1Q7HA

Structure of a conserved pua domain protein from thermoplasma acidophilum
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
151
structure length
151
Chain Sequence
SKHFISKKEAKRIWEQMSRYGIDITGESLEVAAQKSASAYYIGGKPMVFQAGDLIPSVYLLNYRNPSRNIVTVDEGAEPHILNGSDLFAPGIVSMDDSIRKGDMIFVKSSKGYFIAVGMAEMDAGEVMATKRGKAARIIHFPGDELIRAFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a conserved hypothetical protein from T. acidophilum
rcsb
source organism Thermoplasma acidophilum dsm 1728
molecule tags Structural genomics, unknown function
molecule keywords conserved hypothetical protein
total genus 30
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2003-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01472 PUA PUA domain
A PF09183 DUF1947 Domain of unknown function (DUF1947)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 1q7hA02
3.10.450.120 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Pre-PUA domain; domain 1 1q7hA01
1ZS7A 1IT8A 2P38A 2B78A 2AS0A 1ZE2A 2AB4A 1J2BA 1IT7A 1SGVA 2J5VA 3UAIA 1ZE1A 2CWWA 3VSEA 4DMGA 1WXWA 4Q1TA 1K8WA 2J5TA 3D79A 1T5YA 1ZL3A 1R3FA 1IQ8A 1Q7HA 3C0KA 3LDFA 2CX0A 1WXXA 1SQWA 1R3EA 2CX1A 2Q07A
chains in the Genus database with same CATH superfamily
4IIAA 1AVKA 3LMLA 1FW7A 3HJWA 3MG2A 1GY7A 1GMRA 3EX9A 5IEOA 3LWRA 3UL5A 2W03A 4FMAA 2XFSA 3E99A 5DREA 1VQO3 3LJCA 3K9MC 1BIRA 2XGNA 1QAKA 1V74A 3B4OA 5JPPA 3EHCA 1N5HA 4O2HA 1GY5A 1UCKA 1VQ73 1HYFA 1TTOA 1AQZA 1BSDA 1LQGC 2HMMB 1STFI 2HMKB 2GU3A 1NU3A 4STDA 1M1XB 1BSEA 1T3BA 5M19A 3DY5A 1M904 1MWUA 1NB3I 2W56A 1SQWA 3LWQA 2D42A 1OHSA 2MC8A 1IYYA 3PGBA 1I0VA 2BIRA 1LQMB 1CYUA 1B20A 1NJI4 1ZS7A 3IJEB 1W2ZA 1O7NB 1GS3A 4EYCA 3LOYA 1BSCA 1B2ZA 1DMMA 2M7OA 1FA3A 3OXAA 7RNTA 1BRKA 2AB4A 4HM1B 3NV0A 3BIRA 2OOVA 3X40A 1LOVA 3T8UA 2F86B 3GAXA 3CU3A 4XBTA 3LTBA 2W04A 1YVSA 4WYKB 1YJN3 1VQP3 1DMQA 1UGHI 4K1VA 2V1LA 3V92A 2SARA 1FYSA 1GSPA 3MHEA 5DRVA 3LTAA 2CFKA 3C0KA 2CC3A 1BRIA 4FMDA 1Y4KA 1RGGA 1W6GA 2E2VA 2L1SA 1K734 1BNGA 3FF0A 3M6VA 1RRLA 3KZTA 3LWVA 4WFOA 1X1UA 3QK9A 1GD4A 2KF5A 2YX9A 4RNZA 3T0UA 1JBRA 1DVDA 1B27A 1M1K4 1RJOA 4PEJA 1R4CA 3SYUA 3U1WA 1VQ63 1OPYA 2H0HA 2AS0A 2RCDA 2GBWB 2OCTA 4HZ9B 1EEJA 3FG3A 4CPKA 3UAIA 3SEDA 4EBGA 1YVBI 1MGRA 1BNRA 3GZBA 1B3SA 1QMAA 4FCMA 3V98A 2PZVA 2L4VA 3J7Yd 1KC84 1BNJA 1SIIA 2INXA 3Q90A 3V99A 1U8CB 3BLZA 4OUQA 4N6TA 1DMNA 4WWUC 1JRQA 2CFGA 1FGRA 1R3EA 4LSOA 1I3FA 1W6YA 1YNVX 3OWSA 3PYJA 1NB5I 1G96A 3CCR3 3MWZA 1YHQ3 5TGNA 1CQSA 3EC9A 4HM6B 4ZM8A 3DZLA 4WYKA 3AGNA 3KSPA 1I2GA 3GZYB 4L8OA 1G0TA 1RGFA 1D6ZA 1EG9B 4LGQA 2YFIB 1TRQA 1GOVA 5BIRA 4NPBA 1I8VA 3LT9A 4TZ4C 4EV2A 3X3ZA 3I0YA 2CWVA 3WMDA 4RNYA 5D82A 4CDLA 3BNEA 3F7XA 3F7SA 3H51A 4I4KA 1TIJA 5IG0A 1JBTA 2XSOB 3GZRA 1CH0A 4GB5A 2K3DA 1W6CA 1RN4A 3CCS3 2RGQA 1KWIA 1RN1A 1U5OA 1ZO2A 1RKYA 2CWUA 2F4YA 3GWRA 1CEWI 3CPOA 1E3RA 2Q07A 1IVUA 3S5CA 2WGOA 3JUQA 3DH2A 3SLUA 4DKIA 1UOYA 1I2EA 3K63A 4HM7B 2W56B 4O3VA 5AYSC 3PCSA 1BU4A 3VF1A 2ANEA 2R41A 4BL3A 1VQ53 3M4XA 3HX8A 2BNGA 4R9KA 1YI23 5HOHA 3HAXA 3FSDA 1I3IA 3DXOA 3GZXB 4N3VA 3D9RA 4TX4A 3LWOA 1UI8A 2QA43 1Q814 1QVG2 3CCM3 1IT7A 2P09A 3NXJA 2ML5A 1ZE1A 1W7CA 3HIGA 2OOVC 4KFFA 1L5GB 3MQKA 1IVWA 1IVVA 3HOHA 4LMIA 2JQ5A 2HMOB 3AHWA 5IF6A 1GYBA 1UCIA 1US1A 2UGIA 3PCRA 5M1AA 1PU4A 3CCE3 3MG1A 1S5AA 2GSPA 3UNLA 1R3FA 2XFTA 4J5GA 2CH9A 1W4NA 1UUVB 3NQYA 1YIT3 2H0IA 1EUIC 1OHOA 1OUNA 2MF7A 2QEX3 3B8LA 4RZMA 3G0KA 4FR9A 3MPHA 4CI2B 1WMPA 3KIIA 3NBRA 4HM0B 2H0GA 3NHXA 2CG1A 1Q9EA 1O7WB 4BTYA 1VQK3 5G1KA 1E97A 1Z1SA 3ROBA 1K41A 1WMOA 2UUGC 3CC43 1J2BA 1OF5A 3G713 2J5VA 3HJYA 2C11A 4K1UA 5GSPA 2AAEA 3IMAB 2ZA4A 1N5PA 4HKVB 3EJVA 2KXGA 3NQZA 3VGNA 2I9WA 1RGCA 1KD14 2HMJB 2KAAA 2GEXA 1C54A 5BVBA 3CC23 2XSHB 2GXFA 3BB9A 4KFDA 3FZWA 3F9SA 1DETA 3FKAA 2B1XB 2R4IA 2Z7AA 1AVLA 3F14A 3CNXA 2XR8B 2GU1A 1RGEA 5IG3A 2APOA 2Z6BA 2XGLA 4N6NB 2RFKA 1JBSA 3SX1A 3JUPA 3CCJ3 1GOYA 2K0MA 1ULJB 3DGMA 5EEOA 3LZAA 1JN5A 4BTXA 1BANA 3D4AA 5RNTA 3U97A 1JV2B 1Q40A 1MOLA 1SJWA 3F40A 4N6V0 5FGOA 1WXWA 2YFLB 1N9JA 1K8WA 5AIGA 5AYRB 5IERA 2BHMA 3HIIA 4WP5A 5CXOA 1Q42A 1RRHA 4EW5A 5BU4A 2SBLA 4HM5B 2E2UA 1FGOA 4CCVA 1A67A 2E5OA 1UUGB 2F5WA 2CX0A 1K9M4 1UCJA 4EC6A 1IDPA 1WK2A 1LRAA 1RGAA 2K54A 3EB8A 3FG4A 3NBBA 5CLKA 2KF3A 1TFOA 4R80A 2O3OA 1BNIA 1IV7A 5CK6A 3K5TA 3X41A 1N8QA 1MNLA 1LNIA 1JNQA 1WMNA 3LXUX 4AKYA 1JKGA 1ZE2A 1LOYA 3A5EA 1BAOA 1RGKA 1ZGXA 4HJLB 3MG3A 5IENA 3VSEA 2OQEA 4N6OB 3WA2X 1A2KA 2WGQA 4K90B 3CC73 5I97A 1OHPA 1HKXA 2KF6A 2UX0A 4FMCA 5LC7A 1LNHA 1UCLA 1UW1A 2O9UX 3F8HA 3ZV0C 4OVMA 3D5GA 1BGSA 2CKFB 3DGOA 5EVHA 4KVHA 1LOWA 3SOAA 3TDGA 3HI7A 4HM2B 4HBRA 4NREA 3LDFA 2LQVA 4U13A 1OGZA 3URPA 3CCV3 3SOYA 3JUNA 3BU4A 3NV0B 1VZZA 2IMJA 2QGUA 2RFRA 5G2GA 1FUTA 1BNSA 3M6WA 1JN5B 2STDA 5ELJA 1OACA 1JB5A 1D6YA 3SXXA 3JVCA 4J5KA 1Q824 4MMXB 1T2HA 2B78A 1PY3A 1ZX2A 3HK4A 4HVNA 1K28A 3DGYA 1V58A 2PNCA 1W02A 2EY4A 2C10A 1B2XA 2AUSA 2KF4A 3LTDA 4N6UA 4BIRA 1OF5B 1RCKA 2BO9B 3EQQB 3STDA 1IQYA 5D83A 1BRHA 1V57A 3PS8A 4LEHA 3I563 3KFQC 4RNTA 4HZBB 3OX9A 4XBXA 5G1LA 4HM3B 2OTL3 3GRDA 1B2UA 4WHAA 2W6JH 2XEPA 1YIJ3 4AEQA 1W01A 1TRPA 1OGXA 1IK3A 1KSIA 1JKGB 5LC6A 1VQM3 1BRNL 1SIHA 3ER7A 4JRFA 5IG4A 1UUWB 2CHCA 1TJDA 2J8XB 2RNTA 3NM7A 3EE1A 3AMOB 3DM8A 3F8XA 5D81A 4O8SA 5KP3A 3EF8A 4BU4A 2Z77A 1ROAA 3G8ZA 4R1KA 1NDOB 2BMOB 2C4BA 2FGTA 3LT8A 3RGAA 5HGRA 3CCL3 4Q1TA 5AEWB 2IYJA 1RCLA 1JZDA 2P0MA 1T2IA 1FGTA 3BNDA 3S28A 2IA7A 1VQ93 1Q40B 1EKMA 4AKZA 5STDA 1Q7HA 2Y74A 1BUJA 3MSOA 3Q1CA 1EQKA 3WR2A 3DUKA 1O7HB 5M18A 3IPTA 4MMZB 5AIHA 6GSPA 1I0XA 1RLSA 1ROVA 1RMSA 2WOHA 1JB2A 3KCHA 3X42A 1MWSA 5IW9A 1X1YA 1A2PA 3FG1A 2P38A 1TUHA 3G16A 4KFEA 1B2MA 5A0OB 1Q7Y4 3PXMA 2W0QA 4NHFA 1Q864 4RBNA 1X1WA 1VQ83 1ISKA 2W9PA 2HOHA 1VQL3 1HZ1A 1D6UA 1SGVA 3IUWA 2B24B 2CFLA 5IG5A 3WA3A 1SPUA 4DMGA 4CI1B 7STDA 1JJ22 2IUJA 1G02A 1SARA 1O7MB 1RHLA 2P0XA 3S29A 5AI1A 1VQN3 1R4YA 2FNQA 3DMCA 1GD3A 3FGYA 5AIFA 3VSYA 3CCU3 1O7PB 1WQLB 4KT3B 5AIIA 1JZOA 2HMNB 4L7KA 4BTWA 1FUSA 3N54B 3OW22 1WXXA 1O7GB 1BOXA 2RSXA 1DVCA 1S723 1AY7A 1DYUA 4H3UA 2IY2A 1RNTA 2GBXB 1E3VA 3AMOA 3PZWA 1PFPA 1LVNA 1BRJA 2BU4A 4N6LA 3UJMA 1STDA 1IQXA 2Z76A 2F5MA 3N9HA 1OH0A 3HZPA 4JF8A 2CG0A 3M8CA 1FGQA 3WOFB 3MYTA 5CF1A 1I70A 1ASKA 1RGHA 3EN8A 1GOUA 2DP9A 4HAAA 1RDSA 4LYLB 4ORLA 1BNFA 3EN1B 4XM4A 3D79A 1MWRA 1FGMA 3FH1A 4IT7A 1HU9A 2BMQB 3K0ZA 2CFDA 3H3HA 1A2VA 2HMLB 3UB1A 2WOFA 1S04A 3OV4A 3EBYA 3NBJA 1IV9A 3UL6A 1A90A 3G6E3 3N8BA 3LWPA 3WOEB 2CK3H 1YJW3 3KN4A 5CF2A 3LYGA 4ILFA 1YGWA 3M6XA 1MGWA 4GSPA 4N6MA 3CMA3 3EBTA 3LTCA 2XH9A 2CWTA 3ZG5A 3WODG 2OWPA 5KP4A 3KE7A 2JDIH 1OCVA 4CI3B 2A15A 3KKGA 3B4PA 4HYZA 3WDGB 1IVXA 4G1MB 1WNHA 3CNMA 3AHSA 5JPUA 2CW9A 1TE7A 1DE3A 1TP6A 1F8NA 1GMPA 5KP1A 2J5TA 2KKUA 1T5YA 1EA2A 1C7HA 2BT3A 1VQ43 1ZL3A 4IPBA 1FZUA 1RSNA 3DGLA 2CX1A 1BRSA 4LZIA 4MJDA 3RNTA 1BNEA 4MEIA 3QRDA 1QJGA 1UDII 4X2HA 2F98A 3FF2A 3NX0A 3ALAA 2ZDJA 1W5ZA 4XB5A 5AEUB 3CXC2 2W9QA 2GEYA 2FXTA 1AR0A 1BRGA 4QWTA 3D5IA 1ZBOA 1UGIA 2P05A 4FCJA 4O02B 1YGEA 2KCDA 1MWTA 3S27A 4GL6A 1PYLA 1IU7A 1BSAA 1RN7A 2WO0A 3OWYA 2AADA 3ZFZA 2XF3A 3D3LA 1RNBA 2W2CA 1BVIA 2ZHXB 1B2SA 3RDEA 1W2B2 3LH4A 1IQ8A 1LOXA 6STDA 3KSED 1X1XA 2HVYA 3FLJA 2E2TA 1XNEA 2ZL8A 3SVAA 4EXRA 1K8A4 3CD63 1N9EA 3B7CA 2OTJ3 1VQQA 2F99A 5BXQA 4XDVA 2D1WA 3X3YA 1CYVA 3ZG0A 2Z0TA 3L0RA 3NM2A 4KZ1A 3FCSB 4L8PA 1TU5A 1QVF2 3BNBA 1W00A 4K61A 3CPW2 3WHOA 3M6UA 1NO3A 1M9GA 1BSBA 5IEPA 3MKIA 4I5QA 2OQEC 1WTHA 4XDWA 2CWWA 3O8YA 1RGLA 2KRTA 2QIYA 2RBIA 2CIUA 3JUMA 4BL2A 2ML6A 3Q2PA 3Q3FA 8CHOA 4J9AA 4R4KA 2CFWA 3AGOA 1FUWA 3K7CA 3BNCA 1I2FA 2YFJB 4HM4B 3M65A 4FCZA 3JUOA 2Y73A 3OWUA 4FMBA 4XBYA 1NWWA 3T8NA 3CCQ3 2F56A 4OK0A 6RNTA 4J8TA 4CJNA 4Q53A 8RNTA 2BMRB 1LXEA 1IT8A 2IUKA 5EQLA 3RGRA 4GHOA 1QAFA 1NNVA 2FRXA 1GMQA 3CME3 3DGNA 4HM8B 9RNTA 5JBSA 1QALA 5FW5A 1ULIB 1YJ93 1KQS2 3GSPA 1N8R4 1TFKA 3U28A 1RTUA 3NUVA 5ELUA 4MMYB 3G4S3 4X2OA 3ECFA 3X3XA 2XRXB 1BUQA 1UI7A 2LYXA 3I553 7GSPA 1AV4A 3S67A 3A76A 4HOHA 4EV5A 1JB4A 4R9LA 4H61A 1B21A 1GY6A
chains in the Genus database with same CATH topology
1ZS7A 1IT8A 2P38A 2B78A 2AS0A 1ZE2A 2AB4A 1J2BA 1IT7A 1SGVA 2J5VA 3UAIA 1ZE1A 2CWWA 3VSEA 4DMGA 1WXWA 4Q1TA 1K8WA 2J5TA 3D79A 1T5YA 1ZL3A 1R3FA 1IQ8A 1Q7HA 3C0KA 3LDFA 2CX0A 1WXXA 1SQWA 1R3EA 2CX1A 2Q07A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZS7 A;  1IT8 A;  2P38 A;  2B78 A;  2AS0 A;  1ZE2 A;  2AB4 A;  1J2B A;  1IT7 A;  1SGV A;  2J5V A;  3UAI A;  1ZE1 A;  2CWW A;  3VSE A;  4DMG A;  1WXW A;  4Q1T A;  1K8W A;  2J5T A;  3D79 A;  1T5Y A;  1ZL3 A;  1R3F A;  1IQ8 A;  1Q7H A;  3C0K A;  3LDF A;  2CX0 A;  1WXX A;  1SQW A;  1R3E A;  2CX1 A;  2Q07 A; 
#chains in the Genus database with same CATH topology
 4IIA A;  1AVK A;  3LML A;  1FW7 A;  3HJW A;  3MG2 A;  1GY7 A;  1GMR A;  3EX9 A;  5IEO A;  3LWR A;  3UL5 A;  2W03 A;  4FMA A;  2XFS A;  3E99 A;  5DRE A;  1VQO 3;  3LJC A;  3K9M C;  1BIR A;  2XGN A;  1QAK A;  1V74 A;  3B4O A;  5JPP A;  3EHC A;  1N5H A;  4O2H A;  1GY5 A;  1UCK A;  1VQ7 3;  1HYF A;  1TTO A;  1AQZ A;  1BSD A;  1LQG C;  2HMM B;  1STF I;  2HMK B;  2GU3 A;  1NU3 A;  4STD A;  1M1X B;  1BSE A;  1T3B A;  5M19 A;  3DY5 A;  1M90 4;  1MWU A;  1NB3 I;  2W56 A;  1SQW A;  3LWQ A;  2D42 A;  1OHS A;  2MC8 A;  1IYY A;  3PGB A;  1I0V A;  2BIR A;  1LQM B;  1CYU A;  1B20 A;  1NJI 4;  1ZS7 A;  3IJE B;  1W2Z A;  1O7N B;  1GS3 A;  4EYC A;  3LOY A;  1BSC A;  1B2Z A;  1DMM A;  2M7O A;  1FA3 A;  3OXA A;  7RNT A;  1BRK A;  2AB4 A;  4HM1 B;  3NV0 A;  3BIR A;  2OOV A;  3X40 A;  1LOV A;  3T8U A;  2F86 B;  3GAX A;  3CU3 A;  4XBT A;  3LTB A;  2W04 A;  1YVS A;  4WYK B;  1YJN 3;  1VQP 3;  1DMQ A;  1UGH I;  4K1V A;  2V1L A;  3V92 A;  2SAR A;  1FYS A;  1GSP A;  3MHE A;  5DRV A;  3LTA A;  2CFK A;  3C0K A;  2CC3 A;  1BRI A;  4FMD A;  1Y4K A;  1RGG A;  1W6G A;  2E2V A;  2L1S A;  1K73 4;  1BNG A;  3FF0 A;  3M6V A;  1RRL A;  3KZT A;  3LWV A;  4WFO A;  1X1U A;  3QK9 A;  1GD4 A;  2KF5 A;  2YX9 A;  4RNZ A;  3T0U A;  1JBR A;  1DVD A;  1B27 A;  1M1K 4;  1RJO A;  4PEJ A;  1R4C A;  3SYU A;  3U1W A;  1VQ6 3;  1OPY A;  2H0H A;  2AS0 A;  2RCD A;  2GBW B;  2OCT A;  4HZ9 B;  1EEJ A;  3FG3 A;  4CPK A;  3UAI A;  3SED A;  4EBG A;  1YVB I;  1MGR A;  1BNR A;  3GZB A;  1B3S A;  1QMA A;  4FCM A;  3V98 A;  2PZV A;  2L4V A;  3J7Y d;  1KC8 4;  1BNJ A;  1SII A;  2INX A;  3Q90 A;  3V99 A;  1U8C B;  3BLZ A;  4OUQ A;  4N6T A;  1DMN A;  4WWU C;  1JRQ A;  2CFG A;  1FGR A;  1R3E A;  4LSO A;  1I3F A;  1W6Y A;  1YNV X;  3OWS A;  3PYJ A;  1NB5 I;  1G96 A;  3CCR 3;  3MWZ A;  1YHQ 3;  5TGN A;  1CQS A;  3EC9 A;  4HM6 B;  4ZM8 A;  3DZL A;  4WYK A;  3AGN A;  3KSP A;  1I2G A;  3GZY B;  4L8O A;  1G0T A;  1RGF A;  1D6Z A;  1EG9 B;  4LGQ A;  2YFI B;  1TRQ A;  1GOV A;  5BIR A;  4NPB A;  1I8V A;  3LT9 A;  4TZ4 C;  4EV2 A;  3X3Z A;  3I0Y A;  2CWV A;  3WMD A;  4RNY A;  5D82 A;  4CDL A;  3BNE A;  3F7X A;  3F7S A;  3H51 A;  4I4K A;  1TIJ A;  5IG0 A;  1JBT A;  2XSO B;  3GZR A;  1CH0 A;  4GB5 A;  2K3D A;  1W6C A;  1RN4 A;  3CCS 3;  2RGQ A;  1KWI A;  1RN1 A;  1U5O A;  1ZO2 A;  1RKY A;  2CWU A;  2F4Y A;  3GWR A;  1CEW I;  3CPO A;  1E3R A;  2Q07 A;  1IVU A;  3S5C A;  2WGO A;  3JUQ A;  3DH2 A;  3SLU A;  4DKI A;  1UOY A;  1I2E A;  3K63 A;  4HM7 B;  2W56 B;  4O3V A;  5AYS C;  3PCS A;  1BU4 A;  3VF1 A;  2ANE A;  2R41 A;  4BL3 A;  1VQ5 3;  3M4X A;  3HX8 A;  2BNG A;  4R9K A;  1YI2 3;  5HOH A;  3HAX A;  3FSD A;  1I3I A;  3DXO A;  3GZX B;  4N3V A;  3D9R A;  4TX4 A;  3LWO A;  1UI8 A;  2QA4 3;  1Q81 4;  1QVG 2;  3CCM 3;  1IT7 A;  2P09 A;  3NXJ A;  2ML5 A;  1ZE1 A;  1W7C A;  3HIG A;  2OOV C;  4KFF A;  1L5G B;  3MQK A;  1IVW A;  1IVV A;  3HOH A;  4LMI A;  2JQ5 A;  2HMO B;  3AHW A;  5IF6 A;  1GYB A;  1UCI A;  1US1 A;  2UGI A;  3PCR A;  5M1A A;  1PU4 A;  3CCE 3;  3MG1 A;  1S5A A;  2GSP A;  3UNL A;  1R3F A;  2XFT A;  4J5G A;  2CH9 A;  1W4N A;  1UUV B;  3NQY A;  1YIT 3;  2H0I A;  1EUI C;  1OHO A;  1OUN A;  2MF7 A;  2QEX 3;  3B8L A;  4RZM A;  3G0K A;  4FR9 A;  3MPH A;  4CI2 B;  1WMP A;  3KII A;  3NBR A;  4HM0 B;  2H0G A;  3NHX A;  2CG1 A;  1Q9E A;  1O7W B;  4BTY A;  1VQK 3;  5G1K A;  1E97 A;  1Z1S A;  3ROB A;  1K41 A;  1WMO A;  2UUG C;  3CC4 3;  1J2B A;  1OF5 A;  3G71 3;  2J5V A;  3HJY A;  2C11 A;  4K1U A;  5GSP A;  2AAE A;  3IMA B;  2ZA4 A;  1N5P A;  4HKV B;  3EJV A;  2KXG A;  3NQZ A;  3VGN A;  2I9W A;  1RGC A;  1KD1 4;  2HMJ B;  2KAA A;  2GEX A;  1C54 A;  5BVB A;  3CC2 3;  2XSH B;  2GXF A;  3BB9 A;  4KFD A;  3FZW A;  3F9S A;  1DET A;  3FKA A;  2B1X B;  2R4I A;  2Z7A A;  1AVL A;  3F14 A;  3CNX A;  2XR8 B;  2GU1 A;  1RGE A;  5IG3 A;  2APO A;  2Z6B A;  2XGL A;  4N6N B;  2RFK A;  1JBS A;  3SX1 A;  3JUP A;  3CCJ 3;  1GOY A;  2K0M A;  1ULJ B;  3DGM A;  5EEO A;  3LZA A;  1JN5 A;  4BTX A;  1BAN A;  3D4A A;  5RNT A;  3U97 A;  1JV2 B;  1Q40 A;  1MOL A;  1SJW A;  3F40 A;  4N6V 0;  5FGO A;  1WXW A;  2YFL B;  1N9J A;  1K8W A;  5AIG A;  5AYR B;  5IER A;  2BHM A;  3HII A;  4WP5 A;  5CXO A;  1Q42 A;  1RRH A;  4EW5 A;  5BU4 A;  2SBL A;  4HM5 B;  2E2U A;  1FGO A;  4CCV A;  1A67 A;  2E5O A;  1UUG B;  2F5W A;  2CX0 A;  1K9M 4;  1UCJ A;  4EC6 A;  1IDP A;  1WK2 A;  1LRA A;  1RGA A;  2K54 A;  3EB8 A;  3FG4 A;  3NBB A;  5CLK A;  2KF3 A;  1TFO A;  4R80 A;  2O3O A;  1BNI A;  1IV7 A;  5CK6 A;  3K5T A;  3X41 A;  1N8Q A;  1MNL A;  1LNI A;  1JNQ A;  1WMN A;  3LXU X;  4AKY A;  1JKG A;  1ZE2 A;  1LOY A;  3A5E A;  1BAO A;  1RGK A;  1ZGX A;  4HJL B;  3MG3 A;  5IEN A;  3VSE A;  2OQE A;  4N6O B;  3WA2 X;  1A2K A;  2WGQ A;  4K90 B;  3CC7 3;  5I97 A;  1OHP A;  1HKX A;  2KF6 A;  2UX0 A;  4FMC A;  5LC7 A;  1LNH A;  1UCL A;  1UW1 A;  2O9U X;  3F8H A;  3ZV0 C;  4OVM A;  3D5G A;  1BGS A;  2CKF B;  3DGO A;  5EVH A;  4KVH A;  1LOW A;  3SOA A;  3TDG A;  3HI7 A;  4HM2 B;  4HBR A;  4NRE A;  3LDF A;  2LQV A;  4U13 A;  1OGZ A;  3URP A;  3CCV 3;  3SOY A;  3JUN A;  3BU4 A;  3NV0 B;  1VZZ A;  2IMJ A;  2QGU A;  2RFR A;  5G2G A;  1FUT A;  1BNS A;  3M6W A;  1JN5 B;  2STD A;  5ELJ A;  1OAC A;  1JB5 A;  1D6Y A;  3SXX A;  3JVC A;  4J5K A;  1Q82 4;  4MMX B;  1T2H A;  2B78 A;  1PY3 A;  1ZX2 A;  3HK4 A;  4HVN A;  1K28 A;  3DGY A;  1V58 A;  2PNC A;  1W02 A;  2EY4 A;  2C10 A;  1B2X A;  2AUS A;  2KF4 A;  3LTD A;  4N6U A;  4BIR A;  1OF5 B;  1RCK A;  2BO9 B;  3EQQ B;  3STD A;  1IQY A;  5D83 A;  1BRH A;  1V57 A;  3PS8 A;  4LEH A;  3I56 3;  3KFQ C;  4RNT A;  4HZB B;  3OX9 A;  4XBX A;  5G1L A;  4HM3 B;  2OTL 3;  3GRD A;  1B2U A;  4WHA A;  2W6J H;  2XEP A;  1YIJ 3;  4AEQ A;  1W01 A;  1TRP A;  1OGX A;  1IK3 A;  1KSI A;  1JKG B;  5LC6 A;  1VQM 3;  1BRN L;  1SIH A;  3ER7 A;  4JRF A;  5IG4 A;  1UUW B;  2CHC A;  1TJD A;  2J8X B;  2RNT A;  3NM7 A;  3EE1 A;  3AMO B;  3DM8 A;  3F8X A;  5D81 A;  4O8S A;  5KP3 A;  3EF8 A;  4BU4 A;  2Z77 A;  1ROA A;  3G8Z A;  4R1K A;  1NDO B;  2BMO B;  2C4B A;  2FGT A;  3LT8 A;  3RGA A;  5HGR A;  3CCL 3;  4Q1T A;  5AEW B;  2IYJ A;  1RCL A;  1JZD A;  2P0M A;  1T2I A;  1FGT A;  3BND A;  3S28 A;  2IA7 A;  1VQ9 3;  1Q40 B;  1EKM A;  4AKZ A;  5STD A;  1Q7H A;  2Y74 A;  1BUJ A;  3MSO A;  3Q1C A;  1EQK A;  3WR2 A;  3DUK A;  1O7H B;  5M18 A;  3IPT A;  4MMZ B;  5AIH A;  6GSP A;  1I0X A;  1RLS A;  1ROV A;  1RMS A;  2WOH A;  1JB2 A;  3KCH A;  3X42 A;  1MWS A;  5IW9 A;  1X1Y A;  1A2P A;  3FG1 A;  2P38 A;  1TUH A;  3G16 A;  4KFE A;  1B2M A;  5A0O B;  1Q7Y 4;  3PXM A;  2W0Q A;  4NHF A;  1Q86 4;  4RBN A;  1X1W A;  1VQ8 3;  1ISK A;  2W9P A;  2HOH A;  1VQL 3;  1HZ1 A;  1D6U A;  1SGV A;  3IUW A;  2B24 B;  2CFL A;  5IG5 A;  3WA3 A;  1SPU A;  4DMG A;  4CI1 B;  7STD A;  1JJ2 2;  2IUJ A;  1G02 A;  1SAR A;  1O7M B;  1RHL A;  2P0X A;  3S29 A;  5AI1 A;  1VQN 3;  1R4Y A;  2FNQ A;  3DMC A;  1GD3 A;  3FGY A;  5AIF A;  3VSY A;  3CCU 3;  1O7P B;  1WQL B;  4KT3 B;  5AII A;  1JZO A;  2HMN B;  4L7K A;  4BTW A;  1FUS A;  3N54 B;  3OW2 2;  1WXX A;  1O7G B;  1BOX A;  2RSX A;  1DVC A;  1S72 3;  1AY7 A;  1DYU A;  4H3U A;  2IY2 A;  1RNT A;  2GBX B;  1E3V A;  3AMO A;  3PZW A;  1PFP A;  1LVN A;  1BRJ A;  2BU4 A;  4N6L A;  3UJM A;  1STD A;  1IQX A;  2Z76 A;  2F5M A;  3N9H A;  1OH0 A;  3HZP A;  4JF8 A;  2CG0 A;  3M8C A;  1FGQ A;  3WOF B;  3MYT A;  5CF1 A;  1I70 A;  1ASK A;  1RGH A;  3EN8 A;  1GOU A;  2DP9 A;  4HAA A;  1RDS A;  4LYL B;  4ORL A;  1BNF A;  3EN1 B;  4XM4 A;  3D79 A;  1MWR A;  1FGM A;  3FH1 A;  4IT7 A;  1HU9 A;  2BMQ B;  3K0Z A;  2CFD A;  3H3H A;  1A2V A;  2HML B;  3UB1 A;  2WOF A;  1S04 A;  3OV4 A;  3EBY A;  3NBJ A;  1IV9 A;  3UL6 A;  1A90 A;  3G6E 3;  3N8B A;  3LWP A;  3WOE B;  2CK3 H;  1YJW 3;  3KN4 A;  5CF2 A;  3LYG A;  4ILF A;  1YGW A;  3M6X A;  1MGW A;  4GSP A;  4N6M A;  3CMA 3;  3EBT A;  3LTC A;  2XH9 A;  2CWT A;  3ZG5 A;  3WOD G;  2OWP A;  5KP4 A;  3KE7 A;  2JDI H;  1OCV A;  4CI3 B;  2A15 A;  3KKG A;  3B4P A;  4HYZ A;  3WDG B;  1IVX A;  4G1M B;  1WNH A;  3CNM A;  3AHS A;  5JPU A;  2CW9 A;  1TE7 A;  1DE3 A;  1TP6 A;  1F8N A;  1GMP A;  5KP1 A;  2J5T A;  2KKU A;  1T5Y A;  1EA2 A;  1C7H A;  2BT3 A;  1VQ4 3;  1ZL3 A;  4IPB A;  1FZU A;  1RSN A;  3DGL A;  2CX1 A;  1BRS A;  4LZI A;  4MJD A;  3RNT A;  1BNE A;  4MEI A;  3QRD A;  1QJG A;  1UDI I;  4X2H A;  2F98 A;  3FF2 A;  3NX0 A;  3ALA A;  2ZDJ A;  1W5Z A;  4XB5 A;  5AEU B;  3CXC 2;  2W9Q A;  2GEY A;  2FXT A;  1AR0 A;  1BRG A;  4QWT A;  3D5I A;  1ZBO A;  1UGI A;  2P05 A;  4FCJ A;  4O02 B;  1YGE A;  2KCD A;  1MWT A;  3S27 A;  4GL6 A;  1PYL A;  1IU7 A;  1BSA A;  1RN7 A;  2WO0 A;  3OWY A;  2AAD A;  3ZFZ A;  2XF3 A;  3D3L A;  1RNB A;  2W2C A;  1BVI A;  2ZHX B;  1B2S A;  3RDE A;  1W2B 2;  3LH4 A;  1IQ8 A;  1LOX A;  6STD A;  3KSE D;  1X1X A;  2HVY A;  3FLJ A;  2E2T A;  1XNE A;  2ZL8 A;  3SVA A;  4EXR A;  1K8A 4;  3CD6 3;  1N9E A;  3B7C A;  2OTJ 3;  1VQQ A;  2F99 A;  5BXQ A;  4XDV A;  2D1W A;  3X3Y A;  1CYV A;  3ZG0 A;  2Z0T A;  3L0R A;  3NM2 A;  4KZ1 A;  3FCS B;  4L8P A;  1TU5 A;  1QVF 2;  3BNB A;  1W00 A;  4K61 A;  3CPW 2;  3WHO A;  3M6U A;  1NO3 A;  1M9G A;  1BSB A;  5IEP A;  3MKI A;  4I5Q A;  2OQE C;  1WTH A;  4XDW A;  2CWW A;  3O8Y A;  1RGL A;  2KRT A;  2QIY A;  2RBI A;  2CIU A;  3JUM A;  4BL2 A;  2ML6 A;  3Q2P A;  3Q3F A;  8CHO A;  4J9A A;  4R4K A;  2CFW A;  3AGO A;  1FUW A;  3K7C A;  3BNC A;  1I2F A;  2YFJ B;  4HM4 B;  3M65 A;  4FCZ A;  3JUO A;  2Y73 A;  3OWU A;  4FMB A;  4XBY A;  1NWW A;  3T8N A;  3CCQ 3;  2F56 A;  4OK0 A;  6RNT A;  4J8T A;  4CJN A;  4Q53 A;  8RNT A;  2BMR B;  1LXE A;  1IT8 A;  2IUK A;  5EQL A;  3RGR A;  4GHO A;  1QAF A;  1NNV A;  2FRX A;  1GMQ A;  3CME 3;  3DGN A;  4HM8 B;  9RNT A;  5JBS A;  1QAL A;  5FW5 A;  1ULI B;  1YJ9 3;  1KQS 2;  3GSP A;  1N8R 4;  1TFK A;  3U28 A;  1RTU A;  3NUV A;  5ELU A;  4MMY B;  3G4S 3;  4X2O A;  3ECF A;  3X3X A;  2XRX B;  1BUQ A;  1UI7 A;  2LYX A;  3I55 3;  7GSP A;  1AV4 A;  3S67 A;  3A76 A;  4HOH A;  4EV5 A;  1JB4 A;  4R9L A;  4H61 A;  1B21 A;  1GY6 A; 
#chains in the Genus database with same CATH homology
 1ZS7 A;  1IT8 A;  2P38 A;  2B78 A;  2AS0 A;  1ZE2 A;  2AB4 A;  1J2B A;  1IT7 A;  1SGV A;  2J5V A;  3UAI A;  1ZE1 A;  2CWW A;  3VSE A;  4DMG A;  1WXW A;  4Q1T A;  1K8W A;  2J5T A;  3D79 A;  1T5Y A;  1ZL3 A;  1R3F A;  1IQ8 A;  1Q7H A;  3C0K A;  3LDF A;  2CX0 A;  1WXX A;  1SQW A;  1R3E A;  2CX1 A;  2Q07 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...