1Q7HA

Structure of a conserved pua domain protein from thermoplasma acidophilum
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
151
structure length
151
Chain Sequence
b'SKHFISKKEAKRIWEQMSRYGIDITGESLEVAAQKSASAYYIGGKPMVFQAGDLIPSVYLLNYRNPSRNIVTVDEGAEPHILNGSDLFAPGIVSMDDSIRKGDMIFVKSSKGYFIAVGMAEMDAGEVMATKRGKAARIIHFPGDELIRAFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Structure of a conserved hypothetical protein from T. acidophilum
rcsb
source organism Thermoplasma acidophilum dsm 1728
molecule tags Structural genomics, unknown function
total genus 30
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2003-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01472 PUA PUA domain
A PF09183 DUF1947 Domain of unknown function (DUF1947)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 1q7hA02
3.10.450.120 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Pre-PUA domain; domain 1 1q7hA01
2CX1A 4Q1TA 1R3EA 2CWWA 1IT7A 1WXWA 2CX0A 2Q07A 1IQ8A 1T5YA 3VSEA 2J5TA 1R3FA 1SQWA 3LDFA 1WXXA 1ZS7A 1SGVA 3C0KA 1J2BA 2B78A 1ZE2A 1K8WA 1Q7HA 3UAIA 4DMGA 1ZL3A 2AB4A 1ZE1A 3D79A 2J5VA 2P38A 2AS0A 1IT8A
chains in the Genus database with same CATH superfamily
4GL6A 2KCDA 1ZGXA 2ZL8A 4FCZA 1IT7A 2IA7A 1N9JA 1TP6A 1SIIA 2FXTA 2ZA4A 4R1KA 5IG4A 4N6OB 3DGYA 2UUGC 2XEPA 1BSBA 1YGWA 6GSPA 5AIFA 1GOVA 3LWPA 1I8VA 2LYXA 4RZMA 1VQ93 1UCKA 3MPHA 5IEPA 3K63A 1JZOA 3G16A 3EB8A 4CJNA 3BB9A 3FLJA 1JBTA 3M6WA 2AB4A 1B2SA 3NV0B 2GEYA 4TX4A 1BU4A 2KF6A 2P0XA 5CXOA 1WK2A 2CH9A 2J8XB 3OWYA 1OCVA 3NX0A 1OF5A 4Q1TA 1BANA 1US1A 1M1K4 1SARA 2C10A 3H51A 3T8NA 4MEIA 4STDA 1B3SA 3LMLA 1WNHA 5AIGA 1B2UA 1DMNA 1HKXA 1QJGA 3FKAA 3DH2A 1FGOA 5JPUA 2QGUA 3ZFZA 3CNMA 5GSPA 2P05A 2BU4A 1DMQA 3MG3A 3LTBA 4WHAA 3WHOA 2F99A 4HVNA 2KRTA 1SJWA 2K54A 1VQN3 3URPA 1RN1A 3NV0A 3AGNA 2GEXA 2B24B 3UB1A 2GU1A 3HZPA 1BNSA 3S5CA 3D3LA 2AUSA 3BLZA 1MGRA 2LQVA 1BNJA 4Q53A 4J8TA 1ROVA 2XSOB 4HM3B 2YFJB 1O7NB 1O7PB 1TRQA 3DZLA 4J9AA 1YJ93 1RSNA 3G0KA 3B4OA 1I70A 3Q2PA 4FCJA 3G8ZA 1F8NA 1GSPA 4I4KA 4EYCA 5ELUA 1BRKA 2XFSA 5AEUB 1TJDA 9RNTA 5IW9A 1CQSA 1IQ8A 1RCKA 5M18A 1T2HA 2F5WA 2L1SA 1MWUA 1LOYA 3DMCA 2XH9A 3LJCA 3OWUA 1EUIC 1LQGC 1TFOA 5BIRA 5D82A 3WODG 2W0QA 4HM2B 1LVNA 5D81A 1FGQA 3L0RA 3AHSA 3AMOB 1IK3A 4FCMA 2D42A 1JB5A 3CC73 1A2KA 3PYJA 4GSPA 4CDLA 1GD3A 7RNTA 1BRSA 3NM7A 2CFDA 4EC6A 4LSOA 3ROBA 1GY5A 2CFWA 2RFKA 3M6XA 1IQXA 2DP9A 2HMKB 4G1MB 3PS8A 5IG5A 2F98A 1GYBA 2SBLA 4IT7A 3HK4A 4MMYB 4RBNA 4XDWA 3WR2A 1I2EA 3EBTA 3N8BA 1UDII 1EQKA 2ML5A 4O3VA 3U97A 3CCM3 2EY4A 2B1XB 2J5TA 1WTHA 5G1LA 4XM4A 5DRVA 1K28A 1QVG2 1IQYA 4OUQA 2RSXA 1AQZA 2W56A 3WOEB 1A2VA 3OV4A 4MJDA 2RGQA 3F8XA 1YGEA 3HAXA 4AKYA 1UCLA 1B21A 4R9KA 4L8OA 1X1YA 1IV9A 4O8SA 7GSPA 4FMDA 2CIUA 3F14A 3LTCA 4EXRA 1GOYA 1JJ22 3CMA3 2ZDJA 1RRLA 2W2CA 3OWSA 1O7MB 3S29A 3CCR3 3KIIA 2JDIH 2AS0A 1TE7A 3CME3 5AEWB 5ELJA 1JBSA 1WMPA 3B4PA 2CWWA 2O3OA 3G4S3 3HIGA 1QMAA 4FMCA 1UUWB 5AYRB 2CKFB 5AYSC 2BHMA 3EC9A 3FG1A 1RGAA 3FH1A 4HOHA 3CCJ3 1IV7A 2K3DA 4N6TA 1HYFA 3X40A 4EBGA 1B27A 1BSCA 3LZAA 4HM4B 3M65A 3X3YA 1W2B2 3K9MC 2JQ5A 3J7Yd 3RGRA 4XBTA 2GU3A 1ZS7A 3EJVA 3V92A 3WMDA 3AGOA 1R4YA 1BNIA 1UI8A 3CD63 1V74A 1A90A 1NJI4 3IMAB 5JBSA 1RLSA 3F7XA 1BSDA 2Z76A 3EHCA 3IJEB 1EG9B 3HOHA 1DVDA 3KZTA 3MWZA 1PFPA 4ORLA 1U8CB 2OCTA 1NO3A 1G02A 2D1WA 2F86B 3ECFA 2ZHXB 1X1XA 3X3ZA 1JZDA 1BNEA 2RCDA 1AVKA 1K41A 3MKIA 3N9HA 1TTOA 1QALA 2HMMB 2XRXB 1I2GA 1L5GB 4HM7B 3DGOA 3SX1A 3EE1A 2W6JH 1OHPA 1NNVA 1VQ53 4H3UA 1WXXA 1STFI 3A76A 3OX9A 1NU3A 4ILFA 4U13A 1Q814 1GMRA 5BVBA 3DUKA 1BIRA 1RCLA 4L7KA 1UUVB 5EEOA 1C54A 4HKVB 1BSAA 1FUTA 2KF4A 1DETA 3LH4A 1IYYA 3S67A 3RNTA 4AEQA 2CC3A 4CI3B 1W01A 4KZ1A 5IEOA 1ASKA 1RGLA 1QAFA 4N6UA 3V98A 4N6V0 1Q40B 2J5VA 1X1UA 3ZG5A 4BTYA 1T2IA 3H3HA 4K61A 4BIRA 1R3EA 2UGIA 1IVXA 3MQKA 1EKMA 1GY6A 4EW5A 1VQ63 4K1UA 1PYLA 2BO9B 1FUWA 2CX0A 3NXJA 2HMLB 3B8LA 3RGAA 1W02A 1VQ73 1GS3A 2Z77A 1PY3A 3SEDA 1Q824 3STDA 1MWTA 1OGXA 1E97A 1GMPA 1Z1SA 2W9QA 3JUQA 3X41A 1W2ZA 1BRNL 2IUKA 3SXXA 1BRIA 2XGLA 3S28A 3JUPA 5JPPA 1ZL3A 3HI7A 4HM8B 1ULIB 3GZRA 5TGNA 4HYZA 1Q40A 1G96A 1ISKA 1IVWA 1EA2A 2R4IA 1W4NA 3D9RA 1AY7A 1DMMA 3WDGB 2OTL3 1IU7A 1GOUA 5CF1A 3DM8A 4KFEA 1FW7A 1YJN3 3VF1A 3KSED 1OHSA 2XFTA 4LMIA 6RNTA 3FGYA 4CI1B 3WA2X 3GAXA 1CYUA 1A2PA 1QAKA 1GMQA 4HM6B 4RNZA 1YHQ3 4KVHA 4NHFA 1SGVA 1IVVA 4LZIA 1UI7A 1NWWA 3FZWA 3NQYA 3U1WA 3G713 3ZV0C 2WGQA 3G6E3 1BUQA 5KP4A 5HOHA 4X2OA 2FGTA 3MG2A 1LOVA 2BMOB 5CK6A 3MYTA 1TRPA 2PZVA 5KP1A 1TUHA 8CHOA 1YVSA 4CCVA 3BNBA 4XB5A 3DGNA 2KKUA 3BNCA 1VQO3 2OQEC 1WMNA 3KKGA 4IIAA 3CC23 1N8R4 1XNEA 1RJOA 3I553 1MWRA 3F9SA 1D6YA 1RHLA 5G1KA 4PEJA 1MGWA 1S723 3SVAA 1CYVA 2H0IA 2CK3H 3BNDA 3LTAA 1TIJA 1ULJB 3PZWA 5FGOA 3M4XA 1GD4A 1JV2B 3KFQC 3CCU3 3Q1CA 3SOAA 1LQMB 4XBYA 5AI1A 3V99A 1I3IA 1UW1A 3NQZA 3HIIA 4J5GA 5A0OB 3AMOA 1VZZA 2KF5A 1YIT3 1OPYA 4K90B 1S04A 1BUJA 1SPUA 1JKGB 2E5OA 4L8PA 7STDA 3LWRA 1IT8A 3SYUA 1BGSA 2E2VA 3DGMA 1BRGA 2CFLA 3F40A 4BTWA 4FR9A 2QEX3 4R80A 1VQ43 1RNBA 5EVHA 1VQ83 3CPW2 1FGTA 2BMRB 4OK0A 1BRHA 3MHEA 2OQEA 1LXEA 4BL3A 1Q864 3UL5A 1V58A 2GBXB 1R3FA 2IYJA 2XF3A 3GZXB 3NBRA 3U28A 1FUSA 1FYSA 1LNHA 3DXOA 3NBBA 3OW22 1K9M4 4TZ4C 4R9LA 2Y73A 2GBWB 1BNRA 1G0TA 2I9WA 3LWVA 1J2BA 5AIIA 1E3RA 3EN8A 1BRJA 4O02B 2L4VA 3KSPA 1SIHA 1D6UA 4MMXB 2KXGA 1JKGA 2OWPA 3A5EA 1NDOB 1I0VA 1W7CA 1S5AA 4GHOA 3NBJA 1IVUA 3M6VA 1MOLA 1V57A 4WFOA 2QIYA 1KQS2 2WOHA 2P38A 3CCE3 2HMNB 1O7GB 3LOYA 2BMQB 1W5ZA 2CFKA 1UCJA 1YI23 3NUVA 1WXWA 1RGGA 3UL6A 3AHWA 2ML6A 4EV2A 4N3VA 3NHXA 3IPTA 3K7CA 2O9UX 1FA3A 1BOXA 3BU4A 1M9GA 4NPBA 3SOYA 2CWTA 5M1AA 3X3XA 1Q7Y4 2CFGA 4XBXA 1ZX2A 2HOHA 3KE7A 5STDA 1PU4A 1DVCA 1FZUA 2WGOA 3Q3FA 3HX8A 3X42A 1E3VA 1KD14 1N9EA 3UAIA 5IERA 4JRFA 5BXQA 3E99A 2Y74A 3CNXA 2OTJ3 1RGFA 1NB5I 4KFDA 1NB3I 3LWOA 2W9PA 2P09A 4JF8A 1C7HA 3PGBA 3JUOA 3FSDA 2CX1A 1OF5B 2OOVC 1VQL3 3PCSA 3K5TA 2BNGA 6STDA 2E2TA 1LOXA 1N5PA 4N6NB 4KFFA 4EV5A 2IMJA 3IUWA 2RNTA 2KF3A 3FG4A 3JUMA 1BNGA 1N8QA 4HBRA 1YVBI 2MF7A 2H0GA 2FRXA 1JBRA 2PNCA 3CC43 5IG3A 1RDSA 1U5OA 2CG1A 4H61A 1Q9EA 3I563 1VQK3 1M904 2XGNA 5IG0A 1CEWI 2M7OA 3UJMA 2WOFA 2W03A 1UGIA 1ZE1A 5LC6A 2C4BA 1I0XA 2APOA 3EN1B 4BU4A 1T3BA 1RGCA 2KAAA 1UGHI 5BU4A 3SLUA 5M19A 1RGKA 2C11A 1RKYA 1RN4A 5DREA 1N5HA 3EX9A 1GY7A 4O2HA 1AV4A 1DYUA 2YX9A 2OOVA 2CG0A 3D4AA 3MG1A 4AKZA 2YFLB 3CCL3 4X2HA 4HM0B 4RNTA 1JRQA 3I0YA 3T8UA 2RFRA 1HU9A 4QWTA 3BNEA 4RNYA 1OHOA 4I5QA 1K734 1OACA 1FGRA 2HMJB 2A15A 5KP3A 5CLKA 2F4YA 3DGLA 3DY5A 3T0UA 4WWUC 1BSEA 1RTUA 4BL2A 5AIHA 1LRAA 5I97A 3FCSB 3GZYB 4HM1B 1IDPA 1Q42A 3GSPA 3MSOA 1VQP3 3EBYA 1TU5A 3M8CA 1AR0A 2AADA 2V1LA 4DKIA 3CXC2 4CPKA 2SARA 1A67A 3N54B 2BIRA 1JB4A 3O8YA 2CHCA 3VGNA 1OUNA 4HZ9B 1OGZA 4FMBA 3LT9A 3D5IA 1T5YA 3M6UA 1BVIA 3ER7A 4LYLB 4N6LA 5HGRA 1CH0A 2H0HA 1JN5B 3EF8A 1QVF2 2YFIB 4WP5A 4ZM8A 2Z6BA 2XR8B 1RRHA 2STDA 3LDFA 2W56B 3NM2A 3HJYA 1LNIA 3C0KA 2HVYA 1RN7A 2MC8A 3WOFB 1B2XA 1YIJ3 4DMGA 1UUGB 3GWRA 3F7SA 3FF0A 4LEHA 4GB5A 1AVLA 5IENA 3TDGA 2Z0TA 3BIRA 1VQQA 2E2UA 2R41A 2W04A 4WYKB 4N6MA 1K8WA 1RMSA 8RNTA 3D5GA 4CI2B 3CCS3 2ANEA 1BNFA 5G2GA 2Z7AA 1B20A 5EQLA 3QRDA 2CW9A 3KN4A 5IF6A 5RNTA 2Q07A 1ZO2A 1RGEA 1O7WB 4XDVA 1B2MA 2GSPA 3F8HA 3VSEA 1JN5A 1DE3A 3ZG0A 1R4CA 1M1XB 2K0MA 3PCRA 2QA43 1WMOA 3UNLA 2GXFA 3LT8A 1ROAA 3CCV3 1MWSA 1I3FA 1W6CA 3LTDA 1ZE2A 3GRDA 2RBIA 2HMOB 4IPBA 2P0MA 4HJLB 4HM5B 3QK9A 3S27A 1FGMA 3K0ZA 5FW5A 3CCQ3 1YJW3 3PXMA 3CPOA 1BAOA 4WYKA 1W00A 1ZBOA 1D6ZA 1MNLA 1K8A4 5CF2A 3LWQA 3D79A 1B2ZA 3B7CA 3EQQB 4HZBB 4R4KA 2INXA 1UCIA 5D83A 3WA3A 3HJWA 1HZ1A 3OXAA 2WO0A 1W6GA 2AAEA 2IY2A 1KSIA 3FF2A 2CWUA 1RGHA 2FNQA 1KC84 1KWIA 4MMZB 4NREA 2BT3A 2F56A 1I2FA 1SQWA 5LC7A 3VSYA 1OH0A 1TFKA 1X1WA 2UX0A 3GZBA 3ALAA 4FMAA 3CU3A 3LXUX 4LGQA 3KCHA 2XSHB 2B78A 2F5MA 3RDEA 1VQM3 2CWVA 3Q90A 3JVCA 1Q7HA 1EEJA 4KT3B 1RNTA 4OVMA 4BTXA 1STDA 4J5KA 1UOYA 1YNVX 4K1VA 3JUNA 3FG3A 1O7HB 1LOWA 1WQLB 2IUJA 3LYGA 1JB2A 1W6YA 1JNQA 4HAAA 1Y4KA
chains in the Genus database with same CATH topology
2CX1A 4Q1TA 1R3EA 2CWWA 1IT7A 1WXWA 2CX0A 2Q07A 1IQ8A 1T5YA 3VSEA 2J5TA 1R3FA 1SQWA 3LDFA 1WXXA 1ZS7A 1SGVA 3C0KA 1J2BA 2B78A 1ZE2A 1K8WA 1Q7HA 3UAIA 4DMGA 1ZL3A 2AB4A 1ZE1A 3D79A 2J5VA 2P38A 2AS0A 1IT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CX1 A;  4Q1T A;  1R3E A;  2CWW A;  1IT7 A;  1WXW A;  2CX0 A;  2Q07 A;  1IQ8 A;  1T5Y A;  3VSE A;  2J5T A;  1R3F A;  1SQW A;  3LDF A;  1WXX A;  1ZS7 A;  1SGV A;  3C0K A;  1J2B A;  2B78 A;  1ZE2 A;  1K8W A;  1Q7H A;  3UAI A;  4DMG A;  1ZL3 A;  2AB4 A;  1ZE1 A;  3D79 A;  2J5V A;  2P38 A;  2AS0 A;  1IT8 A; 
#chains in the Genus database with same CATH topology
 4GL6 A;  2KCD A;  1ZGX A;  2ZL8 A;  4FCZ A;  1IT7 A;  2IA7 A;  1N9J A;  1TP6 A;  1SII A;  2FXT A;  2ZA4 A;  4R1K A;  5IG4 A;  4N6O B;  3DGY A;  2UUG C;  2XEP A;  1BSB A;  1YGW A;  6GSP A;  5AIF A;  1GOV A;  3LWP A;  1I8V A;  2LYX A;  4RZM A;  1VQ9 3;  1UCK A;  3MPH A;  5IEP A;  3K63 A;  1JZO A;  3G16 A;  3EB8 A;  4CJN A;  3BB9 A;  3FLJ A;  1JBT A;  3M6W A;  2AB4 A;  1B2S A;  3NV0 B;  2GEY A;  4TX4 A;  1BU4 A;  2KF6 A;  2P0X A;  5CXO A;  1WK2 A;  2CH9 A;  2J8X B;  3OWY A;  1OCV A;  3NX0 A;  1OF5 A;  4Q1T A;  1BAN A;  1US1 A;  1M1K 4;  1SAR A;  2C10 A;  3H51 A;  3T8N A;  4MEI A;  4STD A;  1B3S A;  3LML A;  1WNH A;  5AIG A;  1B2U A;  1DMN A;  1HKX A;  1QJG A;  3FKA A;  3DH2 A;  1FGO A;  5JPU A;  2QGU A;  3ZFZ A;  3CNM A;  5GSP A;  2P05 A;  2BU4 A;  1DMQ A;  3MG3 A;  3LTB A;  4WHA A;  3WHO A;  2F99 A;  4HVN A;  2KRT A;  1SJW A;  2K54 A;  1VQN 3;  3URP A;  1RN1 A;  3NV0 A;  3AGN A;  2GEX A;  2B24 B;  3UB1 A;  2GU1 A;  3HZP A;  1BNS A;  3S5C A;  3D3L A;  2AUS A;  3BLZ A;  1MGR A;  2LQV A;  1BNJ A;  4Q53 A;  4J8T A;  1ROV A;  2XSO B;  4HM3 B;  2YFJ B;  1O7N B;  1O7P B;  1TRQ A;  3DZL A;  4J9A A;  1YJ9 3;  1RSN A;  3G0K A;  3B4O A;  1I70 A;  3Q2P A;  4FCJ A;  3G8Z A;  1F8N A;  1GSP A;  4I4K A;  4EYC A;  5ELU A;  1BRK A;  2XFS A;  5AEU B;  1TJD A;  9RNT A;  5IW9 A;  1CQS A;  1IQ8 A;  1RCK A;  5M18 A;  1T2H A;  2F5W A;  2L1S A;  1MWU A;  1LOY A;  3DMC A;  2XH9 A;  3LJC A;  3OWU A;  1EUI C;  1LQG C;  1TFO A;  5BIR A;  5D82 A;  3WOD G;  2W0Q A;  4HM2 B;  1LVN A;  5D81 A;  1FGQ A;  3L0R A;  3AHS A;  3AMO B;  1IK3 A;  4FCM A;  2D42 A;  1JB5 A;  3CC7 3;  1A2K A;  3PYJ A;  4GSP A;  4CDL A;  1GD3 A;  7RNT A;  1BRS A;  3NM7 A;  2CFD A;  4EC6 A;  4LSO A;  3ROB A;  1GY5 A;  2CFW A;  2RFK A;  3M6X A;  1IQX A;  2DP9 A;  2HMK B;  4G1M B;  3PS8 A;  5IG5 A;  2F98 A;  1GYB A;  2SBL A;  4IT7 A;  3HK4 A;  4MMY B;  4RBN A;  4XDW A;  3WR2 A;  1I2E A;  3EBT A;  3N8B A;  1UDI I;  1EQK A;  2ML5 A;  4O3V A;  3U97 A;  3CCM 3;  2EY4 A;  2B1X B;  2J5T A;  1WTH A;  5G1L A;  4XM4 A;  5DRV A;  1K28 A;  1QVG 2;  1IQY A;  4OUQ A;  2RSX A;  1AQZ A;  2W56 A;  3WOE B;  1A2V A;  3OV4 A;  4MJD A;  2RGQ A;  3F8X A;  1YGE A;  3HAX A;  4AKY A;  1UCL A;  1B21 A;  4R9K A;  4L8O A;  1X1Y A;  1IV9 A;  4O8S A;  7GSP A;  4FMD A;  2CIU A;  3F14 A;  3LTC A;  4EXR A;  1GOY A;  1JJ2 2;  3CMA 3;  2ZDJ A;  1RRL A;  2W2C A;  3OWS A;  1O7M B;  3S29 A;  3CCR 3;  3KII A;  2JDI H;  2AS0 A;  1TE7 A;  3CME 3;  5AEW B;  5ELJ A;  1JBS A;  1WMP A;  3B4P A;  2CWW A;  2O3O A;  3G4S 3;  3HIG A;  1QMA A;  4FMC A;  1UUW B;  5AYR B;  2CKF B;  5AYS C;  2BHM A;  3EC9 A;  3FG1 A;  1RGA A;  3FH1 A;  4HOH A;  3CCJ 3;  1IV7 A;  2K3D A;  4N6T A;  1HYF A;  3X40 A;  4EBG A;  1B27 A;  1BSC A;  3LZA A;  4HM4 B;  3M65 A;  3X3Y A;  1W2B 2;  3K9M C;  2JQ5 A;  3J7Y d;  3RGR A;  4XBT A;  2GU3 A;  1ZS7 A;  3EJV A;  3V92 A;  3WMD A;  3AGO A;  1R4Y A;  1BNI A;  1UI8 A;  3CD6 3;  1V74 A;  1A90 A;  1NJI 4;  3IMA B;  5JBS A;  1RLS A;  3F7X A;  1BSD A;  2Z76 A;  3EHC A;  3IJE B;  1EG9 B;  3HOH A;  1DVD A;  3KZT A;  3MWZ A;  1PFP A;  4ORL A;  1U8C B;  2OCT A;  1NO3 A;  1G02 A;  2D1W A;  2F86 B;  3ECF A;  2ZHX B;  1X1X A;  3X3Z A;  1JZD A;  1BNE A;  2RCD A;  1AVK A;  1K41 A;  3MKI A;  3N9H A;  1TTO A;  1QAL A;  2HMM B;  2XRX B;  1I2G A;  1L5G B;  4HM7 B;  3DGO A;  3SX1 A;  3EE1 A;  2W6J H;  1OHP A;  1NNV A;  1VQ5 3;  4H3U A;  1WXX A;  1STF I;  3A76 A;  3OX9 A;  1NU3 A;  4ILF A;  4U13 A;  1Q81 4;  1GMR A;  5BVB A;  3DUK A;  1BIR A;  1RCL A;  4L7K A;  1UUV B;  5EEO A;  1C54 A;  4HKV B;  1BSA A;  1FUT A;  2KF4 A;  1DET A;  3LH4 A;  1IYY A;  3S67 A;  3RNT A;  4AEQ A;  2CC3 A;  4CI3 B;  1W01 A;  4KZ1 A;  5IEO A;  1ASK A;  1RGL A;  1QAF A;  4N6U A;  3V98 A;  4N6V 0;  1Q40 B;  2J5V A;  1X1U A;  3ZG5 A;  4BTY A;  1T2I A;  3H3H A;  4K61 A;  4BIR A;  1R3E A;  2UGI A;  1IVX A;  3MQK A;  1EKM A;  1GY6 A;  4EW5 A;  1VQ6 3;  4K1U A;  1PYL A;  2BO9 B;  1FUW A;  2CX0 A;  3NXJ A;  2HML B;  3B8L A;  3RGA A;  1W02 A;  1VQ7 3;  1GS3 A;  2Z77 A;  1PY3 A;  3SED A;  1Q82 4;  3STD A;  1MWT A;  1OGX A;  1E97 A;  1GMP A;  1Z1S A;  2W9Q A;  3JUQ A;  3X41 A;  1W2Z A;  1BRN L;  2IUK A;  3SXX A;  1BRI A;  2XGL A;  3S28 A;  3JUP A;  5JPP A;  1ZL3 A;  3HI7 A;  4HM8 B;  1ULI B;  3GZR A;  5TGN A;  4HYZ A;  1Q40 A;  1G96 A;  1ISK A;  1IVW A;  1EA2 A;  2R4I A;  1W4N A;  3D9R A;  1AY7 A;  1DMM A;  3WDG B;  2OTL 3;  1IU7 A;  1GOU A;  5CF1 A;  3DM8 A;  4KFE A;  1FW7 A;  1YJN 3;  3VF1 A;  3KSE D;  1OHS A;  2XFT A;  4LMI A;  6RNT A;  3FGY A;  4CI1 B;  3WA2 X;  3GAX A;  1CYU A;  1A2P A;  1QAK A;  1GMQ A;  4HM6 B;  4RNZ A;  1YHQ 3;  4KVH A;  4NHF A;  1SGV A;  1IVV A;  4LZI A;  1UI7 A;  1NWW A;  3FZW A;  3NQY A;  3U1W A;  3G71 3;  3ZV0 C;  2WGQ A;  3G6E 3;  1BUQ A;  5KP4 A;  5HOH A;  4X2O A;  2FGT A;  3MG2 A;  1LOV A;  2BMO B;  5CK6 A;  3MYT A;  1TRP A;  2PZV A;  5KP1 A;  1TUH A;  8CHO A;  1YVS A;  4CCV A;  3BNB A;  4XB5 A;  3DGN A;  2KKU A;  3BNC A;  1VQO 3;  2OQE C;  1WMN A;  3KKG A;  4IIA A;  3CC2 3;  1N8R 4;  1XNE A;  1RJO A;  3I55 3;  1MWR A;  3F9S A;  1D6Y A;  1RHL A;  5G1K A;  4PEJ A;  1MGW A;  1S72 3;  3SVA A;  1CYV A;  2H0I A;  2CK3 H;  3BND A;  3LTA A;  1TIJ A;  1ULJ B;  3PZW A;  5FGO A;  3M4X A;  1GD4 A;  1JV2 B;  3KFQ C;  3CCU 3;  3Q1C A;  3SOA A;  1LQM B;  4XBY A;  5AI1 A;  3V99 A;  1I3I A;  1UW1 A;  3NQZ A;  3HII A;  4J5G A;  5A0O B;  3AMO A;  1VZZ A;  2KF5 A;  1YIT 3;  1OPY A;  4K90 B;  1S04 A;  1BUJ A;  1SPU A;  1JKG B;  2E5O A;  4L8P A;  7STD A;  3LWR A;  1IT8 A;  3SYU A;  1BGS A;  2E2V A;  3DGM A;  1BRG A;  2CFL A;  3F40 A;  4BTW A;  4FR9 A;  2QEX 3;  4R80 A;  1VQ4 3;  1RNB A;  5EVH A;  1VQ8 3;  3CPW 2;  1FGT A;  2BMR B;  4OK0 A;  1BRH A;  3MHE A;  2OQE A;  1LXE A;  4BL3 A;  1Q86 4;  3UL5 A;  1V58 A;  2GBX B;  1R3F A;  2IYJ A;  2XF3 A;  3GZX B;  3NBR A;  3U28 A;  1FUS A;  1FYS A;  1LNH A;  3DXO A;  3NBB A;  3OW2 2;  1K9M 4;  4TZ4 C;  4R9L A;  2Y73 A;  2GBW B;  1BNR A;  1G0T A;  2I9W A;  3LWV A;  1J2B A;  5AII A;  1E3R A;  3EN8 A;  1BRJ A;  4O02 B;  2L4V A;  3KSP A;  1SIH A;  1D6U A;  4MMX B;  2KXG A;  1JKG A;  2OWP A;  3A5E A;  1NDO B;  1I0V A;  1W7C A;  1S5A A;  4GHO A;  3NBJ A;  1IVU A;  3M6V A;  1MOL A;  1V57 A;  4WFO A;  2QIY A;  1KQS 2;  2WOH A;  2P38 A;  3CCE 3;  2HMN B;  1O7G B;  3LOY A;  2BMQ B;  1W5Z A;  2CFK A;  1UCJ A;  1YI2 3;  3NUV A;  1WXW A;  1RGG A;  3UL6 A;  3AHW A;  2ML6 A;  4EV2 A;  4N3V A;  3NHX A;  3IPT A;  3K7C A;  2O9U X;  1FA3 A;  1BOX A;  3BU4 A;  1M9G A;  4NPB A;  3SOY A;  2CWT A;  5M1A A;  3X3X A;  1Q7Y 4;  2CFG A;  4XBX A;  1ZX2 A;  2HOH A;  3KE7 A;  5STD A;  1PU4 A;  1DVC A;  1FZU A;  2WGO A;  3Q3F A;  3HX8 A;  3X42 A;  1E3V A;  1KD1 4;  1N9E A;  3UAI A;  5IER A;  4JRF A;  5BXQ A;  3E99 A;  2Y74 A;  3CNX A;  2OTJ 3;  1RGF A;  1NB5 I;  4KFD A;  1NB3 I;  3LWO A;  2W9P A;  2P09 A;  4JF8 A;  1C7H A;  3PGB A;  3JUO A;  3FSD A;  2CX1 A;  1OF5 B;  2OOV C;  1VQL 3;  3PCS A;  3K5T A;  2BNG A;  6STD A;  2E2T A;  1LOX A;  1N5P A;  4N6N B;  4KFF A;  4EV5 A;  2IMJ A;  3IUW A;  2RNT A;  2KF3 A;  3FG4 A;  3JUM A;  1BNG A;  1N8Q A;  4HBR A;  1YVB I;  2MF7 A;  2H0G A;  2FRX A;  1JBR A;  2PNC A;  3CC4 3;  5IG3 A;  1RDS A;  1U5O A;  2CG1 A;  4H61 A;  1Q9E A;  3I56 3;  1VQK 3;  1M90 4;  2XGN A;  5IG0 A;  1CEW I;  2M7O A;  3UJM A;  2WOF A;  2W03 A;  1UGI A;  1ZE1 A;  5LC6 A;  2C4B A;  1I0X A;  2APO A;  3EN1 B;  4BU4 A;  1T3B A;  1RGC A;  2KAA A;  1UGH I;  5BU4 A;  3SLU A;  5M19 A;  1RGK A;  2C11 A;  1RKY A;  1RN4 A;  5DRE A;  1N5H A;  3EX9 A;  1GY7 A;  4O2H A;  1AV4 A;  1DYU A;  2YX9 A;  2OOV A;  2CG0 A;  3D4A A;  3MG1 A;  4AKZ A;  2YFL B;  3CCL 3;  4X2H A;  4HM0 B;  4RNT A;  1JRQ A;  3I0Y A;  3T8U A;  2RFR A;  1HU9 A;  4QWT A;  3BNE A;  4RNY A;  1OHO A;  4I5Q A;  1K73 4;  1OAC A;  1FGR A;  2HMJ B;  2A15 A;  5KP3 A;  5CLK A;  2F4Y A;  3DGL A;  3DY5 A;  3T0U A;  4WWU C;  1BSE A;  1RTU A;  4BL2 A;  5AIH A;  1LRA A;  5I97 A;  3FCS B;  3GZY B;  4HM1 B;  1IDP A;  1Q42 A;  3GSP A;  3MSO A;  1VQP 3;  3EBY A;  1TU5 A;  3M8C A;  1AR0 A;  2AAD A;  2V1L A;  4DKI A;  3CXC 2;  4CPK A;  2SAR A;  1A67 A;  3N54 B;  2BIR A;  1JB4 A;  3O8Y A;  2CHC A;  3VGN A;  1OUN A;  4HZ9 B;  1OGZ A;  4FMB A;  3LT9 A;  3D5I A;  1T5Y A;  3M6U A;  1BVI A;  3ER7 A;  4LYL B;  4N6L A;  5HGR A;  1CH0 A;  2H0H A;  1JN5 B;  3EF8 A;  1QVF 2;  2YFI B;  4WP5 A;  4ZM8 A;  2Z6B A;  2XR8 B;  1RRH A;  2STD A;  3LDF A;  2W56 B;  3NM2 A;  3HJY A;  1LNI A;  3C0K A;  2HVY A;  1RN7 A;  2MC8 A;  3WOF B;  1B2X A;  1YIJ 3;  4DMG A;  1UUG B;  3GWR A;  3F7S A;  3FF0 A;  4LEH A;  4GB5 A;  1AVL A;  5IEN A;  3TDG A;  2Z0T A;  3BIR A;  1VQQ A;  2E2U A;  2R41 A;  2W04 A;  4WYK B;  4N6M A;  1K8W A;  1RMS A;  8RNT A;  3D5G A;  4CI2 B;  3CCS 3;  2ANE A;  1BNF A;  5G2G A;  2Z7A A;  1B20 A;  5EQL A;  3QRD A;  2CW9 A;  3KN4 A;  5IF6 A;  5RNT A;  2Q07 A;  1ZO2 A;  1RGE A;  1O7W B;  4XDV A;  1B2M A;  2GSP A;  3F8H A;  3VSE A;  1JN5 A;  1DE3 A;  3ZG0 A;  1R4C A;  1M1X B;  2K0M A;  3PCR A;  2QA4 3;  1WMO A;  3UNL A;  2GXF A;  3LT8 A;  1ROA A;  3CCV 3;  1MWS A;  1I3F A;  1W6C A;  3LTD A;  1ZE2 A;  3GRD A;  2RBI A;  2HMO B;  4IPB A;  2P0M A;  4HJL B;  4HM5 B;  3QK9 A;  3S27 A;  1FGM A;  3K0Z A;  5FW5 A;  3CCQ 3;  1YJW 3;  3PXM A;  3CPO A;  1BAO A;  4WYK A;  1W00 A;  1ZBO A;  1D6Z A;  1MNL A;  1K8A 4;  5CF2 A;  3LWQ A;  3D79 A;  1B2Z A;  3B7C A;  3EQQ B;  4HZB B;  4R4K A;  2INX A;  1UCI A;  5D83 A;  3WA3 A;  3HJW A;  1HZ1 A;  3OXA A;  2WO0 A;  1W6G A;  2AAE A;  2IY2 A;  1KSI A;  3FF2 A;  2CWU A;  1RGH A;  2FNQ A;  1KC8 4;  1KWI A;  4MMZ B;  4NRE A;  2BT3 A;  2F56 A;  1I2F A;  1SQW A;  5LC7 A;  3VSY A;  1OH0 A;  1TFK A;  1X1W A;  2UX0 A;  3GZB A;  3ALA A;  4FMA A;  3CU3 A;  3LXU X;  4LGQ A;  3KCH A;  2XSH B;  2B78 A;  2F5M A;  3RDE A;  1VQM 3;  2CWV A;  3Q90 A;  3JVC A;  1Q7H A;  1EEJ A;  4KT3 B;  1RNT A;  4OVM A;  4BTX A;  1STD A;  4J5K A;  1UOY A;  1YNV X;  4K1V A;  3JUN A;  3FG3 A;  1O7H B;  1LOW A;  1WQL B;  2IUJ A;  3LYG A;  1JB2 A;  1W6Y A;  1JNQ A;  4HAA A;  1Y4K A; 
#chains in the Genus database with same CATH homology
 2CX1 A;  4Q1T A;  1R3E A;  2CWW A;  1IT7 A;  1WXW A;  2CX0 A;  2Q07 A;  1IQ8 A;  1T5Y A;  3VSE A;  2J5T A;  1R3F A;  1SQW A;  3LDF A;  1WXX A;  1ZS7 A;  1SGV A;  3C0K A;  1J2B A;  2B78 A;  1ZE2 A;  1K8W A;  1Q7H A;  3UAI A;  4DMG A;  1ZL3 A;  2AB4 A;  1ZE1 A;  3D79 A;  2J5V A;  2P38 A;  2AS0 A;  1IT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...