1Q7HA

Structure of a conserved pua domain protein from thermoplasma acidophilum
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
151
structure length
151
Chain Sequence
SKHFISKKEAKRIWEQMSRYGIDITGESLEVAAQKSASAYYIGGKPMVFQAGDLIPSVYLLNYRNPSRNIVTVDEGAEPHILNGSDLFAPGIVSMDDSIRKGDMIFVKSSKGYFIAVGMAEMDAGEVMATKRGKAARIIHFPGDELIRAFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Structure of a conserved hypothetical protein from T. acidophilum
rcsb
source organism Thermoplasma acidophilum dsm 1728
molecule tags Structural genomics, unknown function
total genus 30
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2003-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01472 PUA PUA domain
A PF09183 DUF1947 Domain of unknown function (DUF1947)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 1q7hA02
3.10.450.120 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Pre-PUA domain; domain 1 1q7hA01
1T5YA 1ZS7A 2J5TA 2J5VA 1IQ8A 3C0KA 1ZL3A 1SGVA 2CX0A 1K8WA 2B78A 4DMGA 3D79A 4Q1TA 1WXWA 1Q7HA 1SQWA 2CWWA 1R3EA 1J2BA 3VSEA 2CX1A 2Q07A 2P38A 2AB4A 1IT8A 1ZE2A 3UAIA 3LDFA 1IT7A 2AS0A 1WXXA 1R3FA 1ZE1A
chains in the Genus database with same CATH superfamily
3SOYA 2QIYA 4H3UA 3X40A 3NV0A 1BRKA 1IQ8A 3OWUA 1O7HB 1Q7Y4 4IT7A 3BIRA 4KFEA 3S29A 3T8NA 3U1WA 4HKVB 4O3VA 1BRSA 3G16A 3KZTA 1STFI 2BU4A 4WP5A 1TIJA 3F14A 1Y4KA 3N9HA 4FMBA 4XBTA 5LC6A 4BU4A 2YX9A 4BTYA 3LWVA 4FMDA 4WFOA 3SOAA 3AHSA 3UL5A 3S28A 6STDA 2CKFB 1FGTA 2CG1A 1GOUA 1ZBOA 3M6VA 1JN5A 1FA3A 1I2EA 1CH0A 1UUVB 2IY2A 3T8UA 5CXOA 1WMPA 3CME3 3SYUA 1LOXA 1JB4A 5M19A 1DETA 1OCVA 3DM8A 2HMNB 1RNBA 3HJYA 2FRXA 1VQP3 1X1XA 1ZL3A 1VQO3 1K8WA 2WOHA 1OHPA 1C7HA 4HYZA 3FLJA 2BT3A 1K28A 3DGOA 4MMXB 1JV2B 1QALA 1JBRA 4CI2B 3E99A 3H51A 3M65A 1WNHA 4I5QA 3VF1A 1Q40A 4EXRA 4HM7B 3I0YA 1W6CA 2K3DA 3RDEA 3HAXA 3VGNA 1DMMA 1FGMA 2UX0A 3CNXA 3LTCA 2W04A 2WO0A 5TGNA 1UI8A 3MKIA 4LYLB 1O7GB 3MWZA 4RZMA 2BNGA 1R4YA 1WXXA 2CFGA 3JUNA 9RNTA 1MWRA 1UCIA 3NXJA 3NQYA 2JDIH 1K41A 3SEDA 1W00A 1WMNA 2Y73A 5AIGA 2KF4A 3EJVA 1U5OA 3CMA3 4NPBA 3NHXA 2IUJA 1GS3A 1NO3A 1YVSA 3WA2X 1TTOA 1ROVA 4R9KA 4DMGA 1W2ZA 3CCR3 3M8CA 5CK6A 4WWUC 3BB9A 1JKGB 2Z77A 1RGHA 3LT8A 1US1A 4OK0A 4WHAA 4J9AA 2RCDA 4RNZA 2E2UA 1Q9EA 3NBRA 3GZRA 3I563 1SARA 1LXEA 1BNGA 1ZO2A 4O02B 2CFLA 1Q824 3X3ZA 1UI7A 2H0HA 2ML6A 2QGUA 3ROBA 1Q864 1KC84 3BNBA 3O8YA 5RNTA 4MJDA 1I0VA 1UGIA 5IF6A 2CIUA 1QMAA 3UB1A 3F8HA 4O2HA 3D5GA 3CCJ3 1QVG2 2BMQB 1I2FA 5CF2A 3V92A 1B2MA 1UCLA 1GD3A 3OWYA 1UOYA 4J8TA 1SPUA 5FW5A 3EX9A 2W6JH 4RNTA 1LOYA 3DMCA 1ZGXA 5IEOA 1I3FA 4N6TA 3EN1B 1C54A 1YGWA 2GEXA 5EQLA 1OH0A 2XGNA 1L5GB 2OCTA 1W5ZA 1GOVA 1LRAA 5A0OB 3WR2A 1LOVA 3CPOA 2RGQA 5M1AA 1UUGB 8CHOA 2Q07A 1KWIA 1N9EA 1CQSA 1OF5A 1SIHA 3BU4A 3F7SA 3LWPA 1B2ZA 3BNDA 4OUQA 1YJW3 2OTL3 3DZLA 1O7NB 3HK4A 3DUKA 3MG3A 4H61A 1A2PA 2OQEA 3WHOA 3M6UA 2O3OA 1WMOA 1AR0A 1DE3A 1V74A 1WQLB 2JQ5A 2OTJ3 3D3LA 1NWWA 3STDA 5IW9A 1UCKA 3SLUA 3FF2A 3M6XA 1MWTA 4HM0B 3A5EA 2MF7A 4OVMA 5STDA 1BOXA 2FNQA 1K734 4ZM8A 3NUVA 1BNFA 1G02A 2W9PA 1EG9B 3FGYA 4HZ9B 5D82A 5ELUA 3RNTA 1YJN3 3LWQA 3VSEA 1TFOA 1B2SA 1W01A 3JVCA 1IQXA 1RLSA 3DGMA 5IEPA 2GEYA 2ZL8A 3BNCA 1B27A 1GD4A 3ZG0A 4BIRA 2CFWA 3LXUX 2RFKA 5IG3A 1TUHA 2B24B 5G2GA 2CG0A 1B2XA 3MSOA 1JZOA 1VQN3 3Q1CA 1BUQA 4RNYA 2RBIA 1OACA 4G1MB 3WMDA 2KF6A 3N54B 4N6LA 1IDPA 4JRFA 2J5TA 1EKMA 1JB5A 1O7PB 3EN8A 4KT3B 1VQ63 1IQYA 5HOHA 2D42A 3AGOA 4IIAA 3D79A 1FUTA 3D9RA 1W7CA 1I0XA 4J5GA 4XB5A 1WXWA 4BL2A 3B8LA 1D6YA 3ER7A 3JUPA 1E3VA 1ROAA 1NJI4 5G1KA 1M1K4 3K9MC 4FMAA 2QEX3 1IVXA 3CC43 4HJLB 4LGQA 4N6NB 4XDWA 1VQL3 3LYGA 2AB4A 1BRIA 4LMIA 5LC7A 2P0MA 2XGLA 4K90B 3HI7A 3PXMA 1TFKA 2A15A 3CCV3 2AS0A 1W02A 2FGTA 1IK3A 3CCS3 1I8VA 1R3FA 2GXFA 1BVIA 3ECFA 3GRDA 1RRHA 7GSPA 1EQKA 1AVKA 3LT9A 1HYFA 3D4AA 3FZWA 2W03A 8RNTA 2IYJA 4HM2B 5IERA 3B7CA 1BSAA 3FSDA 3HIIA 2B1XB 3CC73 2CFKA 4XDVA 3JUMA 1VZZA 2CHCA 3QK9A 4LEHA 2Z7AA 1Q7HA 3FCSB 4STDA 1VQ73 3FG1A 5CF1A 3RGAA 1RGGA 4R4KA 1PY3A 4O8SA 2ZHXB 2MC8A 4HM1B 1OGXA 3UAIA 2GBXB 7STDA 3CCM3 1UCJA 3S5CA 1G0TA 1BRHA 1ASKA 4WYKB 2E2VA 2BMRB 3IUWA 3G6E3 2WGOA 2CWTA 1TJDA 1U8CB 1RTUA 4L7KA 2YFLB 2WGQA 1GYBA 3DGLA 4GSPA 4U13A 2Z0TA 1RSNA 1FGOA 3B4PA 3DY5A 1GY7A 3GAXA 4HM6B 2C10A 3F8XA 2ZA4A 1N5HA 4KZ1A 5M18A 4IPBA 4PEJA 2F98A 1TE7A 3EBTA 5AEWB 5BIRA 3G4S3 4ORLA 2HOHA 1RMSA 1LOWA 3GZBA 2F86B 2UUGC 3FG4A 3LJCA 3KE7A 1RHLA 1BU4A 1GY5A 2LYXA 3GZYB 4X2OA 4DKIA 1A2VA 1FGRA 5KP1A 1Z1SA 2O9UX 1ZE2A 1KQS2 1YI23 1S723 3K5TA 4R9LA 3HJWA 3G713 1BNEA 4HM5B 4MMYB 1RGLA 2GBWB 5G1LA 1S5AA 1O7WB 1RN4A 3GSPA 3PCSA 1Q42A 3AHWA 1AV4A 1N5PA 5JPPA 2Z76A 3ZV0C 1N8QA 2SBLA 5AIFA 3PYJA 1HKXA 4L8OA 1HU9A 5AIHA 3C0KA 2Z6BA 3BLZA 1MOLA 4N6V0 1BNJA 2KF5A 2RSXA 2ZDJA 4HM8B 2B78A 5EEOA 1BSDA 2XSHB 1RCLA 3NBBA 4CPKA 3MPHA 4Q1TA 6GSPA 1R4CA 1RGFA 2PZVA 3FKAA 4KFDA 4CJNA 1ISKA 4EV2A 5I97A 3HOHA 2W56B 3CPW2 1BSBA 1NB3I 1PFPA 2CC3A 4J5KA 3J7Yd 1Q40B 3Q90A 2IMJA 2P38A 3IPTA 5CLKA 1RN7A 1UW1A 3G0KA 3K7CA 2PNCA 1BRGA 1F8NA 2ML5A 3PZWA 4GB5A 4N6OB 3WOEB 3M4XA 5AYRB 3EE1A 1DVCA 1T2HA 5AYSC 2F5MA 3OWSA 4K61A 2OOVC 2KXGA 1GMQA 1SGVA 2CX0A 2SARA 4CI1B 3BNEA 1MNLA 1OGZA 3U28A 4KVHA 3KN4A 5D83A 1I70A 1FYSA 2GU3A 1BANA 1CEWI 1HZ1A 1B21A 1MWUA 2XSOB 3JUQA 3EHCA 1BSEA 3MG1A 1BAOA 1X1UA 2D1WA 1VQ83 1IVUA 1RGEA 1GSPA 2J8XB 1A67A 1IT8A 2HVYA 2EY4A 1IV9A 1EA2A 3KIIA 2CFDA 3G8ZA 2P05A 1LQMB 1GY6A 1AY7A 2KAAA 2BMOB 4LZIA 2GSPA 1KSIA 1AQZA 3LTDA 1NB5I 3V99A 3AMOB 4I4KA 3K0ZA 2HMKB 5KP4A 1OPYA 3S67A 1RN1A 3IJEB 3ZFZA 3SXXA 4MEIA 3NBJA 1A90A 4HM4B 1MWSA 5AI1A 1OUNA 5KP3A 4N6UA 2L4VA 1DMNA 3S27A 4XBYA 1JB2A 1W2B2 2XEPA 3OXAA 3CD63 5BU4A 2AADA 4WYKA 4CCVA 1DMQA 1RNTA 2F99A 2P09A 3GWRA 3LTAA 1O7MB 2XFTA 4R1KA 1K8A4 1IT7A 3F9SA 4HOHA 2IUKA 3D5IA 4FR9A 5JPUA 1YNVX 1A2KA 1WK2A 1WTHA 3X3XA 2HMMB 4HAAA 3FG3A 1JKGA 4ILFA 3DXOA 4RBNA 3HZPA 5DREA 1SIIA 2W9QA 1NNVA 1E97A 2KCDA 3OX9A 2OOVA 1NU3A 2KRTA 2UGIA 3Q2PA 4Q53A 2XF3A 3I553 3CCU3 2H0GA 1RCKA 1BNIA 3M6WA 1RGKA 1TU5A 1YIJ3 2RFRA 1N8R4 1QVF2 2HMJB 3CU3A 5IG4A 2Y74A 1E3RA 1SJWA 1UDII 2YFIB 3HX8A 2AUSA 1D6UA 2CH9A 4BL3A 4TX4A 4BTWA 1AVLA 1LQGC 2E5OA 3UL6A 3CC23 4XM4A 1BNSA 1DYUA 1TRQA 4EC6A 3A76A 1T2IA 3B4OA 3RGRA 2J5VA 1RKYA 4L8PA 1PYLA 2L1SA 1VQK3 3LZAA 1Q814 1FW7A 5HGRA 5ELJA 3SX1A 3NV0B 3PS8A 1I2GA 2E2TA 4HZBB 4CI3B 2AAEA 2W56A 3IMAB 1B3SA 4FCMA 1D6ZA 2P0XA 2W2CA 3MYTA 5D81A 1SQWA 1JZDA 2CK3H 2WOFA 2CWWA 1JJ22 1YVBI 2K54A 3URPA 1M9GA 3U97A 3N8BA 2F56A 1PU4A 2OQEC 4AKZA 1G96A 2C4BA 2XH9A 2INXA 1CYVA 2YFJB 1K9M4 1RGAA 3FF0A 5BXQA 2APOA 1V57A 4QWTA 1BGSA 1STDA 2CWUA 1QAKA 3LDFA 1IV7A 3KFQC 2R4IA 2KKUA 1JN5B 5DRVA 3KCHA 1ZE1A 3CNMA 3EBYA 5AIIA 5IENA 3HIGA 1ZS7A 1RRLA 4GHOA 1YHQ3 1VQQA 1ULIB 2I9WA 1BSCA 1W4NA 4K1VA 3WOFB 4R80A 4X2HA 1YJ93 1CYUA 1W6GA 1X1WA 2OWPA 3EF8A 3PGBA 4GL6A 4KFFA 1BNRA 4TZ4C 1OHOA 2LQVA 1IVWA 2FXTA 3Q3FA 1UUWB 1OHSA 1IU7A 5FGOA 1W6YA 2STDA 3LMLA 3WDGB 1GMRA 1KD14 1V58A 1VQ43 1FUWA 1JRQA 1VQM3 1YIT3 3OV4A 6RNTA 3LWRA 2BHMA 1XNEA 4N6MA 4NREA 3MQKA 1B20A 1LNIA 1QJGA 1RGCA 3NM7A 5IG0A 1GOYA 3K63A 4HBRA 3AMOA 3WA3A 4HVNA 1ZX2A 1T5YA 2K0MA 3AGNA 2C11A 1UGHI 3KSED 1BRJA 3LWOA 3KKGA 3X42A 3CCL3 3NX0A 4JF8A 3EC9A 2BIRA 4K1UA 2H0IA 4NHFA 3ZG5A 5JBSA 7RNTA 3FH1A 3X41A 1FGQA 3CCQ3 4HM3B 1R3EA 3DH2A 4EYCA 1J2BA 4AKYA 1LNHA 3KSPA 1B2UA 1ULJB 2RNTA 4LSOA 1IYYA 1QAFA 1EUIC 4FCJA 1M904 3CCE3 1TRPA 3NM2A 4EW5A 1MGWA 2IA7A 3H3HA 3LOYA 2V1LA 3PCRA 5GSPA 1VQ93 2R41A 3L0RA 1YGEA 3V98A 4EV5A 5IG5A 1M1XB 2GU1A 2XRXB 2CWVA 3JUOA 3LH4A 1S04A 3DGNA 2QA43 2KF3A 2M7OA 2XR8B 2ANEA 1VQ53 2W0QA 5AEUB 3DGYA 5BVBA 4AEQA 3EQQB 5EVHA 1BUJA 1LVNA 1DVDA 3UNLA 3QRDA 1MGRA 2F4YA 4BTXA 4FMCA 1JBSA 3WODG 3UJMA 3F40A 4MMZB 1FUSA 2BO9B 1GMPA 3SVAA 1JNQA 1X1YA 3MHEA 3GZXB 3TDGA 1BIRA 3OW22 1FZUA 3NQZA 4CDLA 2F5WA 4N3VA 2CX1A 2HMLB 3VSYA 3MG2A 4EBGA 1BRNL 1I3IA 3T0UA 3X3YA 3F7XA 1T3BA 2DP9A 1OF5B 3LTBA 1RJOA 4FCZA 2HMOB 2XFSA 3EB8A 1N9JA 1EEJA 1IVVA 1NDOB 2CW9A 1RDSA 4XBXA 3CXC2 1TP6A 3ALAA 1JBTA
chains in the Genus database with same CATH topology
1T5YA 1ZS7A 2J5TA 2J5VA 1IQ8A 3C0KA 1ZL3A 1SGVA 2CX0A 1K8WA 2B78A 4DMGA 3D79A 4Q1TA 1WXWA 1Q7HA 1SQWA 2CWWA 1R3EA 1J2BA 3VSEA 2CX1A 2Q07A 2P38A 2AB4A 1IT8A 1ZE2A 3UAIA 3LDFA 1IT7A 2AS0A 1WXXA 1R3FA 1ZE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T5Y A;  1ZS7 A;  2J5T A;  2J5V A;  1IQ8 A;  3C0K A;  1ZL3 A;  1SGV A;  2CX0 A;  1K8W A;  2B78 A;  4DMG A;  3D79 A;  4Q1T A;  1WXW A;  1Q7H A;  1SQW A;  2CWW A;  1R3E A;  1J2B A;  3VSE A;  2CX1 A;  2Q07 A;  2P38 A;  2AB4 A;  1IT8 A;  1ZE2 A;  3UAI A;  3LDF A;  1IT7 A;  2AS0 A;  1WXX A;  1R3F A;  1ZE1 A; 
#chains in the Genus database with same CATH topology
 3SOY A;  2QIY A;  4H3U A;  3X40 A;  3NV0 A;  1BRK A;  1IQ8 A;  3OWU A;  1O7H B;  1Q7Y 4;  4IT7 A;  3BIR A;  4KFE A;  3S29 A;  3T8N A;  3U1W A;  4HKV B;  4O3V A;  1BRS A;  3G16 A;  3KZT A;  1STF I;  2BU4 A;  4WP5 A;  1TIJ A;  3F14 A;  1Y4K A;  3N9H A;  4FMB A;  4XBT A;  5LC6 A;  4BU4 A;  2YX9 A;  4BTY A;  3LWV A;  4FMD A;  4WFO A;  3SOA A;  3AHS A;  3UL5 A;  3S28 A;  6STD A;  2CKF B;  1FGT A;  2CG1 A;  1GOU A;  1ZBO A;  3M6V A;  1JN5 A;  1FA3 A;  1I2E A;  1CH0 A;  1UUV B;  2IY2 A;  3T8U A;  5CXO A;  1WMP A;  3CME 3;  3SYU A;  1LOX A;  1JB4 A;  5M19 A;  1DET A;  1OCV A;  3DM8 A;  2HMN B;  1RNB A;  3HJY A;  2FRX A;  1VQP 3;  1X1X A;  1ZL3 A;  1VQO 3;  1K8W A;  2WOH A;  1OHP A;  1C7H A;  4HYZ A;  3FLJ A;  2BT3 A;  1K28 A;  3DGO A;  4MMX B;  1JV2 B;  1QAL A;  1JBR A;  4CI2 B;  3E99 A;  3H51 A;  3M65 A;  1WNH A;  4I5Q A;  3VF1 A;  1Q40 A;  4EXR A;  4HM7 B;  3I0Y A;  1W6C A;  2K3D A;  3RDE A;  3HAX A;  3VGN A;  1DMM A;  1FGM A;  2UX0 A;  3CNX A;  3LTC A;  2W04 A;  2WO0 A;  5TGN A;  1UI8 A;  3MKI A;  4LYL B;  1O7G B;  3MWZ A;  4RZM A;  2BNG A;  1R4Y A;  1WXX A;  2CFG A;  3JUN A;  9RNT A;  1MWR A;  1UCI A;  3NXJ A;  3NQY A;  2JDI H;  1K41 A;  3SED A;  1W00 A;  1WMN A;  2Y73 A;  5AIG A;  2KF4 A;  3EJV A;  1U5O A;  3CMA 3;  4NPB A;  3NHX A;  2IUJ A;  1GS3 A;  1NO3 A;  1YVS A;  3WA2 X;  1TTO A;  1ROV A;  4R9K A;  4DMG A;  1W2Z A;  3CCR 3;  3M8C A;  5CK6 A;  4WWU C;  3BB9 A;  1JKG B;  2Z77 A;  1RGH A;  3LT8 A;  1US1 A;  4OK0 A;  4WHA A;  4J9A A;  2RCD A;  4RNZ A;  2E2U A;  1Q9E A;  3NBR A;  3GZR A;  3I56 3;  1SAR A;  1LXE A;  1BNG A;  1ZO2 A;  4O02 B;  2CFL A;  1Q82 4;  3X3Z A;  1UI7 A;  2H0H A;  2ML6 A;  2QGU A;  3ROB A;  1Q86 4;  1KC8 4;  3BNB A;  3O8Y A;  5RNT A;  4MJD A;  1I0V A;  1UGI A;  5IF6 A;  2CIU A;  1QMA A;  3UB1 A;  3F8H A;  4O2H A;  3D5G A;  3CCJ 3;  1QVG 2;  2BMQ B;  1I2F A;  5CF2 A;  3V92 A;  1B2M A;  1UCL A;  1GD3 A;  3OWY A;  1UOY A;  4J8T A;  1SPU A;  5FW5 A;  3EX9 A;  2W6J H;  4RNT A;  1LOY A;  3DMC A;  1ZGX A;  5IEO A;  1I3F A;  4N6T A;  3EN1 B;  1C54 A;  1YGW A;  2GEX A;  5EQL A;  1OH0 A;  2XGN A;  1L5G B;  2OCT A;  1W5Z A;  1GOV A;  1LRA A;  5A0O B;  3WR2 A;  1LOV A;  3CPO A;  2RGQ A;  5M1A A;  1UUG B;  8CHO A;  2Q07 A;  1KWI A;  1N9E A;  1CQS A;  1OF5 A;  1SIH A;  3BU4 A;  3F7S A;  3LWP A;  1B2Z A;  3BND A;  4OUQ A;  1YJW 3;  2OTL 3;  3DZL A;  1O7N B;  3HK4 A;  3DUK A;  3MG3 A;  4H61 A;  1A2P A;  2OQE A;  3WHO A;  3M6U A;  2O3O A;  1WMO A;  1AR0 A;  1DE3 A;  1V74 A;  1WQL B;  2JQ5 A;  2OTJ 3;  3D3L A;  1NWW A;  3STD A;  5IW9 A;  1UCK A;  3SLU A;  3FF2 A;  3M6X A;  1MWT A;  4HM0 B;  3A5E A;  2MF7 A;  4OVM A;  5STD A;  1BOX A;  2FNQ A;  1K73 4;  4ZM8 A;  3NUV A;  1BNF A;  1G02 A;  2W9P A;  1EG9 B;  3FGY A;  4HZ9 B;  5D82 A;  5ELU A;  3RNT A;  1YJN 3;  3LWQ A;  3VSE A;  1TFO A;  1B2S A;  1W01 A;  3JVC A;  1IQX A;  1RLS A;  3DGM A;  5IEP A;  2GEY A;  2ZL8 A;  3BNC A;  1B27 A;  1GD4 A;  3ZG0 A;  4BIR A;  2CFW A;  3LXU X;  2RFK A;  5IG3 A;  1TUH A;  2B24 B;  5G2G A;  2CG0 A;  1B2X A;  3MSO A;  1JZO A;  1VQN 3;  3Q1C A;  1BUQ A;  4RNY A;  2RBI A;  1OAC A;  4G1M B;  3WMD A;  2KF6 A;  3N54 B;  4N6L A;  1IDP A;  4JRF A;  2J5T A;  1EKM A;  1JB5 A;  1O7P B;  3EN8 A;  4KT3 B;  1VQ6 3;  1IQY A;  5HOH A;  2D42 A;  3AGO A;  4IIA A;  3D79 A;  1FUT A;  3D9R A;  1W7C A;  1I0X A;  4J5G A;  4XB5 A;  1WXW A;  4BL2 A;  3B8L A;  1D6Y A;  3ER7 A;  3JUP A;  1E3V A;  1ROA A;  1NJI 4;  5G1K A;  1M1K 4;  3K9M C;  4FMA A;  2QEX 3;  1IVX A;  3CC4 3;  4HJL B;  4LGQ A;  4N6N B;  4XDW A;  1VQL 3;  3LYG A;  2AB4 A;  1BRI A;  4LMI A;  5LC7 A;  2P0M A;  2XGL A;  4K90 B;  3HI7 A;  3PXM A;  1TFK A;  2A15 A;  3CCV 3;  2AS0 A;  1W02 A;  2FGT A;  1IK3 A;  3CCS 3;  1I8V A;  1R3F A;  2GXF A;  1BVI A;  3ECF A;  3GRD A;  1RRH A;  7GSP A;  1EQK A;  1AVK A;  3LT9 A;  1HYF A;  3D4A A;  3FZW A;  2W03 A;  8RNT A;  2IYJ A;  4HM2 B;  5IER A;  3B7C A;  1BSA A;  3FSD A;  3HII A;  2B1X B;  3CC7 3;  2CFK A;  4XDV A;  3JUM A;  1VZZ A;  2CHC A;  3QK9 A;  4LEH A;  2Z7A A;  1Q7H A;  3FCS B;  4STD A;  1VQ7 3;  3FG1 A;  5CF1 A;  3RGA A;  1RGG A;  4R4K A;  1PY3 A;  4O8S A;  2ZHX B;  2MC8 A;  4HM1 B;  1OGX A;  3UAI A;  2GBX B;  7STD A;  3CCM 3;  1UCJ A;  3S5C A;  1G0T A;  1BRH A;  1ASK A;  4WYK B;  2E2V A;  2BMR B;  3IUW A;  3G6E 3;  2WGO A;  2CWT A;  1TJD A;  1U8C B;  1RTU A;  4L7K A;  2YFL B;  2WGQ A;  1GYB A;  3DGL A;  4GSP A;  4U13 A;  2Z0T A;  1RSN A;  1FGO A;  3B4P A;  3DY5 A;  1GY7 A;  3GAX A;  4HM6 B;  2C10 A;  3F8X A;  2ZA4 A;  1N5H A;  4KZ1 A;  5M18 A;  4IPB A;  4PEJ A;  2F98 A;  1TE7 A;  3EBT A;  5AEW B;  5BIR A;  3G4S 3;  4ORL A;  2HOH A;  1RMS A;  1LOW A;  3GZB A;  2F86 B;  2UUG C;  3FG4 A;  3LJC A;  3KE7 A;  1RHL A;  1BU4 A;  1GY5 A;  2LYX A;  3GZY B;  4X2O A;  4DKI A;  1A2V A;  1FGR A;  5KP1 A;  1Z1S A;  2O9U X;  1ZE2 A;  1KQS 2;  1YI2 3;  1S72 3;  3K5T A;  4R9L A;  3HJW A;  3G71 3;  1BNE A;  4HM5 B;  4MMY B;  1RGL A;  2GBW B;  5G1L A;  1S5A A;  1O7W B;  1RN4 A;  3GSP A;  3PCS A;  1Q42 A;  3AHW A;  1AV4 A;  1N5P A;  5JPP A;  2Z76 A;  3ZV0 C;  1N8Q A;  2SBL A;  5AIF A;  3PYJ A;  1HKX A;  4L8O A;  1HU9 A;  5AIH A;  3C0K A;  2Z6B A;  3BLZ A;  1MOL A;  4N6V 0;  1BNJ A;  2KF5 A;  2RSX A;  2ZDJ A;  4HM8 B;  2B78 A;  5EEO A;  1BSD A;  2XSH B;  1RCL A;  3NBB A;  4CPK A;  3MPH A;  4Q1T A;  6GSP A;  1R4C A;  1RGF A;  2PZV A;  3FKA A;  4KFD A;  4CJN A;  1ISK A;  4EV2 A;  5I97 A;  3HOH A;  2W56 B;  3CPW 2;  1BSB A;  1NB3 I;  1PFP A;  2CC3 A;  4J5K A;  3J7Y d;  1Q40 B;  3Q90 A;  2IMJ A;  2P38 A;  3IPT A;  5CLK A;  1RN7 A;  1UW1 A;  3G0K A;  3K7C A;  2PNC A;  1BRG A;  1F8N A;  2ML5 A;  3PZW A;  4GB5 A;  4N6O B;  3WOE B;  3M4X A;  5AYR B;  3EE1 A;  1DVC A;  1T2H A;  5AYS C;  2F5M A;  3OWS A;  4K61 A;  2OOV C;  2KXG A;  1GMQ A;  1SGV A;  2CX0 A;  2SAR A;  4CI1 B;  3BNE A;  1MNL A;  1OGZ A;  3U28 A;  4KVH A;  3KN4 A;  5D83 A;  1I70 A;  1FYS A;  2GU3 A;  1BAN A;  1CEW I;  1HZ1 A;  1B21 A;  1MWU A;  2XSO B;  3JUQ A;  3EHC A;  1BSE A;  3MG1 A;  1BAO A;  1X1U A;  2D1W A;  1VQ8 3;  1IVU A;  1RGE A;  1GSP A;  2J8X B;  1A67 A;  1IT8 A;  2HVY A;  2EY4 A;  1IV9 A;  1EA2 A;  3KII A;  2CFD A;  3G8Z A;  2P05 A;  1LQM B;  1GY6 A;  1AY7 A;  2KAA A;  2BMO B;  4LZI A;  2GSP A;  1KSI A;  1AQZ A;  3LTD A;  1NB5 I;  3V99 A;  3AMO B;  4I4K A;  3K0Z A;  2HMK B;  5KP4 A;  1OPY A;  3S67 A;  1RN1 A;  3IJE B;  3ZFZ A;  3SXX A;  4MEI A;  3NBJ A;  1A90 A;  4HM4 B;  1MWS A;  5AI1 A;  1OUN A;  5KP3 A;  4N6U A;  2L4V A;  1DMN A;  3S27 A;  4XBY A;  1JB2 A;  1W2B 2;  2XEP A;  3OXA A;  3CD6 3;  5BU4 A;  2AAD A;  4WYK A;  4CCV A;  1DMQ A;  1RNT A;  2F99 A;  2P09 A;  3GWR A;  3LTA A;  1O7M B;  2XFT A;  4R1K A;  1K8A 4;  1IT7 A;  3F9S A;  4HOH A;  2IUK A;  3D5I A;  4FR9 A;  5JPU A;  1YNV X;  1A2K A;  1WK2 A;  1WTH A;  3X3X A;  2HMM B;  4HAA A;  3FG3 A;  1JKG A;  4ILF A;  3DXO A;  4RBN A;  3HZP A;  5DRE A;  1SII A;  2W9Q A;  1NNV A;  1E97 A;  2KCD A;  3OX9 A;  2OOV A;  1NU3 A;  2KRT A;  2UGI A;  3Q2P A;  4Q53 A;  2XF3 A;  3I55 3;  3CCU 3;  2H0G A;  1RCK A;  1BNI A;  3M6W A;  1RGK A;  1TU5 A;  1YIJ 3;  2RFR A;  1N8R 4;  1QVF 2;  2HMJ B;  3CU3 A;  5IG4 A;  2Y74 A;  1E3R A;  1SJW A;  1UDI I;  2YFI B;  3HX8 A;  2AUS A;  1D6U A;  2CH9 A;  4BL3 A;  4TX4 A;  4BTW A;  1AVL A;  1LQG C;  2E5O A;  3UL6 A;  3CC2 3;  4XM4 A;  1BNS A;  1DYU A;  1TRQ A;  4EC6 A;  3A76 A;  1T2I A;  3B4O A;  3RGR A;  2J5V A;  1RKY A;  4L8P A;  1PYL A;  2L1S A;  1VQK 3;  3LZA A;  1Q81 4;  1FW7 A;  5HGR A;  5ELJ A;  3SX1 A;  3NV0 B;  3PS8 A;  1I2G A;  2E2T A;  4HZB B;  4CI3 B;  2AAE A;  2W56 A;  3IMA B;  1B3S A;  4FCM A;  1D6Z A;  2P0X A;  2W2C A;  3MYT A;  5D81 A;  1SQW A;  1JZD A;  2CK3 H;  2WOF A;  2CWW A;  1JJ2 2;  1YVB I;  2K54 A;  3URP A;  1M9G A;  3U97 A;  3N8B A;  2F56 A;  1PU4 A;  2OQE C;  4AKZ A;  1G96 A;  2C4B A;  2XH9 A;  2INX A;  1CYV A;  2YFJ B;  1K9M 4;  1RGA A;  3FF0 A;  5BXQ A;  2APO A;  1V57 A;  4QWT A;  1BGS A;  1STD A;  2CWU A;  1QAK A;  3LDF A;  1IV7 A;  3KFQ C;  2R4I A;  2KKU A;  1JN5 B;  5DRV A;  3KCH A;  1ZE1 A;  3CNM A;  3EBY A;  5AII A;  5IEN A;  3HIG A;  1ZS7 A;  1RRL A;  4GHO A;  1YHQ 3;  1VQQ A;  1ULI B;  2I9W A;  1BSC A;  1W4N A;  4K1V A;  3WOF B;  4R80 A;  4X2H A;  1YJ9 3;  1CYU A;  1W6G A;  1X1W A;  2OWP A;  3EF8 A;  3PGB A;  4GL6 A;  4KFF A;  1BNR A;  4TZ4 C;  1OHO A;  2LQV A;  1IVW A;  2FXT A;  3Q3F A;  1UUW B;  1OHS A;  1IU7 A;  5FGO A;  1W6Y A;  2STD A;  3LML A;  3WDG B;  1GMR A;  1KD1 4;  1V58 A;  1VQ4 3;  1FUW A;  1JRQ A;  1VQM 3;  1YIT 3;  3OV4 A;  6RNT A;  3LWR A;  2BHM A;  1XNE A;  4N6M A;  4NRE A;  3MQK A;  1B20 A;  1LNI A;  1QJG A;  1RGC A;  3NM7 A;  5IG0 A;  1GOY A;  3K63 A;  4HBR A;  3AMO A;  3WA3 A;  4HVN A;  1ZX2 A;  1T5Y A;  2K0M A;  3AGN A;  2C11 A;  1UGH I;  3KSE D;  1BRJ A;  3LWO A;  3KKG A;  3X42 A;  3CCL 3;  3NX0 A;  4JF8 A;  3EC9 A;  2BIR A;  4K1U A;  2H0I A;  4NHF A;  3ZG5 A;  5JBS A;  7RNT A;  3FH1 A;  3X41 A;  1FGQ A;  3CCQ 3;  4HM3 B;  1R3E A;  3DH2 A;  4EYC A;  1J2B A;  4AKY A;  1LNH A;  3KSP A;  1B2U A;  1ULJ B;  2RNT A;  4LSO A;  1IYY A;  1QAF A;  1EUI C;  4FCJ A;  1M90 4;  3CCE 3;  1TRP A;  3NM2 A;  4EW5 A;  1MGW A;  2IA7 A;  3H3H A;  3LOY A;  2V1L A;  3PCR A;  5GSP A;  1VQ9 3;  2R41 A;  3L0R A;  1YGE A;  3V98 A;  4EV5 A;  5IG5 A;  1M1X B;  2GU1 A;  2XRX B;  2CWV A;  3JUO A;  3LH4 A;  1S04 A;  3DGN A;  2QA4 3;  2KF3 A;  2M7O A;  2XR8 B;  2ANE A;  1VQ5 3;  2W0Q A;  5AEU B;  3DGY A;  5BVB A;  4AEQ A;  3EQQ B;  5EVH A;  1BUJ A;  1LVN A;  1DVD A;  3UNL A;  3QRD A;  1MGR A;  2F4Y A;  4BTX A;  4FMC A;  1JBS A;  3WOD G;  3UJM A;  3F40 A;  4MMZ B;  1FUS A;  2BO9 B;  1GMP A;  3SVA A;  1JNQ A;  1X1Y A;  3MHE A;  3GZX B;  3TDG A;  1BIR A;  3OW2 2;  1FZU A;  3NQZ A;  4CDL A;  2F5W A;  4N3V A;  2CX1 A;  2HML B;  3VSY A;  3MG2 A;  4EBG A;  1BRN L;  1I3I A;  3T0U A;  3X3Y A;  3F7X A;  1T3B A;  2DP9 A;  1OF5 B;  3LTB A;  1RJO A;  4FCZ A;  2HMO B;  2XFS A;  3EB8 A;  1N9J A;  1EEJ A;  1IVV A;  1NDO B;  2CW9 A;  1RDS A;  4XBX A;  3CXC 2;  1TP6 A;  3ALA A;  1JBT A; 
#chains in the Genus database with same CATH homology
 1T5Y A;  1ZS7 A;  2J5T A;  2J5V A;  1IQ8 A;  3C0K A;  1ZL3 A;  1SGV A;  2CX0 A;  1K8W A;  2B78 A;  4DMG A;  3D79 A;  4Q1T A;  1WXW A;  1Q7H A;  1SQW A;  2CWW A;  1R3E A;  1J2B A;  3VSE A;  2CX1 A;  2Q07 A;  2P38 A;  2AB4 A;  1IT8 A;  1ZE2 A;  3UAI A;  3LDF A;  1IT7 A;  2AS0 A;  1WXX A;  1R3F A;  1ZE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...