1Q7HA

Structure of a conserved pua domain protein from thermoplasma acidophilum
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
151
structure length
151
Chain Sequence
b'SKHFISKKEAKRIWEQMSRYGIDITGESLEVAAQKSASAYYIGGKPMVFQAGDLIPSVYLLNYRNPSRNIVTVDEGAEPHILNGSDLFAPGIVSMDDSIRKGDMIFVKSSKGYFIAVGMAEMDAGEVMATKRGKAARIIHFPGDELIRAFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Structure of a conserved hypothetical protein from T. acidophilum
rcsb
source organism Thermoplasma acidophilum dsm 1728
molecule tags Structural genomics, unknown function
total genus 30
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2003-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01472 PUA PUA domain
A PF09183 DUF1947 Domain of unknown function (DUF1947)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 1q7hA02
3.10.450.120 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Pre-PUA domain; domain 1 1q7hA01
1T5YA 3D79A 1ZS7A 3LDFA 4DMGA 1R3FA 1Q7HA 2AS0A 1SGVA 1IQ8A 3C0KA 2J5TA 1R3EA 2P38A 2Q07A 1ZE1A 3VSEA 2CX0A 2AB4A 3UAIA 1J2BA 1ZL3A 1IT7A 1IT8A 4Q1TA 2CX1A 1SQWA 1ZE2A 1WXXA 2J5VA 2B78A 1WXWA 2CWWA 1K8WA
chains in the Genus database with same CATH superfamily
1ZS7A 5ELUA 1AVKA 1GOYA 2XRXB 1FUWA 1R3FA 1TFKA 1B2UA 3CCR3 1JZOA 1S5AA 2P09A 2CFGA 3CPW2 5IG5A 1FGQA 2B24B 1DETA 2GXFA 2OQEC 2XGLA 3N9HA 3UNLA 1VQ53 3LOYA 5G2GA 3ECFA 1BRHA 1D6UA 1WK2A 4CI2B 3V92A 2F5MA 2C10A 1J2BA 4PEJA 2DP9A 1O7WB 4CCVA 1IT7A 4Q1TA 3F40A 1ZBOA 1TRPA 1Q814 2HVYA 4QWTA 4HKVB 4KZ1A 1VQL3 5JPUA 3V99A 1AQZA 3LTAA 5ELJA 1RTUA 1K9M4 3VGNA 1XNEA 1LQMB 1ROVA 2O9UX 2CWVA 3FSDA 1IVUA 1W6CA 3G8ZA 5BIRA 3HI7A 1NO3A 3NM2A 2FGTA 2W2CA 3ALAA 4J9AA 1WMPA 5RNTA 1ISKA 1DE3A 1CQSA 2BT3A 2O3OA 1I2EA 2BHMA 1IV9A 4WHAA 4HM0B 3ZFZA 2L4VA 3CCE3 3G6E3 2J8XB 5AI1A 3SX1A 2CFKA 4HZ9B 3RGAA 3DUKA 1BRGA 1EEJA 1ROAA 4I5QA 5CXOA 1FUTA 3IPTA 4FMCA 1OHSA 4N6UA 5BU4A 3M4XA 2QA43 1GYBA 2M7OA 2F56A 3HZPA 3CCS3 1CYUA 1JV2B 1L5GB 2F5WA 1UW1A 3ER7A 3ZG0A 1JRQA 2IA7A 1UGHI 4WWUC 1F8NA 1BRJA 1LQGC 2FXTA 2HMJB 5LC7A 4AKZA 1K8A4 3EN8A 2KF5A 3S27A 4NREA 3BNBA 1M1K4 2J5TA 4G1MB 1EG9B 3PXMA 5JPPA 3HJYA 2CHCA 1V57A 4BIRA 3OW22 4FCZA 2W56A 4N6NB 3S67A 2D42A 1IVVA 3I563 1RN4A 1YJW3 1LVNA 2WGQA 1I0XA 1I0VA 3M65A 3B4PA 2H0GA 4R9LA 2CH9A 1EUIC 2BIRA 2HMOB 4L8PA 1VQM3 3MPHA 1TTOA 3F8HA 2CK3H 1B20A 1MGRA 1Q864 2GEXA 4GSPA 1YVSA 4K1UA 4MMZB 3PYJA 1VQ73 2RSXA 1TE7A 3AHSA 3CU3A 1TP6A 3NV0A 4FMBA 1BNSA 2KCDA 1YJN3 1JKGA 1SPUA 1FUSA 1A2VA 1Q40A 2K3DA 5KP3A 3IUWA 1JB5A 3NBRA 1AVLA 1YNVX 3PCSA 2Q07A 1UUGB 2XF3A 2CFDA 3WHOA 3A76A 5IG0A 1TJDA 3NX0A 3SOYA 1X1WA 1GD4A 3DXOA 2EY4A 1VQN3 1VQ83 2KXGA 4EYCA 2CFLA 1IT8A 2R41A 1S723 3GAXA 1TIJA 1DYUA 3KKGA 5G1LA 5A0OB 2HOHA 4K1VA 5FGOA 1O7HB 3K9MC 4BTWA 3MKIA 2CX1A 2UGIA 1TU5A 3K7CA 3DGOA 2J5VA 2Y73A 4LGQA 1IQXA 2E2UA 4OK0A 4RNTA 4FCMA 3CD63 2A15A 3L0RA 3KSPA 3WMDA 1RDSA 1RGFA 3M6WA 5AYRB 1GY5A 1VQK3 3MG1A 2CIUA 1HYFA 2Z76A 3NHXA 5I97A 5G1KA 3HK4A 3CC43 2E2TA 2WOHA 4X2OA 1OGXA 1IYYA 1STDA 1PYLA 1GMPA 2OQEA 4AKYA 1BUJA 5AIIA 1RGCA 1X1XA 3FG4A 4Q53A 3OWYA 1IVXA 2R4IA 1G96A 5HGRA 1BNFA 3JUOA 2IUKA 4MEIA 4R80A 2APOA 3K5TA 3NQZA 1W6GA 1OUNA 3EBYA 3KCHA 4KFFA 2ML5A 3PS8A 3M6UA 3D5GA 4RZMA 1AR0A 2GU1A 3OV4A 1HKXA 4TZ4C 1BANA 3SLUA 1R3EA 3JUPA 4LSOA 1YGWA 2AADA 1YJ93 1JN5B 3X42A 3NM7A 4IIAA 4GHOA 1NB3I 1GMQA 4HM8B 1T2HA 2CX0A 3HAXA 3UAIA 3AGNA 4R4KA 4XBXA 3FF2A 2W0QA 1SIHA 3FGYA 3V98A 3X40A 2ML6A 4HM3B 1I8VA 2JDIH 3KZTA 1D6ZA 1RHLA 2F4YA 8CHOA 3RNTA 1GY6A 2Z6BA 1S04A 4H61A 3RDEA 3WR2A 3CCQ3 1NDOB 5IEPA 2H0IA 4BTXA 1B21A 1LXEA 1BSDA 1V58A 4DKIA 6GSPA 1WNHA 1YHQ3 2QIYA 5BVBA 4TX4A 5D81A 1B2MA 1RGEA 4OUQA 1UCLA 6RNTA 2L1SA 4KT3B 4JRFA 1YI23 1FGMA 1UGIA 2MC8A 3JUQA 1UDII 2D1WA 2IUJA 1M1XB 3GZXB 1BNEA 1RJOA 7STDA 2AB4A 2BO9B 4H3UA 1BSAA 1CYVA 1T2IA 1I3FA 3EF8A 3ROBA 3Q90A 4FMAA 1QVG2 1W5ZA 2WOFA 2WGOA 3STDA 6STDA 2OCTA 1RN7A 4OVMA 2BU4A 1UUVB 2BMRB 1N5PA 2YFLB 4K61A 1NNVA 1SQWA 1ZE2A 1WXXA 2BMQB 5DRVA 5EEOA 4L8OA 3AMOB 5IENA 1E97A 1UI7A 3LDFA 1Q42A 2ZHXB 3D9RA 5IG3A 3BNDA 1BNJA 1X1YA 5AIGA 3TDGA 1JJ22 1RNTA 2AS0A 5JBSA 2ZL8A 1GOVA 3CCV3 4FCJA 3DM8A 3M8CA 1JBTA 3F7XA 1O7PB 5DREA 4KFEA 3VF1A 2BNGA 1TFOA 3UJMA 1ULIB 1FYSA 1QMAA 4RNYA 3Q1CA 3B7CA 4KFDA 2F86B 2LQVA 1GS3A 3WOEB 3ZV0C 1RGLA 1FGOA 5AIFA 3URPA 3X3YA 3CCM3 1QAFA 1RRHA 4O02B 3D5IA 1W02A 2KF6A 2KF3A 3T8NA 2QGUA 1W4NA 4LMIA 5M19A 1B27A 1W6YA 3UB1A 2XH9A 1OF5A 2XFSA 4ILFA 1TUHA 2XEPA 3LXUX 2W6JH 2XSOB 2STDA 2C4BA 4RNZA 3NBJA 3OWSA 2RNTA 1MWRA 4HBRA 4R1KA 2YX9A 3DMCA 4EV2A 3EX9A 3G4S3 2XR8B 2RFKA 1RSNA 8RNTA 1KD14 2SBLA 2W56B 3AGOA 1O7NB 1IQYA 4JF8A 5AYSC 1ZX2A 2RBIA 3CCJ3 3FH1A 1RCKA 3KN4A 1R4CA 4N6V0 4NPBA 2YFJB 3DGLA 1GD3A 1ZL3A 1IU7A 1N8QA 1HZ1A 3LTCA 1E3VA 7RNTA 1I3IA 4O3VA 1QAKA 5GSPA 4KVHA 1R4YA 3NQYA 2I9WA 1RRLA 4WYKA 1BRIA 3GSPA 4N6MA 1LNHA 1BRNL 5TGNA 1NU3A 4WFOA 3LWPA 4HM1B 3H3HA 3D79A 1LNIA 4J8TA 4RBNA 3WDGB 3GZYB 2K54A 3NV0B 1Q7HA 3JUNA 3RGRA 3KIIA 4XDWA 3S5CA 1AY7A 1RCLA 1JKGB 3FG1A 4LZIA 5EVHA 1K41A 1B2XA 3PGBA 1FA3A 2W04A 1NWWA 1VZZA 4J5KA 2ZDJA 3D4AA 1FGTA 2CG1A 1UCIA 3LZAA 1MWSA 2GU3A 3HIIA 3MG2A 4NHFA 1BAOA 3SYUA 4GL6A 1KQS2 1N9EA 1RNBA 1BNRA 1IVWA 2CFWA 2JQ5A 1OPYA 1QJGA 2PZVA 1X1UA 3Q3FA 1C54A 3GRDA 3DGNA 1BUQA 1DVDA 2YFIB 3LMLA 1BRKA 4HM6B 3FZWA 1IK3A 2OTL3 1RGKA 2C11A 1EQKA 1BNGA 1Z1SA 2Z7AA 4XBYA 3BIRA 1I70A 1PFPA 2XFTA 1ULJB 4HM5B 1C7HA 1LRAA 1N5HA 1RGHA 3HJWA 2MF7A 1B3SA 4STDA 2W03A 3MG3A 1LOXA 3LJCA 1WMOA 3X41A 1AV4A 5FW5A 5M1AA 4N6OB 4N6LA 3JVCA 4XM4A 1IQ8A 1MGWA 1UUWB 3GWRA 1LOWA 3CNXA 1VQ93 1ZE1A 5IERA 1RGGA 3K0ZA 2SARA 3F9SA 3N8BA 2GBXB 2FRXA 4R9KA 3WODG 5CF2A 1VQ43 1QVF2 3LTDA 5CK6A 3KSED 1CH0A 3F7SA 3U28A 3H51A 1RKYA 1YIT3 2CWUA 3G713 3FG3A 1JNQA 1W2ZA 3D3LA 1SJWA 3K63A 2KF4A 4HM7B 4HOHA 5IW9A 1A67A 4HYZA 1BSEA 5STDA 3DY5A 1LOVA 1K734 2CWWA 1JB4A 4CI1B 5LC6A 4DMGA 2IY2A 3FKAA 3HOHA 2V1LA 1UI8A 3IJEB 3LTBA 1RLSA 3LWRA 1GMRA 2OOVC 7GSPA 5AIHA 2CC3A 2WO0A 1A90A 1SGVA 1MWTA 1W7CA 2ZA4A 1OCVA 3BU4A 3F14A 1JBRA 1MNLA 4GB5A 3N54B 2IMJA 1BRSA 4CJNA 3ZG5A 2KKUA 5EQLA 3MQKA 3SEDA 5D82A 2FNQA 2W9PA 1JBSA 3OWUA 1MOLA 1WMNA 3HIGA 3PZWA 4ORLA 3BNCA 5D83A 1N8R4 3E99A 3NBBA 1OGZA 3LWQA 4CPKA 3CXC2 3AMOA 1BOXA 3MSOA 4HVNA 1FGRA 3LWOA 2RGQA 1A2KA 3PCRA 3CNMA 3EJVA 9RNTA 1IV7A 3CCL3 5CF1A 1U8CB 1W2B2 1K8WA 3JUMA 1RMSA 1UCKA 2W9QA 4U13A 4HJLB 3U97A 1MWUA 2PNCA 2GEYA 2Y74A 4N3VA 4MMYB 4EC6A 2UX0A 1A2PA 2AAEA 1BGSA 4N6TA 1M9GA 2P05A 2Z77A 3DGYA 3DH2A 3EN1B 3FLJA 1TRQA 1DVCA 3QK9A 1EA2A 4WP5A 1BSBA 1UCJA 2K0MA 2CWTA 1Q7Y4 5IEOA 3NUVA 1IDPA 2F99A 4LEHA 1O7GB 3X3ZA 1U5OA 1DMNA 1EKMA 1BU4A 3GZBA 3DZLA 3U1WA 4HAAA 3UL5A 2ANEA 3FF0A 3SOAA 2E2VA 3NXJA 2B78A 1JZDA 2Z0TA 4MJDA 1HU9A 3OXAA 2UUGC 4XB5A 3BNEA 3HX8A 4EXRA 3T8UA 1B2ZA 5IF6A 3CCU3 1K28A 2HMKB 3LH4A 2AUSA 1W01A 3C0KA 2P38A 1DMMA 4ZM8A 1VQO3 3LYGA 4HZBB 1NJI4 2KAAA 3LT8A 1I2GA 1T3BA 4IPBA 4O2HA 4O8SA 4BU4A 1WTHA 1YIJ3 1W00A 4CI3B 5HOHA 1OHOA 3CME3 1OACA 3MYTA 1SIIA 1QALA 2HMLB 4LYLB 5BXQA 3VSYA 3F8XA 3UL6A 1STFI 1NB5I 1ASKA 3KFQC 3MHEA 1VQ63 3S29A 2B1XB 3A5EA 3B4OA 3I0YA 1Q824 3KE7A 2IYJA 1O7MB 1WXWA 5KP4A 1T5YA 3WA3A 1OF5B 2CKFB 3EB8A 2HMMB 3MWZA 3G16A 2KRTA 3T0UA 2BMOB 1GSPA 1DMQA 1Q40B 3EHCA 3I553 2P0XA 1FW7A 1YGEA 3SXXA 3CMA3 2LYXA 3AHWA 4FMDA 2P0MA 4K90B 1KSIA 3CC23 4XDVA 3M6VA 3DGMA 2F98A 3IMAB 2HMNB 1PU4A 3S28A 4EV5A 4I4KA 2OTJ3 4BL2A 2RCDA 2XGNA 3EQQB 2OWPA 4AEQA 4HM2B 4X2HA 3SVAA 4L7KA 1ZO2A 1Q9EA 3OX9A 3G0KA 1PY3A 1G02A 4MMXB 4WYKB 3WOFB 5M18A 1WQLB 1BVIA 4EW5A 1D6YA 3FCSB 1G0TA 3B8LA 1I2FA 2XSHB 1RN1A 2CW9A 3BLZA 4BTYA 5KP1A 1BNIA 3GZRA 1M904 4IT7A 3BB9A 3LWVA 1OH0A 1GY7A 1UOYA 1FZUA 1US1A 1VQQA 1N9JA 1Y4KA 4J5GA 5AEWB 1YVBI 3CC73 1BIRA 1JN5A 3M6XA 3EC9A 4CDLA 3O8YA 1VQP3 3EE1A 3WA2X 1V74A 2CG0A 3QRDA 3LT9A 3VSEA 1BSCA 1SARA 3EBTA 1JB2A 2OOVA 1KWIA 1LOYA 1GOUA 1E3RA 2GBWB 5AEUB 1OHPA 2RFRA 3X3XA 2E5OA 2GSPA 5CLKA 2H0HA 3CPOA 4FR9A 4BL3A 1B2SA 2QEX3 3J7Yd 1KC84 1ZGXA 4XBTA 4HM4B 1CEWI 5IG4A 2INXA 3Q2PA 4EBGA 1RGAA
chains in the Genus database with same CATH topology
1T5YA 3D79A 1ZS7A 3LDFA 4DMGA 1R3FA 1Q7HA 2AS0A 1SGVA 1IQ8A 3C0KA 2J5TA 1R3EA 2P38A 2Q07A 1ZE1A 3VSEA 2CX0A 2AB4A 3UAIA 1J2BA 1ZL3A 1IT7A 1IT8A 4Q1TA 2CX1A 1SQWA 1ZE2A 1WXXA 2J5VA 2B78A 1WXWA 2CWWA 1K8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T5Y A;  3D79 A;  1ZS7 A;  3LDF A;  4DMG A;  1R3F A;  1Q7H A;  2AS0 A;  1SGV A;  1IQ8 A;  3C0K A;  2J5T A;  1R3E A;  2P38 A;  2Q07 A;  1ZE1 A;  3VSE A;  2CX0 A;  2AB4 A;  3UAI A;  1J2B A;  1ZL3 A;  1IT7 A;  1IT8 A;  4Q1T A;  2CX1 A;  1SQW A;  1ZE2 A;  1WXX A;  2J5V A;  2B78 A;  1WXW A;  2CWW A;  1K8W A; 
#chains in the Genus database with same CATH topology
 1ZS7 A;  5ELU A;  1AVK A;  1GOY A;  2XRX B;  1FUW A;  1R3F A;  1TFK A;  1B2U A;  3CCR 3;  1JZO A;  1S5A A;  2P09 A;  2CFG A;  3CPW 2;  5IG5 A;  1FGQ A;  2B24 B;  1DET A;  2GXF A;  2OQE C;  2XGL A;  3N9H A;  3UNL A;  1VQ5 3;  3LOY A;  5G2G A;  3ECF A;  1BRH A;  1D6U A;  1WK2 A;  4CI2 B;  3V92 A;  2F5M A;  2C10 A;  1J2B A;  4PEJ A;  2DP9 A;  1O7W B;  4CCV A;  1IT7 A;  4Q1T A;  3F40 A;  1ZBO A;  1TRP A;  1Q81 4;  2HVY A;  4QWT A;  4HKV B;  4KZ1 A;  1VQL 3;  5JPU A;  3V99 A;  1AQZ A;  3LTA A;  5ELJ A;  1RTU A;  1K9M 4;  3VGN A;  1XNE A;  1LQM B;  1ROV A;  2O9U X;  2CWV A;  3FSD A;  1IVU A;  1W6C A;  3G8Z A;  5BIR A;  3HI7 A;  1NO3 A;  3NM2 A;  2FGT A;  2W2C A;  3ALA A;  4J9A A;  1WMP A;  5RNT A;  1ISK A;  1DE3 A;  1CQS A;  2BT3 A;  2O3O A;  1I2E A;  2BHM A;  1IV9 A;  4WHA A;  4HM0 B;  3ZFZ A;  2L4V A;  3CCE 3;  3G6E 3;  2J8X B;  5AI1 A;  3SX1 A;  2CFK A;  4HZ9 B;  3RGA A;  3DUK A;  1BRG A;  1EEJ A;  1ROA A;  4I5Q A;  5CXO A;  1FUT A;  3IPT A;  4FMC A;  1OHS A;  4N6U A;  5BU4 A;  3M4X A;  2QA4 3;  1GYB A;  2M7O A;  2F56 A;  3HZP A;  3CCS 3;  1CYU A;  1JV2 B;  1L5G B;  2F5W A;  1UW1 A;  3ER7 A;  3ZG0 A;  1JRQ A;  2IA7 A;  1UGH I;  4WWU C;  1F8N A;  1BRJ A;  1LQG C;  2FXT A;  2HMJ B;  5LC7 A;  4AKZ A;  1K8A 4;  3EN8 A;  2KF5 A;  3S27 A;  4NRE A;  3BNB A;  1M1K 4;  2J5T A;  4G1M B;  1EG9 B;  3PXM A;  5JPP A;  3HJY A;  2CHC A;  1V57 A;  4BIR A;  3OW2 2;  4FCZ A;  2W56 A;  4N6N B;  3S67 A;  2D42 A;  1IVV A;  3I56 3;  1RN4 A;  1YJW 3;  1LVN A;  2WGQ A;  1I0X A;  1I0V A;  3M65 A;  3B4P A;  2H0G A;  4R9L A;  2CH9 A;  1EUI C;  2BIR A;  2HMO B;  4L8P A;  1VQM 3;  3MPH A;  1TTO A;  3F8H A;  2CK3 H;  1B20 A;  1MGR A;  1Q86 4;  2GEX A;  4GSP A;  1YVS A;  4K1U A;  4MMZ B;  3PYJ A;  1VQ7 3;  2RSX A;  1TE7 A;  3AHS A;  3CU3 A;  1TP6 A;  3NV0 A;  4FMB A;  1BNS A;  2KCD A;  1YJN 3;  1JKG A;  1SPU A;  1FUS A;  1A2V A;  1Q40 A;  2K3D A;  5KP3 A;  3IUW A;  1JB5 A;  3NBR A;  1AVL A;  1YNV X;  3PCS A;  2Q07 A;  1UUG B;  2XF3 A;  2CFD A;  3WHO A;  3A76 A;  5IG0 A;  1TJD A;  3NX0 A;  3SOY A;  1X1W A;  1GD4 A;  3DXO A;  2EY4 A;  1VQN 3;  1VQ8 3;  2KXG A;  4EYC A;  2CFL A;  1IT8 A;  2R41 A;  1S72 3;  3GAX A;  1TIJ A;  1DYU A;  3KKG A;  5G1L A;  5A0O B;  2HOH A;  4K1V A;  5FGO A;  1O7H B;  3K9M C;  4BTW A;  3MKI A;  2CX1 A;  2UGI A;  1TU5 A;  3K7C A;  3DGO A;  2J5V A;  2Y73 A;  4LGQ A;  1IQX A;  2E2U A;  4OK0 A;  4RNT A;  4FCM A;  3CD6 3;  2A15 A;  3L0R A;  3KSP A;  3WMD A;  1RDS A;  1RGF A;  3M6W A;  5AYR B;  1GY5 A;  1VQK 3;  3MG1 A;  2CIU A;  1HYF A;  2Z76 A;  3NHX A;  5I97 A;  5G1K A;  3HK4 A;  3CC4 3;  2E2T A;  2WOH A;  4X2O A;  1OGX A;  1IYY A;  1STD A;  1PYL A;  1GMP A;  2OQE A;  4AKY A;  1BUJ A;  5AII A;  1RGC A;  1X1X A;  3FG4 A;  4Q53 A;  3OWY A;  1IVX A;  2R4I A;  1G96 A;  5HGR A;  1BNF A;  3JUO A;  2IUK A;  4MEI A;  4R80 A;  2APO A;  3K5T A;  3NQZ A;  1W6G A;  1OUN A;  3EBY A;  3KCH A;  4KFF A;  2ML5 A;  3PS8 A;  3M6U A;  3D5G A;  4RZM A;  1AR0 A;  2GU1 A;  3OV4 A;  1HKX A;  4TZ4 C;  1BAN A;  3SLU A;  1R3E A;  3JUP A;  4LSO A;  1YGW A;  2AAD A;  1YJ9 3;  1JN5 B;  3X42 A;  3NM7 A;  4IIA A;  4GHO A;  1NB3 I;  1GMQ A;  4HM8 B;  1T2H A;  2CX0 A;  3HAX A;  3UAI A;  3AGN A;  4R4K A;  4XBX A;  3FF2 A;  2W0Q A;  1SIH A;  3FGY A;  3V98 A;  3X40 A;  2ML6 A;  4HM3 B;  1I8V A;  2JDI H;  3KZT A;  1D6Z A;  1RHL A;  2F4Y A;  8CHO A;  3RNT A;  1GY6 A;  2Z6B A;  1S04 A;  4H61 A;  3RDE A;  3WR2 A;  3CCQ 3;  1NDO B;  5IEP A;  2H0I A;  4BTX A;  1B21 A;  1LXE A;  1BSD A;  1V58 A;  4DKI A;  6GSP A;  1WNH A;  1YHQ 3;  2QIY A;  5BVB A;  4TX4 A;  5D81 A;  1B2M A;  1RGE A;  4OUQ A;  1UCL A;  6RNT A;  2L1S A;  4KT3 B;  4JRF A;  1YI2 3;  1FGM A;  1UGI A;  2MC8 A;  3JUQ A;  1UDI I;  2D1W A;  2IUJ A;  1M1X B;  3GZX B;  1BNE A;  1RJO A;  7STD A;  2AB4 A;  2BO9 B;  4H3U A;  1BSA A;  1CYV A;  1T2I A;  1I3F A;  3EF8 A;  3ROB A;  3Q90 A;  4FMA A;  1QVG 2;  1W5Z A;  2WOF A;  2WGO A;  3STD A;  6STD A;  2OCT A;  1RN7 A;  4OVM A;  2BU4 A;  1UUV B;  2BMR B;  1N5P A;  2YFL B;  4K61 A;  1NNV A;  1SQW A;  1ZE2 A;  1WXX A;  2BMQ B;  5DRV A;  5EEO A;  4L8O A;  3AMO B;  5IEN A;  1E97 A;  1UI7 A;  3LDF A;  1Q42 A;  2ZHX B;  3D9R A;  5IG3 A;  3BND A;  1BNJ A;  1X1Y A;  5AIG A;  3TDG A;  1JJ2 2;  1RNT A;  2AS0 A;  5JBS A;  2ZL8 A;  1GOV A;  3CCV 3;  4FCJ A;  3DM8 A;  3M8C A;  1JBT A;  3F7X A;  1O7P B;  5DRE A;  4KFE A;  3VF1 A;  2BNG A;  1TFO A;  3UJM A;  1ULI B;  1FYS A;  1QMA A;  4RNY A;  3Q1C A;  3B7C A;  4KFD A;  2F86 B;  2LQV A;  1GS3 A;  3WOE B;  3ZV0 C;  1RGL A;  1FGO A;  5AIF A;  3URP A;  3X3Y A;  3CCM 3;  1QAF A;  1RRH A;  4O02 B;  3D5I A;  1W02 A;  2KF6 A;  2KF3 A;  3T8N A;  2QGU A;  1W4N A;  4LMI A;  5M19 A;  1B27 A;  1W6Y A;  3UB1 A;  2XH9 A;  1OF5 A;  2XFS A;  4ILF A;  1TUH A;  2XEP A;  3LXU X;  2W6J H;  2XSO B;  2STD A;  2C4B A;  4RNZ A;  3NBJ A;  3OWS A;  2RNT A;  1MWR A;  4HBR A;  4R1K A;  2YX9 A;  3DMC A;  4EV2 A;  3EX9 A;  3G4S 3;  2XR8 B;  2RFK A;  1RSN A;  8RNT A;  1KD1 4;  2SBL A;  2W56 B;  3AGO A;  1O7N B;  1IQY A;  4JF8 A;  5AYS C;  1ZX2 A;  2RBI A;  3CCJ 3;  3FH1 A;  1RCK A;  3KN4 A;  1R4C A;  4N6V 0;  4NPB A;  2YFJ B;  3DGL A;  1GD3 A;  1ZL3 A;  1IU7 A;  1N8Q A;  1HZ1 A;  3LTC A;  1E3V A;  7RNT A;  1I3I A;  4O3V A;  1QAK A;  5GSP A;  4KVH A;  1R4Y A;  3NQY A;  2I9W A;  1RRL A;  4WYK A;  1BRI A;  3GSP A;  4N6M A;  1LNH A;  1BRN L;  5TGN A;  1NU3 A;  4WFO A;  3LWP A;  4HM1 B;  3H3H A;  3D79 A;  1LNI A;  4J8T A;  4RBN A;  3WDG B;  3GZY B;  2K54 A;  3NV0 B;  1Q7H A;  3JUN A;  3RGR A;  3KII A;  4XDW A;  3S5C A;  1AY7 A;  1RCL A;  1JKG B;  3FG1 A;  4LZI A;  5EVH A;  1K41 A;  1B2X A;  3PGB A;  1FA3 A;  2W04 A;  1NWW A;  1VZZ A;  4J5K A;  2ZDJ A;  3D4A A;  1FGT A;  2CG1 A;  1UCI A;  3LZA A;  1MWS A;  2GU3 A;  3HII A;  3MG2 A;  4NHF A;  1BAO A;  3SYU A;  4GL6 A;  1KQS 2;  1N9E A;  1RNB A;  1BNR A;  1IVW A;  2CFW A;  2JQ5 A;  1OPY A;  1QJG A;  2PZV A;  1X1U A;  3Q3F A;  1C54 A;  3GRD A;  3DGN A;  1BUQ A;  1DVD A;  2YFI B;  3LML A;  1BRK A;  4HM6 B;  3FZW A;  1IK3 A;  2OTL 3;  1RGK A;  2C11 A;  1EQK A;  1BNG A;  1Z1S A;  2Z7A A;  4XBY A;  3BIR A;  1I70 A;  1PFP A;  2XFT A;  1ULJ B;  4HM5 B;  1C7H A;  1LRA A;  1N5H A;  1RGH A;  3HJW A;  2MF7 A;  1B3S A;  4STD A;  2W03 A;  3MG3 A;  1LOX A;  3LJC A;  1WMO A;  3X41 A;  1AV4 A;  5FW5 A;  5M1A A;  4N6O B;  4N6L A;  3JVC A;  4XM4 A;  1IQ8 A;  1MGW A;  1UUW B;  3GWR A;  1LOW A;  3CNX A;  1VQ9 3;  1ZE1 A;  5IER A;  1RGG A;  3K0Z A;  2SAR A;  3F9S A;  3N8B A;  2GBX B;  2FRX A;  4R9K A;  3WOD G;  5CF2 A;  1VQ4 3;  1QVF 2;  3LTD A;  5CK6 A;  3KSE D;  1CH0 A;  3F7S A;  3U28 A;  3H51 A;  1RKY A;  1YIT 3;  2CWU A;  3G71 3;  3FG3 A;  1JNQ A;  1W2Z A;  3D3L A;  1SJW A;  3K63 A;  2KF4 A;  4HM7 B;  4HOH A;  5IW9 A;  1A67 A;  4HYZ A;  1BSE A;  5STD A;  3DY5 A;  1LOV A;  1K73 4;  2CWW A;  1JB4 A;  4CI1 B;  5LC6 A;  4DMG A;  2IY2 A;  3FKA A;  3HOH A;  2V1L A;  1UI8 A;  3IJE B;  3LTB A;  1RLS A;  3LWR A;  1GMR A;  2OOV C;  7GSP A;  5AIH A;  2CC3 A;  2WO0 A;  1A90 A;  1SGV A;  1MWT A;  1W7C A;  2ZA4 A;  1OCV A;  3BU4 A;  3F14 A;  1JBR A;  1MNL A;  4GB5 A;  3N54 B;  2IMJ A;  1BRS A;  4CJN A;  3ZG5 A;  2KKU A;  5EQL A;  3MQK A;  3SED A;  5D82 A;  2FNQ A;  2W9P A;  1JBS A;  3OWU A;  1MOL A;  1WMN A;  3HIG A;  3PZW A;  4ORL A;  3BNC A;  5D83 A;  1N8R 4;  3E99 A;  3NBB A;  1OGZ A;  3LWQ A;  4CPK A;  3CXC 2;  3AMO A;  1BOX A;  3MSO A;  4HVN A;  1FGR A;  3LWO A;  2RGQ A;  1A2K A;  3PCR A;  3CNM A;  3EJV A;  9RNT A;  1IV7 A;  3CCL 3;  5CF1 A;  1U8C B;  1W2B 2;  1K8W A;  3JUM A;  1RMS A;  1UCK A;  2W9Q A;  4U13 A;  4HJL B;  3U97 A;  1MWU A;  2PNC A;  2GEY A;  2Y74 A;  4N3V A;  4MMY B;  4EC6 A;  2UX0 A;  1A2P A;  2AAE A;  1BGS A;  4N6T A;  1M9G A;  2P05 A;  2Z77 A;  3DGY A;  3DH2 A;  3EN1 B;  3FLJ A;  1TRQ A;  1DVC A;  3QK9 A;  1EA2 A;  4WP5 A;  1BSB A;  1UCJ A;  2K0M A;  2CWT A;  1Q7Y 4;  5IEO A;  3NUV A;  1IDP A;  2F99 A;  4LEH A;  1O7G B;  3X3Z A;  1U5O A;  1DMN A;  1EKM A;  1BU4 A;  3GZB A;  3DZL A;  3U1W A;  4HAA A;  3UL5 A;  2ANE A;  3FF0 A;  3SOA A;  2E2V A;  3NXJ A;  2B78 A;  1JZD A;  2Z0T A;  4MJD A;  1HU9 A;  3OXA A;  2UUG C;  4XB5 A;  3BNE A;  3HX8 A;  4EXR A;  3T8U A;  1B2Z A;  5IF6 A;  3CCU 3;  1K28 A;  2HMK B;  3LH4 A;  2AUS A;  1W01 A;  3C0K A;  2P38 A;  1DMM A;  4ZM8 A;  1VQO 3;  3LYG A;  4HZB B;  1NJI 4;  2KAA A;  3LT8 A;  1I2G A;  1T3B A;  4IPB A;  4O2H A;  4O8S A;  4BU4 A;  1WTH A;  1YIJ 3;  1W00 A;  4CI3 B;  5HOH A;  1OHO A;  3CME 3;  1OAC A;  3MYT A;  1SII A;  1QAL A;  2HML B;  4LYL B;  5BXQ A;  3VSY A;  3F8X A;  3UL6 A;  1STF I;  1NB5 I;  1ASK A;  3KFQ C;  3MHE A;  1VQ6 3;  3S29 A;  2B1X B;  3A5E A;  3B4O A;  3I0Y A;  1Q82 4;  3KE7 A;  2IYJ A;  1O7M B;  1WXW A;  5KP4 A;  1T5Y A;  3WA3 A;  1OF5 B;  2CKF B;  3EB8 A;  2HMM B;  3MWZ A;  3G16 A;  2KRT A;  3T0U A;  2BMO B;  1GSP A;  1DMQ A;  1Q40 B;  3EHC A;  3I55 3;  2P0X A;  1FW7 A;  1YGE A;  3SXX A;  3CMA 3;  2LYX A;  3AHW A;  4FMD A;  2P0M A;  4K90 B;  1KSI A;  3CC2 3;  4XDV A;  3M6V A;  3DGM A;  2F98 A;  3IMA B;  2HMN B;  1PU4 A;  3S28 A;  4EV5 A;  4I4K A;  2OTJ 3;  4BL2 A;  2RCD A;  2XGN A;  3EQQ B;  2OWP A;  4AEQ A;  4HM2 B;  4X2H A;  3SVA A;  4L7K A;  1ZO2 A;  1Q9E A;  3OX9 A;  3G0K A;  1PY3 A;  1G02 A;  4MMX B;  4WYK B;  3WOF B;  5M18 A;  1WQL B;  1BVI A;  4EW5 A;  1D6Y A;  3FCS B;  1G0T A;  3B8L A;  1I2F A;  2XSH B;  1RN1 A;  2CW9 A;  3BLZ A;  4BTY A;  5KP1 A;  1BNI A;  3GZR A;  1M90 4;  4IT7 A;  3BB9 A;  3LWV A;  1OH0 A;  1GY7 A;  1UOY A;  1FZU A;  1US1 A;  1VQQ A;  1N9J A;  1Y4K A;  4J5G A;  5AEW B;  1YVB I;  3CC7 3;  1BIR A;  1JN5 A;  3M6X A;  3EC9 A;  4CDL A;  3O8Y A;  1VQP 3;  3EE1 A;  3WA2 X;  1V74 A;  2CG0 A;  3QRD A;  3LT9 A;  3VSE A;  1BSC A;  1SAR A;  3EBT A;  1JB2 A;  2OOV A;  1KWI A;  1LOY A;  1GOU A;  1E3R A;  2GBW B;  5AEU B;  1OHP A;  2RFR A;  3X3X A;  2E5O A;  2GSP A;  5CLK A;  2H0H A;  3CPO A;  4FR9 A;  4BL3 A;  1B2S A;  2QEX 3;  3J7Y d;  1KC8 4;  1ZGX A;  4XBT A;  4HM4 B;  1CEW I;  5IG4 A;  2INX A;  3Q2P A;  4EBG A;  1RGA A; 
#chains in the Genus database with same CATH homology
 1T5Y A;  3D79 A;  1ZS7 A;  3LDF A;  4DMG A;  1R3F A;  1Q7H A;  2AS0 A;  1SGV A;  1IQ8 A;  3C0K A;  2J5T A;  1R3E A;  2P38 A;  2Q07 A;  1ZE1 A;  3VSE A;  2CX0 A;  2AB4 A;  3UAI A;  1J2B A;  1ZL3 A;  1IT7 A;  1IT8 A;  4Q1T A;  2CX1 A;  1SQW A;  1ZE2 A;  1WXX A;  2J5V A;  2B78 A;  1WXW A;  2CWW A;  1K8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...