA 4H4CA 4WV3A 5LQSA 4RULA 1AM4D 1E92A 2SNIE 1KSFX 4TTTS 5B4TA 3KEGA 2GN9A 1PV2A 1O58A 1ZXLA 1PVDA 1ZVKA 2PZKA 5E7QA 1LBTA 3NDRA 1LF5A 1M6VA 1C3XA 1VL2A 2ACEA 2IP2A 3SX0A 4DHWA 2ATCA 4XM0A 1XPRA 4OUKX 2IV2X 3PX7A 4DCPA 4U8GA 4EEZA 1V39A 5LPNA 4Q7JB 5JDIC 5FL3A 2C2ZA 4L8VA 4KW7A 1Y1RA 2GZ3A 5JAUA 3FFBA 4LJSA 1OXVA 3B20A 5T5QA 3EWNA 3NAQA 5JC1A 3T0FA 1VBNA 4WLFA 1MJHA 3IR5A 4KLAA 4AJHA 4BP9A 4AO6A 3DWGA 3NBAA 1YDWA 3LX4A 3AI3A 1IY2A 2X0NA 4F5WA 1LFAA 2Q5QA 4DRYA 5IVPA 1I4TD 1TAQA 2ODQA 4UBIA 5ALSA 3OX1A 1VFPA 2QL5A 1LPAB 2VJOA 4N82A 3SK0A 4D9MA 5F7OA 3ZDAA 4AKHA 4DA4A 3GMDA 3MFQA 1RLTA 2RJ3A 4YRCA 2E7ZA 2OCGA 2IS6A 4FS3A 1SVNA 3ZEAA 1IFXA 4MYHA 1ISMA 3FDZA 5ALLA 1PHRA 2G1UA 2HK6A 2ZBUA 3ETNA 1VIVA 4LRSB 2BZGA 3TAHA 1VKJA 3N8NA 4UAUA 2FYTA 1IAQA 2QSUA 5ITSA 3A4VA 4IDBA 3SJZA 2OCBA 4JMPA 4B3SB 3MS2A 3CHYA 3P1JA 4UMEA 4G86A 4HLUA 3VC7A 1AK1A 4WW0A 1XDZA 3ZQ4A 1KPIA 1P4HA 2VJDA 2XWJI 3CLKA 1NQUA 5H70A 5IKXA 2MWMA 2C3YA 1EYZA 2IU4A 2X3FA 5I9MA 1VMIA 2QD3A 3N3AC 5BSMA 4D97A 3EGCA 2IE0A 3CRQA 3MILA 3RWOA 4YAUA 4NZMA 3WSWA 2HCBA 1H1LB 3QITA 1O8CA 4M54A 4DDMA 3P2MA 1N25A 2JZNA 2HCRA 4F6LA 5CFOA 3TX2A 4KVFA 4YDQA 4KAXA 3K72B 5PGMA 3GB9A 4N6OA 3LUGA 3IVAA 3IE2A 1XIVA 2HIAA 2QLMA 3EDMA 3FE2A 2BBTA 2F3QA 3MRXA 3O94A 5C0OE 3NIDB 1UPXA 3GI1A 4Q4AB 4M98A 1L5RA 1NM5A 1E3LA 1K8QA 2PRYA 3EVNA 4CLEA 2AFHB 3T9AA 4M0EA 4JI7B 4K9RA 4RIHA 1RC1A 4P0QB 1PLKA 2UYHA 1FS5A 1NLZA 1PR9A 2Q6LA 3EEIA 3G1UA 2O3QA 4IKOA 5AJWA 4YP1A 3TVYA 3TLGB 4OLAA 4MKGA 1BHQ1 3WK6A 4FLEA 3RU7A 3SC4A 1P75A 1M5RA 4Q02A 1VPTA 10MHA 4NENA 2EERA 1LSJA 1U3GA 1KORA 3ETJA 4KAAA 2QU7A 4G8BA 3ZWWA 2WV7A 2O2JA 3C24A 4QXRA 2N1MA 5K3FA 3T9BA 4AUNA 4E4RA 4OJTA 4QREA 2E4WA 1TGVA 2ZM6B 4E46A 3NALA 2RH5A 4D3ZA 2CE2X 3TBFA 4MLDA 1EH5A 1XU4A 1JB9A 4NYIR 4PS0A 4V03A 4WESA 4TKUA 2P0AA 4W63A 4XQEA 1SD2A 3MXTA 2FZKA 4P2BA 5FT9A 3CH4B 4J0DA 2RGNA 4EBFA 5JCJD 2O8CA 2I2WA 4XD7D 1M6HA 4PIPA 4FSHA 1YIOA 3SQDA 2QORA 5EZ5A 2CDRA 2R2AA 2WJPA 3MZ0A 4RVCA 4D0NA 1IUOA 2X7JA 1RWOA 1II9A 1B7GO 4YREA 1H1LA 2N0SA 4P34A 3R09A 2G9QA 2GD2A 1YZVA 3OA0A 4EL5A 3GN1A 1OA0A 3C1UA 3PPYA 4ZQCB 2EKZA 3JQCA 1M0EA 2NVOA 3OICA 4Q3CA 4M7RA 4HDRA 1MQAA 4RLSA 1JXMA 4EPWA 2OCKA 1XLVA 1Z56C 1GITA 1T5OA 3KB2A 1AQUA 4P53A 1DG1G 3ORRA 5DIZA 4TVBA 3KYDB 2AJLI 3LCJA 2VA8A 5EWJA 2Z2YA 3PA8A 1UEXC 2BMDA 3O4JA 3O26A 3O1LA 3IHTA 5CCXA 1EP9A 3FOAA 5TQJA 4TRJA 1J7KA 1YL7A 2GF2A 3BL8A 1Z6ZA 1V5WA 5EE9A 1ZS9A 2NYAA 3SKVA 1ZG3A 2D2IA 1DWUA 3NJRA 4A2QA 1XRPA 2GNPA 1I01A