1Q7BA

The structure of betaketoacyl-[acp] reductase from e. coli in complex with nadp+
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
243
structure length
243
Chain Sequence
NFEGKIALVTGASRGIGRAIAETLAARGAKVIGTATSENGAQAISDYLGANGKGLMLNVTDPASIESVLEKIRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVGTMGNGGQANYAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTRALSDDQRAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGGMYMV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cofactor-Induced Conformational Rearrangements Establish a Catalytically Competent Active Site and a Proton Relay Conduit in FabG
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
total genus 85
structure length 243
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2003-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1q7bA00
5CPBA 4UEJA 4R1TA 5L7YA 2W2LD 3UUWA 3E48A 4E5NA 1K6XA 2VUTA 3FPCA 3JQ6A 4B4WA 1ISFA 3TOZA 2I3AA 1E77A 1EZ4A 1VC2A 3H9EO 3KYBA 4UAGA 1IB6A 2VOJA 3WWZA 3WYCA 2WMDA 1G0NA 5MDHA 1DC5A 4Z9YA 3QWBA 5HRUA 3CTMA 2IRWA 4WK6A 2BRUA 3IKTA 3V8BA 2EF1A 3L4SO 3KBOA 3Q1LA 1PIWA 3AUAA 5T6BA 3QWIA 4DMLA 4U0JA 1D7OA 1YJ8A 2Q1SA 2G5CA 2I5PO 4QO7A 2OBYA 3KVOA 1YL7A 3SLKA 4OMUA 3VH4A 1UZMA 1YRLA 2PKQO 5JFOA 1FMCA 1Z74A 3UVEA 2AQ8A 4G81A 1YDEA 1PQWA 4YAEA 1T2AA 2BI8A 4NBTA 3TZKA 3COSA 1J0XO 1GCOA 3FWZA 3H5RA 4OXNA 4HUJA 1EFKA 3DWFA 1I2ZA 2QG4A 1LRJA 1TT5A 1YONA 4II2A 5BSGA 1E3SA 1HT0A 2O4CA 3OP4A 1VE9A 3BMNA 4R1SA 1XEAA 4R5MA 1CETA 1R16A 1M76A 1O6ZA 2B5VA 1IHYA 4DBVO 5L9AA 4FGSA 1LDNA 1QV6A 1P3DA 4KTVE 4A5OA 5ER6A 2PA3A 3H4VA 2A35A 1SEPA 3PZBA 4NR0A 3VPGA 5LCXA 1GTMA 1Z75A 2J3JA 3ASVA 4BQPA 2NTNA 4CLEA 4CQMB 4E5YA 4EW6A 1DIHA 3LVFO 3TNLA 4R16A 2X22A 4YJHB 4MP6A 1O5IA 5CHEA 1YOVA 2V6MA 4XCVA 3U4CA 1EVZA 1O8CA 3V1TC 4FFOA 1LDGA 3KYCA 1YKFA 3VTFA 3LDHA 4P4NA 3PYXA 1XDWA 3RUFA 2I67A 2AEFA 5I7SA 4IMRA 5DP2A 1DEHA 1EVIA 1JW9B 5JCXA 1WAMA 3AU8A 2ZB8A 4BGIA 1NPDA 5JDIC 3PI7A 4E0BA 4E2XA 4KUEA 1WZIA 2GRAA 3OHSX 4YTEA 3PWKA 1HDYA 1QYXA 5T67A 1U2DA 4XR9A 3WYEA 3ROPA 4ZGWA 4XR4A 4QX6A 1ZSYA 4WASA 3H65A 4RPGA 1GD1O 1AXEA 1MC5A 1R4NB 1R66A 2HCTA 2NTVA 4CUJA 5L7WA 2Y1CA 4R41A 5C7OO 4EUHA 1HYEA 1RM3A 2ET6A 3FBTA 4OM8A 4P22A 4EEXA 2JHGA 1V3UA 1U5AA 3PEFA 2O4UX 3D3EA 3KEQA 4Z3DA 5CEJA 4E5MA 3C85A 1ZCJA 1ZK4A 4CLOA 1NX6A 4FCCA 2YDXA 4NJOA 3H8VA 1KEWA 4CQLB 1T25A 3VDRA 1W0CA 1KIFA 1AE1A 4UULA 3GG2A 3DOJA 4D3DA 2H5LA 1Q0QA 2VYVA 3FF4A 2DPHA 3QVXA 4PZDA 4QECA 7ADHA 1BVRA 1C1DA 4M87A 2GO1A 1DPGA 2VUSA 4BO4A 3E9QA 4YR9A 3GPIA 3DFZA 4OSOA 3F1LA 1I32A 1L7DA 1H2BA 2ZQYA 3ITDA 4FR5A 4IDGA 4BKRA 3ZDFA 2PLAA 4FQ8A 4TQGA 1SOVA 1WDKA 3PHJA 1NAHA 3NTOA 1GFSA 3ONDA 1HYHA 2TMDA 4YXFA 4P8RA 3I9NA 4YAKA 2X8LA 1P77A 5U1PA 1N1GA 3ANLA 4XQGA 3WFJA 1EMDA 4EJ0A 3IS3A 1SO8A 4BO3A 4XD2A 5ICSA 1YJQA 1B16A 3LT2A 4BNWA 3PYMA 1H6CA 5K6AC 5C3MA 4XYLA 1H6AA 3T7EA 3F1KA 3OBBA 4Y6SA 1A9YA 1YB4A 5A3JA 1E7RA 1MXFA 2CDCA 4KWIA 1QRRA 1LX6A 3L9WA 4IGFA 2EG9A 2PH3A 1G6KA 3GY0A 4FPXA 4B7XA 1SCUA 3SJ7A 3TRIA 4IJKA 5G0WA 1U3UA 3M2TA 5IZCC 3H7AA 1HYGA 4XYBA 3IIEA 3AK4A 2OZPA 5DCWA 2C5EA 1NWCA 3S2FA 4IDFA 3A4VA 3K8ZA 2I3GA 4J7XA 4IJUA 5JAQA 2JL1A 2W2KA 3HG7A 4YEDA 5HS6A 3DZHA 2OL4A 3W6UA 3ASUA 1HE4A 4O5OA 1ZSVA 4AJ4A 3ZWOA 4W99A 2EIHA 1N7HA 4OQYA 5AQ1A 4C7KA 4E5PA 5G0VA 3VPFA 3ONEA 4J0EA 1D8AA 1ZBQA 1ISGA 1C3VA 1PGJA 2GSDA 2VTDA 3HFSA 4MJLA 3TOXA 3ON5A 5B1YA 1B8PA 3I1JA 4NBWA 4DL9A 4O63O 1WPQA 4DQUA 1F8FA 2IEBA 5C37A 3JTMA 2ZIZA 3HE3A 4AJKA 4IXTA 6ADHA 2BFAA 3OEYA 1LDBA 4B4VA 3EZLA 4MINA 2NM0A 1VI2A 4L4RA 4MVJI 2WD8A 4U6SA 4FFNA 1DAOA 4BO0A 4LISA 3EDMA 2AXQA 4BV8A 1NNUA 4U8GA 3A1NA 3QW2A 1DAPA 4PZCA 4UVGA 1ZK0A 3BTOA 3MJEA 1PS8A 1PR3A 4MVJM 4PLWA 4CM4B 5FEUA 3LSYA 4A26A 3KO8A 4PG5A 4FJ1A 2NVBA 4UVEA 2HKIA 1CWUA 5AOVA 4EUFA 2JCVA 1QG6A 3TZQA 2DKNA 4YA6A 4M1QA 1MFPA 1M2WA 5JSFA 3WNQA 2I76A 3GOHA 4R69A 4AG3A 2WD7B 1PJSA 1DLJA 1OI7A 3ZWYA 3HQ4O 3A9WA 1WNTA 4BKUA 3UN1A 2OMEA 4E3ZA 3ICCA 1FK8A 2VRCD 3EVNA 4KMSA 3EW7A 4FDAA 1LBEA 1KY5A 1EE9A 4UUNA 2ZTVA 4CV2A 1O95A 1N7GA 3U49A 5THQA 5TC4A 1ADGA 1R0LA 1WMAA 3TZHA 2AG8A 5IF3A 5JDIA 5MGBA 1I2BA 2EP7A 4G2NA 1E7MA 3W4IA 2O3SA 4XB2A 2LDXA 4BGVA 5JCJD 1ZFNA 5L3ZA 1E1LA 3B6ZA 2J3HA 4Y6PA 1WXDA 3I6IA 4I9HA 3IUPA 5IN5A 5T8KA 4BMNA 4BO5A 2VT2A 3GVXA 4E6PA 2YQ5A 4DLAA 1NQAO 4A10A 2GN9A 1LQTA 2CDBA 2IDZA 2FMUA 3HDHA 4WNIA 3RBZA 5I9NA 1HE2A 1RYDA 2YFHA 2NQTA 3RASA 1FDWA 4IUYA 5IZCA 5JO9A 4F45A 1DHTA 4LGVA 5JC8A 1GPDG 4DYVA 5CG2A 3I4CA 4AJHA 2O50A 4IS3A 2FPGA 1KC1A 2VZ8A 1F17A 3G17A 4D45A 1K3TA 1FDUA 3F3SA 3PGXA 4QUKA 4CR6A 5JDCC 2PK3A 4RZIA 4TWRA 4ID9A 4ZQBA 3WIEA 3KRTA 2XPCA 5JAZA 1P1HA 5B37A 4MVJF 4ZD6A 1NYTA 3BMQA 3W8DA 4ZQHA 2W2LA 1KS9A 4XZ3A 3P5SA 1KVQA 1LNQA 4R5HA 4JROA 3QVOA 4H15A 4QSMA 1DRUA 5G4KB 5ITWA 4ESOA 4YJGA 1P31A 2C2XA 1NHWA 5H82A 4IDDA 2Y1FA 2XF8A 4KOAA 4MKRA 2FN7A 2JD2A 3C7DB 2Y67A 4CR8A 2O48X 5KJCA 3V1YA 1M67A 2DPGA 3GEDA 4BNHA 3DAPA 3WBFA 1KC3A 4K26A 3GT0A 3OJOA 3U4IA 4GX2A 4RVGA 4ZICA 2B37A 1B3BA 1BDMA 3PQDA 4XIJA 4BNKA 2Z1NA 1ID1A 4JQCA 3RAJA 4BQRA 5L40A 1X0VA 3W8EA 1TT5B 1XG5A 1ZEMA 2DC1A 4BNMA 2GN8A 5A9RA 3ANNA 2EKQA 1CERA 3JQAA 4IY1A 4CM9D 1P0FA 5TNXA 1I33A 4J16A 3BTUA 2R00A 3RC9A 2OORA 3WX0A 5J23A 2YHUA 4YRAA 3N7UA 4YT5A 2ZYDA 4GLLA 4MVJD 3K31A 3GVHA 5JY1A 2NLOA 1FJHA 3BMOA 3QVTA 1GU7A 4WLNA 1HDCA 3GN2A 4BO2A 5DDIP 2IZ1A 3L6OO 2EJWA 2HMUA 4AVYA 1R4MB 4YJHA 3JQDA 4HFMA 2FSSA 2HRBA 2JAPA 3QSGA 3G3EA 2RIRA 1YO6A 1GEGA 3LF1A 5KNLA 4EYEA 1AXGA 3NV9A 4F6CA 2PGJA 5JNLA 1YQXA 2PKQP 2CY0A 4G65A 3F5QA 1ULUA 3WGTA 2Y1OA 2C2YA 1WWKA 4DYDA 5TJHA 4E31A 1UP4A 5T8KC 4J1NA 4RDHA 3S2EA 2E37A 5ER9A 5F1KA 4NK5A 1KVSA 3PJEA 5CP8A 5F5NA 4B3IA 4NU6A 4CMAA 4BO8A 1JVBA 2WYUA 3NT5A 1KY4A 3RCBA 2DTDA 4MVJP 2PZKA 2Q2WA 3OJ0A 4G5HA 1QXSA 4NH4A 4YWJA 3INTA 1NXQA 4Z6KA 2FOIA 2VRBA 1LDMA 1CQJA 1WZEA 2B4QA 4JJGA 4XA8A 2Q2QA 4A7PA 1SAYA 2OFPA 5DBIA 1GYPA 1Y7TA 5G4LA 2CUKA 1PZFA 4CLOB 4PLFA 5IG2A 3EMKA 4K28A 1UUFA 4II3A 4XB1A 1E7QA 5JS6A 3GGOA 1EEHA 3OM9A 3OICA 1HE5A 1XA0A 4OIMA 2VUUA 2W4QA 5TX7A 3VHRA 3ZU3A 4CPDA 1PX0A 4RF2A 3X2EA 1E5QA 2Y66A 1GQQA 2J5QA 4Z0PA 4IGEA 4J4HA 3U4DA 4R4JA 3WFIA 2PH5A 4XDYA 4BO1A 3ZV3A 4MKXA 1P9LA 1PQUA 1J49A 1X7DA 2ZCVA 1ML3A 4H3VA 5T57A 4XX0A 5IDWA 3ULKA 2OP0A 1C14A 3QQPA 4DBZA 4WJZA 2X9NA 1JTVA 5GY7A 5I8ZA 3HFGA 5TIIA 2FWMX 3AFMA 5TLSA 3DTYA 1OMOA 4PLHA 1ONPA 3QJ5A 2FPPA 1D1SA 1YOVB 2G76A 5GZ3A 3QWHA 4MIOA 3D5TA 4O59O 2GZ1A 4WEQA 1ZMTA 4CMEC 1J5PA 1MA0A 2BH9A 1PGOA 1WDLA 6LDHA 5F21A 2H9IA 4CR7A 4GKBA 2NTJA 4DQXA 2JFFA 1LEHA 1DSSG 1OC2A 2OO5A 4TRNA 1LSOA 3CZRA 5CEEA 4CQMD 3PXXA 2CNBA 1U3WA 1R0KA 3VTZA 4PLYA 5TS3A 3O8QA 4F6LA 2YV1A 4QEDA 3CEAA 3F9IA 4NBRA 4J43A 1BW9B 5B4UA 1LSSA 3C1AA 3RC1A 2FZEA 1N92A 4E33A 2CFCA 2YJZA 1RJWA 4XGIA 1KBZA 1SNYA 4ND5A 3S2IA 3WLFA 3JYNA 3R3JA 4QTZA 2PZJA 3WR5A 2OBNA 5B12A 3ROMA 5JO0A 1LTHR 1HF3A 1U7HA 1X1TA 3MJCA 5ENVA 3VVBA 1QMGA 5ITVA 3GHHA 4E12A 3MJSA 3G79A 4B8ZA 2RCYA 3V5NA 4MKZA 4DQVA 1PU2A 3JQ8A 3GRPA 3PPIA 4PZEA 4FB5A 3FBGA 5DOZA 2GASA 2D4AA 5KIAA 1CEQA 4AJOA 1KEPA 3UOGA 1N2SA 3EHEA 1HDGO 3GNTA 4DGSA 4OXKA 4PFJA 1ISHA 4XQCA 1DIBA 5ILOA 2J8ZA 1ZJZA 3NEPX 1PL8A 4YQYA 2ZATA 3QVSA 3I9MA 3FCOA 1CQIA 4FGWA 2D5AA 4IZIA 1VL6A 4R51A 2NADA 4PLGA 2EHDA 3NGLA 3WXBA 3C3XA 2FR1A 1I3MA 2I66A 3G1UA 2UYYA 3RFXA 3C8MA 4RJTA 1TI7A 3KZVA 2X1HA 1XELA 1Y1PA 2PD6A 5A5FA 2BLLA 2D3TA 4BMVA 1JQBA 1N1EA 2HLPA 2I99A 3UCFA 1XIVA 3OA2A 3LC7O 4WE3A 3DXFA 4QQRA 4U6QA 3N58A 1F06A 3A28A 1TB4A 3AU9A 4E21A 4Z0HO 1PJ4A 3JD3A 2NVUA 2GDZA 2B69A 1X7GA 1X1EA 3CXRA 3WLEA 4W6ZA 1UP7A 3R1IA 1EVJA 1E1KA 1VKNA 3ZW9A 1H6BA 3B1KA 1YWGO 1GZ4A 4OJNA 2YW9A 2WE8A 4S1VA 1T4DA 4R68A 1I24A 2O7SA 3VPXA 3ZU5A 4GX5A 2RHCA 1VLLA 2RH4A 5L7TA 3M1LA 1Q0LA 4B4UA 1HRDA 4KUGA 4QT0A 4A0SA 1YXMA 3EZYA 3AI1A 4N54A 4XYMA 5AXAA 1RYEA 5FFFA 4HBGA 3WQSB 1M75A 1Z73A 3R0IA 2VYNA 1E0DA 2P4HX 3KYCB 2GYYA 3IP3A 1KVUA 4HADA 1T1SA 2HDHA 1YQGA 4FIZA 1ADBA 3IP1A 1ADCA 4E30A 1J4AA 3V2UA 1QKIA 3W4JA 4R1UA 5L53A 1I01A 4CM4A 2UUOA 2BFPA 3LC2O 1BXZA 4WOKA 4ONEA 4EITA 4D79A 4IZHA 4JJIA 5FI3A 4NK4A 1NBOA 2A9FA 2X0IA 4LMPA 4UREA 4F3YA 2AG5A 2DTXA 5DCYA 2H6EA 3PJDA 2EWMA 3DBLB 4AJJA 2D1YA 3AFNA 4INAA 5BSEA 1WW8A 4CMIB 3E9NA 4H7PA 4LRSB 4OOEA 3RSHA 2O3TA 3RJ9A 4OQZA 2P9EA 4BNFA 2Z1MA 2ZTMA 3PLNA 3GNQA 3KHUA 3VAZA 1PS0A 4IM7A 3E03A 1GV0A 1W4ZA 1VJTA 1IYZA 4IDCA 3S2GA 3PHHA 1QSGA 3NAQA 3UXYA 3T7CA 5EMHA 3BMNB 5JPIA 3DZJA 4NDNE 1HETA 4FJ0A 1PZHA 4TRJA 4IMPA 1O0SA 4HKTA 2QYTA 4HFJA 1PJBA 2BFOA 3AM3A 2ZB4A 1X15A 1GCUA 1NWHA 2UV8A 4OL9A 4R9RA 4XQEA 3ETDA 1ZUD1 4UVDA 5EPOA 2HO5A 4P4GA 2HSDA 3MCVA 1EQ2A 5IN4A 5TRTA 3JV7A 3GA0A 1H6DA 4QFDA 2X0JA 3DZIA 4BNTA 3INRA 4YCAA 3ZN2A 2C20A 5JYDA 3ADOA 4WKGA 1WVGA 3QP9A 3R3SA 3O9ZA 4GPD1 1ZVMA 2Y0EA 3H9GA 5DOVA 2PWZA 5COBA 3TPCA 3GDGA 4RZHA 3OETA 1F0YA 5I8WA 1N8KA 3B70A 2HK9A 4NBUA 1Q7GA 3K73O 5L4NA 1O9BA 3HB4X 4GGOA 1GV1A 4YJGB 1KYQA 1HE3A 3DMTC 4WGGA 4BNUA 3HN7A 4ALNA 4YPOA 5CPFA 1YB1A 3IOYA 1UJMA 2YV2A 5L45A 1BG6A 2C82A 4WLUA 5C5IA 3WJAA 1ZO8A 3DHEA 4EBFA 3JQGA 3VZSA 3WGZA 4DPLA 2IZZA 2VHWA 3SX2A 2VYVD 3DEYX 2OHXA 3CZMA 3GMDA 4NU5A 4WCFC 1IULA 3V1UA 1NTOA 2GCGA 2JFHA 2ZKLA 2NACA 4RVFA 4BNGA 1NR1A 4M49A 2C07A 2ZYAA 4JBHA 3L0DA 3MTJA 1T24A 3UKOA 1A5ZA 3DAFA 5L4SA 3AY7A 5EQFA 5F1OA 3OMLA 3WWYA 4AJEA 4EEZA 3ST7A 1AN9A 4YJDA 4Y98A 2NWQA 2JHFA 2A4KA 1PGPA 4O1MA 4URFA 1A4UA 3AUTA 2EJVA 2BF7A 2EV9A 1Z7EA 4MIEA 1I2CA 4Z9XA 3A06A 1QYWA 2JAHA 4TROA 5F1PA 2E49A 1H94A 2EERA 3U4HA 4LSWA 5HM8A 5A9SA 1Y5RA 4TZTA 5IDQA 4FFMA 4CLDA 4C7JA 3WYBA 4CM5A 3IUSA 4CUKA 3RUDA 5K6AA 5T64A 4FSHA 4KQXA 3PFWO 3Q9UA 2PNFA 4A27A 1A4IA 5A4DA 3GRKA 4IS2A 4GQAA 1ISIA 3MOIA 1GADO 3GZNA 4CLRB 2R6JA 2AQIA 5U4QA 3ZNNA 4ALJA 4JK3A 1BVUA 1Q7BA 5KVQA 5KVVA 3DZFA 5HBRA 2G0TA 2J3KA 2PY6A 4BNJA 1ONOA 3D7LA 4BHTA 1VPDA 5IXYA 4GWKA 4I5FA 2QZ9A 1GQYA 2X86A 3HDJA 4JN6B 4ND2A 4D3SA 2DT5A 1K0UA 2FY8A 4J3FA 3WBBA 2JD1A 1V0JA 2NU8A 3ENKA 4CODB 4JNKA 1SB8A 1YDWA 3DTTA 1G0OA 2JFGA 3ZGYA 3E6AA 1I36A 1ZW1A 1HSOA 2DLDA 4BV9A 1X13A 5TQVA 2B36A 1NVMB 1U8XX 3DZKA 1F12A 5T5QA 4PCVA 4D0SA 1U3VA 4IIVA 1U8FO 3U3XA 1ENZA 1DC3A 2B35A 1PJLA 1JKJA 4D3FA 2W2KB 1UXKA 2C0CA 3IMFA 2R2GA 4FJ2A 3PQEA 1V6AA 4CM1A 4DLBA 3D3WB 3EY4A 1UH5A 2IODA 4FOOA 4D46A 1GAEO 4WCFA 4O0LA 4DLLA 1N5DA 3GUYA 5BNFA 2WJPA 1PZEA 4AJIA 4LK3A 1ENPA 4JLWA 3GAFA 3VZQA 1ZKMA 1IOLA 3RUIA 4J9VA 4ALKA 1V3TA 2TMGA 4DXHA 1PS9A 1UR5A 3T4EA 4RPKA 2VZ9A 3K5PA 1RM5A 1Q0HA 3AJRA 1Y9AA 4ZQEA 3KM0A 3JCZA 3D4OA 1K6IA 2DUWA 3ROKA 2DFDA 5HS4A 3VH2A 1ZK1A 4PRLA 2Y68A 3L4BA 1O94A 2JD0A 4OXYA 4NZ9A 1O89A 1DFIA 1BGVA 2Z95A 1DRWA 3EK2A 4QFCA 3RD5A 5JAMA 1PSDA 4IPTA 5G2OA 3RKUA 4YJFA 4NBVA 3H9UA 3ZWBA 1H9BA 4ND3A 4EJ6A 5DBGA 2UDPA 2GNAA 4Z3KA 3AM4A 3KSZO 4RVHA 4CM7A 3RKRA 4JGBA 1HZZA 3I83A 1U9JA 3UCEA 3DB2A 1Y6JA 2BKAA 1RM4A 5JCJA 3Q2IA 2NU6A 1I3NA 2BHLA 3DONA 2WYWA 1ONNA 4U7WA 5ENDA 5TT1A 3W8FA 3WJ7A 2UVDA 3BHJA 3LZ6A 4GX1A 1G1AA 4RQUA 1HDOA 4ROSA 2DQ4A 4K9DA 1HDXA 2D8AA 3ZHXA 4WOJA 3UHAA 4E13A 2PTGA 1T2EA 4UUPA 1M6HA 3RBVA 4PG4A 4OAQA 4I08A 3GZ4A 2NNLD 3GQVA 5KKAA 4AFNA 3PYLA 2IXAA 1MC4A 4NPCA 3IKVA 3HHPA 2EP5A 3NJ8A 3C1OA 4BNZA 3HUDA 4XWYA 1PGNA 1OOEA 1GQ2A 1IZ0A 1R4MA 1VL8A 1EE2A 1UZLA 1Y81A 1T4BA 1K89A 3H3FA 4ZJUA 1EK5A 1F8GA 1RKXA 2PD3A 4L74A 3ZNQA 4MVJH 4RORA 2EKPA 2WTBA 4J49A 4PG8A 3NYWA 3JQFC 4GSLA 3M1AA 5JY6A 2GPTA 1XQ1A 4PLPA 5COAA 3SC4A 3CE6A 4BNXA 3LK7A 4E4YA 5KJ6A 1DO8A 1MV8A 1LJ8A 1LA2A 1JWAB 2GR9A 1U7TA 3OSUA 3PQFA 3VKUA 4BB5A 2YDYA 2PGDA 3JYOA 3JD0A 1S6YA 3BMQB 2DFVA 4L4XA 3B20A 3I23A 3O26A 2DBVO 5A3VA 1BRMA 1BSVA 4UEKA 2IEDA 2QQ5A 1NHGA 4ND4A 5C7LO 3SVTA 4Z0TA 3JSAA 2VWPA 2FR8A 5B4TA 1ZK3A 4H16A 3I9KA 2Q46A 3H5NA 1KVRA 3GGPA 4E2YA 3P7MA 1NR7A 3H9JA 3PIDA 1LSUA 4CMHA 5I7EA 3U0BA 5EL0A 3TFOA 3DMYA 1B3RA 4CV3A 3PHLA 4MPDA 4B7UA 5IDXA 2ZTUA 1YE3A 3ZHBA 1ZNQO 4FFRA 2Q1WA 3BTVA 4ZRNA 1QORA 4J6FA 2YHIB 4IXWA 1BMDA 2FHSA 3JQAB 4N5NA 1YB5A 1YH3A 3GAZA 4XKJA 1CJCA 3VH3A 4L75A 1P44A 2YV3A 2CSUA 1C0PA 4XJSA 3BMCA 1W8DA 2DAPA 4K1LA 3QWFA 3NDRA 1MG5A 1MUUA 4ZU3A 3KXDA 3U09A 2NV6A 2E4AA 3E5MA 4AL4A 4J7UA 3WGHA 2IYOA 3I9JA 4RLHA 1ENYA 3HB5X 3ZWMA 3AI3A 1W73A 1ZSNA 2B5WA 2Q50A 2P5UA 2ZCUA 1E5LA 3LT1A 4ALIA 3UCXA 4Q3AA 3ROQA 1HLPA 3V2HA 3AUUA 3D4NA 2B4RO 3PTZA 1Q1NA 3N74A 3Q0EA 1FXSA 3RI3A 1F14A 1EUZA 2Q49A 3SEFA 3EC7A 1KEUA 1HWYA 4R3WA 5IAAA 1P1IA 4M89A 1NPTO 1WP4A 1R12A 3RFVA 2DU8A 3RC2A 4XRRA 3OF2A 5EQDA 5I9LA 3AM5A 4E2WA 1JVSA 1M66A 4CL8A 4RV9A 3PGJA 3HZZA 5IJZA 3DBLA 5CDSA 3AY3A 4L8VA 1EUDA 4ZRMA 2QRJA 3S55A 3E5RA 3L77A 4CMIA 4R01A 1TT7A 2OGUA 1AHHA 3F6YA 5A1TA 4W9NA 3HJAA 5GZ6A 3DHNA 3Q2KA 1U4OA 4Q39A 2Q4EA 2BGKA 2IXBA 3JQ8B 3DR3A 3DBHB 3RWBA 3GEGA 1AUPA 4DIBA 1JLLA 3WGQA 3ZU2A 4OOFA 3KUXA 3ZWXA 4CM9A 4OH1A 3DAGA 3WTCA 5A9SB 3FPLA 2CVOA 1DB3A 1VSUA 3M6IA 2VWHA 1GEEA 2HUNA 5JW6A 4HV4A 4MVJA 4CMEA 3PJFA 3NJ4A 3GUCA 3MOGA 1OFGA 3FI9A 4L76A 4UUOA 3K30A 5JMWA 5A04A 4WLVA 4CMJA 5EERA 5FWNA 3GHYA 1A27A 3JQBC 3CMMA 3F47A 5JBIA 5B4VA 1E6WA 1NQOA 5I9MA 3KSDO 3MJTA 3H6KA 9LDBA 5CEFA 2AHRA 1WDMA 1ZEJA 1Y8RA 2D59A 1SPXA 4I8XA 4YACA 4TVOA 4ALMA 3NDJA 1JN0A 1EK6A 4PVCA 3E82A 3ZHYA 4JIGA 4Q3NA 3ZU4A 2GN6A 2Y99A 1A7AA 4FFLA 1UXIA 1E3EA 4YBZA 2NVUB 4W7IA 3OQ6A 3L4BC 4ZN6A 4PLTA 4JBIA 1K5HA 1PR9A 3JQEA 3BHIA 4XDZA 3ABIA 4JXKA 1EBUA 5DN9A 2HJRA 3D3WA 3JQCA 3CUKA 4WLEA 2G1UA 4CLXA 4WCFB 2VOEA 2ZTLA 4XRGA 3IDSA 3PWSA 4RCVA 1ZK2A 4GH5A 4RQTA 5BR7A 2UAGA 1CRWG 1DFGA 4J90A 5TJ9A 5JC1A 3OIGA 4CM8B 4BVAA 4LCJA 1YBAA 2PFGA 3ZH2A 3F4BA 1D3AA 1U28A 4AJ2A 4ZHSA 1GUFA 1ADFA 3GFBA 3K9QO 3KEOA 3MEQA 3PDJA 5GZ1A 1XQ6A 1U4SA 3U62A 2RHRA 1XU9A 3NX4A 4IIUA 1E1NA 2O23A 1X7HA 3KB6A 3GDOA 3MJ4A 3WSVA 4J9UE 1DIAA 5GMOA 4WPGA 2Y0DA 3KLPX 3FTPA 1C1XB 4R1NA 5AVOA 4DA9A 2Q4BA 1YBVA 1NFRA 4IQGA 2O2YA 4MDHA 1UAYA 1KOLA 4L0QA 2VCYA 1FF9A 3UICA 2D0IA 2Z5LA 2X6TA 1PJ3A 2GD1O 4HFRA 1EQUA 3SJUA 2C54A 3P2YA 3K6JA 2P4QA 3E18A 4I5GA 3TF5A 4W7HA 1QR6A 3QRWA 3ZZNA 4N18A 4PRKA 3WMXA 4CLRA 3E1KA 1U5CA 4XYGA 3O4RA 3RROA 1TXGA 3HNPA 5C7IO 5L95A 4J1TA 5EJ2A 1DJNA 2F1KA 3MWDB 8LDHA 3C7AA 2BMAA 2O3QA 1Y8QA 5JE8A 1H93A 1KEVA 1B7GO 2BELA 3JYLA 3PHIA 2PD4A 3WNVA 1BDBA 2EEZA 3QVWA 4IDBA 4N7RA 4GSKA 1XLTA 4ZQFA 1E92A 1IPEA 1DHRA 1LRKA 3WQQA 2IYPA 1R37A 4WLOA 2X0NA 1ZIDA 5A9TA 3WG9A 1OAAA 2RH8A 5I7VA 3ZNPA 3KETA 4ZQGA 2QX7A 3ETEA 3DOOA 3ANMA 1LLUA 1ZH8A 1GYQA 1B15A 2B0JA 1FDTA 1XCBA 3AUSA 1PZGA 4GL4A 4YQZA 3GVIA 2Q2VA 4I9NA 1MP0A 3JQ9C 3BA1A 2AE1A 2ZJ1A 2DBZA 3QHAA 4BS9A 5TT0A 3AWDA 3VC7A 4E5KA 3IJRA 1PWXA 4YT2A 3WSWA 4DC0A 3C7CB 3BAZA 1A9ZA 1K6JA 3BTSA 5G0TA 4EGFA 4NFHA 3BZUA 1H2HA 1P1KA 4EZBA 3JQ7A 2J5KA 3D64A 2X4GA 3Q6IA 2FR0A 4DPMA 1A72A 1E6UA 3CMCO 3IAHA 4RVSA 1PGQA 2R00C 4NI5A 3ZNOA 2I9PA 4GI2A 5JMPA 4EI2A 3ZW8A 3BIOA 3MJVA 3DHYA 1VJ1A 1LLDA 5ES3A 2X58A 1JDJA 3WGYA 4D41A 3TZ6A 1LDYA 4MIYA 3WB9A 5JDCA 2JJYA 2P2SA 4XYEA 4I1IA 4BB6A 5BNIA 1HTBA 3VOSA 2QHXA 3FNHA 1ARZA 3NRCA 5KVCA 2QRLA 3OECA 4S3MA 1E3WA 4P4LA 1MG0A 2VHZA 1VKOA 1I0ZA 3ADPA 4OKNA 4D43A 1RWBA 5U9CA 3I6QA 1Z6ZA 4YAIA 4TSKA 2ILTA 4ZVVA 2HAEA 2I65A 1E3JA 4XIYA 2HJSA 4RF4A 3JQGB 2C5AA 5EESA 3RUHA 3I9LA 4XQ9A 4BKQA 2YUTA 3HWRA 4Y8VA 1ZXBA 4A2CA 1HDRA 2V7PA 1UP6A 5IFLA 3QIVA 2VWGA 3AW9A 4CM6A 1TA4A 4NNJA 2POQX 2DBRA 5G0SA 2AQHA 5HTOA 3C1TA 4HP8A 3U5TA 1BTOA 4BKPA 4RF3A 5JAIA 3ICPA 4YB8A 5CFZA 1I10A 3PLRA 2V6GA 3CSDA 3JD2A 1XR3A 2VWQA 3JD1A 4B8WA 2VN8A 3DC2A 3G0OA 3BMCB 5LC1A 1OC4A 1UDAA 4NHEA 3DBRB 4IDAA 1GY8A 1OZAA 3OQ1A 3PJGA 1Z7BA 2HK7A 4DIFA 2P68A 1B26A 3JQFA 3P19A 4YDRA 1YVEI 5BSHA 2B83A 1ZMOA 1V9LA 4J4TA 3LQFA 2ZB7A 2BGLA 3OEWA 3VKVA 1R15A 4J2HA 4PVDA 1HZJA 4HNGA 3GK3A 3GVCA 1B8UA 1I5RA 3FN4A 5IDYA 1XSEA 3HDYA 4HY3A 2AMFA 1ZZEA 2FPIA 4W9NC 4BMSA 1PJTA 5IZ4A 1TVEA 4PIVA 3BYZA 5KTKA 2D5CA 4OO3A 3QA9A 4BKOA 1EFLA 2J6IA 4J91A 2HMSA 2GF2A 2PZLA 2WEKA 4I5EA 4PN3A 1GR0A 1IY8A 4CMKA 3TSCA 1QP8A 4B3JA 4KDFA 1JA9A 4PLCA 4AICA 5KJFA 1N9GA 1B2LA 3FNGA 2VYND 3ONFA 3QLJA 1R6DA 3WMWA 3E8XA 4KWHA 5DT9A 2VHXA 2LDBA 3DFUA 3UH1A 1QYDA 2NVWA 4NFSA 3RUEA 2WE7A 3D1LA 4FS3A 4TKLA 3OQBA 1PWZA 4CQLA 1BXGB 3B1JA 3JD4A 1VM6A 1DDOA 3H9QA 3WQRA 5L4LA 3RC7A 1P1RA 4LW8A 2P5YA 4Q3EA 4BOYA 3EAGA 2OXIA 1DBVO 4WNCA 2Y1DA 1YS4A 2QZZA 4J2OA 3DZGA 3K2BA 3VVCA 1DFHA 1NVTA 3LT4A 3F46A 2QW8A 3QE3A 1HXHA 3GFGA 1IPFA 1LC3A 1SB9A 4EJMA 3I9OA 2Y0CA 3TQHA 1DXYA 2XAAA 2FRDA 2X5JO 2PKRA 2E82A 1MGOA 5HWSA 3DL2A 2GN4A 7MDHA 1I8TA 3HADA 3VH1A 4BGEA 4N5LA 1Z45A 5KJEA 1NQ5A 4UEOA 5KOIA 2AW5A 4WECA 1HSZA 1T2CA 4PG6A 5ICMA 4HNHA 4R9SA 4RVUA 4JP2A 1R0SA 4Y6RA 4TRRA 2RAFA 3F4LA 4N5MA 4OGWA 3W4KA 3GZNB 4FOSA 4W82A 2JKVA 3K2EA 1LQUA 1Y8RB 3PRJA 2AEJA 3K96A 3H5AA 3VPHA 4OHUA 2VRCA 4YT4A 3P2OA 4CLHA 4YAGA 4MVJE 1PJCA 4LSMA 4QXMA 1DC6A 1B8VA 4ILKA 3A14A 4XEHA 5ILGA 2CD9A 2DUUA 1E6EA 2YQ4A 1W6UA 2GLXA 1FDVA 5CDGA 5HA5A 4PLZA 3Q9NA 3PK0A 4IJWA 1QLJA 2O2SA 1NM5A 4YAJA 5AXBA 1DRVA 5TSDA 2AE2A 2HK8A 2OP1A 4JCOA 4C4OA 1JAXA 1E3IA 4KP7A 4UVHA 3VPSA 3K92A 4FD3A 4JJFA 2G82A 4FW8A 4M8SA 4GGPA 4B79A 3LYLA 4GX0A 3FSRA 2RBEA 3RVDA 3PDUA 4TRMA 4Y67A 3TN7A 3WICA 3CIFA 3MWEB 4BO7A 1V35A 2BD0A 4U5QA 5KWEA 1DJQA 4W4TA 1Q7CA 3JYQA 4MVJG 4PLVA 4D42A 3FWNA 1KERA 3S8MA 3JYPA 3WGGA 5KJ1A 3DBHA 5AXCA 5TGDA 4DWVA 2FP4A 1EVYA 4XGNA 2Q99A 4RDIA 4RVDA 3ZWNA 3WIDA 1E3LA 3L6EA 4IJVA 3X2FA 4MP8A 2VHVA 5DBFA 1QLHA 1Z82A 2QYSA 4M54A 1XGKA 4CMCA 4FC6A 4GVXA 3OIFA 3HN2A 3NTQA 2OUIA 5BT9A 2O7QA 5FYDA 3DO5A 3IQDB 2IZ0A 3AY6A 5F5LA 4ALLA 2W8ZA 3KOUA 4HXYA 4KDEA 3ZV4A 3I4FA 2CVZA 4J1QA 3OA0A 2C7GA 3KV3O 3W6ZA 4NJMA 2A92A 4PG7A 3PIIA 1YL6A 2AEMA 5CDUA 2QIOA 3DZBA 2WWRA 4IQ0A 3TDKA 4CMGA 3JQAD 1Y8QB 3I52A 1ISJA 3NGXA 2V6FA 4M86A 4YJFB 5I7FA 3KYDB 3O38A 4RLSA 4HWKA 2E48A 5COQA 3OH8A 2HMWA 1ZJYA 3ITKA 3PP8A 5JYEA 4B4OA 1GL3A 3GN1A 2CF5A 1UAGA 4HX5A 4LMRA 1VJ0A 1HEUA 4CV0A 3FTNA 2X5KO 2G17A 3ZWPA 3KLMX 1GZ3A 3D4PA 2P91A 2PGLA 2HU2A 1WMBA 4IQ8A 1RM0A 3S1LA 3ZI0A 4AJLA 2DBQA 4BO6A 3OJEA 3PFFA 3GC6A 1VRWA 3ZWWA 1VL0A 1C0LA 4K6CA 3WGOA 3E9MA 1PEDA 2XXJA 2XOXA 1SZJG 5TF4A 2AA3A 2SCUA 1YGYA 3TJRA 3FHLA 3WDSA 5JXWA 3ENNA 1U3TA 1SEVA 3RBXA 3I5MA 3U9LA 4BNLA 1P74A 4ITUA 4RGBA 5AXDA 3UFXA 3UF0A 1UXJA 2VTEA 3T4XA 1V3VA 1NFFA 2CF6A 1C0KA 3DDNA 4FN4A 3RUAA 3ZHZA 2W90A 2GZ2A 4RL6A 1ENOA 2P9CA 3CH6A 4GKVA 2ZJ0A 2VQ3A 2UUPA 4RPHA 1A71A 1DIGA 4BNVA 3CKYA 5CG1A 1HDZA 2YY7A 3HSKA 5DZSA 5LDGA 3LU1A 1E3WB 1UDCA 3O03A 4B3HA 4M55A 5G4KA 2FSVA 3AOGA 1NAIA 3NT4A 4JBGA 4XGKA 2H1SA 5IXSA 3DBVO 4O6VA 5A5EA 3WGIA 2HQ1A 2NSDA 4KZPA 1T2FA 1TLTA 1XKQA 4DREA 2D2IA 4DIOA 4A73A 4UUMA 1BXKA 3ETGA 5EIOA 2Q1TA 1QV7A 2NQ8A 1JKFA 4BGUA 2O3JA 2WD7A 4TMFA 4I9UA 4NIMA 4Z9FA 3TWOA 5BSFA 3RJ5A 2GUGA 4LVUA 3EVTA 1XU7A 2DVMA 2Y1GA 5BNTA 5ADHA 3EGOA 3D0OA 2CMDA 2J5RA 1YBMA 1B0AA 3GVPA 4LN1A 3JQ9A 3WTBA 3GH3A 1H9AA 3GLQA 1AGNA 3MTGA 2WSBA 1J6UA 3QV1A 3H3JA 2PR2A 3PZRA 1C1DB 4YVFA 1UXHA 2YHIA 1D1TA 1OBFO 2QRKA 3BMOB 4WUVA 4CL3A 1P33A 1NQTA 8ADHA 4BO9A 1LXCA 2V65A 3AOEC 2Q3EA 1PJ2A 3BHMA 5CDTA 1GDHA 5DCUA 1U1IA 4GMGA 1IUKA 3L6DA 4NG5A 3JQ7B 4JX8A 3Q11A 2PZMA 5KKCA 2DM6A 4D0RA 4IDEA 3G49A 3TL2A 1EDOA 3DMTA 4CQMA 4MOWA 5DF1A 4EUEA 1FDSA 1LDEA 4TVBA 3BXXA 4ZA2A 4CM3A 1MFZA 2VNSA 2EW2A 4CUZA 2EW8A 4GBJA 3Q3CA 4NFYA 1LI4A 2DTEA 4FBGA 4K6FA 4GVLA 4KUHA 1Q2XA 2WM3A 2WYVA 1I3KA 5FF9A 3FRJA 3GMSA 1N9GB 4RPLA 2E6UX 4F46A 3H2ZA 2W98A 1LLCA 2VNAA 4P38A 3NKLA 4BIIA 3ZCXA 4E2ZA 2X23A 3WS7A 5A05A 1R4NA 3EYWA 4RPJA 1WLYA 1E7YA 1NASA 4KTTE 1BXGA 3RQSA 1HKUA 4J1SA 1IL0A 5DP1A 3VZPA 1QYVA 3RUCA 1E7WA 4WLFA 1EUCA 3G1TA 3JQBA 4J0FA 4OKIA 2CVQA 3LLVA 2Q45A 2C29D 4JP3A 4D7AA 4HFNA 3IC5A 3GGGA 3V2GA 1LRLA 4L4SA 2X9GA 5BQFA 1GUYA 3UAGA 1HLDA 5DNAA 2O3UA 2P9GA 4IBOA 3EUWA 3DBRA 4IINA 3DQPA 4CJXA 5A06A 2B4TO 1ULSA 4WCDA 3FR7A 1V8BA 4L9RA 1I30A 2X5OA 3UW3A 4BL5A 4Q3BA 1P1JA 1ZXLA 1YQDA 4QO8A 3WOHA 1NVGA 3RFTA 1HL3A 2BI7A 3TFQA 1XYGA 3GDFA 1MXHA 4LRTB 1CF2O 3ZWCA 2I6TA 1RPNA 1NP3A 4NMHA 4X54A 1H5QA 1EDZA 1BHSA 1XHLA 4GLOA 5LDHA 2X0RA 3OFSA 4AJPA 3LLSA 1I3LA 1LC0A 4J7CA 3SC6A 2A94A 4I5DA 3L9XA 1Y9EA 3NT2A 2EKLA 1T26A 1LSJA 4RF5A 4DPKA 9LDTA 2OOSA 4D44A 4YYZA 3OJFA 1L7EA 1MLDA 1SC6A 2AQKA 3GF4A 2EGGA 3GR6A 4LCEA 1JAYA 3NTRA 5EN4A 2XXBA 2BGMA 2F00A 2JCXA 1B14A 1NFQA 2EXXA 1MB4A 2JCYA 4FC7A 1IE3A 3D5QA 3O8QB 5L51A 1AHIA 2ZB3A 3SXPA 2YFQA 1BW9A 2EGHA 2Y93A 4DUPA 3ZWAA 1UDBA 3QWAA 4DVJA 3TL3A 2IE0A 1E1MA 4BNYA 2WDZA 4YRBA 1UXGA 4DRYA 4R54A 4WEOA 1PTJA 1C0IA 3RIHA 4R3NA 5K9ZA 5AYVA 4EDFA 1SBYA 1MX3A 2BFMA 4XJTA 5A03A 1PL6A 1KVTA 1IHXA 5DULA 1GYRA 3CINA 1LUAA 1ISMA 3IL2A 3LF2A 4B7CA 4AJ1A 5K0ZA 1TEHA 2HRZA 3ZV5A 2GZ3A 4CM8A 4OYRA 4MP3A 3HDQA 4E32A 2V6BA 4Q3CA 2ZYGA 1L1FA 1DOHA 4Y9DA 3TZCA 5CAEA 1NPYA 2VZ0A 1SOWA 1CDOA 2C59A 3R6DA 3W1VA 1ORRA 3ZV6A 4TZKA 3PHGA 4AJNA 1C1XA 1LU9A 3L07A 4YRDA 4U0KA 1DLIA 3PWZA 2PV7A 2GGSA 1S7CA 4BNIA 1JWBB 3SBOA 4DC1A 3KSUA 1U2GA 4MO2A 1P1FA 1YL5A 4NJMB 4KQWA 4Q3DA 3RU7A 1JKIA 4DMMA 2X9VA 5KCZA 1K2WA 1Y5MA 1UZNA 1KETA 3LC1O 3QY9A 1CIVA 4UVIA 1GUZA 4GMFA 2Y1EA 3OIDA 1T2DA 3KYDA 1XWFA 3FD8A 2ZK7A 4CMBA 1JU9A 2VHYA 1VSVA 2ZQZA 3NUGA 4FFPA 4OSPA 5EINA 4BNNA 1M6WA 5CDYA 1PL7A 4BUCA 2C7VA 4RO0A 2H63A 1SMKA 4Q9NA 1CYDA 4DTIA 2GERA 1PJQA 3LT0A 3DOCA 4GWGA 1GPJA 3OJLA 1LLQA 3STHA 2NUAA 4YT8A 3RU9A 2Y05A 5F3RA 1PQPA 4LVCA 3PVZA 3M2PA 3ORFA 2Q1UA 2X7HA 2NU7A 2O3RA 3CPSA 3GNSA 4TKMA 3UGKA 2HMTA 1BWSA 2CZCA 3VZRA 1QYCA 3SLGA 1X14A 3B1FA 5A02A 3GG9A 1IZ9A 3GEMA 3AI2A 3FNFA 4PGFA 3NDIA 1P0CA 5JLAA 4A03A 3KTDA 3VDQA 4L73A 4NQZA 5G0UA 3AOEA 2NU9A 2YYYA 4GAEA 5KVSA 3H2SA 3FR8A 2J3IA 3F5SA 1E7SA 4J4BA 3IJPA 3GPDG 5FI5A 2VT3A 1T1RA 1P45A 1A7KA 4ND1A 5H81A 1EBFA 2HMVA 1X0XA 3MZ0A 5H83A 2FZWA 3FNEA 2YZ7A 1H0KA 3I3OA 4CV1A 1D4FA 3ZWVA 3C24A 1GZ6A 1DC4A 5THKA 3INGA 2CDAA 1DIRA
chains in the Genus database with same CATH superfamily
1C3JA 2JI8A 4QBGB 4UEJA 5CPBA 1P2DA 3FJYA 2W2LD 3Q7PA 4MW5A 4NV1A 3UMCA 3PPWA 3PQ3A 1RYFA 3E2MA 1QHSA 1Q77A 1SXHA 1NYRA 2OO3A 4M1OA 1ISFA 2FZCA 1J1IA 2QRQA 3EGWA 3K0BA 1PF7E 2W00A 4CF4A 4QUJA 1IB6A 1B1AA 1Y3FE 3GEPA 4ZHQF 1G0NA 4GMHA 3MELA 3RYHA 3MILA 3V7WA 3MC1A 4Z9YA 4O3FA 2ZJ8A 3WIUA 3REFA 4KQIA 4EM6A 3Q1LA 2C04A 2R11A 3C3AA 3QF4A 3AUAA 1TGYA 5T41A 4EJSA 4PZ9A 3SX4A 4R2LA 4U0JA 3Q3HA 1YJ8A 1SVMA 3I0ZA 1IG0A 2OBYA 2YIJA 3EA4A 1E9VA 1QAQA 1GIAA 1YL7A 2QM0A 1OXTA 2D0DA 3PGVA 1X9HA 4X9XA 2PT7A 3LY7A 1WCIB 3SGLA 2PKQO 4UHKA 2OAQ1 1FMCA 1MR3F 2JB9A 3HB0A 1Y3DE 1Z74A 5ITSA 3AHDA 3LOQA 2BBWA 1T2AA 3TZKA 3AKZA 5CVCA 2EC5A 1GCOA 1K8YB 1WZCA 4REQA 1E0AA 1NUHA 2ORYA 3I5YA 4F56A 1RJDA 4LF9B 1T6NA 2D7CA 3HCOA 5LQSA 2DPXA 2I2DA 4II2A 3VU3A 5CFOA 2GCEA 4RHEA 4CDRA 1QIGA 4MQ5A 2RHDA 1KY3A 1MH9A 1PYOA 4R1SA 1E4EB 1XEAA 2AUTA 3R5JA 2RHOA 1YJBA 3QU4A 4OFZA 5HIMA 4L72A 4BPRA 4X95A 2TECE 1LWNA 4RKQA 2XTMA 3T7IA 2WVJA 3LXRA 2W2PA 4MTLA 3TQIA 2A35A 2GETA 1DL5A 2FUEA 1SEPA 2QAGB 4LXUA 1J7JA 1Q6ZA 2JKYA 3K1YA 3LAWA 2LVBA 2YX1A 1EM8A 3ASVA 4WZ6A 4CQMB 1JJBA 4B6OA 4E5YA 4ER5A 2ZBRA 5TQ0A 2FQQA 3MD0A 4FWIB 2X22A 1ECJA 2PNJA 3U48A 4E33A 1NXVA 1IXRC 1L7MA 3AT1A 3C7TA 3OLZA 4Y9TA 3I73A 1EVZA 4MCHA 3U4CA 3V1TC 3C0KA 4AZ3A 5C1DA 3RTDA 1LFAA 4CEIA 1LDGA 1NP7A 1GFZA 2R79A 2CXHA 2XCSB 3LBYA 1XQXA 2ZVDA 2NPFA 4JQYA 2PGIA 3L18A 3K0SA 1DOAA 4Q24A 1IN4A 1JJVA 4K9NA 3A2LA 2E4YA 4EGCB 4Q7MB 3QBVA 3LWDA 3DTVB 5DP2A 1LJLA 3BK7A 3EQ9A 1VCHA 3OQIB 4R2IA 5BSTA 3VPGA 2I9KA 3PIRA 1RJ9B 3D2AA 1XQ9A 3AUFA 3RAGA 2FFJA 2J9YB 4KUEA 1WZIA 2GRAA 3OHSX 4QGAA 4ESHA 3U7QA 4FLMA 4RJKA 5EWLA 2YVUA 2GJKA 9ABPA 2XMZA 2CLCX 4R8VA 2DZDA 4QX6A 4AZ0B 1ZSYA 3QXJA 5HZKA 4RPGA 3PT5A 2QRNA 3AIKA 3EGEA 1R66A 1TKBA 5L7WA 3RHFA 4E4TA 1NF2A 3LA6A 5KTRA 3DA8A 2VAWA 2UKDA 2X77A 4OHFA 3ZGLA 3B8HA 3NB0A 4EUHA 1RM3A 3LYAA 4ZEVA 3MWFA 3K70B 1E4VA 1YAHA 2YS7A 3LUJA 2HWYA 3W6PA 4CYMA 4UU0A 4JP8A 1EHCA 3G68A 3IV7A 3PNLA 4MHSA 4DLXA 4C0LA 4EO4A 4OJQA 2NV2B 3A9SA 3G5TA 1NX6A 5E7MA 5EJ9A 2GKGA 3KOWA 2QNIA 3AHFA 1NN0A 1O8BA 3VDRA 4YY3B 2QZSA 4MVCA 4UULA 1SCDA 1AQYA 1RHMA 1TKCA 2VJMA 1CJKC 4NENB 2Q6IA 3AY0A 1Q0QA 2VYVA 4FGKA 2ZR0A 3GJZA 3MRVA 4OLJA 3AEXA 2DPHA 4LYGA 2HJGA 5GIOE 1NL3A 4MYTA 3KOZA 4M87A 5T3UA 3RIGA 3TPFA 4IV5A 4EB6A 4AF7A 2Q1YA 3L8ZA 2II6A 1MF7A 4Y2RA 3CNEA 4O2RA 3KJFA 4F0JA 4YR9A 4V1CA 4G0UA 1E3MA 1I32A 1L7DA 5I5EA 4IDGA 4W1SA 4JYZA 2AXPA 1Y34E 4ZQCB 3ZDFA 4HK4A 1FYDA 1CZHA 1F4LA 1VPTA 3O5AA 1PNRA 4NP6A 3ONDA 2F62A 3GGCA 2TMDA 4RLFA 3EWSA 4NECA 5IARA 4L0CA 4XQGA 3TUIC 1QHYA 3WFJA 3K71B 4Y2PA 3V32A 3IS3A 1VZ2A 4BO3A 4E2FA 4A36A 4JXZA 4HLUC 1AUVA 1YJQA 3C8HA 4OHRA 5EJAA 4QGFA 3E9CA 1E89A 3HV0A 3SQNA 5C3MA 1VE7A 4HDMB 3EEQA 4MV7A 1CS0A 2JI4A 3I05A 4EHLA 3T7EA 3OJCA 4B5KA 1RYYA 3D6MA 3OBBA 1YKGA 3OQJA 3URMA 1KA9H 1OAOA 4P0TA 2CDCA 4KWIA 4GC5A 1JDSA 1O6FA 2RDMA 2PH3A 3NJRA 3RGWS 3L7IA 3SJ7A 2J9FA 3TRIA 2VH5R 1H2WA 2IYAA 4IJKA 1WJGA 5G0WA 2YNMA 2J85A 1KL7A 3CG0A 4B2YA 2UVPB 2OAP1 3KD2A 3LS2A 3Q1KA 3SNHA 5KOJB 2IGBA 3AK4A 4V03A 2C5EA 4BBZA 5HR5A 1NWCA 5EE9A 3S2FA 3VHXB 3A4VA 2AL7A 3DWIA 4TXHA 4RHTA 3FYUA 4TPKA 5JAQA 4NAVA 3A1WA 4DCCA 2W2KA 2I78A 1O94C 1WUHS 2IV7A 2QMZA 4O4IB 2APJA 3VGJA 3FE2A 1XJWA 4J94A 2VPYA 2FZKA 4NAUA 2O2HA 1ETUA 3FUTA 1XVTA 3ASUA 4OEHA 4XWGA 4EARA 2OECA 5F33A 5B6PA 2FXVA 2GM5A 3EIOA 1CQPA 2EIHA 3G9XA 4W99A 5EPUA 1G21E 4QPNA 4YRJA 3U26A 3YASA 4B2LA 4EYOA 4UDNA 3VPFA 3ZVLA 1JZQA 2WA2A 1C3VA 2GSDA 1KO7A 3H2GA 3HFSA 4MJLA 2DUNA 3ITNA 4AS3A 5B1YA 2D62A 1DPFA 2BEWB 2ZBPA 1NVVQ 3BL8A 4J76A 3CR8A 4S0ZA 1E8MA 1O95C 1WPQA 1YA6A 4DQUA 3CRZA 4ARCA 4TM7A 2CHUA 1S2IA 2BR4A 4TTAA 4MUXA 1VLZA 3UWSA 3EZLA 4I14A 1TM2A 1P2BA 1VI2A 1ADYA 2DHRA 2F8LA 2J5BA 1NSFA 1H4VB 4IH1A 2PSEA 3UZUA 1V96A 1AKYA 3P5BA 3DMFA 2XCOA 4MLDA 3ZBTA 4L6IA 3R6WA 2B21A 4U8GA 3A1NA 3BGWA 1DAPA 3NTLA 2YMPA 4HH4A 5D51S 3ZK7A 4AN0A 5IXJA 1QP0A 1P2FA 3BTOA 3NHYA 3K9CA 1TLFA 3EXIA 2CJWB 13PKA 2Z8YA 1BYUA 4URHA 5C5EA 4ZANA 2BUAA 1QJ4A 1PJAA 1E1QA 3N87A 4Q1VA 5KTOA 4FJ1A 1TUBA 2NSLA 3F78A 5LA6F 3UT5B 2JCVA 5AW7A 3IKJA 3H87A 3UH0A 1DI0A 4YRKA 3VR3A 1JEQA 2B8NA 4YJ3A 3QUBA 4B7ZA 1OFTA 1DTSA 2VDPB 3R3HA 1M2WA 2COKA 3A26A 4K88A 5JSFA 5HOQA 1KMHB 5F12A 3STXA 4CDNA 1B23P 1QGAA 4IVRA 1C50A 1O97D 3C39A 4ZDWA 2NW6A 3GRCA 3HQ4O 3PS9A 5HP4A 4BKUA 1OKKD 4LZOA 2OMEA 4E3ZA 1KJ9A 3EVNA 3ICCA 3KR9A 3ISVA 4FDAA 4PTYA 1KY5A 4EW1A 2ZTVA 3MT7A 5DRTA 4ZC8A 1N7GA 2Q3FA 2YH2A 3DOEA 2VYCA 1OA0A 3U49A 2IXEA 3AVWA 1JAIA 3A4MA 3KEGA 3AW8A 3RNLA 1CULC 1QLWA 4JP5A 4PX3A 3G02A 1R4ZA 4F2GA 2B8WA 4JLBA 3BIJA 3ET5A 2EP7A 5CB6A 1E7MA 2O59A 1DX6A 1ST3A 1U7OA 1R0WA 2HU5A 2O3SA 2V7TA 3IO5A 1PQYA 4KO3S 4YBRA 5KTPA 3FNRA 1YB7A 5JCJD 1E1LA 3EF0A 2XWPA 3OPQA 4I9HA 1VL5A 1EFPB 2ARKA 2QU7A 221PA 1FFXB 2RG7A 1MIOB 3GVXA 3O8NA 3LQQA 4QYXA 4BO5A 3PEWA 3QSYA 2GN9A 3DQQA 3FH0A 4GRIA 1GXSB 3RBZA 5I9NA 2ZUBA 2XLCA 2NQTA 2P77A 2X6QA 2E7ZA 4PNZA 5BRNA 3IQHX 1DO0A 2G06A 1RTTA 3TD2A 5C8YB 4YRNA 5J2TA 1DJLA 1SD5A 3I4CA 4Q34A 3KUKA 1IRIA 1LPNA 4I1VA 5CG2A 5I8PA 1A1VA 3FYHA 5TEWA 1HY3A 2Q21A 1K3TA 3N2EA 3F3SA 2GNOA 3PGXA 4QUKA 4WA8A 1OAOC 5EZYA 1ZD8A 5FKJA 1S96A 4EY6A 4TWRA 5JVDF 1RAIA 1V71A 3ND5A 3AEQA 1CS4C 2WHPA 2OHOA 2ZUWA 3M81A 3D7MA 4QYTA 5KDLA 4L5IA 5EIHA 4H77A 2B5OA 2A33A 2E4ZA 4R2MA 2L2QA 4XCXA 1KS9A 4JLVA 1KVQA 3RS8A 3SKXA 3VMFA 1FTGA 3EVEA 1ZOIA 4H15A 4HD8A 3TE7A 1O1YA 1QTNA 1YDHA 4LY3A 4QYMA 5ITWA 3LT5A 1J0EA 1W34A 4GZMA 2CL7X 2ZUDA 3ADKA 1N9ZA 1NHWA 4LTMA 5H82A 3W05A 2Y1FA 4L5YA 3PQ8A 1X3LA 2CL0X 4KOAA 2XNDA 4OQ4A 5F9MA 4IXMA 2BIFA 3TEJA 4CR8A 1ODKA 2LE0A 3E22B 4HDKA 3O1LA 1M67A 1O2DA 2DPGA 3QOXA 1NUUA 1WCIA 2ZBQA 1U0OC 5G1NA 1W87A 4CUJA 5DNUA 2FEOA 2OCPA 4UEQA 1KC3A 1CUZA 4GX2A 1H65A 3HCRA 2HBYA 4K3UA 3G2NA 3RK1A 4KGXA 4W8OA 3HKEB 1NW9B 4HWPA 5J5VA 1VKHA 5L40A 1JYSA 1ORIA 2W2QA 1CR6A 3I2HA 5FBVB 3W8EA 3CUYA 3ZC3A 4PX5A 2NAPA 4JLNA 4GEKA 2GTHA 4OQDA 3JQAA 2GFHA 4BB0A 1E4EA 3TR0A 2VJLA 3MW8A 2OV6A 4C2AA 3SICE 2JPDA 3BTUA 2R00A 4US0R 5A4JA 1ABBA 2RGEA 3H1BA 4YRAA 4JD5A 1OFHA 2AFIB 3KXIA 3NASA 1C4KA 1BVHA 5KMGA 5LQNA 4LMBA 5JXGA 1J9ZA 2FRVA 1X1RA 5CYOA 3GJ3A 2L69A 5F98A 1RZRA 3EHDA 4U00A 5JSYA 1HT2E 3CRVA 5GVRA 1GTG1 1NE2A 1JR6A 4KNYA 1RDFA 2WZQA 4UD6A 3L6OO 3ZXXA 4AVYA 2AW3A 3KKZA 3G5LA 4HFMA 3CVWA 2FZ4A 2KSQA 4LJ8A 1II8A 3QSGA 3GA5A 2Y6UA 1MO2A 3ELBA 2VXBA 2X0DA 4B3BA 2LIVA 3G2OA 1PE0A 3RYIA 2CY0A 4G65A 1ZIYA 5DEIA 1A95A 4DUGA 2O0HA 3CPHA 1NBME 2BGGA 3CJTA 3GJ6A 4POAA 3P9NA 1CUEA 3JWEA 3IBFA 1E2UA 4G67A 1UP4A 1FS6A 4LY0A 4BFXA 3IDOA 3NR2A 3ABOB 3KQPA 1SCBA 4P53A 1X38A 4XARA 3S2EA 5ER9A 5F1KA 3G9TA 4ZV7A 4AZVA 2MYTA 1G9SA 5CP8A 2QVGA 3HJHA 5DGTA 5F5NA 4B3IA 2Q5JA 4BO8A 1HURA 1V43A 3SIWA 3AP2A 3NWJA 5BRJA 3L6RA 1E20A 1TW3A 2PZKA 4NH4A 3OJ0A 5M2QA 5FBRB 1NXQA 1I6MA 2FOIA 4QRHA 4LPSA 3ZGOA 1CQJA 4AP5A 2J41A 3UANA 2F1OA 2XVMA 3WLPA 4EG0A 2Q2QA 2VTKA 2ZRAA 4J75A 4DLWA 3GFTA 4NKRA 2Q0XA 5DBIA 5M3BA 1KRWA 2O0MA 4IGIA 2J0SA 2WUDA 4B40A 4PLFA 4RZ3A 2Q0QA 1RBQA 4EQ6B 3EMKA 2OWDA 2RGGA 2CKMA 5C5CA 2LV8A 3BD8A 2PA0A 2IXGA 4K28A 1E59A 3W1EA 4CHGA 1XMJA 3JALB 1XBTA 1Z63A 2EYUA 2O8CB 4FUTA 4LE0A 1DG3A 1AF4A 3T15A 3KDSE 3OICA 2ZYIA 5TX7A 3RVJA 2W4QA 3TTYA 4CPDA 1EAYA 1JLLB 4PSAA 1XT6A 3RIMA 3W3AD 4LVNA 1CIJA 1QO9A 4PZAA 1RC8A 2J5QA 1JLSA 4B73A 1XD9A 2DFPA 1JZTA 3NIWA 5J3JA 4AKIA 4LSZA 5FA6A 4XDYA 3ACCA 1N4DA 3ZV3A 4FMCF 3LJKA 1AK9A 4MKXA 1P18A 4OBEA 2XNCA 3LPDA 3LWNA 1ONBA 1G3MA 4TV8A 1VKRA 1MDBA 4Z2YA 1C14A 1Z2DA 4WJZA 4RTOA 1DKMA 1QX4A 2R8ZA 5GY7A 5I8ZA 3AFMA 4DLRA 2DX7A 5TLSA 3DTYA 5LIPA 2G6TA 2HIGA 4I9FA 3KT0A 2HCJB 1M8KA 3D5TA 5ALPA 3UENA 4BCDA 3BM5A 1YRBA 2W83A 4WEQA 5FI0B 5HKLA 2R3SA 1J5PA 4H9GA 4NCJA 4CKWB 4CTMA 3BOSA 1EFUA 3ELDA 5HQ3B 3K4PA 2Y8EA 2C42A 3FMPB 1EYZA 2FK7A 5JCOC 2Q6KA 4X97A 2NTJA 3T35A 5L3SB 2AD1A 3FG9A 1LEHA 1DSSG 3H99A 5FOWA 3W78A 1R18A 1VE6A 5EWLB 3BG5A 5CEEA 5BN3A 1G8HA 2JH8A 3UMVA 3PXXA 2PRZA 4AZ0A 3O8RA 5TS3A 1PHRA 3N39C 1YZQA 5E3IA 2VEOA 1T10A 2YV1A 4QEDA 3F9IA 3FYUB 4QUEA 3NHLA 1M0WA 5B4UA 4MDEA 2J7PA 1LSSA 1JUDA 2HO4A 3G1WA 4ON9A 1E66A 1UC9A 2DEUA 4Z53A 2BTEA 1I9GA 4C0JA 2YVLA 2YNMC 2J59A 4CU2A 4AMBA 4C0KA 1ODSA 1SNYA 4ND5A 5C1OA 3IE0A 2KI5A 3WOVA 3EZ7A 4ZOBA 3JYNA 1U99A 2QRHA 3ENQA 3ZDYB 3NHFA 2X42A 4GUAA 4L8GA 2ZIEA 1JKJB 4MRPA 2WBLC 2PZJA 3WR5A 4B7AA 4HXGA 4Q4JB 5KO2A 1LTHR 2BHNA 3IMKA 5F9FA 1E69A 3OCUA 2JLCA 1X1TA 2EBWA 4N12A 1INLA 5AHKA 3T1NA 5ITVA 4LF7B 2NTYC 5JG7A 2QL9A 3KB8A 4F06A 1U1GA 3G79A 2WF8A 4G3XA 3D6UA 4JOCA 4DQVA 2DUJA 3IPXA 3GRPA 1T0PA 3PPIA 4V0LA 3TQRA 1TJ5A 2NO0A 3WL7A 3N0XA 4F1KA 4FB5A 2GASA 2D4AA 1CEQA 4HJXA 1IZ7A 4JVNA 4AJOA 3RG2A 1V7QA 4NTZA 4RNCA 1WMDA 1G3QA 2FN3A 3PJRA 2QT1A 2EZ9A 2H8KA 4HWGA 2H17A 3IQEA 4HPXB 4XQCA 3T7SA 3UB2A 4YIHA 3FA2A 5DMXA 5K99A 2QBYB 1ZJZA 3NEPX 3OOJA 2YV5A 5CK4A 5FBKA 4YQYA 1ZU5A 1ZW6A 1JHPA 2H4ZA 3EG5A 2OCKA 1DJPA 3QVSA 3T52A 4OK3A 3FCOA 5IJ0B 3W79A 2KWIA 3MQ4A 1VL6A 2DE0X 3RNOA 1SXQA 2EHDA 3SHOA 1GCAA 1OSNA 2FFBA 3G1UA 2N1BA 3PUKA 3TG2A 3IUMA 4MQBA 4UOQA 3THWB 2I7CA 2P9ZA 4HXEB 3KZVA 1GZUA 2X1HA 1U7ZA 3NYRA 4QPZA 5CX4A 1JFFA 2F43A 3G8BA 1Y3BE 4YUWA 5A0VA 1OH6A 3ZZUA 3EMDA 1RW4A 1EFVB 3WXMA 1Q16A 1JQBA 5DK4A 2FMIA 3FY4A 2OYRA 3SK0A 1XIVA 1NVKA 4WE3A 121PA 4U6QA 3T0FA 5AW3A 3N58A 3A28A 1TB4A 3AU9A 4LBZA 2NVUA 1YQWA 1SVNA 2X19A 5ESRA 2B69A 1XAGA 4XGQA 4KQEA 5JS7A 1RAHA 3FVVA 3IXLA 2R8PA 2A59A 4W6ZA 2R8RA 3QEKA 3U3KA 2GCOA 4EPVA 1E1KA 2PJUA 4RAQA 3LH5A 4BFYA 1W2HA 3NC0C 1H6BA 4TS4A 1GZ4A 4OJNA 1UBCA 4OPMA 2C8VA 3NS7A 3QJYA 4K87A 1T4DA 3RTGA 3S5JA 4R68A 3ZHTA 3UJHA 3VC1A 5EIWA 4HNUA 3R6LA 1JIJA 4G1FA 5DBOA 3VPXA 1M33A 2FSIA 2ZE6A 2OBLA 1A8QA 2Z2ZA 1VLLA 2RH4A 4QYSA 5L7TA 1JA0A 3SHFA 5LL6P 5J2TB 1QONA 4KUGA 1Y63A 3HXLA 3AI1A 3QEOA 1EGHA 1RJEA 4ZALA 5FFFA 2ZIAA 1IU9A 3WV5A 4HBGA 5C8YF 1N0HA 1SUBA 1Z73A 2GKSA 4OYLA 2Q6LA 1EP1B 5I9SA 1DRKA 3MN1A 1E0DA 3NFYA 3QBEA 1Z6AA 3SZMA 5BVHA 4TWBA 4DADA 1NF9A 5JADA 1KVUA 2QJFA 3GD5A 5DJ5A 1OV4A 3VO9A 2QK4A 4HADA 4GP9A 4PINA 2GBLA 4Y7DA 1DBSA 2Z58A 1GRNA 2PMDA 2XE6A 3FBWA 1E18A 3JWJA 4KHZA 4LJ6A 4AO8A 4CL0A 1ZGBA 2MTBA 1SQ5A 3PUHA 3U9SA 2PYDA 1ADCA 1OXSC 3V2UA 1KE2A 2QAIA 3EXIB 2CJWA 3EBLA 2BW0A 2OVFA 4OVKA 1I01A 4R1UA 5D5HA 1G55A 5L53A 1VMIA 1PTJC 3NBZC 4JU8A 4DRXA 2KMLA 3ISJA 3MCTA 2C7OA 4ONEA 1QGUA 4QPJC 4FZRA 4RS3A 3ILYA 1XJQA 2G77B 3IT2A 1JEQB 4F5DA 4NK4A 1NBOA 2Z04A 4GBMA 4LMPA 3O94A 3GFSA 3DLBA 1N0UA 2BGUA 1JA1A 3G8DA 1QE5A 2EWMA 2ONCA 2WMNB 2H00A 3CX7A 3VOTA 3U4QA 2PJZA 3QFHA 4L78A 3BKXA 1WW8A 2V7BA 1G20B 1U65A 3WL5A 5B7NA 2IYRA 2YVAA 3ABRB 3FHOA 4UFOA 1VCIA 1PK8A 2AYZA 4HLCA 3AB8A 2P9EA 5G3ZA 2OK7A 2ZTMA 3MCZA 1BDHA 1RHRA 3PLNA 3KHUA 1PS0A 3F4KA 1SWVA 3E03A 4BCBA 4D6XA 1IYZA 2UVQA 2PCLA 5C80A 1E60A 1JJFA 1FNDA 3FCUB 5IAGA 3MBIA 4YPVA 5LWHA 1RI5A 2E0IA 2YZMA 3NAQA 2EKZA 5EMHA 5CFPA 5BSMA 4FNOA 1ZGAA 1YZGA 2PT9A 4FOPA 1EFPA 1F48A 1PZHA 4UBIA 3FX2A 5E6UA 2XCIA 4Q7QA 1JMKC 2QYTA 4S2EA 1PJBA 2ZB4A 2JFBA 3AM3A 5EUMA 1GCUA 1PG5A 4KYVA 4WKBA 1XXHA 2WF6A 3FB1A 4KAFA 3RK0A 3ZDRA 5IABA 1ZL2A 3CUEF 4UVDA 5EPOA 3N8DA 3F6PA 1K8ZB 2YIDA 4IWXA 4P4TA 4OXIA 5IN4A 3EAQA 4LYHA 5IM5A 5TRTA 4Y9SA 2GJ4A 2X0JA 4UM7A 1TMKA 4ZEXA 3KUDA 2REQB 1ZC4A 2XODA 1FLAA 1NVEA 1DDGA 1KPIA 3E61A 4YCAA 3TTUA 5CJPA 3ZN2A 2HJVA 2CBXA 3GFQA 2VP9A 4UOEA 5JYDA 1Q14A 1SKYE 1WVGA 3TQFA 4FEAA 1QIIA 1OBOA 3NKFA 4GPD1 3AEQB 5K2MA 3TTSA 3S1SA 1BDJA 2D0OB 4DKJA 4FYIA 3TPCA 2F1HA 4H6VA 3DPSA 4RK7A 1WMEA 1TPZA 2H07A 2JCBA 3IULA 1Q5PA 4DJ5X 2H4XA 1BMFD 1N8KA 4GUDA 4YRMA 1YC2A 3EQ2A 4F4CA 1K7CA 2G9RA 3K73O 1HI9A 3OP1A 5ALEA 1J09A 3SCZA 1DCMA 5BWLA 1DELA 1BNCA 1HE3A 2FF7A 1E3TA 1UODA 3KZNA 4YJKA 4YLYA 4UJ3A 3HUFA 3FPSA 2O8DB 1UJMA 2GK3A 1BG6A 4WLUA 5C5IA 4CG1A 2YVQA 2RC5A 4H4EA 3WGZA 1J8YF 2VHWA 3SX2A 3T1VA 3EZNA 4GPZA 3GMDA 4QYIA 1JIKA 3CZMA 4KITB 4WCFC 4BBAA 1HQKA 1WHTA 1OGIA 3QK7A 4I4TF 4JB0A 2HIHA 1NTOA 4OMFG 2ZKLA 5IT9A 1NBWB 4ZARA 3TRHA 3LRXA 2PXHA 4BNGA 1L1QA 4UZEA 2C07A 1AS2A 1RIFA 3LY8A 3HKEA 5AJZA 3RSGA 1G9TA 3L0DA 3M5DA 3MTJA 2CXOA 4MW4A 4QWMA 4CNQA 2G1JA 4N8SA 3EXHA 3UKOA 4EG4A 5AVYA 4QU0A 3DAFA 3ZKWA 5CU7A 3OZIA 3ZIUA 3V1NA 1JDNA 3AY7A 5AJWA 2CLIB 5EQFA 4M6WA 3WWYA 4AJEA 1G7CA 4CTNA 5BW4A 4K6OA 3ST7A 1AN9A 1P60A 2Q6TA 4FB4A 2GHIA 3P4XA 4Y98A 3IAFA 4PZZA 2A4KA 2INGX 2QVXX 4URFA 2WOOA 1A4UA 1FBNA 3AUTA 1WTAA 3G82C 4JKYA 1Q0UA 4EVSA 2EV9A 4NWIA 4J0CA 4ZYVA 4EKEA 2FSUA 4IOJA 1OFIA 4Z9XA 3TK1A 1YJXA 4UU8A 3NM6B 4TROA 4FDLA 1H94A 2EERA 1Q20A 1KH1A 2JAOA 2VAMA 5DGCA 3TGWA 4LDNA 3H9BA 3CLVA 3SZOA 1OBHA 2ZJFA 4RMHA 3FNIA 2B4AA 3A1FA 3CH4B 3VKFA 1UOEA 5K6AA 5T64A 3KNZA 1NDQA 4KQXA 4JT8A 4EKYA 3F7OA 1K4KA 4TMWA 4A27A 4BAGA 2TMYA 4K0RA 2BGNA 3RS7A 1ISIA 1VDZA 3MOIA 4FYMA 4CKWA 2OC4A 5U4QA 3WSTA 4ALJA 4B6SA 1JEEA 2HCRA 2PBFA 2ASVA 1AF7A 1TF5A 2IUYA 4QLAA 3WA7A 1RXCA 4C43A 1Q7BA 2ZJ4A 5KVVA 3CGGA 2J3KA 3D6TB 2DBYA 3PUZA 3OIWA 4G37A 2Q7DA 1ONOA 1QPZA 3Q7RA 5DB4A 4EWLA 1C9JA 3ND8A 3IEKA 1P29A 2QZ9A 4ND2A 3H5OA 2DCMA 1L2TA 3NHUA 1I3CA 3MTAA 4JP1A 4NABA 5TVKA 1RHQA 2XT9A 1V0JA 2UZ4A 4CODB 5CA1F 3VU9B 2IUTA 1SB8A 1YDWA 3HXPA 4QL3A 4KVGA 5FYQA 1E1RA 3RHZA 1ZVVA 2JA2A 4DCPA 4CTJA 4UOZA 1KZ4A 2X8AA 1S1MA 1Y5IA 1NVMB 1U8XX 5EIBD 4RV4A 4H7KA 3OLWA 4Q48A 3IUQA 2P6PA 3NZEA 2EU8A 1OZGA 1KYZA 1CE8B 4YMHA 4X6XA 4O4LF 4HWOA 1ENZA 3C87A 3TSYA 4E7OA 2B35A 4I50A 3R5XA 1E2JA 4L95C 2C0CA 3JAMA 3PQEA 3CY6A 2PZ8A 2R7KA 1GGKA 2IODA 3MMPA 3HKCB 4A8JA 4EZIA 3HJRA 2CN1A 2C3MA 1M6EX 4O0LA 1UBJS 1C9KA 1NW6A 3GUYA 2X1VA 3OE7A 1UMKA 4GP6A 4F7WA 1KMCA 2WUFA 5JD4A 2HPVA 8ATCA 1UPFA 1C7FA 3HL4A 4WJLA 5MF6A 2IKSA 4R6WA 1G5FA 1PNVA 1VBKA 3TG8A 1TTTA 2C92A 4J9VA 3RUIA 1V3TA 2TMGA 2A57A 3T9EA 3QZUA 3V34A 3ZLVA 1PS9A 1UR5A 3KE8A 4K2HA 4RPKA 4Q9LA 5DASA 3WKDA 1P19A 2AZ4A 4X93A 2IS1A 1Q0HA 5IBRA 1S7GA 1KAQA 1A7JA 3DE6X 1KQ3A 4ZQEA 3TCKA 3WP0A 3KM0A 3JCZA 2X3YA 5GONA 3D4OA 3S1AA 1JBKA 2VDJA 3VR3D 1IZ8A 4R71A 1RQPA 1K6IA 2DUWA 1U9CA 2MSEB 3LW7A 4JQOA 3RC3A 1W0JA 3FDXA 3HCCA 3VV2A 1R50A 4N40A 1QFSA 1KBOA 3PEEA 4WQMA 1P4AA 1GGEA 2GB4A 4P7FA 1SCIA 3COJA 2ID8A 2AFHE 3AVPA 1O89A 5BN4A 3GJ0A 3THWA 1FY2A 1W30A 4Q7KA 4QFCA 3ANTA 3KQKA 3BK1A 3PQ5A 4TTQA 1PSDA 3RKUA 2B99A 4MTCA 4YJFA 1EFVA 1LK7A 5DBGA 1DTEA 1Y7HA 1OT5A 2KLBA 2M9MA 4Z3KA 3GT4A 4UAJA 3U81A 4KQCA 4JFAA 3DH0A 3Q3JB 3VSAA 4BZQA 4JGBA 2Q7OE 1Y6JA 3OU2A 5JCJA 1KI3A 1MMFB 2CCKA 5J40A 3L8YA 4ZMRA 9MHTA 1QQTA 5C1BA 1WXGA 1ONNA 2XNKA 5FADA 3ZGVA 3IOCA 4GX1A 2WP0A 1HDOA 3IPYA 1NXSA 5A2GA 5J4KA 3TBKA 2EOAA 3RFFA 1Y6RA 2IC5A 2XUJA 1XMQB 3DMRA 4UHEA 5GADl 3CNQS 2X0KA 2PX5A 4ZVLA 3VU1A 1VLVA 3QNWA 1EP2B 2PLRA 4KQGA 2H08A 3SQLA 3ZHXA 4E13A 4UUPA 1XEWX 2F3QA 4TSFD 1KK2A 3DBIA 2KBFA 3E3MA 1RBZA 2JHPA 4AFNA 3CR3C 4HAXA 4QXQA 4GM4A 1MC4A 4NPCA 1X7WB 4BNZA 3C1OA 3PNSA 1DAIA 1GQ2A 4FCVA 1A9QA 1TZBA 2I91A 1OBCA 1M9NA 1R4MA 4HWSA 3MIZA 3WBKA 1NMEA 4Q66C 3CVVA 1K89A 3H3FA 2QSZA 2PD3A 1QG2A 4LXYA 3T3OA 3CLSC 4IJQA 4R0VA 3CA8A 4LPKA 3RT9A 3BGOS 5I9IA 2P7HA 3JQFC 2QY9A 4QODA 3AG5A 2QUZA 3BKWA 3M1AA 5JY6A 3A9TA 3K2IA 3SC4A 5AJVB 1N0VC 1CY4A 2GDJA 3LK7A 3QH4A 4TKVB 3LUDA 4N6OA 2E2WA 4P3KA 4PHHA 4Q12A 4QDOA 1DG1G 1T5TA 2FX3A 1LA2A 5TF0A 3NIDB 3T38A 4MV3A 4PCLA 2GR9A 4DRXB 1U7TA 3N2ZB 5JQWA 2PKXA 3MT8A 1M0TA 2PGDA 2PUVA 5LZ5A 4JQZA 1QGUB 2XWSA 4KPYA 2HXYA 4PO1A 4CT0A 3B20A 2OOKA 3O26A 4RK5A 2WUEA 1DU4A 1QNFA 1BSVA 1E2IA 1OLOA 4B2PA 2FN9A 3BXPA 3DEKA 2RB5A 3TB4A 1G8GA 2FN8A 4GQIA 4D4GA 4XEUA 4H16A 4CRWB 2H29A 1RXSA 5FB3A 1NF8A 4OKSA 4E2YA 1V3QE 3CJQA 3PIDA 5FFMA 4ZVTA 4NZNA 3HDVA 5ALYA 2A1IA 3SYKA 1LSUA 5F5XA 4CMHA 5HZMA 5ALTA 5EL0A 3U0BA 3ZE7A 3TFOA 1ZXXA 3M5WA 5F2EA 3DMYA 3JZIA 4UBMA 3KTOA 2IX9A 2CZGA 1C9NA 2I71A 1QIKA 2QROA 3PHLA 1Y42X 3RV4A 5IDXA 1J9GA 5LLTA 1WABA 1ODCA 1DC7A 1LTQA 2Y1WA 4XUDA 3RVKA 3HCFA 3H1FA 4A82A 1GQSA 1W2GA 4MQUA 2B1QA 4ZRNA 1QORA 2AC2A 4IFBA 3EXEA 4GECA 4J6FA 2JLRA 2QN3A 1J8VA 4U02A 1XU4A 3GLFA 1N5JA 2FHSA 1ORVA 1QRDA 1YH3A 4QARA 5HPYB 4L75A 3JS5A 2DR3A 3RLIA 1C0PA 1NZDA 5DLPA 3BMCA 3WMRA 2JZOA 3UPUA 2JDID 1PWEA 2Z6VA 5BUSA 3EPHA 1L4LA 3GYGA 2ZUFA 2JIZD 1MUUA 5A7GA 1YZKA 3KXDA 2QZPA 1MABA 2GPWA 3U09A 2GTIA 3FCYA 3TDNA 1N4AA 3Q87B 4AL4A 1AK1A 3A8TA 3CF4G 4IO1A 3NVDA 1F6WA 3WGHA 2YRFA 4RTQA 2QN9A 3I9JA 4TXNA 2GQ0A 1GQOA 3ZWMA 3N0RA 5HF5A 5IWAB 1ZSNA 1M2NA 2B5WA 3V6MA 2REQA 3AFHA 3AZPA 5E4YA 1H1TA 1RZVA 1E5LA 2V6IA 3UJ9A 3V2HA 1HT1E 2PWBA 4Q3AA 2DWPA 3AUUA 4E11A 3QUTA 2XD9A 3QXSA 3TKAA 3W6OA 4R84A 4RPIA 4L2IA 2BUBA 3THSA 2EARA 3D54D 1Y6FA 1F14A 2PS9A 1EUZA 3LFHA 1OX5A 1F8YA 3IUNA 4F1WA 1WCV1 2BLNA 1P1IA 4M89A 3HLTA 3N2KA 3GLSA 2A3RA 3EARA 4OI0A 1FUIA 3DFMA 4KRYA 1TYEB 1ES9A 3IP5A 2WJVA 4MPRA 5KYVA 3FW1A 4XRRA 1CJBA 5EHIA 2KHZA 3NVAA 3OFND 4WN3A 1JHDA 5I9LA 2JBWA 3M6LA 2QRPA 3KPVA 1JVSA 1TQ4A 4WXHA 5LZ2A 4S2UA 2D7DA 2EQAA 3HZZA 3P9IA 5IJZA 4C08A 3JZFA 2YOFA 1Y3AA 1EUDA 4Q01A 3IYLW 3S55A 2DWOA 2GXAA 3E5RA 3MYRA 3L77A 3T7RA 4CMIA 2HLHA 3HP4A 3O84A 5IVDA 4EF4A 1E2BA 2G83A 4R2KA 2OBFA 3GLHE 1MRNA 4AUKA 2M1XA 5DBEX 4I7EA 3CVUA 3G5MA 3A4YA 4W9NA 4AKSA 3EVCA 3ODPA 2QSUA 5GZ6A 1XK6A 3DHNA 1QQ7A 1GRQA 4LDZA 1QU3A 3OG9A 1CUJA 2OGTA 2W48A 5ECGC 4RE5A 2DETA 4XE5A 4HLDA 3HBFA 1PWHA 2B1JA 3I6BA 1U0GA 2L19A 3ZU2A 1ZI9A 5HTOA 4CM9A 1W4CA 4X64B 2QJWA 3QYAA 1Q0ZA 3R8FA 2EG5A 1US8B 5AIAA 3F8SA 3H4MA 1ZJ5A 3FPLA 3KYIB 2CVOA 4D9MA 5LQCA 4MRNA 2XIJA 3B6MA 1FU8A 3EY9A 4FCWA 1YR9A 2VWHA 1GEEA 2PWYA 4DLKA 5JW6A 1CJUC 3CF6R 2Z8YM 3CISA 4HV4A 1NE7A 4M99A 4Y9RA 1ESCA 3A1CA 8MHTA 1W4LA 1OFGA 3MLAA 3MOGA 4F3NA 3TRDA 3FI9A 1JG3A 1XZEA 4L76A 2YJ6A 1ZR4A 3LECA 4XGRA 1M6VB 3THYB 5C4MA 1A0OA 2XTJA 4W1QA 2ST1A 4CMJA 5KU1A 1A9RA 2CFSA 3EMVA 3GP8A 2QTLA 3JQBC 5JBIA 4IIGA 1FSZA 5EAIA 2NZXA 4LKRA 5LMUB 5F2NA 2EJCA 2V5VA 1NQOA 2VHUA 3FPKA 4HMPA 5I9MA 3H6KA 2GLTA 3CONA 5AJXA 1ULAA 2E4UA 1SK8A 2J7KA 2ECKA 1K6MA 3E7DA 3K53A 3HU5A 4M88A 5SZKB 1E5DA 1VRCA 3UMJA 4AYXA 3GPCA 3O4GA 4DY4A 2G88A 2VP2A 2OXCA 3C3WA 3E82A 3CWZA 4XM1A 4MUNA 2Y99A 4E1VA 1UXIA 2PFKA 4D0GA 3L7DA 5DTRA 4Q93A 4X6LA 1RVDA 1NF3A 3E58A 4HG2A 2HOQA 4PYOA 1FUYB 1MJ5A 2V7EA 3FYTA 3OU6A 3PSHA 4I50B 1FTSA 4XDZA 5JCZA 1EFHA 3KT8A 2XHEA 5DN9A 3DXXA 4EHJA 4HN2A 1ZU4A 1TVKA 3Q4GA 1G7SA 4WCFB 1OXVA 4IICA 2VF2A 5DM60 4R7TA 1OX4B 1ZI6A 2ZTLA 3HA2A 3MTEA 3KQLA 2ZGVA 1FA9A 3U44B 1ZK2A 4W1RA 2J9GA 4RQTA 4GIBA 1UBEA 1BD4A 1CRWG 2PL5A 2XMRA 1YE5A 3EXHB 3BSSA 3IH5A 1RADA 2VNJA 3P0FA 4OJKA 2BZ1A 2PFGA 3IBCA 2GT1A 1UEJA 3E9DA 3S44A 3PXBA 4ZHSA 1NBMD 3H2IA 2GD6A 1DVRA 3MEQA 2Z4TA 3DDUA 3T9CA 1XU9A 1GTL1 1X1QA 1XTIA 4TLBA 1UDRA 1IXKA 1NVDA 4DE5A 3SDZA 4XWOA 3MFYA 3FWYA 3DHWC 3R09A 4WPGA 1R6VA 1C1XB 5AVOA 4P80A 2Q4BA 2NPOA 1YBVA 1QE0A 2A5LA 4IQGA 4MDHA 1BH2A 4X85A 1KOLA 3TIXB 3WKBA 1H4QA 1OFUA 2VCYA 5FOVA 1FF9A 1ZBDA 3CVXA 1L9KA 5DTQA 1JF8A 4M9SA 3UYLA 1KBQA 4YP5A 4KOEC 1XXLA 2PPVA 3P2YA 2P4QA 1B0ZA 3VU0A 5JZOA 5KKNB 1UOOA 1P7YA 3FKSA 1AV7A 4PAOA 3RSZA 3QU5A 4ECEA 5LM3A 3TF5A 4W7HA 4H3HB 3KCQA 5H80A 2LZ0A 3PGLA 3ORSA 3HBLA 1U1EA 2FP3A 1YRHA 3UJ6A 2Y9PB 4HTAA 3R7BA 1M2OB 2AJ8A 4KNWA 5JBNA 5L95A 4J1TA 5BOVA 8LDHA 1U2EA 3UG6A 1L9XA 1GPMA 3BXZA 5I47A 1IY2A 3GCWA 5TEVA 5JH7B 2M1ZA 1XN1A 2PD4A 2XQIA 4IDBA 4LGMA 4N7RA 4LGYA 3QLVC 3GFPA 1WKCA 1XZCA 1FNCA 8OHMA 1IPEA 1DHRA 1GZ5A 1N5MA 3WQQA 1R37A 1ZIDA 3KETA 1OAAA 2RH8A 1Z38A 3ZNPA 4KHPB 1POXA 1ZMXA 3CEMA 2BDEA 4YONB 3W5JA 4C3UA