1Q7HA

Structure of a conserved pua domain protein from thermoplasma acidophilum
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
151
structure length
151
Chain Sequence
SKHFISKKEAKRIWEQMSRYGIDITGESLEVAAQKSASAYYIGGKPMVFQAGDLIPSVYLLNYRNPSRNIVTVDEGAEPHILNGSDLFAPGIVSMDDSIRKGDMIFVKSSKGYFIAVGMAEMDAGEVMATKRGKAARIIHFPGDELIRAFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a conserved hypothetical protein from T. acidophilum
rcsb
source organism Thermoplasma acidophilum dsm 1728
molecule tags Structural genomics, unknown function
molecule keywords conserved hypothetical protein
total genus 30
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2003-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01472 PUA PUA domain
A PF09183 DUF1947 Domain of unknown function (DUF1947)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 1q7hA02
3.10.450.120 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Pre-PUA domain; domain 1 1q7hA01
1IT7A 1R3EA 2CX1A 4Q1TA 2B78A 1T5YA 1WXWA 3C0KA 2AB4A 2P38A 1ZE2A 1SGVA 2Q07A 1ZL3A 1J2BA 1IT8A 2J5TA 1K8WA 1SQWA 3VSEA 3LDFA 1IQ8A 1ZE1A 2CWWA 3D79A 1R3FA 2AS0A 2CX0A 3UAIA 4DMGA 1ZS7A 2J5VA 1Q7HA 1WXXA
chains in the Genus database with same CATH superfamily
1NB3I 4BTWA 1FW7A 3HJWA 1KSIA 1I0VA 2B78A 1LNIA 3D9RA 3CCE3 3OXAA 2OCTA 2RFKA 1BSAA 1G0TA 4MEIA 3EF8A 1D6YA 3X42A 1IQYA 3LXUX 1BUJA 1OCVA 2F56A 5IG4A 4EXRA 1S04A 1LVNA 1YJW3 2FXTA 2MF7A 3PS8A 3VSEA 3NM7A 1IU7A 4WFOA 3CCM3 3LDFA 3SEDA 3U1WA 1Q40B 5CK6A 3JUOA 3G6E3 1FUSA 2GBWB 3G713 1W2ZA 2HMMB 5LC6A 1JZDA 1X1UA 3CCL3 3LZAA 1EQKA 1TFKA 3S5CA 1O7GB 3JUQA 3K63A 1UUGB 1YVBI 1BANA 3CMA3 2CH9A 1VQM3 1RCKA 1OUNA 4H61A 1IT7A 1N9EA 1RN7A 3CC43 4BTYA 2FNQA 3PGBA 2CG0A 3FG1A 3NBJA 1IVVA 3RGRA 3V92A 3IJEB 4XBXA 1B2XA 1DMQA 1FGQA 1ZE2A 1TRPA 3DM8A 3M8CA 2E2VA 4RNZA 3VF1A 1VQL3 1BNRA 5CF1A 2CFLA 2CKFB 3H3HA 1YGEA 4HM6B 3HJYA 3M6UA 1VQN3 4HAAA 1IQ8A 3HZPA 3ZG5A 1WMNA 2ANEA 3CPW2 1V74A 3G16A 1PU4A 1GY6A 1RN1A 2O9UX 1BRJA 2P05A 3UAIA 1LOWA 1RJOA 3G0KA 1FUTA 4HM2B 4N6UA 3NM2A 1GD3A 2CFGA 1BSCA 4O02B 2AADA 1RNTA 3CCR3 1M9GA 3OWYA 1BRGA 3WOFB 2XGNA 1G96A 1E3VA 1I2FA 3AGNA 4GSPA 4N6NB 2W03A 3B4OA 4HM4B 3CCQ3 2C4BA 2K0MA 1FZUA 3KE7A 3JUMA 1JN5A 1FA3A 3WA3A 2HMOB 1NNVA 2WGQA 3X3ZA 4R80A 2GBXB 1BSDA 1Q7Y4 1BU4A 4J5GA 5IG0A 2J5TA 1GSPA 1W6YA 1UUVB 2KRTA 3UB1A 3D5GA 4N6LA 3DH2A 3GWRA 8CHOA 3CC73 5M1AA 1VQK3 1LOYA 1RDSA 2P0XA 5KP3A 1G02A 2H0HA 2OQEA 5HGRA 2Y73A 4AKZA 1AR0A 1VQ93 1MNLA 2D1WA 3EE1A 2KF5A 4KFEA 1ZGXA 1VQ83 1BRKA 3Q3FA 3ECFA 3NBRA 2OOVA 1JV2B 2CWVA 1B2ZA 5AEWB 3X40A 1IQXA 4CI1B 2P09A 5G1LA 1O7PB 1OGXA 4Q53A 3SLUA 3UNLA 3LWRA 2E5OA 4BL2A 1ISKA 3LT8A 1GS3A 1GY7A 3FH1A 3FG3A 1I0XA 3HIIA 3T8NA 3KKGA 3HI7A 3K7CA 4N6OB 4FR9A 1W5ZA 1DMNA 3LWPA 1BNJA 1IT8A 3LWQA 3M6VA 1GMRA 1RSNA 2O3OA 3BIRA 3JVCA 3CCS3 1NDOB 1YIT3 2Z76A 4FCJA 4LGQA 3CU3A 2CFKA 1N9JA 4GL6A 4EC6A 1UI7A 4JF8A 1VQ43 1S5AA 1ROVA 3EC9A 4CI3B 3LH4A 4HZBB 4J5KA 3B8LA 2KF4A 1EEJA 3FG4A 5BVBA 4CDLA 3B4PA 4XM4A 7GSPA 6RNTA 1RNBA 3AHWA 1WTHA 3HIGA 3MWZA 3N8BA 1I3IA 3G4S3 1I3FA 4FCMA 4WYKA 3CXC2 5FW5A 4MMXB 3JUPA 4BTXA 2BT3A 3UL5A 1AV4A 3EQQB 3I553 3UJMA 3GAXA 4L8PA 1MOLA 2INXA 1DETA 2APOA 1X1YA 3EJVA 1NJI4 3MG3A 2BIRA 2QIYA 1WMPA 4FMDA 1SQWA 5AIGA 1TRQA 1JZOA 1Q40A 2WO0A 3EHCA 2YFJB 1FYSA 4CCVA 1B27A 2W56A 2KKUA 3ZV0C 3D79A 1OF5B 3X41A 4HJLB 4XDVA 4BU4A 2BNGA 4NHFA 3O8YA 3WR2A 5IG5A 3LJCA 1R4CA 2BO9B 1FGTA 4OUQA 5HOHA 5AYRB 3DGLA 4N6MA 1FUWA 1ZBOA 1D6ZA 2H0IA 4N6TA 1UGHI 2SBLA 2EY4A 1CQSA 2LYXA 5D82A 4RNYA 3HK4A 4WWUC 4L7KA 1GYBA 3DY5A 3NQZA 1K734 2BU4A 1TP6A 3F40A 2AUSA 2K54A 3LMLA 3WDGB 3BNBA 4X2HA 1C7HA 1OHOA 2IYJA 2GSPA 4RZMA 3FGYA 1TJDA 1RGHA 1HKXA 1WQLB 3LTBA 3NHXA 1JKGB 1UI8A 5D83A 1KD14 3PCRA 1JB2A 2ZHXB 1W6GA 2CK3H 1M1XB 1IVWA 1I2GA 3BLZA 2STDA 3FCSB 1PFPA 2W0QA 4EW5A 4EV2A 1GY5A 3N54B 2DP9A 2W04A 3NBBA 2ZDJA 2L4VA 3MQKA 3EX9A 4KFFA 4XB5A 2Z0TA 2OTJ3 5CLKA 4IPBA 1M904 2OQEC 1LRAA 2CW9A 5CF2A 3LWVA 3BB9A 1Q814 1UW1A 1IVXA 1A67A 2BMRB 1RRLA 3F14A 5EVHA 4I5QA 2PZVA 1BAOA 1ZL3A 1IVUA 1RGEA 3X3XA 2YFLB 1ZX2A 2XSHB 1OHSA 1QALA 2XF3A 5A0OB 1K9M4 4N3VA 1VQ53 1RGAA 3DGYA 4AKYA 1YJ93 3K9MC 1Q864 3WA2X 1X1XA 3OWUA 1EUIC 3Q90A 3EBYA 1RTUA 3S29A 1U8CB 1E3RA 4HKVB 1GOYA 2R41A 2GU3A 3URPA 3OWSA 1YIJ3 2GEXA 1N8R4 1RGLA 4IIAA 3HX8A 3BNDA 4IT7A 4MMYB 3FF0A 4KFDA 2MC8A 1SPUA 1RMSA 3VSYA 1R3EA 1SARA 3DXOA 3DZLA 3LTCA 3C0KA 2W9QA 3OV4A 1Q824 1IDPA 1SGVA 3KFQC 3GRDA 1QMAA 1BRSA 4ORLA 3F9SA 3I563 4HM3B 2JQ5A 2BHMA 4HM5B 2SARA 3PCSA 1QVG2 1DMMA 1JB5A 3NX0A 3MKIA 4PEJA 5G1KA 1YHQ3 2GXFA 1T2IA 3L0RA 3BU4A 1OGZA 3PZWA 3OW22 5ELJA 5FGOA 2RNTA 1IV7A 3DGOA 1A2KA 3KSED 1WK2A 1FGMA 5ELUA 3S67A 2M7OA 2WOFA 2RFRA 3TDGA 2CHCA 6GSPA 1BNFA 4DKIA 2GEYA 1UCKA 2HOHA 1RGCA 3GSPA 1Q7HA 3S28A 4L8OA 3E99A 2XEPA 3QRDA 3DMCA 4ILFA 3U97A 1RGGA 2AB4A 3M6WA 2KXGA 2RSXA 1FGOA 1B20A 1BRIA 1HZ1A 2F98A 1RHLA 1AQZA 2F4YA 3KCHA 1B21A 2HMNB 2Q07A 2AAEA 4AEQA 4R9KA 3F8XA 3GZRA 4OVMA 1LOVA 1W7CA 3I0YA 2KF3A 4JRFA 1LXEA 1BRHA 1BGSA 7STDA 4G1MB 1L5GB 3MYTA 4NPBA 2OOVC 4WHAA 1JB4A 1R4YA 1EG9B 1S723 3GZXB 2QGUA 3FF2A 1E97A 2J5VA 3ZFZA 3RGAA 1UCJA 4HBRA 3AHSA 2ML5A 1Q9EA 2A15A 3G8ZA 3T8UA 1YGWA 1T5YA 1GMPA 3CCU3 1CEWI 2XFSA 2P38A 3IPTA 1BIRA 1NWWA 1DYUA 1RN4A 3FLJA 4TX4A 5BIRA 2W6JH 1K8A4 1JBTA 3Q1CA 1NO3A 3MG2A 1K28A 3DGNA 1BNIA 3MSOA 1UGIA 4I4KA 2XH9A 1BSBA 1ULIB 3KSPA 3MHEA 3NUVA 3Q2PA 3SVAA 5IW9A 5M19A 1AY7A 3V99A 2XGLA 1OHPA 3FSDA 1W4NA 4HM1B 1LQMB 2CWWA 1WMOA 3HAXA 2K3DA 3D3LA 3WOEB 1XNEA 4RNTA 2BMOB 1TUHA 1IV9A 1NB5I 5AIFA 1A90A 5RNTA 4STDA 5IEPA 1JBSA 2HVYA 2GU1A 2UUGC 4FMCA 1I8VA 1O7MB 3KN4A 1B3SA 2IUKA 2IY2A 3ER7A 3OX9A 1D6UA 1PYLA 5STDA 5AIIA 1JNQA 2C10A 3U28A 4K90B 1WXWA 2HMKB 1MWTA 1KWIA 1SJWA 1TTOA 3F8HA 3CNMA 3WODG 2W2CA 2RGQA 3VGNA 2D42A 3JUNA 1QAFA 1LNHA 5JPPA 3X3YA 2CWUA 1WNHA 5DREA 1OACA 4EYCA 2W56B 4K1UA 4O8SA 3EB8A 1PY3A 3N9HA 1MGWA 5EEOA 2J8XB 4CJNA 3DGMA 1W00A 4EV5A 1B2UA 4KVHA 5D81A 4HM0B 1VZZA 1GOUA 1TFOA 1O7NB 1VQ73 3SXXA 1ROAA 4K1VA 5GSPA 2CC3A 1T3BA 2ZA4A 1W02A 3PXMA 4HVNA 3CME3 1QVF2 1IYYA 2CWTA 2F5MA 1QJGA 3CCJ3 3V98A 1VQP3 1OH0A 4TZ4C 3CC23 1US1A 2E2TA 2YFIB 2UGIA 2YX9A 1EA2A 1I2EA 2IUJA 1O7HB 3HOHA 3WHOA 3LWOA 3LTDA 4LYLB 4LZIA 5JBSA 1U5OA 3LYGA 4HM8B 1C54A 1GD4A 3M65A 1N5HA 4LSOA 5G2GA 1BVIA 2F86B 4K61A 4ZM8A 1VQ63 1BRNL 4BL3A 2B1XB 4KT3B 3LTAA 1EKMA 5IEOA 2Z77A 3D5IA 1KQS2 5AI1A 4HM7B 1CYUA 3A76A 1A2VA 2CFDA 2XSOB 3MG1A 4GB5A 4HOHA 1JKGA 4OK0A 1ZO2A 4H3UA 2I9WA 4J9AA 4XBTA 5BU4A 4EBGA 1BNGA 3FZWA 1JRQA 2ZL8A 1RKYA 2XFTA 2WOHA 1QAKA 1BNSA 2B24B 1HU9A 1J2BA 1ASKA 2R4IA 3STDA 3CCV3 2WGOA 1STFI 2W9PA 1RCLA 2ML6A 5IERA 1CH0A 5M18A 2FRXA 3EN1B 3EN8A 3MPHA 3LT9A 4QWTA 1LOXA 5CXOA 4MMZB 4CI2B 4R4KA 2LQVA 4R1KA 1B2MA 3GZYB 4U13A 5AIHA 3SOAA 1MGRA 1UUWB 5DRVA 5I97A 2QA43 1B2SA 5IF6A 4N6V0 4CPKA 2L1SA 1FGRA 1JJ22 2OTL3 1STDA 3S27A 1F8NA 1K41A 3NV0B 2CG1A 3T0UA 1TIJA 2UX0A 3BNCA 3A5EA 6STDA 4GHOA 1A2PA 4FMBA 4J8TA 2CIUA 4BIRA 1Y4KA 1Z1SA 3SX1A 1RGKA 1K8WA 3NV0A 5TGNA 1V57A 5AYSC 3NXJA 1VQO3 1SIHA 3ZG0A 3AMOA 1RGFA 3K0ZA 1M1K4 1DE3A 1O7WB 3H51A 2QEX3 2CX0A 4RBNA 3IMAB 3QK9A 2KAAA 1JBRA 4DMGA 3RDEA 1YNVX 1JN5B 1VQQA 3LOYA 5AEUB 5IENA 3CPOA 1W2B2 4HYZA 5LC7A 1MWSA 1DVDA 1MWRA 4WP5A 2CX1A 3J7Yd 1UDII 1V58A 2C11A 3UL6A 5KP4A 3CD63 2H0GA 3F7XA 1IK3A 1W6CA 1N8QA 8RNTA 1KC84 1AVKA 2F99A 4O2HA 4XDWA 3BNEA 3NQYA 4R9LA 4X2OA 3ROBA 1ULJB 3B7CA 3DUKA 2HMJB 3GZBA 3KZTA 1T2HA 2FGTA 4WYKB 5EQLA 2HMLB 5BXQA 3RNTA 2CFWA 3PYJA 2RBIA 4LMIA 3WMDA 4O3VA 4NREA 1BNEA 1YVSA 1BUQA 3K5TA 1X1WA 1UCIA 1AVLA 2Y74A 1ZS7A 3M6XA 2RCDA 3EBTA 3SOYA 5KP1A 3F7SA 3ALAA 1RLSA 3D4AA 1YJN3 4LEHA 1W01A 1N5PA 5JPUA 1YI23 3IUWA 1Q42A 4Q1TA 4HZ9B 4FMAA 7RNTA 2Z6BA 2PNCA 1OF5A 2XRXB 1NU3A 2OWPA 1MWUA 1GOVA 2P0MA 1GMQA 4FCZA 1TU5A 1OPYA 3FKAA 3AMOB 1UOYA 2V1LA 3KIIA 2KF6A 1ZE1A 1I70A 1RRHA 5IG3A 2KCDA 1BOXA 1LQGC 3CNXA 2JDIH 2IMJA 1TE7A 4KZ1A 2F5WA 2IA7A 4XBYA 2Z7AA 1R3FA 1CYVA 2BMQB 2XR8B 2AS0A 3AGOA 1UCLA 1HYFA 1SIIA 3SYUA 9RNTA 2E2UA 1BSEA 1DVCA 3M4XA 4MJDA 1WXXA
chains in the Genus database with same CATH topology
1IT7A 1R3EA 2CX1A 4Q1TA 2B78A 1T5YA 1WXWA 3C0KA 2AB4A 2P38A 1ZE2A 1SGVA 2Q07A 1ZL3A 1J2BA 1IT8A 2J5TA 1K8WA 1SQWA 3VSEA 3LDFA 1IQ8A 1ZE1A 2CWWA 3D79A 1R3FA 2AS0A 2CX0A 3UAIA 4DMGA 1ZS7A 2J5VA 1Q7HA 1WXXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IT7 A;  1R3E A;  2CX1 A;  4Q1T A;  2B78 A;  1T5Y A;  1WXW A;  3C0K A;  2AB4 A;  2P38 A;  1ZE2 A;  1SGV A;  2Q07 A;  1ZL3 A;  1J2B A;  1IT8 A;  2J5T A;  1K8W A;  1SQW A;  3VSE A;  3LDF A;  1IQ8 A;  1ZE1 A;  2CWW A;  3D79 A;  1R3F A;  2AS0 A;  2CX0 A;  3UAI A;  4DMG A;  1ZS7 A;  2J5V A;  1Q7H A;  1WXX A; 
#chains in the Genus database with same CATH topology
 1NB3 I;  4BTW A;  1FW7 A;  3HJW A;  1KSI A;  1I0V A;  2B78 A;  1LNI A;  3D9R A;  3CCE 3;  3OXA A;  2OCT A;  2RFK A;  1BSA A;  1G0T A;  4MEI A;  3EF8 A;  1D6Y A;  3X42 A;  1IQY A;  3LXU X;  1BUJ A;  1OCV A;  2F56 A;  5IG4 A;  4EXR A;  1S04 A;  1LVN A;  1YJW 3;  2FXT A;  2MF7 A;  3PS8 A;  3VSE A;  3NM7 A;  1IU7 A;  4WFO A;  3CCM 3;  3LDF A;  3SED A;  3U1W A;  1Q40 B;  5CK6 A;  3JUO A;  3G6E 3;  1FUS A;  2GBW B;  3G71 3;  1W2Z A;  2HMM B;  5LC6 A;  1JZD A;  1X1U A;  3CCL 3;  3LZA A;  1EQK A;  1TFK A;  3S5C A;  1O7G B;  3JUQ A;  3K63 A;  1UUG B;  1YVB I;  1BAN A;  3CMA 3;  2CH9 A;  1VQM 3;  1RCK A;  1OUN A;  4H61 A;  1IT7 A;  1N9E A;  1RN7 A;  3CC4 3;  4BTY A;  2FNQ A;  3PGB A;  2CG0 A;  3FG1 A;  3NBJ A;  1IVV A;  3RGR A;  3V92 A;  3IJE B;  4XBX A;  1B2X A;  1DMQ A;  1FGQ A;  1ZE2 A;  1TRP A;  3DM8 A;  3M8C A;  2E2V A;  4RNZ A;  3VF1 A;  1VQL 3;  1BNR A;  5CF1 A;  2CFL A;  2CKF B;  3H3H A;  1YGE A;  4HM6 B;  3HJY A;  3M6U A;  1VQN 3;  4HAA A;  1IQ8 A;  3HZP A;  3ZG5 A;  1WMN A;  2ANE A;  3CPW 2;  1V74 A;  3G16 A;  1PU4 A;  1GY6 A;  1RN1 A;  2O9U X;  1BRJ A;  2P05 A;  3UAI A;  1LOW A;  1RJO A;  3G0K A;  1FUT A;  4HM2 B;  4N6U A;  3NM2 A;  1GD3 A;  2CFG A;  1BSC A;  4O02 B;  2AAD A;  1RNT A;  3CCR 3;  1M9G A;  3OWY A;  1BRG A;  3WOF B;  2XGN A;  1G96 A;  1E3V A;  1I2F A;  3AGN A;  4GSP A;  4N6N B;  2W03 A;  3B4O A;  4HM4 B;  3CCQ 3;  2C4B A;  2K0M A;  1FZU A;  3KE7 A;  3JUM A;  1JN5 A;  1FA3 A;  3WA3 A;  2HMO B;  1NNV A;  2WGQ A;  3X3Z A;  4R80 A;  2GBX B;  1BSD A;  1Q7Y 4;  1BU4 A;  4J5G A;  5IG0 A;  2J5T A;  1GSP A;  1W6Y A;  1UUV B;  2KRT A;  3UB1 A;  3D5G A;  4N6L A;  3DH2 A;  3GWR A;  8CHO A;  3CC7 3;  5M1A A;  1VQK 3;  1LOY A;  1RDS A;  2P0X A;  5KP3 A;  1G02 A;  2H0H A;  2OQE A;  5HGR A;  2Y73 A;  4AKZ A;  1AR0 A;  1VQ9 3;  1MNL A;  2D1W A;  3EE1 A;  2KF5 A;  4KFE A;  1ZGX A;  1VQ8 3;  1BRK A;  3Q3F A;  3ECF A;  3NBR A;  2OOV A;  1JV2 B;  2CWV A;  1B2Z A;  5AEW B;  3X40 A;  1IQX A;  4CI1 B;  2P09 A;  5G1L A;  1O7P B;  1OGX A;  4Q53 A;  3SLU A;  3UNL A;  3LWR A;  2E5O A;  4BL2 A;  1ISK A;  3LT8 A;  1GS3 A;  1GY7 A;  3FH1 A;  3FG3 A;  1I0X A;  3HII A;  3T8N A;  3KKG A;  3HI7 A;  3K7C A;  4N6O B;  4FR9 A;  1W5Z A;  1DMN A;  3LWP A;  1BNJ A;  1IT8 A;  3LWQ A;  3M6V A;  1GMR A;  1RSN A;  2O3O A;  3BIR A;  3JVC A;  3CCS 3;  1NDO B;  1YIT 3;  2Z76 A;  4FCJ A;  4LGQ A;  3CU3 A;  2CFK A;  1N9J A;  4GL6 A;  4EC6 A;  1UI7 A;  4JF8 A;  1VQ4 3;  1S5A A;  1ROV A;  3EC9 A;  4CI3 B;  3LH4 A;  4HZB B;  4J5K A;  3B8L A;  2KF4 A;  1EEJ A;  3FG4 A;  5BVB A;  4CDL A;  3B4P A;  4XM4 A;  7GSP A;  6RNT A;  1RNB A;  3AHW A;  1WTH A;  3HIG A;  3MWZ A;  3N8B A;  1I3I A;  3G4S 3;  1I3F A;  4FCM A;  4WYK A;  3CXC 2;  5FW5 A;  4MMX B;  3JUP A;  4BTX A;  2BT3 A;  3UL5 A;  1AV4 A;  3EQQ B;  3I55 3;  3UJM A;  3GAX A;  4L8P A;  1MOL A;  2INX A;  1DET A;  2APO A;  1X1Y A;  3EJV A;  1NJI 4;  3MG3 A;  2BIR A;  2QIY A;  1WMP A;  4FMD A;  1SQW A;  5AIG A;  1TRQ A;  1JZO A;  1Q40 A;  2WO0 A;  3EHC A;  2YFJ B;  1FYS A;  4CCV A;  1B27 A;  2W56 A;  2KKU A;  3ZV0 C;  3D79 A;  1OF5 B;  3X41 A;  4HJL B;  4XDV A;  4BU4 A;  2BNG A;  4NHF A;  3O8Y A;  3WR2 A;  5IG5 A;  3LJC A;  1R4C A;  2BO9 B;  1FGT A;  4OUQ A;  5HOH A;  5AYR B;  3DGL A;  4N6M A;  1FUW A;  1ZBO A;  1D6Z A;  2H0I A;  4N6T A;  1UGH I;  2SBL A;  2EY4 A;  1CQS A;  2LYX A;  5D82 A;  4RNY A;  3HK4 A;  4WWU C;  4L7K A;  1GYB A;  3DY5 A;  3NQZ A;  1K73 4;  2BU4 A;  1TP6 A;  3F40 A;  2AUS A;  2K54 A;  3LML A;  3WDG B;  3BNB A;  4X2H A;  1C7H A;  1OHO A;  2IYJ A;  2GSP A;  4RZM A;  3FGY A;  1TJD A;  1RGH A;  1HKX A;  1WQL B;  3LTB A;  3NHX A;  1JKG B;  1UI8 A;  5D83 A;  1KD1 4;  3PCR A;  1JB2 A;  2ZHX B;  1W6G A;  2CK3 H;  1M1X B;  1IVW A;  1I2G A;  3BLZ A;  2STD A;  3FCS B;  1PFP A;  2W0Q A;  4EW5 A;  4EV2 A;  1GY5 A;  3N54 B;  2DP9 A;  2W04 A;  3NBB A;  2ZDJ A;  2L4V A;  3MQK A;  3EX9 A;  4KFF A;  4XB5 A;  2Z0T A;  2OTJ 3;  5CLK A;  4IPB A;  1M90 4;  2OQE C;  1LRA A;  2CW9 A;  5CF2 A;  3LWV A;  3BB9 A;  1Q81 4;  1UW1 A;  1IVX A;  1A67 A;  2BMR B;  1RRL A;  3F14 A;  5EVH A;  4I5Q A;  2PZV A;  1BAO A;  1ZL3 A;  1IVU A;  1RGE A;  3X3X A;  2YFL B;  1ZX2 A;  2XSH B;  1OHS A;  1QAL A;  2XF3 A;  5A0O B;  1K9M 4;  4N3V A;  1VQ5 3;  1RGA A;  3DGY A;  4AKY A;  1YJ9 3;  3K9M C;  1Q86 4;  3WA2 X;  1X1X A;  3OWU A;  1EUI C;  3Q90 A;  3EBY A;  1RTU A;  3S29 A;  1U8C B;  1E3R A;  4HKV B;  1GOY A;  2R41 A;  2GU3 A;  3URP A;  3OWS A;  1YIJ 3;  2GEX A;  1N8R 4;  1RGL A;  4IIA A;  3HX8 A;  3BND A;  4IT7 A;  4MMY B;  3FF0 A;  4KFD A;  2MC8 A;  1SPU A;  1RMS A;  3VSY A;  1R3E A;  1SAR A;  3DXO A;  3DZL A;  3LTC A;  3C0K A;  2W9Q A;  3OV4 A;  1Q82 4;  1IDP A;  1SGV A;  3KFQ C;  3GRD A;  1QMA A;  1BRS A;  4ORL A;  3F9S A;  3I56 3;  4HM3 B;  2JQ5 A;  2BHM A;  4HM5 B;  2SAR A;  3PCS A;  1QVG 2;  1DMM A;  1JB5 A;  3NX0 A;  3MKI A;  4PEJ A;  5G1K A;  1YHQ 3;  2GXF A;  1T2I A;  3L0R A;  3BU4 A;  1OGZ A;  3PZW A;  3OW2 2;  5ELJ A;  5FGO A;  2RNT A;  1IV7 A;  3DGO A;  1A2K A;  3KSE D;  1WK2 A;  1FGM A;  5ELU A;  3S67 A;  2M7O A;  2WOF A;  2RFR A;  3TDG A;  2CHC A;  6GSP A;  1BNF A;  4DKI A;  2GEY A;  1UCK A;  2HOH A;  1RGC A;  3GSP A;  1Q7H A;  3S28 A;  4L8O A;  3E99 A;  2XEP A;  3QRD A;  3DMC A;  4ILF A;  3U97 A;  1RGG A;  2AB4 A;  3M6W A;  2KXG A;  2RSX A;  1FGO A;  1B20 A;  1BRI A;  1HZ1 A;  2F98 A;  1RHL A;  1AQZ A;  2F4Y A;  3KCH A;  1B21 A;  2HMN B;  2Q07 A;  2AAE A;  4AEQ A;  4R9K A;  3F8X A;  3GZR A;  4OVM A;  1LOV A;  1W7C A;  3I0Y A;  2KF3 A;  4JRF A;  1LXE A;  1BRH A;  1BGS A;  7STD A;  4G1M B;  1L5G B;  3MYT A;  4NPB A;  2OOV C;  4WHA A;  1JB4 A;  1R4Y A;  1EG9 B;  1S72 3;  3GZX B;  2QGU A;  3FF2 A;  1E97 A;  2J5V A;  3ZFZ A;  3RGA A;  1UCJ A;  4HBR A;  3AHS A;  2ML5 A;  1Q9E A;  2A15 A;  3G8Z A;  3T8U A;  1YGW A;  1T5Y A;  1GMP A;  3CCU 3;  1CEW I;  2XFS A;  2P38 A;  3IPT A;  1BIR A;  1NWW A;  1DYU A;  1RN4 A;  3FLJ A;  4TX4 A;  5BIR A;  2W6J H;  1K8A 4;  1JBT A;  3Q1C A;  1NO3 A;  3MG2 A;  1K28 A;  3DGN A;  1BNI A;  3MSO A;  1UGI A;  4I4K A;  2XH9 A;  1BSB A;  1ULI B;  3KSP A;  3MHE A;  3NUV A;  3Q2P A;  3SVA A;  5IW9 A;  5M19 A;  1AY7 A;  3V99 A;  2XGL A;  1OHP A;  3FSD A;  1W4N A;  4HM1 B;  1LQM B;  2CWW A;  1WMO A;  3HAX A;  2K3D A;  3D3L A;  3WOE B;  1XNE A;  4RNT A;  2BMO B;  1TUH A;  1IV9 A;  1NB5 I;  5AIF A;  1A90 A;  5RNT A;  4STD A;  5IEP A;  1JBS A;  2HVY A;  2GU1 A;  2UUG C;  4FMC A;  1I8V A;  1O7M B;  3KN4 A;  1B3S A;  2IUK A;  2IY2 A;  3ER7 A;  3OX9 A;  1D6U A;  1PYL A;  5STD A;  5AII A;  1JNQ A;  2C10 A;  3U28 A;  4K90 B;  1WXW A;  2HMK B;  1MWT A;  1KWI A;  1SJW A;  1TTO A;  3F8H A;  3CNM A;  3WOD G;  2W2C A;  2RGQ A;  3VGN A;  2D42 A;  3JUN A;  1QAF A;  1LNH A;  5JPP A;  3X3Y A;  2CWU A;  1WNH A;  5DRE A;  1OAC A;  4EYC A;  2W56 B;  4K1U A;  4O8S A;  3EB8 A;  1PY3 A;  3N9H A;  1MGW A;  5EEO A;  2J8X B;  4CJN A;  3DGM A;  1W00 A;  4EV5 A;  1B2U A;  4KVH A;  5D81 A;  4HM0 B;  1VZZ A;  1GOU A;  1TFO A;  1O7N B;  1VQ7 3;  3SXX A;  1ROA A;  4K1V A;  5GSP A;  2CC3 A;  1T3B A;  2ZA4 A;  1W02 A;  3PXM A;  4HVN A;  3CME 3;  1QVF 2;  1IYY A;  2CWT A;  2F5M A;  1QJG A;  3CCJ 3;  3V98 A;  1VQP 3;  1OH0 A;  4TZ4 C;  3CC2 3;  1US1 A;  2E2T A;  2YFI B;  2UGI A;  2YX9 A;  1EA2 A;  1I2E A;  2IUJ A;  1O7H B;  3HOH A;  3WHO A;  3LWO A;  3LTD A;  4LYL B;  4LZI A;  5JBS A;  1U5O A;  3LYG A;  4HM8 B;  1C54 A;  1GD4 A;  3M65 A;  1N5H A;  4LSO A;  5G2G A;  1BVI A;  2F86 B;  4K61 A;  4ZM8 A;  1VQ6 3;  1BRN L;  4BL3 A;  2B1X B;  4KT3 B;  3LTA A;  1EKM A;  5IEO A;  2Z77 A;  3D5I A;  1KQS 2;  5AI1 A;  4HM7 B;  1CYU A;  3A76 A;  1A2V A;  2CFD A;  2XSO B;  3MG1 A;  4GB5 A;  4HOH A;  1JKG A;  4OK0 A;  1ZO2 A;  4H3U A;  2I9W A;  4J9A A;  4XBT A;  5BU4 A;  4EBG A;  1BNG A;  3FZW A;  1JRQ A;  2ZL8 A;  1RKY A;  2XFT A;  2WOH A;  1QAK A;  1BNS A;  2B24 B;  1HU9 A;  1J2B A;  1ASK A;  2R4I A;  3STD A;  3CCV 3;  2WGO A;  1STF I;  2W9P A;  1RCL A;  2ML6 A;  5IER A;  1CH0 A;  5M18 A;  2FRX A;  3EN1 B;  3EN8 A;  3MPH A;  3LT9 A;  4QWT A;  1LOX A;  5CXO A;  4MMZ B;  4CI2 B;  4R4K A;  2LQV A;  4R1K A;  1B2M A;  3GZY B;  4U13 A;  5AIH A;  3SOA A;  1MGR A;  1UUW B;  5DRV A;  5I97 A;  2QA4 3;  1B2S A;  5IF6 A;  4N6V 0;  4CPK A;  2L1S A;  1FGR A;  1JJ2 2;  2OTL 3;  1STD A;  3S27 A;  1F8N A;  1K41 A;  3NV0 B;  2CG1 A;  3T0U A;  1TIJ A;  2UX0 A;  3BNC A;  3A5E A;  6STD A;  4GHO A;  1A2P A;  4FMB A;  4J8T A;  2CIU A;  4BIR A;  1Y4K A;  1Z1S A;  3SX1 A;  1RGK A;  1K8W A;  3NV0 A;  5TGN A;  1V57 A;  5AYS C;  3NXJ A;  1VQO 3;  1SIH A;  3ZG0 A;  3AMO A;  1RGF A;  3K0Z A;  1M1K 4;  1DE3 A;  1O7W B;  3H51 A;  2QEX 3;  2CX0 A;  4RBN A;  3IMA B;  3QK9 A;  2KAA A;  1JBR A;  4DMG A;  3RDE A;  1YNV X;  1JN5 B;  1VQQ A;  3LOY A;  5AEU B;  5IEN A;  3CPO A;  1W2B 2;  4HYZ A;  5LC7 A;  1MWS A;  1DVD A;  1MWR A;  4WP5 A;  2CX1 A;  3J7Y d;  1UDI I;  1V58 A;  2C11 A;  3UL6 A;  5KP4 A;  3CD6 3;  2H0G A;  3F7X A;  1IK3 A;  1W6C A;  1N8Q A;  8RNT A;  1KC8 4;  1AVK A;  2F99 A;  4O2H A;  4XDW A;  3BNE A;  3NQY A;  4R9L A;  4X2O A;  3ROB A;  1ULJ B;  3B7C A;  3DUK A;  2HMJ B;  3GZB A;  3KZT A;  1T2H A;  2FGT A;  4WYK B;  5EQL A;  2HML B;  5BXQ A;  3RNT A;  2CFW A;  3PYJ A;  2RBI A;  4LMI A;  3WMD A;  4O3V A;  4NRE A;  1BNE A;  1YVS A;  1BUQ A;  3K5T A;  1X1W A;  1UCI A;  1AVL A;  2Y74 A;  1ZS7 A;  3M6X A;  2RCD A;  3EBT A;  3SOY A;  5KP1 A;  3F7S A;  3ALA A;  1RLS A;  3D4A A;  1YJN 3;  4LEH A;  1W01 A;  1N5P A;  5JPU A;  1YI2 3;  3IUW A;  1Q42 A;  4Q1T A;  4HZ9 B;  4FMA A;  7RNT A;  2Z6B A;  2PNC A;  1OF5 A;  2XRX B;  1NU3 A;  2OWP A;  1MWU A;  1GOV A;  2P0M A;  1GMQ A;  4FCZ A;  1TU5 A;  1OPY A;  3FKA A;  3AMO B;  1UOY A;  2V1L A;  3KII A;  2KF6 A;  1ZE1 A;  1I70 A;  1RRH A;  5IG3 A;  2KCD A;  1BOX A;  1LQG C;  3CNX A;  2JDI H;  2IMJ A;  1TE7 A;  4KZ1 A;  2F5W A;  2IA7 A;  4XBY A;  2Z7A A;  1R3F A;  1CYV A;  2BMQ B;  2XR8 B;  2AS0 A;  3AGO A;  1UCL A;  1HYF A;  1SII A;  3SYU A;  9RNT A;  2E2U A;  1BSE A;  1DVC A;  3M4X A;  4MJD A;  1WXX A; 
#chains in the Genus database with same CATH homology
 1IT7 A;  1R3E A;  2CX1 A;  4Q1T A;  2B78 A;  1T5Y A;  1WXW A;  3C0K A;  2AB4 A;  2P38 A;  1ZE2 A;  1SGV A;  2Q07 A;  1ZL3 A;  1J2B A;  1IT8 A;  2J5T A;  1K8W A;  1SQW A;  3VSE A;  3LDF A;  1IQ8 A;  1ZE1 A;  2CWW A;  3D79 A;  1R3F A;  2AS0 A;  2CX0 A;  3UAI A;  4DMG A;  1ZS7 A;  2J5V A;  1Q7H A;  1WXX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...