1Q7BA

The structure of betaketoacyl-[acp] reductase from e. coli in complex with nadp+
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
243
structure length
243
Chain Sequence
b'NFEGKIALVTGASRGIGRAIAETLAARGAKVIGTATSENGAQAISDYLGANGKGLMLNVTDPASIESVLEKIRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVGTMGNGGQANYAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTRALSDDQRAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGGMYMV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
publication title Cofactor-Induced Conformational Rearrangements Establish a Catalytically Competent Active Site and a Proton Relay Conduit in FabG
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 85
structure length 243
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2003-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1q7bA00
4TRMA 2HMSA 2NADA 2DLDA 4UAGA 4K9DA 2Z95A 5A02A 2WE7A 3RKUA 5GZ6A 1PWXA 1LRLA 4YPOA 4UEJA 3GA0A 2VZ9A 3VC7A 3VTZA 1QP8A 1BXGA 1R4MB 4XD2A 4A10A 4RPGA 2H5LA 4HXYA 2ZCVA 2O3SA 1SB9A 1Q1NA 3A06A 2EJVA 4O63O 1KVQA 6ADHA 5ENDA 4CM9D 3WGIA 3PJFA 1UZMA 2YV2A 2Q46A 3WG9A 1T2CA 4I5FA 4CLEA 1I2ZA 2QRLA 5ILOA 3MJCA 4K6FA 4EJ0A 1J6UA 1ZJYA 4YJFA 5G0VA 5L45A 1LXCA 3GGOA 4RLHA 1RPNA 1Z6ZA 1PJSA 4LMPA 1DC5A 1I0ZA 3AWDA 3RC2A 1YBAA 1Y5RA 2BFAA 1YONA 3BMNA 3DBLB 4JX8A 3U9LA 1O9BA 3WYBA 1JU9A 3V1YA 1H2HA 2JCVA 2E48A 4BGIA 2Q1UA 4Q3DA 3UAGA 3ABIA 1R0SA 3WMWA 5ES3A 3INTA 5TJ9A 4D44A 1NVTA 3H65A 3L0DA 1LDGA 3BA1A 1PJQA 4PRKA 4YAIA 4DPLA 3I4FA 4MP6A 5CEJA 4J4HA 1WW8A 3ZV5A 4IXWA 5H83A 4BO5A 1EVZA 1P45A 2XAAA 3KBOA 1B26A 2CVZA 1GZ4A 5JAIA 4F6LA 1MXFA 3F4BA 4W9NC 1A72A 4EJ6A 1ONPA 1C14A 3WIEA 3LU1A 4WOJA 2LDBA 3DONA 4ALMA 4BO1A 1CF2O 3BAZA 1Y6JA 4YRBA 2ZB7A 4DGSA 2A92A 2NM0A 1LLCA 2C07A 3GG9A 9LDTA 3OEYA 3B70A 3PIDA 3EVNA 3QVXA 4MO2A 2YV3A 2ZK7A 1XCBA 4BNFA 4J49A 3JTMA 2ILTA 3WDSA 1ISIA 1T26A 3CE6A 3VDQA 5IXYA 2IEBA 4IMPA 3KV3O 1E3WA 1E0DA 3E82A 3X2EA 1U5CA 4E2YA 1S7CA 3K8ZA 1HDZA 1I5RA 3QA9A 4N54A 1UDAA 2AG8A 1NFFA 3RASA 3RFVA 3OICA 4QTZA 2X58A 2YY7A 5HS6A 4WUVA 4GPD1 1EBUA 3H2SA 4JCOA 1RYEA 1XU7A 2YQ4A 3LLSA 2H6EA 4BO3A 2HKIA 4CLOB 4F45A 1HF3A 3IKVA 1BMDA 3PWZA 4FOOA 5F21A 4M87A 5ITVA 2VUUA 4CM8A 4ZQFA 4J0EA 2GZ2A 3W8DA 3EUWA 4MVJF 1WDMA 1Z75A 1EQ2A 3A28A 3JYQA 2YUTA 3ZNOA 4XR4A 1ZK2A 1C0LA 1ORRA 3LDHA 4J4TA 3KOUA 5B37A 5T64A 4BGEA 1NAIA 1DFIA 4YT4A 1GEEA 1A27A 3X2FA 1QV7A 2O3QA 3GQVA 4R5HA 2VUTA 5JPIA 2B36A 2A35A 4AJ2A 3H3FA 1ZEJA 1R37A 5F1OA 2DU8A 2PGDA 3RKRA 1XA0A 2Q4EA 1U8FO 1JKJA 3PGXA 5TSDA 4PZDA 4N5NA 2EHDA 1FF9A 2AMFA 3SVTA 2D3TA 2VCYA 4ND3A 1BXZA 2G0TA 4LRSB 1NQTA 1X15A 2JAPA 3ASUA 4XGNA 4AL4A 1Y7TA 3DBHA 3HADA 5JMWA 3NTRA 4KUGA 5G4LA 3GGGA 1DBVO 3K9QO 4GX0A 1KVSA 4AJIA 2IYOA 3Q0EA 1T2FA 3FF4A 3Q11A 3KUXA 3PHHA 1OAAA 1O95A 2V6FA 4DXHA 3CEAA 4UREA 3RUFA 1WP4A 1JN0A 2Q99A 2ZTLA 3EW7A 2IXBA 1ZVMA 3S2IA 3K92A 1OFGA 4RVUA 3ADOA 1XQ6A 3QP9A 2A9FA 4XYBA 5JY6A 3QLJA 3HN7A 4TSKA 1LC0A 2VNSA 3QE3A 3FD8A 4DTIA 4J1TA 1M6WA 3DXFA 2J5KA 3GAFA 2Y0CA 1FDTA 3IP3A 2GGSA 4JJGA 2VTEA 2X5OA 3S2EA 2QHXA 2NSDA 2CUKA 1E7RA 3VH1A 3RU9A 1LSSA 1J5PA 1LA2A 3H5RA 5IJZA 2D5CA 3ZV6A 4EEXA 2J5QA 4WE3A 1WXDA 2VZ0A 4YRDA 4Z9XA 1KYQA 3GZNA 2FP4A 3JQ7A 4ZRNA 4NU6A 4A73A 3RC7A 4YT8A 2OHXA 5JYDA 1MFPA 4KUHA 2NU7A 2GLXA 1R6DA 2IXAA 2OZPA 4KWHA 3QWIA 1PTJA 5B1YA 4HFNA 4IZHA 3VDRA 1XSEA 2GN9A 3ASVA 1Q7CA 1YB5A 2OL4A 3RSHA 2HK9A 4HFJA 4GMGA 2OBYA 3DBRB 3LC1O 3MTJA 3JQAA 4RF2A 2I65A 4YJGB 1ULUA 4PZCA 4CLXA 3ZWCA 4H7PA 4D43A 3U09A 3Q1LA 3DZGA 4L8VA 5I7SA 1HYHA 3W6UA 5F5NA 3ZHBA 1ISJA 3D1LA 5COBA 1SO8A 3ROQA 4A27A 5DOVA 1XYGA 3PHGA 2RIRA 2BHLA 1X0VA 3VVBA 1JKIA 3U3XA 2WM3A 1VJTA 1VJ0A 3GZ4A 3EYWA 3ZWPA 3F47A 2GCGA 2JD2A 2BKAA 2E37A 3CSDA 4Q3CA 3ICPA 4BNVA 5AYVA 2V6MA 2CMDA 4UEOA 2AA3A 3RAJA 1XG5A 1E6EA 1PL7A 4NIMA 4FB5A 1DLIA 2CD9A 1LX6A 5CDYA 1C1XB 3KHUA 4TVBA 4ALIA 3CINA 1BW9A 3GOHA 4MVJA 4AVYA 1DC3A 3AI3A 3QV1A 1TB4A 4PN3A 1Y1PA 4PZEA 4AJEA 3GK3A 3MJTA 4L4XA 3MJ4A 4PLGA 1T2EA 1UXJA 4E21A 1E1MA 3E18A 3WBBA 4YEDA 2Q2VA 4OGWA 3FPLA 3L9WA 1V0JA 2ET6A 5EN4A 3PLRA 5COQA 3WSVA 5IXSA 4ND2A 3ROPA 1GADO 5JS6A 3WGQA 2HO5A 2X9GA 1SC6A 4D46A 1R0KA 5DBFA 3G17A 3QVOA 1KY5A 3F3SA 1T2AA 3GNTA 3IL2A 4GBJA 3WGOA 3PEFA 5A05A 1ZSNA 5ADHA 3W6ZA 3WGTA 1H93A 4ID9A 4TZKA 2ZJ0A 1L7EA 3IUSA 3PQDA 4DIFA 2J3HA 4B4OA 1LQTA 1LSOA 4UVGA 3BMQB 4CLRA 4ZVVA 3T7EA 2DBVO 5A04A 3C8MA 3UICA 1JTVA 3DMTA 5C37A 2A94A 1GTMA 2Y68A 2GASA 3VPSA 3NUGA 3RC1A 4DQVA 1E7YA 1K2WA 3ZH2A 3O9ZA 5KVCA 4OQYA 4NBRA 3WNQA 3KSZO 3GDFA 3GMSA 1HT0A 4BNHA 5ITWA 5JYEA 1E5QA 2WD8A 3JYLA 1SNYA 5A1TA 2YHIA 3GRPA 3DWFA 2C54A 3G1TA 3ROKA 3SC6A 4YR9A 2B35A 4D3FA 2AQKA 3DZBA 4XZ3A 3OJLA 4DLAA 4BUCA 2QYSA 3RWBA 1P77A 1NQOA 4DYDA 1U5AA 2ZCUA 4R01A 4WECA 5HWSA 1KVTA 4OOFA 1N92A 1HTBA 4KZPA 3UCFA 1GYQA 4C7JA 1RWBA 1U9JA 1Q0LA 4NNJA 4TZTA 5BSHA 2J8ZA 4XX0A 4FFLA 4JJIA 3LQFA 5L9AA 4YB8A 3I3OA 3ZWMA 1UXHA 1F12A 2YQ5A 4YCAA 3SJ7A 1E7MA 1NP3A 2W2KB 2PD6A 4CM1A 2NVBA 1X13A 2G17A 5T6BA 3NTOA 3STHA 1ZK3A 3H9EO 3JQFA 1JVBA 3WMXA 3D4PA 3DOOA 4RF4A 2IDZA 4RVGA 3AM4A 3JD0A 4CM3A 2DBZA 1C1DB 4P4NA 3WQQA 2WD7A 4CQMB 5B4VA 2GN4A 3NGXA 2BGKA 2NVUA 4LSWA 3TSCA 4RJTA 2DM6A 3ZV4A 1BGVA 3OQBA 1P9LA 1RKXA 3AOEA 3ZNQA 2VWHA 3DDNA 3C85A 4URFA 3C1OA 4TVOA 4DQXA 1LC3A 1D1TA 1BWSA 3CKYA 2JFGA 4FOSA 2HSDA 3ZZNA 4BO2A 4LRTB 3RJ5A 3I23A 4IMRA 2C59A 5CHEA 2F1KA 3OIFA 1TXGA 5FYDA 4UVIA 3ZU3A 4WGGA 5EERA 5C7OO 4CR8A 1IE3A 4Q3EA 3PZRA 3RUHA 3H7AA 4PG5A 1UXIA 5CPBA 4YRAA 1U3WA 1MG0A 4X54A 4EGFA 3M1LA 1I2BA 4XJTA 1IZ9A 3K2EA 1BXGB 1SCUA 4IS2A 1NWCA 5KKCA 3BTSA 3GNQA 3V2GA 1AUPA 3UCXA 2O7QA 4BHTA 3QIVA 2P5UA 3LF1A 4L0QA 2AQIA 2VN8A 2BI7A 4XGIA 1GYRA 4QFDA 1X0XA 4JBIA 4R5MA 3TFQA 1O0SA 4YJFB 3ZWOA 4HV4A 3HUDA 2DKNA 5JE8A 4BNIA 1AN9A 3CXRA 1UP7A 3TL3A 4BMNA 2Y93A 2PZKA 5A3VA 4CPDA 4BNYA 1Y8QA 3U5TA 4DIOA 1GR0A 2EERA 3WJ7A 1FK8A 2VYVA 1SEVA 3WTCA 1C0KA 2ZQZA 4OXKA 5G2OA 1E3IA 1AHHA 4R9RA 2FZEA 4U7WA 1PJLA 4CUJA 5KVVA 3QWHA 1HYGA 2OFPA 4RZIA 1RJWA 4J7XA 3CUKA 4Z0PA 5L4NA 1UZNA 5ICSA 2B69A 3AU8A 3C3XA 3EZLA 3AJRA 1TA4A 1QYVA 1IHXA 3DMYA 3KYDA 2EG9A 2BF7A 4R69A 5JO9A 4BQPA 1WZEA 4R41A 4RQUA 4DC1A 4CMAA 3RUEA 2ZKLA 4EUEA 5KJCA 2HAEA 2VWPA 3GUYA 2XOXA 1I36A 3H9UA 3JQFC 4GWKA 3VPGA 3AK4A 3Q3CA 4L75A 3OMLA 3LT0A 2WYVA 3OA2A 4H3VA 5HA5A 4CL8A 4CR7A 4GGPA 3PHJA 4CMBA 4IJKA 2Q1TA 2C7VA 3KEOA 1LRKA 1P1RA 1DIBA 2EGHA 3ZGYA 2I3GA 2PV7A 1AE1A 4CM4A 3COSA 3OSUA 2ZYDA 1E3JA 3PDUA 1RYDA 1XELA 3KSDO 4LN1A 3K96A 3WYCA 1A5ZA 1U2GA 4NDNE 1E3WB 3CTMA 2ZYAA 3UOGA 4RORA 1ZFNA 3EK2A 3WGZA 4RZHA 4I08A 5EQFA 4FD3A 4ZQEA 4NJMA 4EEZA 4M54A 4YT2A 3GUCA 1S6YA 5T8KA 1LDYA 4O59O 4EDFA 2OMEA 5JBIA 2GERA 1I24A 3PGJA 5BNIA 1EEHA 4B7UA 4F3YA 2AE1A 1LTHR 4R4JA 5G0UA 1GZ3A 4MVJM 4TRRA 1UH5A 4J1QA 4R54A 2ZB8A 1KVRA 1Q2XA 3OF2A 2JCXA 2B0JA 1NQ5A 4CM8B 3O4RA 2GF2A 4W7IA 1P74A 3RUCA 3LT4A 4ND5A 4I5GA 3JQ6A 3R1IA 4I5EA 3P2YA 3ZU5A 2OO5A 1H6BA 2DPGA 1T4BA 3C7CB 1A4UA 4WLOA 3UF0A 1MFZA 3RI3A 4J43A 2VHZA 5EJ2A 2UYYA 5CDSA 3PVZA 1MGOA 2RHRA 4GKVA 3W8EA 4XR9A 1DSSG 1GCUA 3L4SO 2P4QA 1K6XA 5L53A 3GVPA 3MOIA 2ZB4A 2Y1GA 3H9QA 1QRRA 3NRCA 5JDCA 4A5OA 3NJ8A 3PQEA 3PHIA 4NFHA 3D4NA 4ONEA 1WDLA 4NG5A 5AXCA 1PGQA 4M8SA 2A4KA 4GX2A 3U4CA 3DBHB 1BTOA 1GD1O 1LLUA 2X0JA 1EFLA 4JQCA 4OHUA 4TRJA 4W82A 4YXFA 1GQQA 1GPJA 1Z82A 3TN7A 3SBOA 1ZNQO 1I8TA 3WXBA 2WDZA 1RM4A 5FFFA 3EHEA 4CM6A 1T24A 3O03A 2VUSA 5JSFA 4JJFA 1VL0A 3OJOA 2PH5A 1HEUA 1PX0A 3AUUA 4DA9A 1SMKA 3OJEA 4OMUA 3VTFA 2AQ8A 4NHEA 5DF1A 4BB6A 1QV6A 3CIFA 1T1RA 2RAFA 1JWAB 1HE5A 4E13A 4BKOA 4BS9A 2OXIA 3PXXA 5H81A 5DOZA 1FDVA 3ZDFA 4ILKA 2I99A 1RM3A 3PPIA 5L7WA 1ADCA 1B14A 3DC2A 2X8LA 5BSEA 5TX7A 4HY3A 2W90A 2Q3EA 1ZW1A 1U3TA 1FDWA 5T8KC 5L7TA 1AGNA 4AICA 3HDYA 1ID1A 3IKTA 1DOHA 4L4SA 1LEHA 1NBOA 3VKVA 1H6DA 4BNMA 3TPCA 1C0PA 5I7EA 3H9GA 4BNTA 2QZ9A 3ZWWA 4NMHA 3JQ7B 4UUMA 5IZ4A 4E5NA 4ZQHA 3TZKA 1F17A 1TI7A 4RF5A 3KVOA 5TT0A 4BB5A 4P22A 3FBTA 1EZ4A 5JXWA 3PWSA 2PNFA 1T4DA 4B3IA 2NNLD 1B8VA 4WPGA 1ADFA 4BMVA 2PY6A 4BV9A 4ZGWA 2PGLA 2YDYA 3TZQA 3LT2A 3F46A 4J2HA 1PGJA 5AOVA 3RD5A 5MGBA 2PR2A 3INGA 2VHXA 1N2SA 4MIYA 2CF6A 1R15A 1UP4A 1A7AA 2J3KA 4AJ4A 7ADHA 1U8XX 4DPMA 1LJ8A 1P1JA 1V3UA 5HRUA 3B1FA 2I3AA 4O1MA 4PLFA 2D59A 5JDCC 2DPHA 4HX5A 3GVHA 1DXYA 2DUUA 1HDCA 4XB2A 3RC9A 1DIHA 1QYXA 1JKFA 1YWGO 5JMPA 2DQ4A 5CDTA 2JFHA 4KMSA 2VRCD 1MXHA 2ZTVA 4BIIA 4MVJP 3I9LA 1DIAA 2IZ1A 4KOAA 4XRGA 5T67A 2AQHA 2NV6A 3KZVA 3GVCA 1JAXA 1DIRA 2DTDA 3LT1A 4KTVE 1VKOA 1NPTO 4NBWA 2QRJA 4FFRA 5T57A 2IZZA 1BW9B 2JJYA 5J23A 1TT5A 4BGUA 4CMJA 3M2PA 1J49A 3QVWA 4OKIA 1N7GA 2LDXA 3Q6IA 4XCVA 1NR1A 4Q3AA 4WCFA 5GY7A 1ZO8A 1B16A 2X0NA 4XYLA 1X1TA 4QQRA 2GYYA 3WWYA 1KEUA 1PQWA 4UUOA 3MWDB 4DWVA 2B4RO 4RF3A 2V6BA 3H9JA 2VZ8A 4BNNA 3JQGA 5DDIP 1OBFO 4B3HA 4PLHA 3UN1A 4CQMD 5K9ZA 2E49A 1NXQA 1QSGA 4IDDA 1E1KA 3W4KA 3FCOA 1QYCA 4C4OA 3QY9A 3OQ6A 3NEPX 1NM5A 2G1UA 3MJVA 1UXKA 2P2SA 5IZCA 2OORA 5G0WA 1O8CA 3A1NA 3HQ4O 3KYCB 3WS7A 4BO6A 2JHFA 3ZWYA 4MJLA 1QG6A 3ETGA 4HFRA 3GT0A 4GVLA 4ZJUA 1P33A 1DAOA 1PZHA 2WYUA 1ZK4A 4NZ9A 1I10A 3WLEA 1V8BA 4FC6A 2FSSA 3BMCA 1CQIA 1X7HA 2J6IA 4I9UA 1B8UA 4CLRB 3QJ5A 4YYZA 1SEPA 3F5QA 3GFGA 2O3TA 4R9SA 5COAA 4NK4A 1LBEA 1PJCA 1QYDA 3I9JA 5FI5A 1FMCA 2B4QA 4PFJA 4BO4A 2Y1OA 3AI1A 4ND4A 3JQEA 4JIGA 1Y81A 3D5QA 1DDOA 2VNAA 3TZCA 2NACA 3PK0A 2V6GA 4BO9A 1VPDA 3S2GA 3VZRA 1OMOA 1PQPA 3DTTA 4TQGA 3K31A 2CSUA 3VOSA 5B12A 2YHIB 4D42A 4TMFA 2EIHA 2GRAA 4YTEA 4MDHA 4E5YA 8LDHA 1ADGA 3E03A 2X7HA 3L07A 4XDYA 4BNLA 3N74A 2EGGA 3RJ9A 3UH1A 4QO8A 3I52A 3VAZA 1K6JA 1EE9A 1MC4A 4BNUA 1LRJA 4A2CA 1O6ZA 4P38A 5CG2A 3NV9A 4EJMA 1ADBA 1R66A 2QRKA 1MB4A 3ETEA 3V2HA 1I3KA 4NBVA 5G0TA 4OM8A 2UDPA 3ZWAA 1HDXA 4AJLA 3HNPA 3OQ1A 3ONEA 2IODA 3UFXA 5C7LO 2Q50A 2VHVA 5KJFA 1D1SA 4L4RA 1ENZA 3VZSA 3TNLA 4HNGA 4JP2A 5GMOA 5FF9A 1FJHA 4MKZA 4NI5A 4DLLA 2HRBA 5FWNA 2PTGA 2RCYA 4LCJA 3HDJA 2Y0EA 4E4YA 1VM6A 2WD7B 3ZW8A 3V2UA 3FBGA 4WLNA 3W1VA 4II2A 3F1KA 4W7HA 5EINA 4IXTA 4CUKA 3JQCA 3LF2A 3ITKA 5K6AA 2HUNA 4GX5A 1SB8A 2YDXA 4D7AA 2VT3A 5AVOA 1MC5A 1RM0A 3PI7A 2QW8A 2WJPA 1ZSYA 3ON5A 3PTZA 2Q1WA 3ZWNA 1A9YA 3AFNA 1DIGA 3SLKA 3Q2KA 2QQ5A 3E8XA 2G76A 2RBEA 1NX6A 5L3ZA 4WJZA 3OA0A 4MVJG 4DQUA 3NTQA 1ARZA 2F00A 1HE2A 3GFBA 3NYWA 4BNKA 2IZ0A 4DC0A 5A9RA 4DLBA 5IZCC 5HBRA 3IS3A 2P9GA 3GHYA 1M76A 1WDKA 2GUGA 2NWQA 1XEAA 5CP8A 2C0CA 3FNEA 4XQEA 3I9KA 4OOEA 2FWMX 4LVCA 4WLUA 2YV1A 4XA8A 4B79A 1YQXA 4E2XA 4PLTA 3W4IA 1GU7A 1DJQA 2PLAA 3DAPA 4EUFA 4XJSA 3U4DA 1HETA 4GSKA 2WYWA 1O89A 1EMDA 1V35A 3D3EA 4LMRA 1ENOA 3C1TA 3RROA 5HM8A 1EE2A 1XIVA 2GSDA 1P1HA 3U0BA 1CEQA 4KDEA 3ZNNA 3OP4A 2W4QA 1DRVA 1HYEA 1DC4A 1BSVA 3FHLA 3OFSA 3UUWA 5EESA 4UEKA 3FR7A 1N7HA 4J1NA 4WCDA 4WNCA 3RUAA 2C82A 4CQLA 1GL3A 3BMOA 4PG6A 5U9CA 4K1LA 1LQUA 2B5VA 4P4LA 4OL9A 3QRWA 3IP1A 3WNVA 1YJ8A 1VKNA 1NYTA 1P31A 4BV8A 4B8ZA 4BO0A 4Z3KA 2FRDA 4J3FA 4CV0A 4DPKA 1LUAA 1ZIDA 1ZUD1 3KYDB 3GC6A 2XXBA 4ROSA 4RVFA 3IUPA 2VWQA 2BRUA 1HDRA 2GO1A 5IDXA 5MDHA 3G0OA 3HJAA 2PKQO 3ITDA 1IL0A 1Z45A 3ANLA 1PJ2A 1B2LA 1EBFA 2B37A 4FSHA 2DTEA 1ZEMA 2HK7A 5KJEA 3JD1A 3SJUA 3TL2A 1E3EA 1LLQA 3E9NA 3GEMA 4MINA 4ZQBA 5JCJA 3JQ8A 2I6TA 2HDHA 2Q4BA 1YDWA 4AJ1A 1X1EA 4RVSA 4E31A 3L6DA 4BNGA 4CM4B 3K30A 3KEQA 3QQPA 4N5LA 2NTJA 4PLWA 1GQ2A 4XIJA 5JNLA 1HSZA 5K6AC 4A03A 1QLHA 3UCEA 1AHIA 1ZBQA 5FI3A 4ZHSA 3S55A 3WIDA 1GDHA 3FI9A 4EZBA 1KC3A 3PYXA 4NJMB 1H6CA 3Q9UA 3D64A 1HSOA 1HLDA 2Y0DA 5TNXA 3PZBA 3JV7A 3ZW9A 4INAA 2O50A 1K89A 4FR5A 2NQ8A 2Q2QA 2YHUA 5ICMA 2FPPA 4J9VA 3RVDA 4JN6B 1VL6A 3DEYX 4RPJA 4E32A 4CMKA 3H6KA 1EUDA 3PFFA 5CDUA 2E6UX 3EAGA 1LU9A 3L77A 3LYLA 4R3NA 5A9SB 2HMWA 3FTNA 4YACA 4AFNA 5A5EA 5U4QA 5ILGA 3WFJA 2ZJ1A 1LDMA 1ZJZA 1XKQA 3G79A 2TMGA 3QW2A 5THKA 4IY1A 2EKLA 3BHIA 4DMMA 4W99A 3DL2A 4PG4A 4AJJA 2D1YA 1B15A 4YDRA 1Y8RA 1BHSA 3PJGA 3R3SA 4PLYA 2HMVA 1IPEA 2YYYA 1WPQA 3F9IA 5BSGA 1YQGA 1ENYA 1PL8A 2UUOA 4D3DA 1GYPA 1Y9EA 2ZQYA 3HG7A 4N7RA 4PVDA 5KIAA 2HRZA 3I1JA 5AXAA 2H63A 3TFOA 4YVFA 4OQZA 2V7PA 1F8FA 2Y1FA 1NVGA 1Z7EA 1KOLA 2P4HX 1D7OA 4WEOA 3GDGA 4CMIA 4XB1A 4CMEA 2Y05A 1BDBA 3UKOA 3M2TA 5ER9A 4CMCA 1NPYA 2WWRA 1H94A 4IS3A 1PJ3A 2C7GA 4U5QA 5HTOA 1JVSA 1GCOA 3TOZA 2O2SA 1T2DA 4IGFA 3E6AA 5THQA 4GGOA 1I01A 2Z1NA 3ZHZA 2CF5A 3VH4A 1LLDA 3AM3A 1HDGO 4NFYA 4YJHA 1F8GA 3Q2IA 1H5QA 1ONNA 3OIDA 4XYMA 1YL7A 3ZN2A 3ZU2A 1U7TA 5CAEA 3MJEA 2NU6A 2QIOA 3O26A 3F5SA 1X14A 1YE3A 3JYPA 2JKVA 2RH8A 5DP1A 4FC7A 4IUYA 4GKBA 3L4BA 2YFHA 4Z9YA 3C24A 4FDAA 2W8ZA 5L51A 5DNAA 4MVJD 1WMBA 4FJ2A 2GDZA 4IDAA 3IJPA 1B3RA 1E1NA 1G0OA 1TEHA 4U6SA 2RH4A 1R12A 5CDGA 2UVDA 1YVEI 3AI2A 2C29D 1HE4A 3KB6A 4A26A 3DMTC 1NQAO 3HN2A 4YA6A 3VPHA 3GMDA 1GPDG 3QWAA 1UZLA 5AXDA 4KQWA 3RFTA 4LGVA 2CVOA 3RCBA 1ZXBA 3HHPA 4B7CA 4H16A 4J90A 4JBHA 1YBVA 4U0KA 3V8BA 1EDZA 3OECA 4IQ8A 1OZAA 3WOHA 3BMNB 4DVJA 3DZFA 2D2IA 2C5AA 5TT1A 3IC5A 1MUUA 1NASA 1PR9A 3AUAA 3K2BA 3KM0A 2B4TO 3A4VA 1ZH8A 2Y66A 4CV3A 4K28A 4B8WA 5IDWA 3B1KA 5AXBA 4GWGA 1H2BA 1ISMA 1R4NA 4WKGA 3ANNA 1JAYA 3JYNA 5DCUA 2JHGA 4DL9A 5JCXA 2AG5A 4J1SA 2JD0A 2B5WA 4OKNA 1CDOA 4PLZA 1I30A 5LDHA 3I83A 4BOYA 5A5FA 1LDNA 2Y1CA 4QECA 1PS9A 3D4OA 2HQ1A 4R16A 1LNQA 1NVMB 1U28A 4Z0HO 1K5HA 4D45A 3DZHA 3N58A 4IINA 3C7AA 3PFWO 3LLVA 4RDIA 4ZQGA 4PCVA 1E7SA 2FPIA 3I6IA 5JFOA 1OOEA 2JFFA 1HDOA 3D7LA 4PLVA 1YB1A 3KRTA 5IN5A 4CM9A 5A06A 3GDOA 3JD3A 3NKLA 3FWZA 5U1PA 2FZWA 4CLDA 4ZRMA 4BMSA 4IBOA 1DAPA 1EQUA 4CMEC 2BI8A 2OBNA 3AOEC 2YW9A 1DFHA 1Q7BA 2O4CA 2X9NA 4ALNA 1GAEO 2FPGA 1PGOA 1N5DA 1YKFA 1E92A 4TRNA 2YJZA 3NGLA 2ZYGA 2J3JA 2Q49A 1TT5B 4BNWA 5JO0A 3U4IA 4RGBA 5IAAA 2CDCA 4FBGA 5TJHA 2X0IA 1U4SA 3A14A 4J4BA 4XQGA 2WE8A 1XHLA 3F6YA 2PWZA 2VHWA 1XR3A 3L4BC 1PJTA 3JQGB 4JGBA 2O3JA 4IQ0A 4NH4A 1QKIA 4XKJA 4TROA 1B0AA 2PD3A 4CLHA 4Y67A 5TIIA 4OXNA 3H4VA 3ZCXA 1ZXLA 1U1IA 4RV9A 4IIUA 1UP6A 1GQYA 2J5RA 5LCXA 1AXEA 1PS8A 4ESOA 3ONFA 1E7QA 3BHMA 1U4OA 3N7UA 4S1VA 1ZK0A 3PP8A 3BMCB 4BKPA 4Y6RA 1P1IA 1X7DA 2BMAA 4DIBA 4HBGA 3VPXA 4IDBA 1WVGA 2BFMA 1SPXA 4IDGA 3KLMX 1B3BA 4HKTA 4MVJI 3RUIA 4YJDA 3WYEA 1EUZA 3JSAA 3PDJA 1WWKA 5TF4A 2VWGA 3JYOA 4E12A 3TZ6A 3VZPA 4XQCA 1LSUA 3GGPA 4D3SA 4CV1A 3WLFA 2E82A 2I67A 3WR5A 4KDFA 3AUTA 3AY3A 3O8QA 4L76A 4R1TA 2CDAA 2NVWA 2EP7A 4N18A 4GAEA 4U0JA 4WLEA 3VZQA 3SEFA 1I3LA 1UR5A 3U4HA 4M89A 4FFOA 4RLSA 4Q3NA 1GUZA 4RDHA 1D8AA 4DBZA 3IIEA 4PVCA 4IPTA 3RFXA 4HFMA 1OI7A 2WMDA 3DFZA 4ZU3A 1A71A 2VTDA 1C1DA 1SBYA 1YBMA 3CMMA 2Q45A 4GSLA 2H9IA 4II3A 2NTNA 3BYZA 4CQMA 4NPCA 3FR8A 4B4UA 5DCWA 1MA0A 3E5MA 4WK6A 5TC4A 2UAGA 1NFRA 1N1GA 4ZD6A 2I5PO 1E6UA 2DC1A 2O7SA 4RPHA 4EW6A 4I1IA 4CJXA 4UUPA 4FFMA 2VYVD 1KETA 4FGWA 4MIEA 4XIYA 3UHAA 4JK3A 3AU9A 1YO6A 4PIVA 5TS3A 3ZNPA 4NFSA 3PHLA 5C5IA 2X22A 5TQVA 4QEDA 3HE3A 3TWOA 3L6OO 3DR3A 4E5PA 4WNIA 3WQSB 2DTXA 3HDHA 1E6WA 5KJ1A 4KUEA 5C7IO 1T1SA 1OC4A 2HU2A 3AOGA 3INRA 1E7WA 4IJUA 4ALLA 2FR8A 3R6DA 4YT5A 4BGVA 5KJ6A 1NPDA 2D5AA 1A4IA 3E5RA 1R0LA 4CR6A 3HSKA 1F0YA 4GQAA 3DHNA 5IG2A 1YS4A 5LC1A 3WGYA 1BRMA 2HJRA 1UJMA 3GZNB 3I5MA 1GV1A 2V65A 4R1NA 3W8FA 1E77A 1FDUA 4JBGA 1EVJA 1P1FA 1U7HA 1PIWA 4M49A 1RM5A 3W4JA 3LC2O 2DFDA 4NU5A 3TQHA 4MKXA 4FJ0A 3GRKA 5BNTA 1GEGA 2ZB3A 2CY0A 2GN6A 4NK5A 2BLLA 3DHYA 3RBVA 3TZHA 1HE3A 1I33A 1NHWA 3JCZA 1O94A 1Z7BA 2W2LD 3PIIA 2CVQA 4CODB 2EKPA 3JQAB 4FFPA 4PLPA 2TMDA 3IMFA 5DBGA 5H82A 1YH3A 3GHHA 3ZV3A 1V9LA 1I3MA 2HJSA 2O3RA 3NAQA 3B6ZA 1P1KA 2BD0A 2UUPA 4E2ZA 4EITA 4QFCA 2EEZA 3A9WA 4FCCA 4OIMA 2AHRA 3U49A 3TRIA 1EUCA 3S2FA 4BO8A 4RCVA 1LDEA 4AJHA 2IEDA 1TLTA 3U62A 3NDJA 2DBQA 4AJPA 4D41A 3IQDB 1X7GA 4MP3A 1PL6A 3HFSA 2BH9A 2XPCA 4WOKA 1WAMA 2AE2A 3EDMA 3PRJA 2OUIA 1DPGA 4OSPA 4LISA 5L4SA 1XQ1A 4AG3A 1UDCA 1PU2A 1ZKMA 3K6JA 4PLCA 4UVHA 2YZ7A 3FRJA 4GL4A 1PZEA 1Q0HA 5K0ZA 1ZCJA 1KC1A 2Y1EA 4CQLB 3F4LA 3BMOB 3I4CA 3D3WA 3OEWA 1K0UA 2ZTUA 1LI4A 1L7DA 5B4UA 5FEUA 5L95A 3KETA 2DBRA 2AEFA 4XEHA 1H6AA 4DUPA 3CMCO 3LZ6A 4GVXA 3EY4A 2X86A 5DULA 1JA9A 4FW8A 1N9GA 2D4AA 3AW9A 3DOCA 4I5DA 3NJ4A 4OO3A 3WJAA 1SZJG 4C7KA 3H5NA 1C0IA 1TVEA 3DBVO 4PGFA 2CFCA 3DFUA 1BXKA 3L9XA 4G81A 2DFVA 2VYND 1NFQA 3TF5A 1NTOA 2O48X 3JQ8B 1EDOA 3LC7O 2NU8A 4J2OA 4UULA 4QT0A 4YAJA 1I3NA 2BFPA 5BT9A 3D5TA 2X9VA 1M6HA 2P9CA 2VT2A 5JAMA 2GZ3A 3P7MA 1VJ1A 4YQZA 1QYWA 3BIOA 2X0RA 1VRWA 1XU9A 2VOJA 3KO8A 4W4TA 2WSBA 4GMFA 4E30A 1J0XO 3KLPX 5KTKA 3PWKA 1QXSA 2X1HA 3NT5A 5G4KA 4B3JA 4HADA 1IULA 1HLPA 3BZUA 3MTGA 4UVEA 4BKQA 4FS3A 3WBFA 3GVIA 1XDWA 3WQRA 1KY4A 3OJFA 3EMKA 1QMGA 4GH5A 3V1UA 5JC1A 4QSMA 4CMGA 3MWEB 5KVSA 4YAKA 4XWYA 2BELA 2R00A 4EYEA 1CYDA 1BG6A 1G6KA 3H5AA 3NDRA 1YRLA 5IF3A 1CQJA 1MP0A 3BXXA 1PJ4A 2O4UX 2X4GA 4U8GA 2PKQP 4LK3A 4ITUA 1IYZA 1KERA 4TKMA 4R1UA 3JQ9A 3C1AA 3DAFA 3B20A 3ZWBA 1W0CA 3WGGA 2EW8A 4AJKA 4YQYA 5CFZA 3H2ZA 3SLGA 2D8AA 1VSUA 3OJ0A 1WMAA 4Q39A 3NT4A 4A0SA 2AW5A 1YOVA 1EVIA 4CUZA 4JROA 4GLLA 1Y8RB 3C7DB 4R3WA 5TRTA 4PG8A 4G2NA 2E4AA 1ULSA 4KP7A 4WLVA 1I2CA 1DRUA 4DRYA 1CWUA 4B4WA 3L6EA 4YWJA 4HP8A 1Z74A 4CV2A 3KYBA 4E0BA 1DFGA 2FOIA 1WNTA 2QYTA 2NVUB 1UAYA 4ALJA 2X23A 4DREA 3LSYA 4TWRA 4CMIB 4F6CA 5I9LA 1K3TA 4J0FA 4WCFC 3H8VA 1P3DA 3GN1A 4RPKA 2NU9A 1R4MA 4LSMA 2BGLA 1NHGA 4HUJA 4N5MA 1U2DA 3DO5A 3E1KA 3PQFA 9LDBA 2R6JA 2C2YA 2UV8A 3MZ0A 5I8WA 3FNFA 4H15A 3LVFO 4IGEA 4Y6PA 3GH3A 1JLLA 2XXJA 1I32A 4YJHB 3PJDA 1W73A 2IE0A 3GEGA 3NX4A 4K6CA 4DYVA 3RUDA 3WWZA 1EVYA 3AFMA 1PGPA 5DCYA 4BKUA 1IUKA 1HL3A 5HS4A 4F46A 5DZSA 3DBLA 3F1LA 4M86A 5AQ1A 4IM7A 3FNHA 1CIVA 1EK5A 3DZIA 3K73O 4BL5A 2JCYA 2PH3A 1G0NA 3FWNA 3V1TC 1P0CA 3MOGA 1NNUA 1B8PA 1L1FA 2H1SA 2FHSA 5L40A 5F5LA 4QX6A 1YDEA 1KEPA 3GN2A 4FGSA 4P8RA 4BNXA 5IN4A 2JAHA 1XLTA 3EC7A 4NBUA 4J7UA 3JQDA 3WFIA 4HWKA 4XYEA 2I76A 1U3UA 1VE9A 1C3VA 4P4GA 4W6ZA 1YB4A 3IAHA 2JL1A 5EL0A 3UW3A 5KOIA 4BO7A 1V6AA 1MV8A 1MG5A 1Y8QB 3JQBA 3ETDA 3IOYA 1PZFA 1YL6A 5C3MA 6LDHA 5TLSA 4NJOA 2R00C 2GN8A 5GZ3A 1DO8A 4G65A 2J3IA 2NLOA 1E1LA 3ZWVA 2AEJA 2JD1A 4J16A 4KTTE 1R4NB 1VL8A 1HDYA 2EWMA 1Q7GA 2HMUA 4U6QA 5A3JA 4EI2A 3JQ9C 5JAZA 3CPSA 1P44A 3CZMA 3ZU4A 1R16A 3UVEA 4AJOA 4BKRA 4MP8A 4XDZA 3R0IA 4IDCA 3WB9A 2R2GA 4WEQA 4R1SA 1YJQA 3EGOA 3GVXA 3P5SA 4CM7A 1TT7A 3FNGA 3CH6A 4OXYA 2PA3A 4JNKA 2IRWA 4B4VA 3GPIA 4IDFA 1VI2A 2EXXA 4RL6A 3ZWXA 2NQTA 1HZZA 2OP0A 1DHRA 3UXYA 2QZZA 4L73A 4BVAA 3ZHYA 1CETA 4QXMA 4RVDA 3TDKA 4TKLA 1N8KA 4O5OA 4UUNA 4L9RA 1DLJA 3GF4A 5KCZA 5DN9A 3ADPA 1T25A 3AY6A 4NR0A 2WTBA 4CLOA 3E9QA 1AXGA 1O5IA 2FSVA 1UAGA 1CRWG 4KQXA 4RQTA 1UUFA 1GZ6A 4R68A 4E6PA 3RU7A 5I8ZA 3WSWA 1PJBA 2QG4A 3ROMA 4NBTA 5A9TA 5A4DA 4Z0TA 3PYLA 1DB3A 1GUFA 3M1AA 4JP3A 3RBXA 5IFLA 2P9EA 4BNZA 4BNJA 1F14A 3G49A 3E48A 3KYCA 4MIOA 4D79A 3ZI0A 1HXHA 4FIZA 4ZN6A 4JXKA 1Y9AA 2G82A 4ZICA 2C2XA 1WLYA 4FQ8A 4FFNA 1W4ZA 3DZJA 4E5KA 1DC6A 1SOWA 1E5LA 1YXMA 3DOJA 4A7PA 4RVHA 3TJRA 3WICA 3K5PA 2NUAA 1BVUA 3JD4A 3ONDA 1BDMA 4JLWA 4DMLA 3FTPA 1H9AA 3ST7A 1E3SA 1GY8A 3SXPA 1IPFA 4S3MA 2IYPA 1VSVA 1V3VA 4EUHA 1KEWA 1VC2A 4MKRA 5CEFA 2DUWA 2QX7A 3T7CA 2PK3A 2FR1A 4I8XA 2EKQA 2ZIZA 3BTOA 4OH1A 3DB2A 1QR6A 3QWBA 2HK8A 2OP1A 3KTDA 3T4EA 3I9OA 5I9MA 3DZKA 5CPFA 1ENPA 2CNBA 3QWFA 4MVJH 3JQBC 3DAGA 2CZCA 5JY1A 3I6QA 5DT9A 1PS0A 3JQAD 4WLFA 3TOXA 3GNSA 2YFQA 2I66A 5CEEA 3CZRA 4XGKA 2Z5LA 1F06A 1IB6A 5KVQA 1ISGA 3O8QB 1XWFA 3BTVA 2NTVA 1M66A 4NQZA 3G3EA 3WGHA 5I9NA 2FR0A 4PG7A 4IIVA 4MOWA 1K6IA 5BQFA 5JC8A 3ENKA 3I9MA 3OIGA 5F1KA 5T5QA 3GAZA 4BQRA 2EV9A 4O0LA 1UXGA 1ZMTA 1MX3A 1ISFA 4Y9DA 1J4AA 2Q1SA 1HRDA 3OM9A 1E3LA 1ZMOA 4RO0A 5LDGA 5BSFA 2GD1O 1IOLA 3P19A 1PEDA 1V3TA 1GUYA 2D0IA 4I9HA 5CG1A 3PJEA 1NR7A 4M1QA 2SCUA 1JWBB 4YBZA 4UVDA 3KSUA 4Q9NA 4Y98A 1IY8A 1QLJA 3WX0A 4GLOA 2PZJA 2P91A 4M55A 1CJCA 3PLNA 1W8DA 3VVCA 3OHSX 2Z1MA 3DBRA 2POQX 2FMUA 4J7CA 4YJGA 2EJWA 3SX2A 3MEQA 3OBBA 2C20A 4Y6SA 5KNLA 2X5JO 2PFGA 3GEDA 4E33A 2GNAA 3JD2A 1QORA 2Y67A 4ALKA 1PSDA 2XF8A 2G5CA 3I9NA 5JLAA 4CMHA 5JCJD 2PGJA 3FSRA 3HZZA 4Q3BA 1KIFA 1M67A 2VOEA 4ND1A 2OOSA 5F3RA 5EQDA 4YAGA 3ICCA 4FJ1A 1Y5MA 3M6IA 2RHCA 4Z6KA 5IDQA 2B83A 4G5HA 2CDBA 5BR7A 1A7KA 3LK7A 4QUKA 1DEHA 5EPOA 1PR3A 3S1LA 2GZ1A 3GG2A 4EBFA 1C1XA 3HB4X 3AM5A 4O6VA 1B7GO 2I9PA 3HDQA 3RIHA 1IHYA 2O2YA 1DRWA 4XRRA 4YAEA 3G1UA 5KWEA 4IJVA 2HMTA 3GR6A 4OSOA 2Y1DA 1GFSA 1YGYA 5I7FA 3VKUA 2O3UA 1ZK1A 1FDSA 1FXSA 1DHTA 2EF1A 3SC4A 3ZHXA 7MDHA 2BFOA 1H9BA 4E2WA 4HNHA 3V5NA 3HWRA 5EMHA 1UDBA 5KKAA 1ZSVA 5JDIA 1CERA 2PKRA 1GV0A 4LW8A 1P0FA 1LDBA 1IZ0A 1Z73A 5EIOA 4QO7A 5BNFA 2GR9A 5A03A 2VQ3A 3EVTA 4CM5A 4RPLA 4ZA2A 4IZIA 4KWIA 3D3WB 4IJWA 4FPXA 1PWZA 4R51A 3VHRA 3QHAA 1A9ZA 1H0KA 4WCFB 1OC2A 5JAQA 1U3VA 3T4XA 5TGDA 2W98A 2ZTMA 3VH3A 2W2LA 4GI2A 1ONOA 2PZMA 2X5KO 1YL5A 3H3JA 3BMQA 3MJSA 4GX1A 3OETA 1N9GB 3HFGA 3KXDA 1JQBA 4CL3A 3R3JA 2VHYA 1YQDA 2AEMA 5IDYA 3P2OA 4MPDA 1BVRA 1NAHA 1HWYA 5G0SA 1HKUA 4B7XA 1ML3A 3IDSA 3MCVA 2FN7A 3DQPA 4J91A 3B1JA 1NWHA 2C5EA 4K26A 2FY8A 4AJNA 4LVUA 1EFKA 1N1EA 3VH2A 2DT5A 2AXQA 3GPDG 4Z3DA 2VRCA 4D0SA 1KVUA 2Y99A 1KEVA 4XYGA 2EP5A 4FN4A 3Q9NA 5I7VA 2X6TA 5ENVA 3DHEA 5A9SA 3IJRA 3ORFA 5DBIA 4J6FA 3O38A 4XQ9A 4IDEA 3PYMA 4LCEA 3HB5X 4Z9FA 5ER6A 2P68A 3WTBA 1PQUA 5G4KB 3UGKA 3VPFA 2PZLA 1G1AA 1HZJA 1JW9B 1JDJA 1KS9A 4I9NA 4W9NA 1MLDA 1D3AA 3QVTA 4Y8VA 5F1PA 3ULKA 3FPCA 3DTYA 1DJNA 3EZYA 1Q0QA 3S8MA 1VLLA 2HLPA 2W2KA 3AY7A 3E9MA 3FN4A 3BHJA 3QSGA 2Q2WA 5DP2A 3NDIA 1M2WA 2PD4A 3OH8A 3D0OA 2WEKA 2HCTA 4L74A 1KBZA 1WZIA 1ISHA 4MVJE 3ENNA 5JW6A 4D0RA 4J9UE 1D4FA 5L7YA 4WASA 4E3ZA 4IQGA 1LSJA 2VYNA 1YOVB 2EW2A 2BGMA 4OYRA 1XGKA 3GY0A 1ZZEA 4OJNA 4PRLA 4E5MA 5JDIC 5L4LA 3BTUA 2OGUA 1SOVA 3GLQA 1EK6A 2GPTA 2ZATA 3ANMA 1M75A 3NT2A 3RQSA 3RBZA 2O23A 2VRBA 3QVSA 2DVMA 1W6UA 4OAQA 5B4TA 8ADHA 5GZ1A 1PGNA 1SAYA 4DBVO 2DAPA 1PZGA 3AUSA 2P5YA
chains in the Genus database with same CATH superfamily
4TXLA 1K7EB 1XZKA 1R9NA 2HC9A 2NADA 2DLDA 2J0EA 4UAGA 4Z0NA 3UWMA 4YCCA 2HW8A 2Q5JA 4K9DA 1CQZA 2Z2YA 1XJ5A 1ZD3A 2PRZA 1AK1A 1PWXA 1WDWB 4MGEA 1HOTA 5BMVF 5I48A 1Q91A 4ZHQF 4MR7B 1IJFA 1R4MB 4QJ3A 1G16A 1S3IA 3K9BA 2ZCVA 4HXYA 5M7EA 3T9AA 3O9MA 4EG7A 2EJVA 2WF5A 4C4ZA 3WGIA 3RLFA 2YV2A 2Z3WA 3WG9A 4EMSA 1T2CA 3GUVA 2QR5A 1R9MA 2WMNB 5ILOA 3MJCA 3G8AA 3PI6A 3DSRA 2JIZD 3PVSA 4V0SA 4YJFA 1JQ3A 5G0VA 4H4EA 5DHSA 3IMCA 4P2BA 3WWOA 2A5LA 2IOHA 1Z6ZA 1PJSA 4LMPA 1XZIA 3T5TA 3W5IA 1E8DA 1T6XA 4N3BA 4F6CA 1N5KA 2E1RA 2C3YA 2J9YB 4FQ7A 1Y5RA 4JX8A 5L3SA 1L5FA 1Y98A 4EEKA 5BT8A 1NLMA 2QE6A 3SGLA 2RG7A 3U39A 3V1YA 4EVSA 4LYGA 5DE3A 1D04A 1KNQA 5JS2A 4B4KA 1Z4IA 2GEJA 5BSMA 2BUBA 1DJLA 1EFRA 1YFJA 1OH5A 4Q3DA 2PKEA 3O82A 1EHYA 2EGUA 3D2LA 2XCRB 2MYTA 1XP8A 2XB4A 2C5LA 4DY4A 5EIBD 1KSJA 3M7IA 3ZGNA 3DZDA 4PRKA 4FX5A 1PJQA 3IT3A 4AZVA 1JXMA 2QGFA 5ETJA 4XUCA 3CT4A 2QLNA 3ZV5A 3HYLA 3OIYA 2WIGA 3H8WA 1S02A 1P45A 5CDFA 2I4TA 2OY0A 1FLDA 3PUHA 2MSCB 3ZHTA 3F4BA 1A72A 1AC5A 3N8NA 4UE2A 3BCHA 3CSUA 1KZ6A 1WUJS 4X1YB 4EJ6A 5EFOA 1LD3A 2I3DA 4FVTA 1VXRA 3HY4A 2OBMA 3UMCA 3LU1A 1RMTA 1VHLA 1BH6A 3PGVA 4X6LA 1YR3A 2FHPA 3EIXA 3BAZA 4UM7A 4NMWA 3DDUA 2C07A 5CB4F 3GG9A 3N39C 3PIDA 5BYBA 4RDXA 1QAQA 2DPXA 3JVEA 3RANA 1GQFA 2F17A 3CLRC 1M9NA 1SVIA 4RPCA 1ISIA 1CNEA 1SBTA 3CE6A 1FBNA 4QVKA 5LXTB 4P0QB 3BH7A 2VIIA 3R40A 3E82A 3X2EA 5K4GA 4WBNB 4B7ZA 2IEYA 3T9EA 1TW2A 2JJ1D 3BB3A 3QA9A 3L5OA 4AN0A 1ZMBA 1EUYA 3HR8A 2D0DA 3JATB 2L69A 3ABRB 3MSXA 4P34A 3RASA 4CCYB 4FMBB 3OICA 5CYPA 2YINC 2YJTD 4FSDA 5LQRA 1EFPB 4WUVA 2VQFB 1RWQA 1EBUA 4GPD1 2W6OA 1Y7HA 2EBHX 2V7EA 3HCAA 5I4CA 4OI0A 1NI5A 1A9QA 2DLNA 3MB5A 1E4EB 1VCIA 2ZIXA 2C3UA 3FDZA 2HJWA 4UQOA 4BO3A 2HKIA 4L3WA 4MQMA 1OASA 1NX9A 1OXVA 4UD2A 4DF3A 3WZLA 5JZ9A 4NJEB 3N2KB 4TVKA 2CXPA 1MQSA 3PWZA 4JVLA 3WDMA 1SKYB 3UQZA 1U0BB 1MO4A 1CRPA 3EXHA 1A95A 4IIHA 3ETNA 4K40A 1Z75A 2VA8A 5LJIA 4Z4EA 3ESXA 3A28A 4FMCF 1XRJA 3AZQA 5AI5A 5K3FB 4XR4A 3UK1A 4TX1A 1QRTA 1EXDA 1LBSA 2DFKB 2J9GA 3P20A 2QUAA 4PY2A 1A27A 1SN7A 3KJEA 4LE2A 5IHXA 2IY8A 2O3QA 4R5HA 3QJGA 3SHQA 2B36A 2A35A 1AOXA 3GW8A 1ZEJA 3P9QA 3OHMA 4EHBA 2C77A 1O94C 2R1UA 5AVYA 4HATA 1FFEA 2BMFA 1XA0A 3SYKA 4OEHA 1D03A 4R8LA 1O5OA 4ABTA 2YYAA 2WUVA 3QUTA 4QUDA 1Q6YA 1QZTA 3EH1A 4N5NA 4AZ3A 1ECCA 5EZYB 3UUEA 1FF9A 4HDSA 1K92A 2D3TA 1BXZA 3PCXA 1NSFA 1V16B 2ZBEA 3LE8A 1G3QA 5EZSA 2JAPA 1LK5A 1L5MA 5LNK1 1DIOB 4DCMA 3H17A 3ILXA 1Y7TA 3AVOA 2H54A 3H13A 4MEBA 1UJBA 4BYMA 1EM6A 2Q6KA 5E4TA 3I5YA 3K9QO 1KVSA 3KD3A 4WOPA 3VPBA 4DR6B 4K9RA 1T2FA 3FF4A 2I2FA 4GRIA 3D8UA 5IHPA 1UFRA 3UAWA 1OAAA 1O95A 4N0DA 2V4MA 3G9UA 3VI3B 3CEAA 4GKAA 2HPVA 1Y9DA 1MX9A 2HA7A 4FCVA 3OQNA 5IT5A 4RACA 2OLEA 1J23A 1VCMA 1GAXA 2OCXA 3AHJA 2ZTLA 4WCVA 4ZEVA 1QPZA 5IT0A 3S2IA 4B31A 4H60A 4ZGBA 1EGQA 4JT8A 1POXA 3DDHA 1RAHA 2P1RA 5JG7A 4ENTA 1NV9A 4GM1A 3TLJA 3Q7PA 4UM8B 1XQ6A 4QAQA 2A9FA 4X60A 1IH8A 1CUSA 3K7EA 3FZEA 3NIFB 1Y5LA 4ZOLA 5B3KA 5I7HA 2OB2A 3HN7A 3WLHA 2GBLA 3IIIA 5AQEA 2EF0A 4I55A 5JQGF 3QE3A 2TECE 3FD8A 3NBQA 2FUNB 4DTIA 3A3YA 1Z06A 2X2PA 1JQLB 2M6SA 2WFAA 4MKFA 5ALTA 1KOFA 2J5KA 2OQVA 1P2SA 2VQSA 2IBMA 2ZE6A 5ALMA 2O52A 3MWLA 1W5EA 4URZR 2ODQA 4KLZA 4TMYA 1RWNA 4KYVA 2X5OA 3VZCA 1ZVQA 4IH4A 3QUAA 3S2EA 5JU6A 1E7RA 4LXYA 1O08A 2GZDA 3C48A 3RU9A 3MS7A 1W93A 1LA2A 4PHGA 3ET4A 2GM9A 1I13A 3TNJA 2QQFA 2HA0A 3X1JA 3PNBA 1WXDA 4QM7A 1Z29A 1GGJA 3PIRA 4U3JA 4YRDA 1T9DA 5HKAA 1QIEA 1U7DA 1W4BA 5MFPA 1KYQA 2QVZX 3JQPA 2FP4A 2GBPA 4ZRNA 1YJBA 1X1CA 3EGXA 4A73A 4YT8A 1Q16A 3E7PA 1FNSA 1YCHA 2XUGA 1DX6A 2GLXA 4QDTA 1DQYA 1FZQA 2IXAA 2OZPA 4CKWB 3NWPA 3BGOS 1E58A 1CF9A 2PVCA 3NS7A 2XQVA 1XSEA 2GN9A 3WY9A 2XMQA 2OL4A 4G0QA 5BYJA 3L41A 5H3LA 4BLTA 3GLHA 2YMLA 3N0WA 2CK3D 4WDRA 2I65A 1XKLA 4OFZA 1P4HA 2AXPA 1E2IA 4G1EB 4CCSA 1MNAA 1JRLA 1QHEA 4L0MA 1A8PA 3Q1LA 2YVQA 5I7SA 1TEZA 5JI3E 3NOQA 2RI1A 2ZUCA 2KB0A 4DMUB 1P8AA 1ZLXA 3O8BA 3RVOA 4R2HA 3FYUC 4HXFB 2GX6A 2I4IA 2W2TA 1SO8A 2BBSA 2BM1A 1RXYA 4JOCA 5BR4A 5DOVA 1XYGA 1TJ3A 2BHLA 1X0VA 3QE4A 1JKIA 3LW8A 1KP2A 1DG1G 5EE5B 5K20A 2VPXA 1USKA 1CUGA 1X6VA 1V43A 2WA1A 2X8BA 2ZE5A 3GZ4A 3WL7A 5GJWC 1M2JA 1JAIA 2QRVB 4MV7A 4E94A 2E37A 4GP7A 4PYNA 5DXAA 4G01B 3F98A 3HVRA 1YF3A 4QASA 4XSVA 2ADMA 1XVTA 2JFWA 1MNQA 4JX9A 4B8YA 4QHSA 2CMDA 1DT3A 2AA3A 3LUCA 3TRJA 5ECWA 2J4DA 2HSWA 1GFWA 4NIMA 1ZCAA 1DLIA 3F5FA 2VP5A 2P2CA 2ZB2A 5FCDA 4C08A 4KO1S 2QUIA 1C1XB 3HBNA 4K05A 1BAPA 1JSXA 4ALIA 1G5HA 5KWIA 2ZYHA 1BW9A 3CINA 3GOHA 1EDDA 3M8KA 3OI7A 4C2AA 4C0WA 5LZ2A 4PN3A 3HCEA 2C5FA 4UHHA 2Q4TA 3CR7A 4NYIR 4R05A 1U5BB 4AJEA 5KOJA 4C7MA 1FS5A 3MJ4A 2GD0A 3DE0X 4PLGA 5AK3A 2XSZA 5JALA 1UXJA 3UV6A 3VR5D 4E21A 1RAGA 1GGNA 1N6HA 3TR5A 4KPYA 2DP4E 1V5GA 4PCLA 4UDOA 2KM1A 2Q2VA 2GZRA 2YJ5A 4J0CA 5E4JA 4G86A 2BFDB 5EN4A 4Z8YA 2FEWB 3Q9SA 4F3RA 4WFIA 2GM5A 2ZU0C 1GADO 3H9CA 3WGQA 5KYGA 1SC6A 1GQOA 2CYAA 3AY0A 4KCGA 4MQ4A 5LQCA 3QVOA 1KY5A 2GJSA 3C8ZA 3PDCA 4JMPA 2PMEA 1IBKB 3ZY5A 3L6RA 3GNTA 5IT4A 2VBFA 5D00A 3SIPA 1TYAE 2ZWOA 3V4ZA 1F0PA 3OCVA 3S2UA 3WHPA 1WHTB 2W37A 3WGTA 4BZXA 3BF7A 5BWLA 4RY0A 3UMYA 3NCHA 4PW0A 3RTDA 4C0LA 4NBKA 1EK1A 1L7EA 4RZ3A 2FWRA 4DIFA 1MR3F 2ZBGA 3QIAA 4B4OA 1UCFA 3OLZA 4R84A 3RTEA 4AY5A 1PLJA 4CLRA 4ZVVA 3ZHUA 2DBVO 3PFHA 3ZXXA 2WUDA 3UICA 1VIYA 1A5TA 3DMTA 1RI1A 4ZJYA 4CT0A 1K75A 5LDDC 4U7DA 2BR3A 1D5WA 4TLLB 1GTMA 1HDEA 2YZKA 4OK6A 4UCFA 4F38A 4V0LA 1GZDA 2GASA 3RC1A 4EQZA 1K2WA 1WCIB 7REQB 4ZO6A 1I9CA 4OQQA 4M0MA 2VBGA 2WJHA 5DRYA 1CY1A 2G83A 2G9VA 3VOBA 4BNHA 2HIHA 2BJVA 3TS1A 2JAUA 4PHHA 1EPUA 4F12A 3ZE9A 2PFKA 2ZRLA 3DWFA 3O94A 1AQ6A 2A1UA 1FW6A 3SC6A 5B5SA 3E7FA 1SVSA 2A5YB 4XZ3A 4ZZ1A 3N75A 2AZ4A 4PZ9A 1P77A 3FM9A 1NQOA 2REXB 2ZCUA 4R01A 2JLAA 3AI7A 1M3SA 4LYYA 4YNBA 5KNBA 2O05A 3BJEA 4A8JC 3IUQA 4NABA 4OQLA 3UCFA 5LMUB 2V0GA 2V6IA 2W2PA 4FT4A 1TCCA 1RWBA 1JIUA 1U9JA 2DULA 1PI3A 3BGDA 4NNJA 2Y2UA 4CG0A 1J21A 3NVAA 4OGLA 4PZ0A 2PX5A 1XZAA 2OT3B 2Q9UA 2PSDA 1Y4AE 4XPIB 3B6EA 3RYCB 1NN1A 4RM3A 2HBZA 1MZPA 1IRIA 1XNRB 1ICEA 1VTKA 4ATNA 1HNXB 5ECGC 2QZJA 2F8MA 4Y9RA 4KXVA 2OBXA 4FU0A 4H35A 1PK8A 2OCDA 5T6BA 3REQB 3A37A 2PX4A 4RVGA 3WLKX 2DF8A 2CLDX 3Q41A 5IEBA 1Q7TA 2DBZA 2VRNA 4UEWA 3LYAA 4P84A 4EHKA 3WQQA 1ZLYA 4J6EA 4CQMB 5J63A 3DEAA 5KOHB 1NR5A 4QUHA 4IXMA 3NGXA 4COKA 2WIKA 2NVUA 2I62A 4RC9A 4HRAA 3LOPA 4MWZA 4R6WA 3TSCA 4AG5A 4RJTA 2H1LA 3VNVA 3ZV4A 1R8XA 2XE7A 2HMYB 4RY8A 1D6JA 4JJZA 4KXNA 1NVVQ 3ZNQA 3NHMA 3HO8A 4EPWA 3MD9A 4GLJA 3MJDA 4HUQB 4B6JA 2R8PA 3LT5A 2PWPA 1GA1A 3G2KA 1OV6A 4MSUA 4YRGA 3OTOB 3S2SA 2W6QA 4Y2XA 4B40A 4RD3A 4QWMA 1CHNA 2W0MA 2FSVC 1YRQA 1ODLA 1RAIA 4JIMA 3RJ5A 3ICQB 2V96A 3AF3A 3PRKE 2P9FA 1Z7YA 1W36C 3ZQ4A 3OEED 4QGHA 3EG9B 5CHEA 4YR7A 1RPTA 2ZJ2A 4M46A 4AZSA 4C22A 5IEJA 1QIMA 4G4SO 4ER7A 1TK3A 1DELA 3TJZA 3D6TB 3FTCA 2QB5A 2BFEA 1I3OA 1R10A 1AG9A 1IBRA 4GSYA 1RP7A 2ZJAA 5DM1A 4PG5A 1UXIA 3PC7A 1HO3A 2W6MA 3UXEA 1YTLA 4OGGA 4DMRA 2G80A 2WOJA 4PC1A 3G0CA 4X54A 3M1LA 1JHVA 1AY0A 3R0ZA 4D96A 121PA 3K2EA 5B1HA 1SCUA 4DLXA 4BE4A 1IN5A 3BTSA 3GNQA 3KFVA 5JSKA 3V2GA 4DJTA 3UCXA 4HJXA 1E1QD 2WDPA 1TQDA 5TE9A 2P6RA 2OPHA 2NZ8A 2AQIA 2VN8A 4HVAA 5J9FA 3UPDA 2RC6A 2BI7A 4QFDA 5AI6A 1O77A 3NKVA 4R5MA 3GYGA 2BFCA 4YJFB 6YASA 1KRWA 3HUDA 2HLNA 2QM0A 3OBIA 3KS9A 1OLSA 2ZI4A 5JE8A 5BUZA 3CXRA 1QTNA 1UP7A 5D7NA 1P0IA 2JI9A 2W2QA 5BQOA 3I61A 4BMNA 2Y93A 1LI5A 4QNMA 2PZKA 5LP6F 4MPTA 5L3SB 3KZKA 1YZGA 4D9JA 3U56A 1Y8QA 4IFIA 16PKA 1AKMA 1YZFA 3EODA 2EERA 3JVVA 1FK8A 1GUDA 4MCJA 2W4MA 4TYWA 4D9EA 1E1RD 1RRGA 1CVRA 2VHEA 3G85A 1AHHA 4HAXA 3TECE 2FZEA 4CUJA 4V0KA 1ZU4A 1S2GA 3QWHA 2IEIA 2V7VA 2OFPA 3TLXA 2GRUA 5L4NA 1UZNA 1XJCA 2GXSA 1H23A 1XB2A 2V5AA 3HLYA 3AU8A 3MXOA 3PUXA 3C3XA 3EQ9A 1TMKA 4GPTA 2OA0A 1OTXA 1NVEA 4G5YA 1YVPA 3W5JA 1DL5A 1TA4A 1M7HA 1VA5A 1IHXA 4DANA 2C7QA 5I7AA 5EJGA 3AVPA 5FH9A 5FFMA 5EMNA 2QLBA 4DC1A 4M1YA 4CMAA 2YC4C 3I42A 2HAEA 1SK8A 3K0HA 4XH9B 5JNSA 1FRFS 3H9UA 4KXMA 4UU7A 2HPHA 2O0MA 3BUSA 3KXKA 3R7LA 5C34B 2X5XA 5DWQA 2F48A 3PQ7A 2WYVA 1VIAA 4YPVA 3IMKA 4CR7A 4IJKA 4RXUA 5IC5A 3BT7A 1O87A 4ZFNA 3H4TA 3HTXA 1GNPA 1QB7A 1QZUA 1AE1A 4H7JA 4CM4A 2ZYDA 1E3JA 1Q1BA 3WISA 1RPAA 4Y1GA 1XELA 3QLTA 4CIDA 3KSDO 4R83A 3K96A 1G2IA 1C9JA 3IPCA 4FYVA 4L4YA 3IEIA 3TBKA 3TNFA 4NDNE 3HYTA 4X24A 4TMWA 3RSZA 3UOGA 1KDYA 2VDKB 3MFYA 3PEYA 2I6UA 3E2IA 3T7IA 4BE7B 1Z39A 2REOA 1Y1LA 4EEZA 1AK2A 4DLTA 1S6YA 4PFSA 2QVBA 4IDOA 4O59O 3FUUA 4EI7A 4CF7A 3KXIA 4MYHA 1CZKA 2GDJA 2GERA 4E4TA 1EEHA 4LI0A 3K0AA 3IELA 4LOLA 4B35A 4F3YA 2OB1A 4H6XA 2ZIXB 3FDZB 2I55A 4F93B 2ZIGA 5KC9A 3BCRA 1P29A 1DAIA 1GZ3A 1OAOA 3EARA 1GP2A 3CZ4A 4G0VA 1SM4A 1LW6E 1MB3A 3F67A 1KVRA 1VBMA 3G8CA 3OF2A 4J1QA 4KLCA 4MKHA 4DT1A 1NQ5A 1RQLA 4MJ7A 1N5OX 3O4RA 4YY3B 1JDNA 3EXHB 2ZUUA 1HPLA 2GAIA 2A9RA 2PXAA 3GFFA 4ND5A 4TXJA 3ZU5A 1JAZA 1S4MA 2DPGA 3C7CB 4D4JA 1A9XA 1A4UA 3ZIAA 4J43A 5J5CA 1E9CA 2VHZA 4B82A 3TE7A 4DR3B 2BEVA 4I3HA 2CEAA 2Z2KA 3OCYA 4JITA 4DCUA 1DC7A 4F3NA 3K9LA 4O2BA 1L1EA 4E4RA 1ILEA 5CBKA 2UYCA 3NASA 3QEAZ 3DHVA 3I76A 1OZHA 2QX8A 1UK9A 4RMNA 3CRRA 3D6NB 2CJXA 5FXMA 2YN4A 3DWEX 3SIRA 4R1LA 3L4SO 3U48A 1QFXA 1K6XA 2VP6A 1H9CA 2PL5A 3MOIA 2R62A 1U8CB 3H9QA 5CVJA 5CVEA 4AZ3B 1XFAA 4Y2PA 4MEAA 1N0HA 4JGGA 4MULA 4HDSB 5CDHA 3K70B 4J07A 3D4NA 4ONEA 3OAAD 2ZRJA 4NG5A 1PGQA 4M8SA 4YJ2F 3T8YA 4QRDA 1R0BA 1Y3AA 4UBMA 5EXEA 3S3TA 1L7AA 1UODA 5JYCA 2PUAA 5KTOA 5FA8A 5GQSA 2PU5A 1O58A 3TQOA 3IT2A 4L07A 4EKDA 5DH9A 4FFBA 1V71A 2OZLB 3NUQA 4GPBA 4UCWA 2GCOB 1VGQA 1CUIA 2R11A 1GJRA 2WSLA 3A7DA 3EDCA 3M5PA 5JFTA 3EVGA 1QG2A 1T0IA 2PKXA 4AWBA 4G56A 3GRUA 4D74A 4RWEA 5J1SB 2W9XA 4DAEA 2WDZA 4FWTA 4MHTA 4MS1A 2QZSA 1G41A 1JHQA 3G7SA 5K3DA 1N2XA 3EHEA 4M0DA 4TYQA 2YWGA 4B7AA 3EXG1 3O03A 2PT7A 3GH1A 4JWKA 4U2FA 5JSFA 3WQHA 3K6KA 2PH5A 1HEUA 4GBGA 3PE4A 5KTYA 3A6DA 2HEGA 3KQHA 4OX9B 2D2XA 3IH5A 3KOWA 2JGIA 1UDWA 4KSCA 2H2GA 4OMUA 2YICA 1JH8A 2BBOA 1SWVA 1U81A 2PZ8A 3VTFA 4ZOLB 3OPVA 1QV6A 5CFMA 1T1RA 3FSEA 3TM4A 5DNUA 4EUKA 3FDFA 4E13A 4NXMB 1GVHA 3OURA 1NZFA 2CNOA 2R86A 3OZGA 2OXIA 4E6PA 3CKKA 2MR6A 2VYQA 2EZ9A 3I1YA 1S3FA 4MWOA 2C4VA 5DOZA 4E5UA 3BK1A 1FDVA 4LJAA 5IS2A 4RK5A 1GG9A 2NO5A 3VR0A 3ZDFA 4D82A 1K8QA 2HRCA 4N0QA 1F9AA 2FLWA 3VKVA 4BDTA 1IB0A 1B14A 1HEIA 1KJ8A 3EG5A 2BHTA 4HY3A 2XOEA 3N8KA 1HNZB 4A1FA 4AW9A 3I34X 4P80A 2FSPA 2UZ3A 4PX9A 1KI4A 5DVZA 1AGNA 3EIUA 1S2DA 3GEBA 3W05A 3IB6A 3P9NA 4AICA 3IKTA 4L4SA 3RHFA 4RTNA 3C3EA 2G25A 1GM5A 4U3JB 4KO8A 3E23A 2IYSA 5I7EA 5KTNA 2QZ9A 1L2TA 1CZHA 5IZ4A 1G9TA 2H2HA 3U0VA 4E5NA 3CNEA 4ZQHA 2XA1A 3HUFA 4C6HA 1UKYA 2W11A 3EGXB 3OZWA 5EKDA 3TG2A 5DPMA 2H52A 2TYSB 1XXHA 2VHQA 3HGMA 1NUUA 3EWSA 5HRCA 4MPJA 5JRJA 2TSYB 3UJPA 5JXWA 2B1RA 2VDUE 4HNQA 1TMYA 5KI6A 3LFHA 4B3IA 4Q05A 3MGAA 4FKZA 2PY6A 2PGLA 3NEJA 3ZQUA 2PCLA 3CZ9A 3GLHB 1FNDA 3T34A 4DBLC 4AMGA 1ZJWA 3RD5A 2MYPA 1C0EA 3WGVA 2R6R1 2Y77A 4MIYA 3K1YA 1GL6A 1FU4A 2KX7A 2BN4A 2O6LA 1R15A 1UP4A 3EMVA 2C04A 4HGZA 1P61B 2GD2A 4ERXA 4FZ3A 7ADHA 5IWCA 4DPMA 5K6TA 3C6BA 2L0XA 4JA2A 1F2TA 2DUMA 1A4RA 2VK1A 2J0QA 3B1FA 2I3AA 1LV8A 4LRWA 3PGLA 4WXYB 3EA0A 4TTQA 3HCBA 5IM5A 4LOAA 5I9BA 3PR1A 1NJSA 1E9DA 3GVHA 4HX5A 4MI6A 5JDCC 2EJCA 4F4DA 3STTA 1MJHA 1Q44A 2ZR9A 4LXTA 1TM2A 2BCGY 2JFHA 4GI5A 4KMSA 3LP6A 1KEKA 2WPNA 3VU8A 1MXHA 1I2MA 4L95C 1PD1A 2ZTVA 4MVJP 2W42A 2IZ1A 4N8SA 1B0UA 3V9AA 1UWCA 2I4NA 2NV6A 2V7WA 2EJUA 2GK4A 2XZTA 3GVCA 2XVXA 2DTDA 1PYGA 3T38A 5ECDA 4YYEA 4M1MA 2VDJA 3T4UA 4BE9A 1AKQA 3M4YA 3NBXX 4CKBA 1A7JA 2Z6AA 2ZS7A 4OHCA 1BW9B 2DX7A 3IXQA 2WR8A 4Q4JA 5EP3A 5J23A 5I6DA 4YRLA 4W9MC 3N1UA 3OQOA 3PGMA 1MOPA 5DX1A 2ZG6A 1NTRA 2ILVA 4WBXC 4RKYA 4WCFA 4Q3AA 5EI5A 3X1MA 4JBWA 1B16A 1GRVA 2VJMB 4OB6A 2IHTA 4XUGB 3DAOA 5INTA 2GYYA 4P6VF 4XCXA 3M82A 3PUVA 1AGYA 4PYKA 4DWVA 1KHTA 1VJGA 2Q5OA 4PBSA 2BFFA 3GLFE 2YY5A 4P7KA 5MDHA 1JQAA 3R7BA 4DMGA 3U3JA 3O1JC 5K9ZA 4LJYA 2OD7A 4IVNA 5EVCA 2DHEA 4HAVA 5HZGA 2HHHB 1SC3A 2ACWA 2FN9A 1HRKA 2HO4A 1YA8A 2TMKA 1TZCA 3FCOA 3IHWA 5HF6A 5BSRA 1OB5A 1QYCA 1TTHA 1X39A 1TU0A 3HYCA 3KOOA 3NEPX 2G1UA 3EMBA 1UXKA 2P2SA 3W2IA 5JD4A 3A1NA 1MH1A 1POWA 2WI8A 3HQ4O 3HH8A 3KYCB 1UM9A 3NHKA 4GI1A 4CKYA 1XUOA 4ZIRA 4DQLA 4QATA 3TZEA 5I3ZA 3BF8A 4ZJUA 1C5KA 1G20E 1H5NA 1ZK4A 3LTEA 3L7BA 2GXUA 5FFNA 3L0ZA 1K4YA 3BMCA 4MI1A 4KITB 5HUHA 4UM9B 3L7NA 2Y27A 5B7NA 3GRCA 4CLRB 3B7PA 4P3KA 1R74A 1VLZA 5CH5A 3F5QA 1AMNA 1YMQA 1ZD2P 2I78A 3GCZA 4L28A 4NK4A 1KAMA 1PJCA 1ST2A 5TPZD 3T06B 2Y1OA 3AI1A 2UYOA 4FHFA 1S8AA 4ZYWA 4HGNA 2EOAA 3RO7A 2RH9B 2VNAA 5ULLA 2JF0A 4RGVA 4NZYA 2Y0PA 2XECA 2NACA 3A1WA 1SC1A 1FPQA 1DZIA 2V6GA 2VZEA 3LPDA 4KGVA 1VPDA 5CA0F 4P58A 3VO1A 3VZRA 3DTTA 1EE1A 3BQ9A 4TQGA 2F1IA 2CSUA 2ONJA 3A36A 3DYBA 3X1WA 3ECCA 4D42A 1V5IA 2A1UB 4NEHB 2EIHA 4OPMA 2PUEA 2EZTA 1JMKC 3SDZA 2A58A 2FGJA 1JLSA 4MDHA 2VDLB 3TFWA 4ZANA 1T4CB 5AOBA 1ADGA 4QTYA 4NV0A 5A0TA 2FRXA 3L07A 3ZWKA 4MIKA 1EKXA 2GKSA 5HILA 2IHNA 4OCZA 1ZQ9A 4TUYF 4QO8A 3I52A 2CCKA 2CUTA 1O94D 1K6JA 5FUWA 3TLYA 2AN9A 2Y9PB 1YR2A 3S2YA 2ZJ6A 4BNUA 3AYZB 4P38A 4ZEMA 1H2FA 3RAEC 1UEIA 1C8LA 1R66A 2ZI6A 3ETEA 1MC1A 4NBVA 2YXDA 5AK6A 4ZAXA 3ZWAA 4D46A 1TKAA 2X0EA 3UFXA 1SXPA 2W2NA 4TMTA 3RSLA 1KK1A 4IWYA 4OKSA 3VOTA 3AVQA 4MW5A 5KJFA 5M04A 2I9KA 4PYLA 5JXHA 3G5AA 2A0FA 3TNLA 2C97A 3MMSA 2V6JA 5AWFC 4TYNA 5EWMB 4C4SA 3RC8A 4MKZA 2GPNA 2ISCA 4TTRA 3WZ2A 3HWSA 1IXKA 1W5SA 4B9EA 3H6GA 3SY8A 3ACBA 4QREA 1AN0A 3LCRA 2BTOA 4N7BA 1YVUA 4M1WA 2CMGA 2VLIA 2WVAA 4EENA 3CX7A 3V7YA 4RVCA 4PPNA 4C4YA 1T0PA 3N6RA 9GPBA 2FSHA 2ZDQA 4KJXA 3LF2A 1MRZA 4ZJZA 3SNKA 3VQTA 2YDXA 4JKYA 2YXPX 3BOSA 3OF5A 3SOPA 4UHBA 1RM0A 1SY7A 5DW0A 3PI7A 4A15A 1TFRA 3BA6A 3ZDZB 3A6PC 1H3FA 3AONB 5AM0A 2Q1WA 1FNCA 5AHWA 2F1RA 3Q2KA 1KR5A 1ODTC 4Y1FA 5AW9A 3GRYA 1Z8NA 3A1FA 3VUEA 1V8ZA 4EHNA 3JARB 3PA8A 1BKSB 1NX6A 1SIUA 3AEQA 1A9PA 3BXEA 3L7LA 2Q5IA 4QXQA 5L3ZA 3IURA 2XYQA 3NTQA 3KJQA 2QENA 2G9NA 4DC0A 2V58A 1Z2AA 2QAIA 3IS3A 1I6LA 2BC9A 2QOEA 3TXXA 3ZCPA 1OJLA 1QH1A 1AQLA 1M76A 1QJ4A 4MUBA 5CFQA 5KNCA 1XEAA 3OFND 1WX1A 2NV0A 3TZCA 1E4OA 4DW8A 3LBHA 3UJNA 4I99A 2NO9A 1HI9A 3FGOA 1WB6A 4PGHA 5CTJA 4K9KA 1SCUB 3QA3E 1XVLA 2YV1A 1KR2A 2G4LA 1YQXA 3MMNA 2OQIA 4QIHA 1QGAA 4QLBA 3R7SA 1GU7A 3CO5A 3H0KA 3OU6A 1Q7RA 4CWAA 2W2XA 4KQHA 2ZPUA 3HP7A 4EUFA 4Q1VA 2BFCB 2WYWA 4YMSA 3OOWA 4EBBA 1AF4A 3D3EA 5C46F 3PFCA 1OLSB 4JCCA 5HVNA 4GLFA 3I30X 1U9YA 4DNOA 2RDMA 5JMTA 1EE2A 3NHJA 1CQWA 1JE0A 3KJGA 1P1HA 1IU9A 2MSWA 4GRAA 4KN5A 4UU1A 3KKMA 3AILA 4UUQA 2BEUB 4H1HA 5DYYA 3T3DA 3UO8B 2VQ6A 1YS6A 1KZYC 1DC4A 1BSVA 4KFUA 5E3HA 2Q9AA 4D8YA 2JGJA 3PA6A 1CU1A 1US8A 3A58B 5B58C 2B20A 1LTQA 2GK7A 3E9RA 5IASA 4KI0A 1RRCA 1L6RA 1GZHB 3QRWA 3DNPA 2GVZC 3R3YA 1T35A 3IP1A 1XTRA 4ZK6A 1NYTA 5AM1A 3H04A 1P31A 4PC7A 4UFPA 1S4QA 3K20A 2A1TR 4FZ5A 4L51A 4Y2UA 4BO0A 3SHTA 4QC2A 4BV8A 3L1JA 4YC7A 1BOOA 3N2IA 1OREA 4GXNA 2UU9B 3GC6A 3LP5A 1PHRA 3TLAA 4BATA 2NAFA 2HWYA 3FGNA 5ERXA 4XUEA 5IDXA 4NP6A 1SELA 4EJSA 5A4IS 4XWKA 1DTWA 3HXOA 3D3KA 4DIEA 5CK5A 1AUQA 4RKEA 4ZI2A 2CHGA 1PJ2A 1B2LA 2B37A 4WOCA 4AO7A 2DR0A 1HK7A 2HK7A 1Q7EA 1JI3A 1ORVA 2AFHE 2G0AA 1OWOA 2AI1A 3B1WA 4PBTA 1O7JA 5KJEA 3SJUA 3UK6A 4EY6A 5CYGA 1U6JA 5FOXA 4GU5A 4N8EA 5JCJA 3S5UA 2ZRFA 4QDKA 5HE8A 2HDHA 5CVCA 4OB8A 4ACBA 1RYYA 4E31A 2KE5A 1XD9A 1ZA2A 3SKYA 1CUUA 4CM4B 3UMMA 1BFKA 3G5TA 2IDMA 4PLWA 1J2RA 1G8YA 3F2VA 1I7PA 4TKVA 2X8JA 1H69A 1TQ2A 5ALJA 1R6TA 5AVSA 3GFSA 3K32A 1CQPA 1OVGA 4NYIQ 1QUEA 4S1WA 2VDQB 3TCXB 4A03A 3DNMA 1Z6XA 2FA9A 2ZAIA 1JEEA 1ZBQA 3AV3A 2DFLA 3EXEA 3L0PA 4NBSA 4QAJA 3FMVA 1GDHA 3FI9A 2ADOA 1ADJA 1KC3A 1NRJB 2I1VB 2XE8A 1JVNA 3OEHD 3PYXA 3P45A 3BILA 3Q9UA 2P0EA 1JFSA 3PNMA 4EG0A 2QL5A 3GROA 3PZBA 2C5SA 2PS3A 4ITVA 4G36A 2JFNA 3K0AB 1R1DA 2PNJA 1PDVA 3BHNA 1OKKD 3LJKA 2C94A 4HG2A 1RI5A 3RUPA 3OCWA 2FPPA 2CMFA 4D5EA 4JN6B 1VL6A 4RPJA 1D2CA 5JASA 1II0A 4IF4A 4N5DA 4R1PA 2CD7A 2KMLA 2C96A 3JWIA 3MA0A 3L8YA 3EAGA 5DGCA 1LU9A 1PTKA 1YDFA 2RGGA 2PUFA 2HMWA 4YACA 3ERCA 1RCUA 3QH4A 2CNWA 4OLAA 2ZFUA 1A9XB 3A3PA 3AM1A 4C3OB 5ILGA 1SVUA 3WFJA 3JVDA 5JWOA 4L57A 5GP1A 1VMAA 5HCNA 4F7DA 4EK9A 4H17A 3R75A 3BSWA 4F1JA 4IY1A 4JLAA 4LMBA 4O2BB 4L08A 1T5BA 3DL2A 3BQNB 4AJJA 2D1YA 2OCKA 2IHKA 2WINI 4ZI7A 1Y8RA 4D4MA 4MWGA 3R3SA 2HMVA 1IPEA 2YYYA 1QTRA 3TM5A 4EVIA 5K8IA 2G04A 3I01A 4N7RA 5KIAA 1X8KA 3COZA 1FFWA 3S81A 2HRZA 2XVAA 3OWXA 4X7RA 2EQ5A 3SXUA 4ESVA 1A96A 1NBAA 5T41A 3VBEA 4XXHA 4ER3A 2V7PA 2J07A 1TJ4A 3KUDA 4K03A 3FGZA 1Z7EA 4Y3UA 2P4HX 1SXJC 4W1RA 2WRZA 2C0PA 4TPKA 2PRSA 3FHTA 2P9YA 2ECFA 4JQZA 3HHEA 4DQKA 3M2TA 4FFBB 4HNAA 2NN3C 4I50A 1JDSA 3S1SA 4IS3A 3WLQA 4U5QA 4P7FA 1JVSA 1GCOA 2O2SA 1Z4NA 2FRDC 3OCUA 1T2DA 1EFHA 2J85A 3C3AA 4V0MA 4HH1A 2IPLA 3H4IA 3TE6A 2QG9A 3VR3D 4YMHA 2BRUC 2HLDD 4MS1B 2DOKA 4YJHA 1F8GA 2P5SA 3N53A 5FBWB 3ZR4B 4D25A 5HR5A 2EFDB 2VHUA 1K8XB 2MIIA 1PG5A 1IMOA 1KYYA 3PVCA 3ZN2A 4DMKA 2WU8A 4JUDX 5LSAA 2VJQA 1ORHA 3BS4A 4G4JA 3MJEA 1D07A 2NU6A 1KAEA 3P9XA 3IVXA 3QG1A 5JHGB 1JG1A 4QBTA 2XQFA 1P91A 2QLLA 1PUIA 2YFHA 1VHDA 4ILEA 3A9RA 3DO8A 3LG2A 4Z9YA 4RPIA 1M8KA 5CCDA 2W8ZA 3FOZA 5L51A 3OZIA 1PT5A 2HHAA 4B3DA 3O3CA 4FJ2A 4G41A 5EGSA 1KYTA 3FPBA 3FSGD 4IDAA 1G8AA 5C4GB 4YAOA 1G0OA 3QKWA 1TEHA 1JQKA 5KQGA 2RH4A 1ZH0A 2I4MA 5J5AA 2UVDA 2B1JA 4ZPXA 2C29D 1K2VN 1EWQA 3DMTC 2BKUA 1NDUA 4MYDA 2XMBA 5AK5A 2B78A 3SIXA 1GNSA 1QK3A 3HMQA 5B58T 4FI3F 5HMMA 4KQWA 4LI3X 4Y2RA 2K6GA 2ZIWB 3RCBA 3CA8A 4CE6A 4R31A 4ZZIA 2XADA 2YQZA 2AXNA 2PIDA 1SKMA 1U2EA 1EDZA 1M74A 3OECA 1A2QA 4FKBA 4L8YA 3UAZA 5CURA 2A59A 4I1UA 3T7RA 4C3VA 4WFJA 2FZVA 2MDTA 2GTPA 5TT1A 1JI0A 1NASA 2EARA 1UPCA 1XXHB 4UQLA 1MV5A 3A4VA 5JD5A 4FYJA 5DXFA 4CV3A 1QRUA 4B8WA 3VPDA 3B1KA 1C9MA 5AXBA 1ODCA 1MHPA 3FNIA 3VR4H 1R4NA 4WKGA 3BRCA 3ANNA 5P21A 1N6IA 3JYNA 4QXRA 4ZVNA 4M0CA 3LBFA 4AKTA 5JCXA 3S8EA 1S2LA 1W25A 2B5WA 3Q7RA 2LZ0A 4PLZA 1I30A 1VKRA 5I7RA 1OXSC 1X9GA 1YS2X 1BWPA 1XZQA 4BQQA 2I1QA 4B2IA 3JVIA 3MBKA 3RBAA 1SHJA 4QYMA 4JOSA 3D4OA 4HPJB 4M8KA 5ED0A 4DLPA 5ADWA 1H4SA 2C4HA 1XCGB 4OFBA 1E8MA 4MV1A 1U28A 4Z9BA 1F2TB 4JI1B 1W5TA 2ZLBA 3ND8A 1AZSC 2N1BA 4IINA 4EECA 1WCWA 4PCVA 1FXWA 2FPIA 4PC6A 3KWLA 1Z5WA 4YRCA 1K4MA 1OTHA 1NJ1A 3DGEC 5C8YA 4YRKA 4HAYA 3BK2A 1RI3A 3BPSA 3KRTA 4MB6A 1VA4A 3RRXA 3H5OA 1JPVA 1M2VA 2QI9F 4CLDA 3WGLA 3UKJA 3IP7A 1ZIOA 1NRXA 5EGNA 2E1PA 1ABFA 1NLUA 3K0KA 5EYPA 1RACA 1VG0B 3TW0A 2BI8A 2NNWB 5B53A 1ELOA 1Q7BA 2YMQA 1R50A 1ZRHA 4L5IA 3TLCA 1TF5A 2X9NA 4EAAA 5SYNA 3F8SA 3QX9A 1IMJA 4CKBB 1ZICA 3LWNA 4Y1EA 1TZKA 1FYEA 4Q4JB 2ZYGA 4UKDA 5DT2A 5KKNB 5J43A 2J3JA 3PXGA 2Q49A 1C9DB 5KYXA 1U80A 4M0FA 5E9JA 3TRDA 4H3HB 1A04A 2VH2A 2WAYA 3QU7A 2ATIA 4YO7A 5AUQA 3FFXA 1U2QA 2WZDA 3OZBA 4GHWA 5CLJA 4MW1A 2CDCA 4IR7A 1F8XA 3LX6A 4K46A 2PX2A 1FFCA 3F0TA 3LCJA 4HNRA 3ZWDA 4XQGA 2FNAA 4NV3A 5FUXA 1N32B 2H7XA 4FE4A 4R2KA 1IBCA 5CX4A 1XTKA 2VHWA 5T6MA 3V8QA 2BFFB 2AR7A 3WWEA 5BQXA 7GPBA 1G59A 4N65A 3MBIA 4RD2A 3HBLA 3OMXA 3HL4A 4JGBA 2O3JA 3F96A 3G0HA 1UJ6A 1SD2A 3LPCA 3AXTA 3PT9A 5F64A 1JHZA 1BWRA 5BOSB 4Z4QA 3ZCXA 3JZDA 3HKCB 1NI4A 4FYXA 5J1TB 3U6KA 1ZXLA 2FWPA 3LQYA 1TLLA 4YP7A 4EW1A 1NG1A 3GX1A 1UM9B 2ZSKA 5EMKA 1UP6A 1KSHA 1MMFB 4RMHA 3ADCA 1ULBA 5EZ5A 2AN5A 3N8DA 4DUZB 1H66A 1AXEA 2FCAA 1BD3A 2Q1YA 1Z2PX 3W7AA 5EPEA 2XA9A 4IEFB 3FRHA 1YA6A 4LKRA