1Q7BA

The structure of betaketoacyl-[acp] reductase from e. coli in complex with nadp+
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
243
structure length
243
Chain Sequence
NFEGKIALVTGASRGIGRAIAETLAARGAKVIGTATSENGAQAISDYLGANGKGLMLNVTDPASIESVLEKIRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVGTMGNGGQANYAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTRALSDDQRAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGGMYMV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cofactor-Induced Conformational Rearrangements Establish a Catalytically Competent Active Site and a Proton Relay Conduit in FabG
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
total genus 85
structure length 243
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2003-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1q7bA00
4ITUA 4BNXA 1GEGA 1YONA 2PZKA 3ZNPA 3INTA 3QWFA 1Z7EA 1X1TA 4M8SA 5DN9A 5JCJA 1EUCA 3GEDA 1X1EA 2HQ1A 3VDRA 2QX7A 4UUOA 4M87A 2D59A 3DAGA 1YKFA 2O3QA 3WMXA 5GZ6A 4UVEA 4IQGA 3FR8A 2G1UA 1UDBA 1UXIA 3C7AA 3EAGA 1EVZA 4FR5A 4IXWA 3AI2A 4BMNA 3EUWA 4IZIA 2NSDA 2P5YA 3DBHA 1IOLA 4ZHSA 5L3ZA 4F6CA 2A9FA 1RM5A 3PWZA 1PSDA 4JCOA 4R1UA 4GBJA 4D3SA 4RQUA 1I01A 4LGVA 3D4PA 2FHSA 4CQLA 1C0KA 1DAOA 1G0OA 4FW8A 3Q1LA 4Z0TA 2I66A 1V8BA 3L07A 4DLBA 1FDTA 2C2XA 1BW9B 4QUKA 4KUHA 1NPTO 3LYLA 3WTCA 2PR2A 3MJSA 5BSEA 2QRLA 4HBGA 1EBFA 4ZJUA 4U8GA 3MJEA 4R16A 5TGDA 3RBVA 5JAQA 3TL2A 1I3NA 1DPGA 1UXHA 3JD1A 2Q4BA 3GVCA 1YQXA 4XYMA 4IQ0A 2OHXA 3JQBA 1L1FA 1SEVA 1EFKA 5G4LA 4IZHA 2FMUA 1E5LA 1PJLA 3ZNQA 3TFOA 5JYDA 1HETA 3DBLA 3QVSA 2EWMA 4JN6B 4OMUA 3JQAD 4D3DA 4L4SA 2IXAA 4JP2A 3AUSA 5HA5A 3RC7A 2YQ4A 3GFGA 2ZQYA 1QRRA 1Y1PA 3IUPA 4D0RA 1WMBA 3ZV3A 5CAEA 3F3SA 4N5MA 1H6BA 5FEUA 1FDVA 4XYLA 3CE6A 2VHYA 3ROKA 5I7SA 4A03A 3PRJA 3ON5A 3PP8A 3AU8A 5A9SA 3I3OA 3W4IA 4PLPA 3DDNA 3F5SA 5CDYA 2VYVD 3ZWYA 3COSA 3KSDO 1F14A 1K5HA 2DTEA 1SOWA 2DLDA 2R6JA 4XGIA 1TLTA 4YA6A 2GDZA 1GCUA 3BMOA 3SXPA 1N9GB 4M49A 4R9RA 3JQAB 3H9EO 2PLAA 1A9ZA 1UP6A 1PU2A 2X9GA 3KEOA 1IHXA 2GGSA 1R4NA 4W82A 5KJEA 4BO4A 5COBA 5CPFA 3M2PA 1HDYA 3H9GA 3RUIA 1G6KA 1C1DB 2PGLA 1EVYA 4N18A 1V9LA 2FY8A 1MA0A 2Q99A 1YB1A 5DULA 1PZFA 2DTDA 2EEZA 1H2HA 3PHGA 1GL3A 3OA2A 2I67A 3R6DA 1U4OA 1QV7A 1E3SA 1X7HA 2V6MA 4TZKA 5AXBA 1U7TA 2BKAA 4TKMA 3I52A 2ZATA 4LISA 3PQFA 2CVZA 1DJNA 4BS9A 3SLGA 4GMFA 1ISJA 1KEWA 1QYXA 1ADCA 3SEFA 1HDCA 1IZ0A 1PQWA 1GCOA 1M66A 2J3HA 3PYXA 1IULA 3U5TA 4GKVA 4J0FA 4O0LA 4CLEA 2YHIB 1QLJA 5DDIP 2CNBA 2I76A 3HDQA 3ZWXA 2O3UA 3PJEA 3ZV5A 2P2SA 1WDKA 5G4KB 1HZJA 2JD1A 2X6TA 3WNQA 3L6OO 3EYWA 3GZNA 4R54A 3RSHA 1YL5A 3TOXA 2EG9A 4YWJA 4XIYA 3R0IA 3KV3O 2OL4A 3O4RA 3DAPA 2BFPA 4NU5A 1YBVA 2XXJA 3H7AA 1X13A 5A3VA 4PLFA 3GDOA 2V6FA 4R5HA 1N1EA 3MZ0A 3AOGA 2VZ0A 5LDGA 4R3WA 2ZJ1A 2RBEA 1HE5A 4S3MA 4RPJA 4EZBA 2Q1SA 1J49A 4BNYA 1YQDA 4BO5A 2FPPA 1LC3A 3R1IA 4L4RA 2HMTA 4FC6A 5KVCA 5A1TA 3WJ7A 2B36A 1JU9A 3I9LA 4G2NA 4A73A 1JKJA 3ORFA 1ZO8A 4QSMA 1BDBA 1CQJA 4CQMD 4NMHA 3U09A 4L74A 5L7WA 5HWSA 2WD7A 1PQPA 3UFXA 3QWAA 3QA9A 2V6BA 4NBUA 4B3JA 4CM4B 4B3HA 2B5WA 5JFOA 3DOJA 5ICMA 4CR7A 9LDTA 1C1XA 5T6BA 2Y99A 4YB8A 3UH1A 5I9LA 3AI3A 2A4KA 5TSDA 4BO7A 4J3FA 2NTJA 1ID1A 7ADHA 3GK3A 4DWVA 3PVZA 4OQZA 2GZ3A 4GWKA 5I7EA 1VM6A 3T4XA 2C54A 1B26A 4J7UA 1DRVA 3K73O 2Q45A 4IIUA 2WJPA 4RORA 2VRCD 4BB5A 2DVMA 4FFOA 1A4IA 4LSWA 4PLYA 1DHTA 4UVDA 4HNGA 3T7EA 4B3IA 3F5QA 4Y8VA 1X15A 5IAAA 3L0DA 3JCZA 4RL6A 3RUCA 4RPGA 4XDZA 4CM1A 1WW8A 2VT2A 4BMVA 2I3GA 1E6UA 4D46A 4DPKA 4JBHA 2H1SA 4CL3A 1Z45A 4S1VA 5T64A 1DXYA 3JD3A 4ALMA 1HE2A 4I8XA 1T1RA 2J5RA 4MVJE 2I9PA 5KVQA 2ZTMA 3L9XA 5L4NA 1Y81A 4XRGA 4XA8A 2W2KA 5I7FA 4ND4A 3BMNA 3GVHA 3IC5A 3QIVA 4QEDA 4YVFA 3JQ7A 1ZUD1 1P1RA 3ZWNA 9LDBA 2P9CA 4BGIA 3HN7A 4N5LA 2H9IA 3GY0A 5KJFA 2YJZA 4N7RA 4W6ZA 4IUYA 3QVWA 3PTZA 3CH6A 3WGHA 3UAGA 1F06A 1VLLA 2Y68A 2E4AA 4WLOA 1GZ4A 4DUPA 1I3KA 3KVOA 3WB9A 2X9NA 4ALNA 2HK8A 3NT2A 5K0ZA 4Z9YA 1HYGA 1MXFA 1AHHA 3FCOA 1SCUA 3GGPA 3JYNA 2BFMA 3ETGA 3H4VA 1U8FO 3QW2A 3H2SA 1QMGA 1B16A 4PLTA 5EINA 4WGGA 3T4EA 1Y7TA 2ZYGA 4EJ0A 3R3JA 4OO3A 3ZHBA 4DLAA 3KUXA 4DQUA 3JQCA 4HUJA 4MJLA 1KVQA 3NYWA 4K26A 4RPHA 2C5AA 1EEHA 2HU2A 4XJTA 2PZMA 3H3FA 1U3WA 3BHMA 4MP8A 4IBOA 3RU7A 3ZWVA 4XKJA 2VYND 4LRSB 2YYYA 4UEOA 3RFTA 1O8CA 1V3VA 4TVBA 2QZ9A 4E12A 1LEHA 2WYUA 4ALIA 4BOYA 2NQ8A 2AE2A 3GUYA 1PTJA 4IMRA 2GSDA 5B1YA 3SX2A 1DC4A 2C29D 4LCEA 4FD3A 4YJGB 1R6DA 4PIVA 1WLYA 2LDXA 3CIFA 2BFAA 1XIVA 1Y8RB 1XSEA 5ENVA 3CZMA 4CM4A 3O26A 3PJFA 1JTVA 1T26A 4KWHA 2CD9A 3CXRA 4OIMA 2AQKA 4YQYA 2BD0A 4IS3A 5JE8A 3I9NA 3G1UA 3FHLA 3K8ZA 2OP0A 3GNQA 2VT3A 5TT0A 3S2FA 5AXDA 3DB2A 4BNHA 3H5RA 3VOSA 2O3TA 2P91A 3C1AA 3Q9UA 2QZZA 1GY8A 3A06A 4XWYA 2AG8A 4L73A 4JBGA 2GASA 4PG4A 1WPQA 3VTFA 1MFZA 4K1LA 1EVJA 4JNKA 4ND5A 1N1GA 1WMAA 1LDEA 2JCYA 4E5MA 3WFJA 4CPDA 3IP1A 4DC1A 2E6UX 3U3XA 3G3EA 1EE2A 4BNNA 2FZEA 4FGWA 4R68A 4WK6A 4UEJA 5JAIA 2VOJA 4NBVA 3RU9A 4DQXA 2VUUA 4DGSA 2G5CA 3WFIA 4E2ZA 3IL2A 2VUSA 3OECA 3TPCA 1Y9EA 2XXBA 4MO2A 4FOOA 4RVHA 4GX5A 5G4KA 4A2CA 2Q2WA 4XZ3A 4L76A 2Y1EA 4PLCA 1PZHA 4CLRB 4CLXA 2D4AA 4CLHA 3R3SA 2JD2A 4CQMB 3DTTA 2OP1A 4XX0A 1LLCA 4R41A 4P38A 5EIOA 1YL7A 3PI7A 3BMQA 4FBGA 3GVPA 3WYEA 3V2GA 5K9ZA 2AEJA 2Y1GA 1BXZA 2Y1FA 1ULUA 4RVSA 1BXGA 2UUOA 3OIGA 4RF2A 4RVDA 3RJ5A 3V1YA 3ZCXA 4E0BA 4YRBA 2PZJA 4OKIA 4IDDA 4BNVA 3WGOA 4CJXA 3HUDA 1CEQA 4U5QA 1GYPA 2YFQA 5BQFA 1ZW1A 1XQ1A 4DL9A 1E3EA 1FDUA 4MIOA 2X5KO 2POQX 4J9VA 3L6DA 4EJ6A 1LRLA 1CF2O 2V6GA 1DIGA 2Q2VA 3ENKA 3K92A 3G79A 3UOGA 2O2SA 1XU9A 5TQVA 3KB6A 2DAPA 4MVJF 4AJLA 3LT2A 3E5MA 3QE3A 1XDWA 2EF1A 4MKZA 3I6IA 4Q39A 3WNVA 1U3VA 1Z82A 3GPIA 4NU6A 1EFLA 2ZYAA 3L9WA 3ZNNA 2OXIA 4RF5A 3PYLA 5KJCA 3AFMA 3NJ8A 2DBRA 1HLPA 2FP4A 4C4OA 2DC1A 1XG5A 3DONA 3WLEA 4D3FA 1NBOA 3U4CA 4AJKA 4M55A 2RHRA 3WQQA 4EBFA 2YDXA 4BGVA 3A28A 3DOCA 2IYOA 2BI7A 3ANLA 3FF4A 4GQAA 1NP3A 1EZ4A 2YUTA 4OOEA 2JAHA 3FBTA 3W4JA 1H9AA 1LSUA 3DZHA 1N5DA 3UGKA 4XGKA 4HV4A 3INGA 1PZGA 4FFNA 1C0LA 4QXMA 1EK5A 2PD4A 2X8LA 1W0CA 3VPHA 1GQYA 3NX4A 1JWAB 3A9WA 3I6QA 4OXYA 4A7PA 1GR0A 3P5SA 4RO0A 1PS0A 3G17A 3H9UA 4E33A 4MVJH 5G0WA 3KYBA 3D4NA 2JFHA 5EL0A 3DMYA 1N7HA 3RC2A 3OJ0A 1KC3A 1BTOA 1VSVA 1MG5A 4J16A 3VPFA 2ZB3A 1BXGB 2B5VA 4JK3A 4IJUA 4PLWA 1ZK0A 1A27A 3EHEA 1TEHA 4IDBA 4JJIA 3WIDA 2GZ1A 4KZPA 3PWKA 5JDIA 2CDBA 1PQUA 3RD5A 3GN1A 1YXMA 3DZGA 4IJKA 4QTZA 5B4TA 3WG9A 4E31A 3LQFA 3MOIA 3GHYA 1I24A 3OEWA 2D5CA 2IE0A 5K6AC 4RLHA 2NM0A 4I5FA 2BELA 1P44A 5DF1A 4JBIA 1E1KA 4IGEA 2PD3A 5DOVA 4WASA 4BUCA 1PJTA 5BSHA 5JMPA 2D2IA 3DMTC 1M6HA 1NX6A 1B15A 2O50A 4DPMA 2NWQA 2Z1NA 2A92A 1U2DA 1KOLA 1OFGA 3K5PA 1T2AA 1T4BA 3OQ1A 1Q7CA 3W6ZA 5I8WA 3FTNA 1PGPA 3WGZA 4LW8A 3KBOA 5BR7A 1ZMTA 2ZJ0A 3N7UA 5A02A 1MX3A 1KS9A 1B7GO 3DHEA 3IMFA 1ZBQA 3AU9A 4WLFA 3O8QA 1O94A 3I83A 1TXGA 1U3TA 4IMPA 3WBBA 3TJRA 1GYRA 3E03A 4UEKA 1LDBA 4OH1A 4XYGA 2CDCA 2WYWA 1W4ZA 2ZB8A 3M1LA 4UVHA 2JKVA 4CLDA 1AE1A 2J8ZA 4AJNA 3GG2A 1ZJYA 2Y05A 3E9NA 1CDOA 4G5HA 2WM3A 4P4LA 4DYDA 5IZCC 1QR6A 1XU7A 3GMSA 3B20A 3LC1O 4HWKA 4I5GA 4OYRA 3F46A 1QP8A 4XQGA 5JCXA 4AJJA 3NT5A 4AJPA 4XDYA 3SC6A 4NFHA 2DBQA 3IJRA 3TZHA 2CZCA 3RKRA 2ZIZA 4F46A 4PG5A 1YL6A 1BGVA 3MEQA 1PJSA 2R00C 3HFGA 4Y6RA 3ZWCA 3HQ4O 3PLRA 1DC5A 4FIZA 3VZPA 1AXEA 4DPLA 5KJ1A 2QIOA 3EW7A 3QQPA 1DC3A 3GVXA 4MVJA 1Q7GA 2E49A 4E2YA 3WQSB 1OZAA 3VPXA 5L40A 5L51A 1LC0A 2UVDA 3KZVA 3S1LA 3MTGA 2ZCUA 3OM9A 5ICSA 4NPCA 1TI7A 4XQ9A 2VWHA 3ADOA 3H65A 4DXHA 4E6PA 1NASA 4CMAA 1VJ0A 5A03A 3WGYA 5IN5A 4CM3A 2WD8A 4L75A 3TQHA 4DC0A 5IJZA 4BO1A 2NU7A 2AA3A 3HE3A 4WLEA 4MKRA 7MDHA 1LXCA 1E7QA 1E7MA 1E7YA 2GPTA 4ZRMA 3UCXA 1I33A 3DZBA 2BLLA 4MP3A 1AN9A 5F5NA 2C7VA 3WSWA 1HZZA 2Z1MA 2R2GA 3LC2O 1C0PA 3VZQA 1MGOA 3ST7A 4D0SA 2J3KA 1NWCA 3M6IA 4R5MA 1D8AA 4TSKA 1NAHA 3ANNA 3LT0A 4CR8A 5ILOA 2PKRA 5JPIA 3KYCB 4UULA 4HFNA 5DBGA 2GLXA 3P19A 3F6YA 3PZRA 2VHXA 3HDJA 2VHZA 2Y1CA 3CSDA 4QX6A 4W4TA 4XYEA 1M76A 4Z3KA 4RF3A 3FNEA 3NDJA 1SO8A 1SC6A 1ENZA 1QYDA 4BNWA 4AG3A 1H2BA 3M1AA 4ZQEA 3WXBA 3PFFA 2HK7A 1AUPA 3LLSA 1JKFA 2DUUA 3LK7A 2JAPA 1VJ1A 2X9VA 1YB5A 2AW5A 3V2UA 4PZEA 8ADHA 4RV9A 3ONEA 4KQWA 3ZW8A 1QYCA 3JQGB 4NJOA 1JLLA 3T7CA 4WLUA 1NWHA 1E6EA 1BG6A 1Y8RA 1ORRA 2DM6A 3RUFA 2J3JA 5A04A 1E5QA 5HM8A 2NQTA 4RDIA 2Y0DA 1F8FA 2P9GA 1PJQA 2OZPA 2Y1OA 3EDMA 5TS3A 3DFUA 1LDMA 4CV3A 3TNLA 3PHIA 2IZ1A 1NPDA 4NR0A 4CM5A 4A10A 3CTMA 5U9CA 2UYYA 4AJ2A 2YHUA 3OHSX 3ZU3A 2J3IA 3AM3A 2HDHA 3D3WB 3FN4A 2DPHA 3PZBA 2D8AA 1HKUA 3G0OA 5GZ3A 4CUKA 3D3EA 3JYQA 3WTBA 3GOHA 3NGXA 5CFZA 2Q50A 4LRTB 2DBVO 3FWZA 3I9JA 3AOEC 2GZ2A 2XOXA 1J5PA 4J91A 4KWIA 4WCFB 4J4BA 1GDHA 2D5AA 2NU6A 5IZ4A 5CG1A 4B4OA 5IFLA 4OOFA 4D43A 3BMCA 3JQBC 3ROMA 3BHIA 4BV9A 3QV1A 1MXHA 1QSGA 3GR6A 4GSKA 3NGLA 4D42A 4TRNA 2C07A 2B37A 1VRWA 2W2LA 4MVJD 1IHYA 3GF4A 1V3UA 4U6QA 1A7KA 1R0SA 1Q0LA 5JAZA 3OIFA 5GZ1A 2HO5A 4QECA 3DZKA 1QYWA 3GFBA 1ONPA 4QFCA 1BDMA 1PEDA 5TJ9A 5C7OO 1B14A 4OL9A 4BKQA 1YOVA 4OJNA 1YDWA 3ENNA 2AQHA 3KYDB 4Z0HO 3W4KA 4GLLA 5EN4A 2QHXA 4ND1A 2Q2QA 2X0NA 4GGOA 4PG8A 2WD7B 3F47A 3TOZA 4Q3EA 4XEHA 2V7PA 4IDFA 1HE3A 4UUMA 1HDXA 4TROA 3B1JA 1A72A 1I2ZA 4IDGA 2RH8A 4IY1A 5MDHA 2IEDA 3D0OA 4CQMA 1ZK4A 2JCVA 1BWSA 3WYCA 1QG6A 5EQFA 5CEFA 1GV1A 2VYNA 2BGLA 1NHGA 3JQDA 3GEGA 5JLAA 2RAFA 4E2XA 1ZXBA 3LU1A 1HYEA 3MJCA 3H5AA 1X7DA 3QWHA 1D4FA 1F0YA 4YAKA 2YDYA 4CMCA 3UXYA 2PZLA 3WGTA 2GCGA 3JQ9C 3KXDA 4IDEA 1ZJZA 3JYLA 3K30A 4TVOA 3JTMA 5A5EA 3PK0A 4KDEA 2AEFA 2ZCVA 1LLDA 2PY6A 1YVEI 3DAFA 1DSSG 3QWBA 5A4DA 3CMCO 1DHRA 1MFPA 2GN6A 2VCYA 3IUSA 1IPFA 4DREA 2NNLD 3L4BA 4EJMA 1HTBA 4L8VA 2FPGA 4WCFC 5GMOA 3BTVA 4CLOA 5L7YA 3EVTA 3I5MA 4KUEA 1T24A 4E30A 1PJ3A 5DBIA 3U9LA 3VTZA 3VPGA 5JAMA 4HFMA 2FN7A 3RASA 4PFJA 1CQIA 4DA9A 3VH3A 3LLVA 4BIIA 4YJGA 3ZGYA 2O3RA 4B4VA 1AXGA 1OC2A 4BQPA 1B8PA 1MB4A 3GA0A 1P1KA 3I9KA 4ZQHA 1VSUA 4EUEA 4R1TA 1H6DA 4TMFA 3B70A 2J5KA 1PL7A 1HSOA 3MCVA 2NTVA 4YXFA 4CM6A 3ITDA 2Y93A 3WR5A 4BNGA 4D7AA 1K89A 3BMCB 5AQ1A 4YBZA 4J4TA 4RVUA 4PGFA 3AW9A 1ZEJA 2BGMA 1ZVMA 4BO2A 1GQQA 3GAZA 5KJ6A 4YT4A 1NFFA 5A9SB 2WSBA 4BHTA 2YV2A 2DFVA 3JQ6A 4GX1A 4AJIA 4CMKA 5T57A 4I9UA 3P7MA 3QRWA 1X0VA 3I9OA 3LVFO 3PGXA 5JDCA 3JYPA 1KY5A 1ZSNA 1U2GA 4M86A 3S2EA 2PKQO 3VKUA 1JQBA 3WGIA 2AQ8A 5DOZA 4J49A 1PL6A 1P1JA 5AXAA 1EUZA 2W2LD 2P5UA 4G65A 3AJRA 2VWGA 4HFJA 1PZEA 2P4QA 1KETA 2I3AA 2GD1O 4U0JA 2DQ4A 3GN2A 4J9UE 1WNTA 4TRRA 4BNUA 4ZQGA 3QJ5A 4BV8A 1ZSVA 1N9GA 2CUKA 4RCVA 4YAEA 3SJUA 1TT5B 1DB3A 3U49A 1NFRA 3FSRA 4DMMA 3QWIA 2AEMA 1NNUA 1H0KA 4KDFA 4R9SA 3ZWWA 2EV9A 4M89A 4J0EA 5I7VA 5L53A 8LDHA 3IOYA 1BW9A 1H5QA 3ETEA 4DRYA 2IODA 4GPD1 1ISHA 2DPGA 3RWBA 4YACA 3STHA 5A9RA 4IJVA 4ZU3A 1PIWA 2NVUA 5FF9A 1P1FA 1X7GA 4E21A 4ND2A 2WE8A 3KTDA 3OBBA 4FQ8A 1VKOA 4WLNA 1A71A 2LDBA 3TZCA 2OO5A 3BA1A 4Q3CA 1IPEA 2CVQA 1I32A 1KVUA 5ITWA 3PYMA 2QG4A 4Y67A 3VZSA 1EDZA 2Q49A 1W73A 2FSVA 4GI2A 1XGKA 1XA0A 3Q11A 3C1TA 1UXGA 4DVJA 2CY0A 1U8XX 5H81A 1E7WA 1R16A 4FOSA 5LDHA 5TIIA 1LSJA 5JCJD 5FFFA 3FD8A 4BKOA 3LF1A 3DL2A 3H9QA 1HDRA 1OMOA 4WPGA 2HJRA 5KKCA 2OBNA 3B1KA 3C3XA 4YT5A 2B69A 2HCTA 1CERA 1J4AA 3IS3A 5KKAA 5C3MA 4IQ8A 3GRPA 4YT2A 4NI5A 1GZ6A 2VOEA 5IF3A 1WDLA 5T5QA 4J1QA 2GUGA 2YZ7A 1SB8A 2PH5A 2PD6A 3GMDA 3IQDB 3IJPA 1M67A 1LI4A 3FBGA 4UUNA 5IDWA 1LDNA 3NTQA 5BSGA 1FF9A 3K2BA 3ZV4A 1T2CA 3HWRA 1Q1NA 2Q46A 1I2CA 4EYEA 4PVDA 2VTEA 3RAJA 4WCFA 2Q1WA 5ER6A 1DAPA 4R3NA 1WZEA 4ND3A 3GNTA 2G0TA 2I5PO 3VAZA 3GGOA 5TX7A 2FSSA 2O23A 4DBVO 4XIJA 4CUZA 3BIOA 4GKBA 3ZU2A 1MC4A 4TRJA 4PCVA 5ER9A 3ETDA 4RJTA 4FFMA 2RH4A 2NACA 3KRTA 3JQ8B 1VKNA 1WZIA 2OBYA 3EC7A 1SNYA 1UXJA 4HADA 4PG6A 3DZIA 4CMIB 5CDTA 5F5LA 4K28A 2X1HA 4MVJM 4BGEA 4Q3NA 1ZK1A 2ZQZA 1Y8QA 1U1IA 1I36A 4YJFA 5CHEA 3NTRA 3H3JA 1JA9A 5C37A 1GUZA 2AMFA 4ZGWA 5A06A 1IUKA 3Q9NA 1CYDA 4ILKA 4AFNA 2EKPA 3MOGA 1I3LA 2G82A 5EERA 2HK9A 4IS2A 1XEAA 4NHEA 5H82A 2X4GA 5T8KA 3GHHA 4YRDA 1YJ8A 4BO9A 3WGGA 1PX0A 2GN9A 3AOEA 4INAA 1R4NB 4H3VA 3RJ9A 3VKVA 1LQTA 1WP4A 1NHWA 3JQEA 1JN0A 1DFIA 4NZ9A 4A5OA 4U0KA 2D3TA 4XB1A 3W8DA 1DOHA 1UUFA 1DIRA 4U6SA 3VH4A 4JP3A 3E5RA 1HRDA 4I5DA 4J6FA 4NQZA 3W8FA 4O6VA 2DBZA 1WWKA 1QORA 1BXKA 3D7LA 3GPDG 4CMGA 4K6FA 4PLGA 3ROQA 3OFSA 1GPDG 3DWFA 3GQVA 2A94A 2W8ZA 1U7HA 1UP4A 1GFSA 1SBYA 1IZ9A 4ESOA 2Q1UA 1WXDA 4BQRA 3GGGA 2PFGA 1QLHA 1H6CA 1LDYA 4DIFA 1Q7BA 5COQA 2JJYA 5F1PA 4BNTA 1E1MA 1TT7A 1LRKA 1O95A 4UUPA 4BNKA 1E3IA 4TKLA 1HDOA 3GAFA 1XQ6A 2C2YA 3X2FA 1MLDA 1GUYA 1HT0A 3PHJA 2VWPA 4II3A 1F12A 3LF2A 3IKVA 1B2LA 2EKQA 2ZB4A 3BAZA 5B4VA 3U4DA 1HLDA 4AJHA 5COAA 2Y0CA 1P0FA 4Y6PA 4EGFA 3OJOA 4YT8A 3INRA 1RKXA 3E18A 1SMKA 3ONFA 4L9RA 4AJ1A 3U4HA 3NDIA 1H93A 2O4UX 2C7GA 1I10A 4W7IA 2VZ8A 4WNIA 2YQ5A 4MPDA 4DIBA 2PGJA 4RQTA 1N92A 4DLLA 1K6XA 1D1SA 1TVEA 5AOVA 3ICPA 1L7EA 3DOOA 1Z74A 3GDFA 3TZKA 1VC2A 4IXTA 4R1SA 3ZNOA 4U7WA 3UCFA 4O1MA 3AI1A 3PIDA 4BNFA 1ULSA 3AUUA 5CDUA 5IN4A 4E4YA 4ALLA 1ISMA 3A14A 1I0ZA 1I30A 2BI8A 2X7HA 4ALJA 4UAGA 1NQTA 1W6UA 1YWGO 4OXKA 3RBXA 1I2BA 2XF8A 4XQCA 3ZN2A 4CMIA 3C1OA 1E3JA 3RFVA 4E5YA 3HHPA 1DLJA 2D0IA 3ZI0A 4GMGA 2X5OA 3AY7A 4FPXA 4YJHB 3NTOA 3OJEA 2HJSA 2C20A 1A4UA 1WDMA 2OGUA 4ZQBA 5DCWA 5U1PA 3OH8A 3WSVA 4QFDA 3DHNA 3ZZNA 3KLPX 4J2OA 2G17A 4Q3BA 3RROA 2JFFA 3S55A 2G76A 5DP2A 2W98A 1NVMB 3H9JA 3OETA 4DTIA 1ONOA 2GYYA 3O8QB 3E9QA 3WX0A 2ZTVA 3HG7A 3HFSA 3RFXA 1UDAA 3E1KA 3P2OA 4Z6KA 4RDHA 1DO8A 3G1TA 4O63O 3KEQA 1N8KA 1KERA 4Z0PA 5CEJA 2J6IA 4NK4A 4PN3A 5CG2A 5ITVA 1CIVA 4AICA 3F4BA 3OJFA 1QV6A 2H6EA 1XLTA 3FPLA 2EP7A 1RYDA 1DLIA 4W99A 4CV2A 3KLMX 3OMLA 4PRLA 3DFZA 1W8DA 3JQ8A 4XD2A 1L7DA 1ENYA 4R69A 3VZRA 3TZ6A 3VC7A 4ZQFA 2QYSA 3FPCA 3D3WA 1N2SA 1R0KA 2X0IA 4XJSA 1J6UA 4F45A 4XYBA 4JQCA 1YDEA 2ZTLA 5IXYA 1T4DA 4LMPA 3I4FA 4IM7A 1HSZA 1PGJA 4GLOA 4IGFA 1OAAA 4HY3A 4KTVE 2Z5LA 2VWQA 1B3BA 3U62A 1NQAO 4E13A 1H94A 4P8RA 4ROSA 5THKA 4YJDA 1CJCA 5JS6A 1RJWA 3KSUA 2Q3EA 1ZKMA 2VRCA 4OGWA 2QW8A 2BGKA 2FR1A 2B4RO 2EW8A 4GH5A 4E3ZA 4MVJI 3BZUA 5JSFA 1LNQA 1E7SA 2C59A 3D5QA 4WJZA 1T1SA 2VNSA 4PLVA 3KM0A 3B6ZA 1XHLA 4WECA 2O7SA 2PTGA 4KQXA 3DXFA 1DFHA 2GR9A 1ZH8A 2DTXA 1LJ8A 3NRCA 5AXCA 2HMVA 4CUJA 3PFWO 2CSUA 3PLNA 4Q3DA 2IEBA 4LN1A 5J23A 3ONDA 5LCXA 3C85A 1G0NA 3JQFC 2W4QA 3BMQB 4PZCA 4NFYA 1CWUA 1ARZA 2EP5A 3PXXA 1U5AA 5B37A 4NDNE 2X23A 1HXHA 5HS4A 3ICCA 5TJHA 4FJ0A 1YBAA 3RI3A 4L4XA 4X54A 1E77A 3GH3A 3PDJA 3Q6IA 4YYZA 4EEZA 4RLSA 3JQ9A 4CM9A 1UJMA 4QO8A 2TMGA 3ZV6A 3QY9A 3A1NA 3QSGA 2ZKLA 3PWSA 4BL5A 5HRUA 4HFRA 1DFGA 2BFOA 3WYBA 4AVYA 1C3VA 1BHSA 4DMLA 1N7GA 1I3MA 3CPSA 3UICA 2BH9A 3E8XA 3ITKA 3O38A 4JX8A 4E5PA 1E3WB 2C0CA 2JHFA 3QVXA 5DT9A 5AYVA 1HWYA 2NU8A 1YB4A 2GNAA 1KVTA 1EQUA 1ADBA 1DDOA 1Z73A 3MJTA 1A5ZA 4J7XA 4XRRA 5HS6A 4EDFA 4EW6A 4Q9NA 2PNFA 1DIHA 5JDIC 1BVUA 1XELA 3DBRA 4J1NA 1T2FA 3RC1A 4B8WA 2EERA 2F1KA 2IDZA 2OORA 5U4QA 1PGOA 3ROPA 1E1NA 4QQRA 4CMJA 3WIEA 2BMAA 4D79A 2Z95A 4B8ZA 1YE3A 2HKIA 1P1HA 2VHWA 1NM5A 5B12A 2HUNA 1QKIA 3OIDA 4M54A 2O7QA 2EXXA 1PL8A 1ZIDA 4OXNA 1JDJA 4YJFB 5JBIA 4EI2A 3WS7A 1DBVO 3VVBA 1PJBA 1M75A 1V6AA 1E1LA 4MP6A 4BO6A 3RUDA 3OA0A 4NG5A 1P1IA 3GRKA 3TL3A 1Q0QA 1TA4A 3F9IA 2C82A 1QXSA 1X14A 4NIMA 6ADHA 1U3UA 2BHLA 4IDAA 2W2KB 1YS4A 2VUTA 3L6EA 4RVFA 1S6YA 1O89A 4A27A 4AJOA 1B0AA 2Y67A 2ZB7A 3WWZA 5L7TA 3LT4A 2WE7A 1NXQA 2HSDA 4R4JA 3LSYA 4GX0A 2Q4EA 4IIVA 3RQSA 4DIOA 5G2OA 3WLFA 4A26A 4CMHA 2JFGA 4LSMA 2B4TO 5TF4A 1H6AA 2HMSA 1D1TA 4NBTA 5DBFA 2Q1TA 2NADA 1YGYA 5F1KA 3SJ7A 2X5JO 4BKRA 5I9MA 5ES3A 5IG2A 3KSZO 3MJVA 3PEFA 3ADPA 3IDSA 1PGQA 5BNIA 5T67A 1HDZA 5DZSA 2GN8A 4PLZA 4BNJA 1ADFA 4BB6A 1GD1O 3HB5X 1OC4A 3DBLB 3QVOA 4BO0A 2P68A 3U4IA 2EW2A 5G0SA 2NU9A 3CKYA 4D44A 4D45A 4CV0A 3MTJA 3BYZA 4WEOA 3ZHXA 4F6LA 4BVAA 1JWBB 2EJWA 4WEQA 3ANMA 2IYPA 3AY3A 4WCDA 1PWXA 1YOVB 1C14A 4PZDA 3JQGA 3H8VA 3EMKA 1UZLA 4N5NA 4MDHA 1X0XA 4KMSA 4A0SA 2VTDA 2XAAA 1GV0A 5L9AA 3S8MA 3JD0A 2PKQP 2O2YA 4NBRA 1I5RA 1T2DA 1UAGA 4CQLB 1VE9A 3RCBA 5TLSA 2X86A 3M2TA 3OQ6A 5HTOA 3L77A 4UREA 3ZU5A 1PR3A 3ZHZA 4RGBA 4RF4A 3FWNA 4ZD6A 1DEHA 3DMTA 1Q2XA 1KY4A 1SEPA 1K6IA 1U5CA 2X22A 3I4CA 4J4HA 5JY1A 4GWGA 1ML3A 5ENDA 1LUAA 2CVOA 5HBRA 1G1AA 1LQUA 2NVWA 1QYVA 3KYCA 2FR8A 4LVCA 5K6AA 4XR4A 5TRTA 2FWMX 4M1QA 1FDSA 4ALKA 4KTTE 1YO6A 4FFLA 2VQ3A 5CDSA 4RVGA 3ABIA 1UH5A 1GZ3A 2FPIA 3MWDB 4FCCA 2NV6A 4B7CA 4Z9XA 2VNAA 1P31A 3DR3A 3N58A 5H83A 1R0LA 2PGDA 2RHCA 1D7OA 3V1TC 1EBUA 3E6AA 3HZZA 4RPKA 4EUHA 1Y5MA 4E32A 1GTMA 1ZSYA 2EIHA 3OEYA 3Q3CA 4J90A 4YEDA 1KVRA 4EEXA 1LRJA 3WWYA 1JAXA 1LLQA 2FR0A 3VDQA 3BTOA 2H5LA 2Y0EA 3GLQA 1F17A 3NJ4A 3TRIA 1VL0A 3UVEA 1VI2A 4KUGA 3AY6A 5KVSA 3D64A 3NAQA 2AHRA 1SZJG 1YH3A 1XWFA 3C7CB 4MKXA 4O5OA 2OFPA 3F4LA 3W1VA 1NTOA 3GZNB 3V5NA 4FDAA 1NR1A 4JGBA 3PHHA 1TT5A 2ET6A 4R01A 2WMDA 4BNMA 2E48A 2JCXA 3BTUA 3WGQA 2F00A 2V65A 3SC4A 4BO3A 1FK8A 2AXQA 2GO1A 2X0JA 1HDGO 4J7CA 3KO8A 1ZNQO 2GF2A 1NPYA 4YJHA 1LSSA 1JW9B 4DBZA 1VL6A 3JV7A 2YFHA 4C7JA 4Z9FA 5IZCA 4B4WA 4OKNA 4CV1A 3QVTA 1V3TA 3WBFA 2VRBA 1C0IA 3UCEA 1NFQA 4OQYA 1SB9A 2TMDA 3NDRA 3OQBA 3HDYA 1C1XB 4XB2A 3ULKA 3DQPA 1E6WA 1I8TA 3EGOA 4P4NA 4OSOA 2EGGA 5DCUA 3TDKA 1EK6A 4I9HA 4Z3DA 3HNPA 1XCBA 3WQRA 4BNIA 3TFQA 3IKTA 2IZ0A 1PJ2A 2RIRA 3SBOA 2RCYA 4H15A 4PLHA 5CPBA 1F8GA 3FRJA 3UW3A 1ONNA 4FFRA 2QRJA 3CINA 3ASVA 4B7XA 1P74A 4CL8A 2OOSA 3UHAA 4WLVA 1K3TA 3V1UA 1O0SA 5EJ2A 2GN4A 3JQAA 4FB5A 1MG0A 2UUPA 3OICA 3WOHA 5MGBA 1MUUA 4MIYA 5DP1A 4FSHA 4J1SA 1M2WA 4TZTA 5JMWA 2JD0A 4GAEA 5A5FA 4EUFA 2X58A 1VPDA 2J5QA 5ADHA 1LBEA 4II2A 3H2ZA 3RUAA 2CDAA 4JROA 1KBZA 4FC7A 1PWZA 4HNHA 1PJ4A 3A4VA 2X0RA 2NUAA 2DFDA 4YTEA 2HRZA 3LZ6A 1O9BA 4HXYA 3DBVO 3PGJA 3V8BA 3OSUA 3DEYX 3PHLA 1GYQA 5L4SA 5C5IA 1JKIA 1ZZEA 3GG9A 2UV8A 4HKTA 3HDHA 4YQZA 4CM8A 2O48X 1E92A 3RC9A 5JNLA 4BGUA 1EQ2A 2I65A 2YW9A 2E82A 2DKNA 4IPTA 5I8ZA 3RBZA 1DC6A 1M6WA 2O3SA 1ISIA 2ILTA 3FNHA 3E82A 1MC5A 4I5EA 4CMEC 1LDGA 2XPCA 1RWBA 1OI7A 2GRAA 1SAYA 5JW6A 4DYVA 4FFPA 2DU8A 3LC7O 3TN7A 4O59O 3ZU4A 2D1YA 3JYOA 1GU7A 3H5NA 2IXBA 4BNLA 3BXXA 3EY4A 4TRMA 1R66A 3K2EA 6LDHA 4FS3A 5TNXA 3NKLA 4Y9DA 2ZTUA 2SCUA 4LVUA 4OHUA 2FRDA 3HADA 5ILGA 1K0UA 5GY7A 1GQ2A 1IY8A 4GVXA 4B7UA 2BF7A 4I08A 5EQDA 1HL3A 4E5KA 4YAIA 1XYGA 1HEUA 3BMOB 2JHGA 4GGPA 2O3JA 1SPXA 3B1FA 2OMEA 5BNTA 1Y8QB 5TT1A 3LDHA 5F1OA 1YBMA 2CMDA 3GDGA 1LSOA 3DTYA 3QP9A 1ZK3A 2WYVA 2VYVA 3V2HA 2QQ5A 1KVSA 4WE3A 1HF3A 5THQA 1R15A 3TSCA 3TWOA 4H16A 1UR5A 3EK2A 1ENPA 2VZ9A 3HSKA 3D4OA 1ENOA 3EZLA 4YDRA 4BKPA 2ZYDA 1DRWA 4ID9A 5TC4A 1XKQA 2AE1A 4G81A 1RM0A 3FNGA 4GVLA 4W9NC 4MVJG 3Q2IA 2CFCA 4Q3AA 1VL8A 3FI9A 1Q0HA 5EPOA 5KVVA 4FN4A 3IIEA 2W90A 4CLOB 3UKOA 3DZFA 2I6TA 1UXKA 3C7DB 1ADGA 1IL0A 1V0JA 2NTNA 3BMNB 4YR9A 3PDUA 3ZWBA 4E5NA 2H63A 2B35A 5A3JA 2A35A 3WMWA 5KWEA 3NV9A 1E3WA 2R00A 3QHAA 2VN8A 3IAHA 3UN1A 4CM7A 2IZZA 1V35A 1MP0A 4PG7A 1KC1A 3AM5A 1IYZA 4GSLA 1BMDA 4RPLA 3FNFA 1UZNA 3AM4A 1P3DA 5L45A 1D3AA 2PV7A 5G0UA 3FR7A 3C24A 4XCVA 4NJMB 1P0CA 4MVJP 4RZHA 1ISGA 2NVBA 5BSFA 3DBHB 1MV8A 3O03A 4C7KA 4XR9A 3Q2KA 1J0XO 1ZMOA 2EHDA 3H6KA 1P9LA 1T25A 3DZJA 3CZRA 5T8KC 2EGHA 1O6ZA 1NYTA 3DC2A 3DO5A 4NFSA 4YAJA 1IE3A 1UP7A 1NAIA 3AUAA 4YAGA 4YPOA 1ZEMA 1BRMA 5DCYA 4BMSA 3CEAA 4D41A 4CODB 1CETA 3X2EA 4P22A 1RYEA 2AQIA 4YCAA 1NQOA 4I9NA 3JSAA 1LA2A 4ZICA 1JAYA 5FYDA 1OOEA 2DT5A 1IB6A 1U4SA 3RIHA 2NVUB 4ONEA 2FOIA 4W7HA 1RM3A 5JO9A 2PWZA 5IDXA 2GERA 2P9EA 3OF2A 4WKGA 3SVTA 4LCJA 4ZN6A 1NVGA 1DIAA 4AL4A 5EESA 3MWEB 1JVSA 1PS9A 4NBWA 5JO0A 5JY6A 1WAMA 1R12A 4H7PA 2UDPA 4E2WA 5C7LO 1ZFNA 3D5TA 2CF6A 4J43A 2Y1DA 2UAGA 1UAYA 1O5IA 3Q0EA 3NUGA 2OUIA 1A9YA 3G49A 2YV1A 4KP7A 1U28A 4NH4A 1PS8A 3E48A 4NK5A 2I99A 3KHUA 3AWDA 4WOKA 5IXSA 1KEUA 2FZWA 3ZW9A 1P77A 4N54A 3CMMA 3KOUA 3ZHYA 1EDOA 3ZWOA 5DNAA 5L4LA 1KEPA 4R1NA 2Y66A 3LT1A 3PIIA 3PJGA 2YHIA 3PQDA 4TQGA 1HYHA 3EVNA 1Z6ZA 4PVCA 3K6JA 1GADO 4JXKA 4DQVA 2QRKA 3F1LA 1LU9A 1EVIA 4Y98A 1UZMA 4L0QA 3CUKA 2WDZA 1ZK2A 5KIAA 1ZCJA 2BRUA 4P4GA 3UF0A 3PPIA 4GL4A 3RUHA 1A7AA 3GNSA 3F1KA 3L4BC 5EMHA 4BO8A 3E9MA 1B3RA 2YV3A 3HB4X 3JQFA 2VHVA 5I9NA 1RPNA 1K2WA 4I1IA 1UDCA 5A9TA 5JC1A 1KEVA 1EUDA 3I23A 4AJEA 3GC6A 1C1DA 3L4SO 5IDYA 4EITA 3S2IA 1DIBA 1Y6JA 3DBRB 2HMUA 3GZ4A 3W6UA 5B4UA 1YRLA 3PQEA 3C8MA 2YY7A 5BNFA 5FWNA 5G0VA 3P2YA 4FJ1A 4CMBA 1BSVA 2NLOA 4K9DA 4YRAA 4UVGA 5IDQA 1E3LA 1NVTA 1BVRA 1Z7BA 2EKLA 4NNJA 2P4HX 2WEKA 5FI3A 3ZH2A 4XGNA 1B8VA 1E7RA 5CDGA 3WDSA 1KYQA 3N74A 1R4MB 4IJWA 5G0TA 4ZRNA 1R37A 3W8EA 5KTKA 2HRBA 3RVDA 4B79A 4J1TA 3MJ4A 4HP8A 3K96A 4CM8B 1SOVA 3AK4A 4GX2A 3PJDA 3ZWMA 4CLRA 4OAQA 3AFNA 2E37A 3GT0A 2PH3A 4HX5A 4MINA 4JIGA 2IRWA 2O4CA 4CR6A 3OP4A 1PJCA 1FMCA 4IINA 5C7IO 1GPJA 4FGSA 5CP8A 3NEPX 2WTBA 4FJ2A 5CEEA 4UVIA 3ZDFA 2HLPA 1TB4A 3D1LA 1AGNA 3VVCA 1R4MA 1VJTA 4LK3A 3BTSA 4OM8A 5FI5A 3IP3A 3TF5A 4AJ4A 4JLWA 3ZWAA 1PGNA 4PRKA 2HAEA 4CM9D 3WICA 3I1JA 3HN2A 4QO7A 3K31A 1DJQA 5AVOA 2CF5A 3K9QO 3S2GA 3ZWPA 3UUWA 4WNCA 5F21A 3RUEA 4RZIA 1CRWG 2AG5A 4TWRA 3ASUA 4BKUA 1OBFO 4ZVVA 5A05A 4CMEA 5JXWA 3FTPA 4KOAA 4WOJA 4IDCA 4K6CA 1K6JA 3SLKA 5KNLA 5JC8A 3JD2A 1NQ5A 3O9ZA 1GAEO 1B8UA 3KYDA 4URFA 1U9JA 4JJFA 1XR3A 2B83A 1T2EA 1FJHA 2ZK7A 3VHRA 1LTHR 1ISFA 5F3RA 3BHJA 3QLJA 1PR9A 3TZQA 2EJVA 5L95A 4LMRA 3AUTA 3GUCA 1P33A 5JDCC 1FDWA 4ZA2A 1S7CA 2WWRA 1ZXLA 4NJMA 2B4QA 4MIEA 1KIFA 3KETA 3DHYA 4J2HA 1Y5RA 3NT4A 2QYTA 1YJQA 3HJAA 2PK3A 3VPSA 4B4UA 1P45A 5KOIA 3VH1A 4R51A 1Y9AA 2HMWA 3EZYA 3GVIA 2B0JA 5LC1A 1HE4A 1GUFA 1Z75A 3OJLA 1YQGA 1H9BA 3WJAA 5JYEA 3U0BA 5BT9A 1FXSA 2C5EA 4MOWA 4JJGA 3I9MA 1GEEA 1JVBA 4QT0A 1E0DA 1DRUA 4W9NA 1EE9A 3JD4A 4OSPA 4Y6SA 4WUVA 4BNZA 4XQEA 4F3YA 1NR7A 2JL1A 3VH2A 1LX6A 3GEMA 1WVGA 3RKUA 5KCZA 1EMDA 1RM4A 1LLUA 2PA3A 2DUWA 3JQ7B 1AHIA
chains in the Genus database with same CATH superfamily
4QNNA 1MVLA 3HXPA 4ITUA 3OPYB 1BFDA 2FUKA 4N39A 1I7SB 1Y9JA 1L4HA 3FMGA 1Z7EA 1U11A 1X1TA 2WC1A 2WKQA 2O8BB 1A76A 4HK4A 1EUCA 1GU0A 2HHHB 1W47A 1X1EA 3X1MA 1EIWA 3P32A 4TMXA 4M87A 5BXQC 1R5BA 2O3QA 3I5YA 2YC2C 4R1OA 4UVEA 1GARA 1DQSA 3ORQA 1WF3A 2HU8A 4KO2S 5KNDH 3F8WA 4ZVOA 3U39A 4LDRA 2MTBA 4BMNA 2W42A 4DV6B 1NMYA 3EUWA 2GZAA 3VO8A 4ZI2A 2NZVG 2P5YA 2AF3C 3T5DA 2PGNA 4INOA 1E1QA 4BFZA 2IS2A 1W4AA 5L3ZA 2C3UA 4K3UA 3QHQA 3R6TA 3DO8A 3WB1A 5F9FA 4LXYA 3A1SA 3ET5A 3K0AB 1KE1A 4M9SA 4R1UA 5IKXA 2XQJA 5BPFA 1G9XA 4RQUA 1ZC4A 4F9FA 4LGVA 1M8JA 2FHSA 3D4PA 4QDJA 3SX0A 1ECBA 2JVJA 3K8QA 4PU0A 3Q1LA 1HOTA 3L05A 1TIPA 3L49A 4GPEA 4FGKA 4Z0TA 4YDSA 2P75A 2YRFA 3L07A 1YQUA 1FDTA 1T9GR 4QUKA 3KWMA 2PMDA 1KU0A 3LYLA 2PR2A 3MJSA 3RSZA 2GHRA 2QRLA 3KQYA 4ZJUA 2QTZA 2QF7A 4JOBA 3MJEA 5TGDA 3OUTA 4FEEA 2VHJA 4DHWA 4NL4H 1I3NA 4IIXA 1UXHA 2Q4BA 1E9CA 3GVCA 3PXDA 4OHMA 2XJ4A 5JSKA 3LTEA 3DAYA 4IQ0A 4KNWA 1KEZA 2LGJA 2WV7A 3PD7A 4QXPA 4B2LA 4XVCA 4CKCB 2I6UA 2C31A 2PSHA 4QAQA 3VU9A 4IF4A 4MUIA 1V5IA 3FJ1A 2XXAB 4NSNA 1C9NA 5BYAA 3DBLA 5EWLA 3IPCA 3OLCX 4RNDB 1YUBA 3ETJA 4WMLA 2VJQA 2FN9A 2JIMA 1JR3E 4KEAA 5EP3A 3TW8A 3VZBA 1SQ0A 3HCDA 4JP2A 4AURA 3AUSA 5I7RA 1L7RA 3GFGA 2UVQA 3CM0A 3N6XA 4MUXA 3G5TA 4D82A 4KQKA 3GX1A 1IXYA 5C1BA 2IF0A 1FMJA 2R6AA 2J6HA 4XYLA 3CE6A 2RFLA 2VHYA 3GLSA 3TB6A 2Y92A 4O3MA 3WHPA 1X80A 2J0UA 2ZB2A 4BNDB 4EY5A 3EXAA 5JJCA 3ON5A 3AU8A 3I3OA 2ACEA 1C9JA 1SVSA 2BWJA 3EFHA 3T7AA 5I51A 1KOJA 2P6UA 4O4JF 3UAZA 3QEAZ 1RRFA 4UDNA 4JYPA 1YV9A 3UJDA 1TLTA 3DMNA 3OFKA 1Y34E 1QS0A 3R8CA 2FMKA 3WLMA 4ES6A 1GCUA 1NR5A 2Q9BA 5H16A 3LIIA 3VU8A 3QBDA 3JQAB 2O19A 2QTNA 4FNOA 1A9ZA 3ND8A 2FUG6 1WHTA 3VUEA 3PKIA 2OCBA 1LY1A 2G6TA 4YAFA 2WSSD 4BO4A 4CIAA 2Y8EA 1VPLA 2VSOA 3GJ6A 3UJNA 3UJAA 3RUIA 3M2PA 3CJRA 3PF9A 4WRRA 5FKJA 4GF5A 3L06A 1G98A 1EVYA 2DE0X 3R9XA 1V9LA 7AT1A 1E5XA 3A9TA 3W5JA 3SQDA 5DULA 3L6BA 4PHHA 2EX4A 3O9VA 2DTDA 5BSTA 5P8WA 4EG3A 1H2HA 3R24A 2HYIC 1IY9A 1KFCB 1ZQ9A 3OA2A 1Q20A 2VDUE 1LD3A 1DAIA 1REQB 1E3SA 3TLCA 2V6MA 5I4CA 4ZJPA 5EC8A 2VF8A 4UARA 4B46A 2XB9A 1T5TA 1JR3A 1DJNA 1E32A 3GOQA 4ZIRA 3TFWA 1N2JA 2CXHA 2QVLA 5KEIA 4IJQA 4JD5A 2DHEA 5ELMA 1ADCA 3LUKA 2J3HA 5LDDC 1XTUA 3M4XA 3EGDB 4D9IA 1SHJA 1EJ6A 3DAHA 1AX9A 1ZUNB 2W2PA 1SZPA 1P9RA 2R96A 3WL7A 1ZKDA 1QLJA 2MINB 2CNBA 2ZAIA 3V7NA 5CFQA 3F9CA 3GW8A 2OVBA 2FSVC 4TV8F 4FKBA 1IUPA 1R88A 3E23A 4OMFG 4P33A 3OO0A 4UPDA 4F8JA 2ZSAA 3I04A 3MTEA 3WNQA 1R0RE 3GZNA 5HCUA 2GXQA 4IIGA 3Q7TA 3QMMA 3TOXA 3ICEA 2MSNA 3L8CA 3G8AA 4RIGA 2WTNA 5ITZB 3NHFA 1JDUA 2P1RA 2QUKA 3KV3O 1AK2A 4EGJA 4EPRA 4QHYA 4DT1A 1CRPA 5DX0A 3CS3A 1YZNA 2QRHA 1JA1A 3RSOA 3WA6A 4K6OA 4NCXA 1HT3A 3H7AA 1X13A 4OK6A 3A0UA 3MZ0A 4FS8A 4JI6B 1Q22A 2WHYA 2GHQA 1I5EA 1L4EA 1WKBA 3C5WP 3OWHA 4JBXA 2QX8A 3ZCPA 3LHDA 2RBEA 4R8KA 4B8YA 4KXXA 2Q1SA 3C14C 1AK9A 5CCXA 4BO5A 1U1GA 1LC3A 2R60A 3R1IA 4ID3A 4Z53A 4L4RA 5HBGA 3K2IA 3N59A 4FC6A 4X65B 2ZM5A 2ATEA 3PCTA 3ITNA 3FCYA 4MWEA 4UXIA 4ZU1X 5JS7A 4DG9A 2NT3A 2C8VA 2DKFA 1JKJA 4FIDA 4IVNA 2AJBA 4A73A 3T5AA 3EZGA 5WRFA 1YTLA 1CQJA 5G40A 4YREA 4DFDA 1D09A 3GFTA 3UHFA 1RWNA 3UFXA 3E3AA 1FRVA 5EUBA 4AAYA 3QA9A 1SBQA 4RPCA 2DUJA 4B3JA 4CM4B 4HQRA 2V5VA 1IN6A 5CB6A 3Q12A 2GAFA 2B5WA 3GLVA 1NRWA 3DOJA 2V7UA 4URUR 5C31A 2OBFA 3PFNA 4Y18A 5IU6A 5LMUB 1D9XA 5ICMA 1U28C 4CR7A 2QE7A 4GPTA 1OH7A 3ZDAA 4FK8A 4UTNA 1SFRA 1DTSA 4HLDA 4PHTA 3G5MA 4UHCA 1ZI6A 1ID1A 1U4NA 2NTJA 3RTCA 4B79A 1CUVA 3PVZA 4DWVA 5I7EA 3C3MA 2I03A 4GWKA 1WJGA 1NVFA 3V97A 3T4XA 3W5SA 1JH9A 1KZ9A 4N41A 3DTVD 4LTNA 1B26A 4NE2A 2BEVA 4ZOQI 3EFEA 1DRVA 4J7UA 1AO3A 3UB3A 1AMUA 5KNCA 1T8UA 1YE5A 4AO6A 1BDJA 3FFWA 1FE8A 4KMRA 4Q3KA 4XW2A 2O8EA 4HVAA 5FPHA 1WSDA 4BB5A 3QU2A 4HXGA 2AUTA 3K3PA 1DHTA 2WJVA 3A1FA 3BM5A 3F5QA 1W19A 4RJLA 2JBAB 5JNSA 4DTCA 3JCZA 1VB3A 4RL6A 1JYSA 2ZE6A 5B3LA 1SBHA 5FHRA 5KSPA 3TLEA 5FIUA 4ENQA 5SY9A 3UMCA 4EJSA 3IUNA 1E6UA 2QOEA 3PBKA 4GIBA 4QHSA 5TS2A 1V8FA 2ZYVX 1T0PA 3QXHA 1QPGA 3NM4A 1DXYA 5T64A 1HE2A 1N57A 2J5RA 3OX4A 5L4NA 3O83A 2OPBA 2ZTMA 5DI3A 1Y81A 1K86A 1XRPA 3GCDA 1I7LA 2DWOA 2W9XA 1CUBA 3KKLA 4IJMA 4FDVA 3UJBA 1LCIA 2AFVA 3JQ7A 1ONSA 1P1RA 3BK1A 4FMPA 3HN7A 4N5LA 5FTMA 4N7RA 5CXUA 1R3DA 4Q18A 5DGDA 5ERYA 3AVVA 3WGHA 1PFWA 1GGJA 4PHFA 5KYYA 1VLLA 5IEBA 1GZ4A 2ZSFA 2NP7A 1I3KA 2FRVA 3D2AA 1S2GA 2X9NA 1QHGA 1YZKA 2QGZA 2ZIFA 1ML4A 3NT2A 2ZI6A 4Z9YA 3PHCA 1T1IA 1JG4A 2RI0A 3MM4A 3ETGA 2V0CA 1U8FO 4M1WA 2ESRA 1XEFA 5T4BA 3U48A 4PLTA 3KOZA 3QELA 4F93B 4WGGA 2EW1A 3C3AA 2BW0A 4X8OA 4HDRA 4URYR 2FEAA 5B3KA 1WSBA 3TRDA 1T0BA 1O6BA 3E84A 3Q7IA 4WD3A 4BE7B 1RPZA 3DVLA 5ALNA 3UGQA 1KAEA 2ZTSA 4Y6SA 1EEHA 2C2OA 4P53A 4TGLA 4I14A 2VNKA 1SWWA 4XJTA 4MP8A 5F2NA 4KQ2A 3C48A 4PNHA 3K0SA 2MSCB 4W1PA 2RC6A 4IIJF 3CCCA 3ZWVA 4UEOA 4LRSB 4NPAA 2BTQB 1O8CA 4TVBA 1AKQA 2ERXA 1LEHA 1ZOIA 1T9KA 3BORA 4R3UC 4ALIA 5C2JB 5IUNC 2R0QC 4TYWA 3GUYA 3KV1A 3LPNA 1DXHA 5D2CA 3ZCRA 2JZOA 4D5EA 5BXYA 4YO8A 3ERCA 5KWVA 2C29D 2CV0A 2IY9A 2OM2A 4Z2AA 4IICA 1R6DA 5BP7A 3BPSA 4D3YA 3LOUA 1CP2A 3B51X 1XJCA 1WLYA 2LDXA 1OFIA 2IP1A 2RGDA 3CIFA 4GZLA 1QE0A 2BFAA 5AJUA 2JLYA 1Y8RB 3TSAA 1XSEA 3T1TA 3F78A 4YIKA 4CM4A 4LUCA 1CUDA 1SCIA 3T3PB 7GPBA 4ZAXA 2GZDA 16PKA 2CXUA 4LXHA 3CLHA 4JL5A 5TT0A 3PC8C 3H75A 2OP0A 3GNQA 2QQFA 3HLKA 3W90A 3DB2A 1RU3A 3H5RA 2JGKA 2PRKA 2YW2A 3IMCA 1KO5A 3VOSA 2C61A 2H1HA 2ODTX 1TD1A 1U7UA 2H0QA 3PDIB 4FMDB 2I62A 4KWTA 1XTTA 4KIWA 5LQDA 1SU4A 3AR3A 3ZE8A 4RXUA 1UWVA 4GRDA 2F8LA 5JSYA 5K0EA 4MJ7A 4RS4A 2BZGA 3ND9A 3MRTA 3VUFA 1U5BA 4Q48A 2FG5A 3T3HA 1WPQA 2GO7A 4D8VA 1E61A 4P31A 3SJAA 1D6JA 1QF6A 4ZHQA 2ID4A 2XGMA 3P9IA 4LF5B 2R1TB 4IJ5A 1E69A 1B23P 2EJCA 4R68A 1MZVA 4WK6A 4JI3B 4BFSA 4EM6A 1MAHA 4ETWA 3LG2A 4P9NA 3U56A 2PMBA 1HDIA 4DCPA 2G5CA 3ZHTA 3OECA 4JL8A 4EZIA 1Y9EA 3GJXC 4G86A 5KYVA 4MO2A 1LPPA 4RVHA 5T4EA 1M34A 2Z2IA 3UO8B 3K0EA 1Y37A 3F5DA 2A7QA 1K7CA 3G88A 4BVBA 1WBJB 1PZHA 2AN1A 2D4AA 2JW5A 1T5DX 3NV7A 3QSYA 1Q0SA 3R3SA 5AO9A 5EQJB 2QT0A 3GIDA 4TYMA 1T4CB 4D92A 2RARA 4G25A 4XX0A 4R41A 5KYGA 1NVDA 1YL7A 3PI7A 1S2DA 4A1FA 1ULTA 3IVMA 1OIVA 3KLNA 3V3TA 4D26A 3WYEA 3V2GA 3JPWA 3E58A 1UBJS 2BI4A 2FB9A 1BXZA 3FGPA 1PG0A 2OHFA 3BGSA 3H2GA 1UWKA 2GM5A 3OIGA 4G8JA 4RF2A 4XPZA 1QVWA 2P2GA 1VCNA 1KPHA 5EZYB 4LNUB 1U94A 2WHXA 3DAOA 4OKIA 4OJMX 3WGOA 1C4KA 2GNPA 2XMCA 3PXEA 4H31A 3KTOA 2XQIA 4JVLA 1QUFA 1ZUHA 2VDRB 4I81A 4G9BA 5AI8A 4BVJA 3CNBA 4ZC8A 1ESNA 3ONWA 1FDUA 2ACWA 3FMOB 3Q7EA 4ZOAA 2X5KO 3HBJA 2CFRA 5FTKA 2POQX 4EA6A 4X6LA 4J9VA 3OTWA 4WDQA 2F43A 4NZPA 4QQKA 3L6DA 1UMBA 4OXRA 2V6GA 1TM4E 4EJ6A 1DIGA 5LQRA 1F1JA 3K92A 1QGYA 4OBXA 5E7IA 1XHEA 1C7ZA 1JFVA 3D8NA 3G0BA 1PJ8A 2J09A 2AOXA 2J3EA 4LPKA 1AV7A 1A77A 1RYFA 2QNIA 3QBEA 3WQHA 4MVJF 4AJLA 2H57A 3LT2A 1WU8A 2QRZA 3BSWA 2HA7A 5E1OA 3SKXA 2C3PA 3AEZA 3IQGX 1ZHOA 4PZAA 3I1FA 1PKXA 3LQQA 2D3WA 4XIGS 5HQ3A 5J40A 1E9AA 1ZMXA 4MS1A 3VR5H 4LYDA 2HPHA 1DTWB 4I4NA 1O8BA 1PFQA 2OXIA 4BTVA 3PYLA 4IW3B 4YV0A 3GLFE 5IVKA 3T7DA 1U0JA 1FUEA 3C4JA 4EB0A 3WLEA 4IGKA 4Z51A 1INLA 5ABPA 1YC2A 1OR8A 1NBOA 3BXOA 3QG1A 2P4UA 3WQQA 5DRYA 5EMJA 2YDXA 3SLRA 3QOFA 1HT1E 3PNKA 2H2HA 4DWWA 3DOCA 2J9ZB 3NKFA 4TV9B 4CL2A 1M2EA 1NP3A 3GUHA 4OOEA 3UK1A 2JAHA 1N78A 1H9AA 5BWMA 5AJTA 4G67A 1VFNA 3TIXB 3HO1A 4IGAA 3GZTB 1B6GA 1Q14A 4EARA 4OQQA 3AVWA 2OSBA 1NMEA 2PYIA 5E4JA 1GTVA 3M6AA 3WISA 4QXMA 821PA 1EK5A 1FP7A 2OGWA 3H5WA 1W0CA 4K2AA 1GQYA 4Q4LA 2WJ4A 3A9WA 4A7PA 4HEQA 2FZKA 4KXVA 2Y0PA 4G4JA 3BCUA 4NNOA 2XVYA 4E33A 2QD4A 3DCJA 1L5OA 1QTIA 1M1YA 2JFHA 3RC2A 1I5OA 1KC3A 4KGDA 3EZ9A 3K71B 2QE7D 1XTKA 3NC1C 2NZYA 4RE5A 1SXQA 4IIHA 4QU9A 5C35A 1BXGB 4KXWA 4N5DA 4Y2JA 4N47A 1QVRA 3A9CA 2CFOA 2GHTA 2GTPA 2R7LA 3MVEA 2NSLA 1RYYA 3ISJA 4IJUA 4PLWA 5TY0A 4E09A 1ES9A 3GPBA 1KDYA 1FIUA 5FBZA 5KUTA 4IDBA 4S05A 4KZPA 4JVOA 5B6PA 2CDBA 3M34A 2QUBA 3MN1A 4M8LA 1ODIA 4TS9A 3GN1A 3VPBA 1YXMA 5DIZA 1T3ZA 5B4TA 5LNK6 3WG9A 2BGTA 1SK8A 3MOIA 3OEWA 3PQ5A 4FXOA 2IE0A 1M6NA 2BFDB 3DJFA 1TTHA 1DCMA 2LBPA 2FPPB 1R6VA 3B6MA 3K16A 4L16A 5BR8B 1P44A 2NX2A 5DF1A 3UMVA 3FLEA 3K2QA 1NVEA 3OPYA 4JFRA 4R2MA 1E1KA 3RAGA 4ZYXA 2J5BA 5I9SA 4BUCA 1JEQA 1PD0A 3ER9A 4ASUA 1DO2A 4L6CA 3GMIA 1AKRA 1G2PA 3BVPA 2O50A 1B15A 5EKXA 2IUUA 3WWDA 1Y4ZA 1QCDA 5HG0A 1OKKA 1GAJA 3JW8A 2VDWB 1I0IA 2AKYA 1PWEA 2Z1NA 1LJLA 1KAOA 1ZD4A 2P6MA 3KQOA 4ZVTA 1C3LA 4YMLA 4V0KA 1KOLA 3UMBA 2VUIB 2YVKA 4WK4B 1L8AA 1T2AA 3MG9A 1RYMA 1Q7CA 1RXWA 5I8WA 1YFKA 6AT1A 3N05A 4LFAB 5A62A 2I8AA 1X9IA 2FEOA 1ZMTA 3W6OA 4ZAGA 4I4IA 3OCJA 1MX3A 2OD2A 2IH5A 4DM4A 4H0CA 1O94A 3I83A 1ZD3A 4EF5A 4DLRA 1J42A 4LJ8A 1GYRA 3E03A 1GGVA 4UHDA 3OCXA 5HFAA 1ZJJA 1LDBA 5A1JA 1AQYA 2WYWA 2JGNA 4C88A 1W4ZA 2ZB8A 2C00A 2FETA 1UK6A 2OCKA 3HHEA 2WU3A 3T9EA 4FWTA 2I55A 4B6SA 1ZVQA 2J8ZA 2NZ8A 3R3HA 4N82A 1ZRNA 1ZJYA 4G5HA 1UDRA 1J2UA 2WM3A 4P4LA 3RYFA 5IZCC 4QGBA 1QR6A 3RK1A 3CVXA 3GMSA 4LY6A 4PPGA 4A2PA 2XLCA 4MQEA 2HJ9A 5B3AA 1Y5NA 3RQIA 4AJPA 2ZT8A 3SC6A 1PNTA 5FORA 1OROA 2JJMA 3TZHA 5H4GA 3FHCB 4PG5A 1YL6A 3AX6A 4IV5A 1NQWA 2H4JA 3O3OB 3TJMA 3VR6H 1PG2A 3HY3A 3ESDA 3TX2A 1PJSA 1L3BA 1ZGBA 2R00C 4JNCA 5AKKA 3ZWCA 4YJKA 3STYA 4PTYA 3RHZA 2HT1A 1DC5A 2PAAA 1SVOA 1E9RA 3P9SA 3CFYA 3VZPA 1AXEA 1W2GA 5KJ1A 1DC3A 3HYRA 4BLUA 1R6XA 3HS3A 4E2YA 3LUCA 2VQEB 4H6PA 1AN0A 1OZAA 4NMWA 3WQSB 1WR8A 2C95A 1PT9A 3H19A 1TF7A 4P3KA 4YUWA 2NP6A 2MSEB 1KXJA 1RHMA 3G9QA 3KZVA 2HHAA 5HR5A 1JDZA 4TS1A 4C0XA 2DECA 4RMJA 3S1LA 3NALA 1MHTA 4X84A 5EHNA 5GPBA 3WRXA 1WUKS 3RTBA 1U2ZA 4DZZA 5I6DA 2Q3MA 2VP5A 3L8YA 3NS7A 3T5MA 2Q29A 1K8QA 1QQ7A 2JLRA 2PSJA 3QU7A 2QTWB 1R18A 3NAGA 4CG1A 2YZNA 1AC5A 3H65A 4GSYA 2BM1A 4I9GA 4NECA 1VJ0A 5A03A 4LF9B 3BQNB 5F64A 2YFYA 5IJZA 3IELA 1MB2A 2K4MA 3LKZA 3T5CA 5D8DA 1Z62A 3HE3A 1PR1A 3I0ZA 4MKRA 5KYYB 5CNKA 2HL6A 1GZVA 3GFQA 1XQWA 3HB7A 3RB8A 1E7YA 2D2EA 1HG1A 4ZRMA 4F2PA 1I33A 1N25A 3PQCA 1AN9A 1RQ7A 1E2LA 4AG5A 3AHJA 2BMJA 2HLNA 2JASA 3W9BA 3HCRA 5BSRA 1XLVA 1Q17A 3LC2O 4BBJA 3S2ZA 1C0PA 1IAQA 3EZ2A 4UTRA 3ST7A 4DJJA 4QVIA 3M6IA 2HO4A 3UUEA 3H1FA 3PNBA 2XNHA 4BX2A 1D8AA 2IZOA 4CF6A 4D96A 2AUMA 1E94E 3WV5A 3ANNA 1D07A 1P3JA 4IVQA 3T0FA 2D5BA 2IKQA 4XUDA 5PGMA 3TMKA 1ZA1A 3KYCB 4UULA 1JQEA 5DBGA 4PWZA 2JFWA 5GADl 4EZEA 5FRDA 1AF4A 4LDZA 2IHKA 2DQYA 3W5HA 4C2TA 3CH4B 4UNSA 1X7XA 1B6RA 3F96A 4W4TA 2JBAA 3T0IA 1YS7A 5H4HA 3VO9A 1HUQA 4G01B 3TUZC 2EQAA 2H7YA 1ENZA 5DKFA 4ZO7A 2F3QA 5IP5A 1F2VA 2V58A 3H2HA 3M1AA 1NF8A 4JDUA 4ZQEA 1IOVA 1SUWA 3PFFA 3SR3A 3M33A 4N3AA 2HK7A 1AUPA 2ZZKA 3LLSA 3R7FA 4YR7A 3FFXA 1G3RA 2JAPA 4UBIA 1E8DA 1XTBA 3HCPA 5L6LB 1RI2A 3KT6A 1YB5A 1WSWA 2CJWB 3HY4A 4B87A 1NRIA 4RV9A 1QDLB 3ONEA 2EJBA 2XZPA 2OVFA 2E4ZA 4HQNA 1E6KA 1JLLA 1T9CA 3T7CA 1KKUA 4MR8A 2HA4A 2PYZA 2V98A 1JNYA 4LBZA 3TW0A 3CG0A 2ECPA 1BG6A 1LTQA 1RVV1 1OB2A 5DB4A 1B73A 2J3JA 4L8WB 3COVA 5A04A 5HM8A 4RY9A 2O2IA 2Y0BA 1F8FA 2P9GA 1N0IA 5CJ2A 3V4OA 1I7DA 4GKAA 4EYGA 4NEGA 3OPNA 1Z5ZA 4FCTA 3QE9Y 3WLNA 3RGWS 5KTPA 3GU3A 1A82A 2UXDB 3L7KA 2PUCA 1NPDA 3JALB 2CNKA 5E6RB 1DUVG 1EP9A 3CZPA 4FNGA 1ST3A 5U9CA 4YHBA 3NEAA 4MROA 2QUJA 1IY1A 1TJPB 3SC3A 4U4AA 2YWBA 1J07A 1RLMA 1XZHA 4AMVA 3PZBA 4BFTA 2R85A 3K1TA 1HKUA 3NONA 4YQEA 4AMGA 3UOWA 4I2NA 4TSFA 1E1RD 1NBEA 2QLFA 2XUDA 2VSXA 4Y3UA 2Q50A 1H3FA 2KPOA 1PDVA 3FWZA 3TTTA 4ZOLB 3H1BA 2XOXA 4MQFB 1AY0A 1ZNWA 5DXFA 1NVVQ 2H2GA 4MQFA 3TEMA 3W2IA 4E1AA 2NGRA 3Q5EA 3T06B 3U3DA 3FOCA 4M0UA 2V55B 2YWGA 1WE2A 3DOHA 4AN0A 4B4OA 4CQJA 1RAEA 3BF8A 4O2AA 2UKDA 3KPJA 1MVOA 3KLBA 3ROMA 4UD2A 3S6JA 4A91A 1VJGA 5HZHA 4G5GA 1ZL2A 2QENA 4L57A 2EKDA 2A4MA 4GSKA 4IWXA 2ZRGA 2HUPA 2LP4Y 5FJIA 3AP1A 1E2DA 2XGOA 1KBOA 1A7KA 4QYWA 1Q0LA 4RK0A 1HT2E 4HWOA 2BBOA 2AW3A 3OIFA 5GZ1A 2HJWA 4QYTA 4QECA 3W9YA 3BWVA 4AKHA 5FI0B 3GLGB 2VJAA 4QFCA 5ICEA 3C2QA 2IV2X 5HKAA 4OL9A 3UTDA 5HM6A 4IJ6A 5EZYA 4BKQA 1ZIXA 4ZQCB 1K66A 3O8NA 1FTGA 1OXTA 1YDWA 3ENNA 5IVPA 4NAUA 1BOFA 4GLLA 4UZEA 3VDMA 2ISSD 1RC1A 4ND1A 1RBZA 1VA4A 2J0EA 2RKWA 3TOZA 3IA2A 5EJMA 1NQUA 2V7PA 3ZDQA 4ZCPA 3U7EB 1AH2A 1E9VA 2OGSA 3QXJA 2ICAA 2A86A 1KU6A 2DZDA 4J6EA 1CCWA 5E2BA 5FR2A 3RIGA 1C4WA 1I2ZA 1WY7A 1G3QA 4CQMA 5INTA 1FYEA 4P35A 1Z4KA 3VR4A 1R7RA 2FSIA 2Z9CA 1WHTB 4ISBA 4P3YA 3P0HA 3L2OB 3H87A 3TCKA 4FNMA 4LWPA 4IIFA 3RWOA 2IGBA 5C9ZA 1M10A 3SYNA 2VP6A 2DWCA 3K6SB 4IRXA 3M6FA 5CXXA 5LBUA 2ZIGA 5HF9A 2Q6TA 3L5KA 3RS2A 2P0AA 3HJUA 3LRXA 4TVOA 1TK9A 3JTMA 3PK0A 5J58A 2QXTA 4F1KA 2AEFA 1T0HB 2WPDD 4UBJA 4EHBA 4PO3X 2I1VB 2PY6A 1Q3KA 3DAFA 4O08A 2REOA 2Q3LA 1YJXA 2O2ZA 2A88A 4RKWA 1FS5A 1DSSG 1YBHA 2W2OA 5A4DA 1YBFA 3RYCA 3CMCO 1OKKD 1PLKA 2GN6A 1IPFA 3ZGLA 4DREA 1EFRA 2C9MA 3NNSA 3TSWA 3TCXB 2NNLD 4GP7A 4Z3OA 1N2HA 4PTLA 3TNDA 1U0RA 3SQOA 1NIJA 5L7YA 3I5MA 4UBKA 4EQ6A 2Q2OA 1ODLA 4PS1A 1JEDA 4W6QA 2DYKA 4XX1A 5IARA 4E03A 4PSCA 4HEJA 3U9LA 2GTIA 2HZBA 2WIDA 5CA0B 1X87A 2J7PD 2K2WA 4HFMA 1NXOA 2FN7A 4NOJA 1FFHA 2GBCA 3Q6MA 4KE9A 2IHUA 1YRAA 2M98A 1ZWLA 1G2OA 3T99A 4WXYB 3WOVA 5LZ4A 4A5SA 3I28A 4JVSB 3VH3A 3COJA 2ON6A 2CMGA 2NYAA 1H8EA 2JH3A 4B4VA 3DNFA 3HPQA 2G9QA 4TLMB 3SKYA 4BQPA 1TUGA 3GA0A 1MB4A 2H06A 1CUGA 3GLRA 1P1KA 4WGFA 4FZVA 4JLNA 1L5VA 1T2VA 1UJBA 2H31A 4DSOA 4EUEA 2BTQA 1C8BA 2VZLA 3GEIA 4KKVA 1SQ6A 3PUWA 5ALRA 1I1HA 4QJBA 5CB4B 5DNEA 2ZREA 3P52A 1WUJS 2Y93A 3PQ8A 5ERXA 4R9NA 3WR5A 1Z17A 2P2ZA 3CR8A 1ZZGA 3BMCB 4AKEA 1YFJA 1YUNA 5C53B 2IXGA 1KRHA 2X8JA 3CYFA 1MOSA 2OGZA 1ECFA 2BGMA 2I7CA 2VYFA 2BFCA 1EKXA 1GQQA 2GN1A 4J75A 4HDRB 1AS0A 5F4ZA 4IO0A 5K3OA 4P82A 3DSRA 4LFBB 1W4BA 1WG8A 4H1WA 1AUXA 3ICWA 2PIAA 3JQ6A 4YDHB 5FUXA 4CMKA 3HJRA 4RD1A 1CUIA 3KHTA 3K6KA 4RLFA 1E6MA 2OSVA 3FVRA 4UDYX 5JDCA 3S2EA 2KJQA 5IAOA 2PKQO 1AKWA 2AQ8A 5DOZA 4J49A 4K9KA 5TVKA 1P1JA 4H6WA 4CIDA 5AXAA 1J97A 1EUZA 2W2LD 3JX9A 4YK7A 2P5UA 1ZAYA 2B2XA 3NKVA 5ECYA 2JLSA 2JI9A 1Z6GA 2JEOA 3OZIA 4DOMA 4F97A 1FFBA 3IHTA 3RODA 4Q16A 2I2DA 1L7NA 4U0JA 3TJZA 2DQ4A 2XB4A 4OH7A 3E8SA 4J9UE 1T1EA 4IDHA 3S8EA 2YNMD 5EP2A 4ZQGA 4RMHA 4CN9A 2J9XB 3P27A 5L8VA 4Q1DA 4ZV4A 3H5IA 2I7VA 3LE8A 3F49S 3SJUA 4YAEA 3UBTA 2B0CA 5EAIA 4LRQA 1L7BA 3MYRA 1O97D 2P35A 2IT1A 3QWIA 3H4TA 2QXYA 3LHKA 1IFXA 3WGMA 4TSRA 4QDKA 1JE1A 4RVCA 2WPNA 1KQPA 2C4NA 4CE6A 2WIGA 3S0JA 3DD1A 5ALGA 3TUIC 5H7XA 4YRGA 8LDHA 3ETEA 1H5QA 3MT7A 5TMDA 1MC1A 5E6UB 1GKKA 4W5QA 1A7UA 5FD8A 2NIPA 1XD8A 4KQHA 4IJVA 1HK7A 1X7GA 1G8PA 4IWNA 1V45E 3OBBA 4EAAA 3N75A 1F60A 1TE2A 3FFTA 1A71A 3IAM6 1GZUA 2YMQA 1VGQA 3F5MA 2OO5A 2HFKA 1QG0A 1FX0A 4HZIA 3WLJA 2WAAA 2FPXA 3N2IA 2R4TA 3JQPA 4B6PA 2ODBA 4OQDA 3WMFA 2X15A 2H1LA 2CUNA 2Z9DA 3MPOA 3PYMA 1DKLA 1CJVC 1SUEA 2PPLA 4RY0A 1K88A 4RJKA 1W73A 2VDNB 2FSVA 2A1TR 3QMVA 4JLDA 4YCDA 5K8UA 1DWQA 2Z3WA 3LXRA 3IGFA 1JKMA 3ESBA 3SEAA 3HBAA 2XNCA 3HU5A 4M36A 1U8XX 4WINA 4JYCA 4Q7MB 4FYIA 4QRDA 3BEDA 1RSZA 4RW0A 4EFDA 2HJVA 5LDHA 5JCJD 4EBBA 4BKOA 3BAFA 4U2BA 2H9AA 3AB3A 4TTPA 1N34B 1NI3A 1VLJA 2IF2A 2ZTHA 2N1MA 1GCGA 3PDWA 3C3XA 1NBAA 3MWLA 1U7DA 1THTA 3PEUA 3GRPA 2HDOA 1AG9A 3D54D 3ZLVA 1EEXB 5T5QA 1OX4B 4B6OA 2COUA 4X97A 2FX2A 3GMDA 3TLZA 3IQDB 1M67A 1JQJC 4UUNA 3AZOA 5BSGA 4FDMA 3S4YA 5C7YA 5ULLA 1NSFA 2KWIA 2Q46A 1I2CA 3LA6A 1I4OA 2I7XA 4B71A 1YS6A 4JC8A 3IUYA 2IUSA 1U9ZA 3OT4A 5ER6A 2PH1A 2ZIAA 3OZSA 3FPHA 3CX4A 4RQBA 3GGOA 5TX7A 2FSSA 5GGXA 4XIJA 1N0WA 1PT7A 3SMVA 3G6KA 4FDUA 4GKBA 3LWNA 3ASZA 4PCVA 5ER9A 3A6JA 1TUEA 4NYIQ 1KIMA 2ZPUA 4HN9A 4FFMA 1V8PA 2RH4A 4Q4AA 5DBOA 4CF5A 4EX6A 1Y6GA 3KRTA 3MYYA 3K0KA 3OZUA 5CLJA 1KYWA 2QROA 2BMVA 2OBYA 3EC7A 3UJ7A 7REQA 3H0CA 3K0FB 2QUZA 3WY9A 3RC8A 2AN5A 1N32B 4HADA 3DZIA 5F5LA 3RYHA 1EVKA 1J0EA 4J16C 2COKA 4JJEA 1ZK1A 4HQ0A 1FLVA 4M3NA 4WY2A 4MV5A 2ZQZA 2WVJA 3IB6A 3OPQA 5CK4A 3T38A 5JLJA 1I36A 1G2QA 2LPMA 5F2OA 2YVUA 4CTOA 4EY8A 3WNBA 3T1HB 5K3DA 1ZDMA 2XBUA 2CFIA 4HR7A 4ZGWA 3HXTA 5MN6A 1K8YB 4F8EA 2Q0XA 1V43A 2XNDA 3DCYA 3KQMA 1I3LA 1BX3A 5CH8A 5AKHA 2Z1DA 1P8AA 4Z1OA 1OV6A 1E2PA 3DP9A 1F8XA 3EXEB 4NHEA 4U2GA 5JUWA 2X4GA 1V11A 2SCUB 4MYDA 5K51A 3A6ZA 3ZKAA 4BO9A 2GQ0A 4JYBA 3UZUA 3VKVA 1V25A 1LQTA 2O2HA 4FLMA 1WP4A 5J4HA 1QBKC 1JN0A 5JIBA 4U5XA 4GOOD 4YP5A 3W8DA 2NAPA 2AFHE 1PJZA 2BM9A 1QBGA 1NYLA 2R84A 1EG7A 1QHSA 4HOYA 4I5DA 4W9RA 4J6FA 5DHSA 4Z9BA 4YDQA 1QORA 3GPDG 3P4UA 7ABPA 3NHAA 3ROFA 4UMDA 1T2NA 1U8CB 1DDIA 2F8MA 2IHBA 4GP6A 3DWFA 4JJ4A 4Q34A 4V3BA 1AQUA 2C9ZA 2A94A 2XYHA 4HZUA 2PUHA 3E81A 4FI3C 1CFZA 1YI1A 3GGGA 1K3FA 2D7DA 1H6CA 1US8A 5HRAA 1Y1RA 3TEJA 1TIKA 1YJCA 1Q7BA 1T13A 2X4LA 4MGYR 4DIFA 1E1MA 3FJOA 4BNKA 3UC9A 1X8KA 1JYFA 2PL1A 1E3IA 1HQKA 2ZWOA 2PX2A 3F7NA 1X1CA 3GAFA 4M1TA 1WUIS 1XQ6A 4X92A 3EOAI 5AK6A 1GUYA 1HT0A 5E1BA 3MA0A 3PHJA 3RVOA 5JSUA 1UKCA 1KDTA 4B4KA 5CCBA 1F12A 1NBMA 1ZR2A 3BIWA 4GPZA 4UCFA 1CUWA 1HEIA 1SPBS 4IYRA 2REQB 4ND7A 2ZB4A 3M6VA 5FBLB 3RYIB 2IEIA 5JEEA 5KB3A 4OB8A 4XTRA 4EH1A 1KK1A 1L5MA 1G8JA 1ZCBA 2X1MA 4Y6PA 4YT8A 1YIDA 1X1QA 4Z7QB 4MI9A 4L9RA 1JALA 2GCEA 1TVKA 5LZ5A 1H93A 4HH0A 2C7GA 1I10A 4L28A 4M0DA 5FOSA 5BR1A 1LW7A 3MPUA 2YQ5A 1UC9A 2RGNC 3LBYA 4V2UA 5FOQA 4RQTA 2PUEA 1X2EA 2C4MA 3O8OA 2E4UA 4LZOA 4LEIA 3ICPA 1R6BX 1L7EA 1DQRA 3T5GA 1RTTA 1XCOA 2A0WA 4C0QC 5J4YA 1DE0A 1T1JA 1ODFA 2PU7A 3K9CA 2AZDA 2G08A 3GT3A 1V8DA 4B3TB 2VSYA 3DL4A 1VYUA 4LXXA 4MR9B 3JAWA 3VR1A 4O1MA 3PIDA 4DJFC 2FMTA 3AUUA 2RHOA 3PTLA 4X6UA 3TIFA 4TLBA 5JWRA 1VG0B 1XZBA 3TLJA 5AVZA 2ZWIA 5DH9A 4ALJA 3NHZA 1L9XA 3URKA 3UXHA 1NQTA 4OXKA 1THMA 4XQCA 2JFYA 5EKTA 4DAOA 5HP4A 1GZDA 3OTQA 2VP3A 1W581 3DS8A 3MGKA 3TQRA 1CUCA 1DQNA 1NZFA 2IQ5A 5BUCA 3KQHA 4ZDJA 2F17A 4HB3A 1BC5A 2CLCX 4QAJA 5EHGA 1ZJ6A 4B6FA 4QZVA 4M0EA 2XGJA 2ZOSA 3DVQX 2OGUA 3HBFA 2C96A 3K05A 2C2BA 5DCWA 1CZRA 4KQGA 2GBIA 1NX9A 2RHGB 2ECOA 3DHNA 1LS1A 1C29B 2YZGA 4J2OA 2G17A 4Q3BA 2JFFA 2WU8A 3AEQB 2W98A 3E7FA 3R09A 3AIIA 3OETA 2GT1A 2GYYA 3ZXSA 1NNLA 3O8QB 4E07A 4W9MC 2WVGA 1L5RA 2ZTVA 3HG7A 2GPAA 2FGKA 2OO7A 3E1KA 4O4LB 1Y6QA 4CT4B 5KQLA 1T5LA 3P2OA 3UWMA 4M1SA 1O6GA 3IXQA 4PYMA 4Z6KA 4C2UA 1DO8A 1VI5A 3B2NA 3EZXA 3FB4A 3L7MA 4O63O 1N8KA 4OK3A 4R8SA 4RZXA 3SHFA 2X1LA 3M49A 2J6IA 1CUEA 1XVLA 2WFAA 1CIVA 3NU1A 4AICA 3OE5A 4P34A 1EB8A 2IH4A 1QFSA 2FK7A 3ZXYA 3R4VA 1DPFA 3UJPA 3E9YA 3F4BA 4H6VA 1NJGA 4JEHA 4O2RA 4M9RA 2EP7A 1RYDA 3GMTA 5IT4A 2YCLA 1AZSC 2QN1A 4CKBB 4KPUA 4HAOA 4PRLA 5KMGB 1JEYB 4BEWA 1ZGZA 4RJJA 3BGVA 1JQDA 2PQMA 4R8MA 3TZ6A 5JCOC 3VC7A 3UMMA 2XR1A 2ZPTX 3AF4A 4URXR 5MFZA 4F45A 1NQXA 4JQCA 5JHHB 3A6DA 5EHZA 2P6PA 1T4DA 2M6SA 1ZN9A 1GPNA 4IM7A 4GLOA 1BEEA 5EUMA 3PRYA 3NVAA 3R7LA 2YWFA 4G1UC 4U3JA 2FVYA 5HKKD 3DUFB 5HOEA 4RHFA 1RJDA 2IYTA 1NY6A 1GKLA 1ZH4A 3BFPA 2IWHA 2BLNA 3WWPA 4ROSA 1MCZA 4Q9JA 3QIAA 3DFMA 1LBHA 4ZXFA 3IAFA 1MDBA 2WV9A 4HH3C 2B7CA 3ZS8A 5JS6A 3PC7A 2Q3EA 4ZT5A 4EHNA 2QW8A 1P4SA 2HLDA 2WMOB 3V33A 2OAQ1 2VBCA 3DGFC 4GH5A 1C80A 3SHQA 1Y3CE 2X4DA 3BZUA 4C6TB 3WIUA 5DXAA 5C4MA 1V71A 1ZONA 4IG4A 4P54A 1DEXA 1E7SA 3RRMA 1BFUA 3NI2A 4O4JA 1Y5IA 1OPXA 4LVNA 4QGHA 1QF7A 1TGYA 4UOQA 3KM0A 4ZYUA 3EGVA 2W48A 4WECA 5P21A 1GSHA 1A95A 4ZVMA 3VNRA 3W5CA 2BKXA 3QJGA 5JYCA 3EVDA 4EL5A 3IXMA 1LJ8A 2ZIWB 3NRCA 2EFJA 5CVUA 5AI0A 3WBJA 1J1UA 4CUJA 4FBMA 4EB8A 3ZQJA 3DOFA 4PX5A 4Q3DA 2IEBA 4PYIA 4BU1A 1OYYA 1ORDA 2ZJZA 4PGMA 1QTNA 3BWXA 4EUKA 3COPA 4HAVA 4MWGA 5LCXA 1G0NA 5KC9A 3BMQB 5G41A 2CXSA 4NFYA 4OQFA 1KZ4A 3HVUA 5B37A 1QJCA 1CVRA 4Y2SA 1HXHA 4IH1A