1Q7YG

Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
172
structure length
172
Chain Sequence
b'PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
total genus 37
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00347 Ribosomal_L6 Ribosomal protein L6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 1q7yG01
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 1q7yG02
5JVGE 3G71E 5JVHE 1VQ5E 2ZJQE 1YJNE 1KD1G 4WFAE 1VQ4E 3CCUE 1QVGE 1VQOE 1VQNE 2QA4E 3CCEE 3OW2E 1VQME 3CD6E 3CPWE 1VQPE 3CMAE 1VQ6E 1M1KG 3CCVE 3J7ZG 1VQLE 4IOAE 2CQLA 1M90G 4WCEE 1Q82G 1YJWE 1VQKE 3CXCE 5MLCH 1YIJE 5GADG 5AN9B 1JJ2E 3CCQE 1YITE 3CCSE 1VQ8E 4WFNE 1YJ9E 3CC7E 3I55E 3CC4E 1KC8G 2ZJRE 3I56E 1Q81G 5DM6E 1K9MG 4IOCE 3G4SE 3DLLE 1YHQE 1Q86G 3PIPE 1VQ9E 4U67E 1NJIG 4WFBE 5GAGG 3CCJE 2OTLE 1Q7YG 4UY8G 3CMEE 1VQ7E 5HL7E 1RL6A 1KQSE 5H1SI 3CC2E 2OTJE 3CCLE 3CCME 3PIOE 5GAEG 1N8RG 1K8AG 5DM7E 1YI2E 4IO9E 1W2BE 2QEXE 3CF5E 3CCRE 1S72E 3G6EE 1K73G 1QVFE 4WF9E 5GAHG 2ZJPE
chains in the Genus database with same CATH superfamily
5JVGE 3G71E 5JVHE 1VQ5E 2ZJQE 1YJNE 1KD1G 1P4PA 4WFAE 1VQ4E 3CCUE 2OYBO 1QVGE 1VQOE 1VQNE 2OL8O 2QA4E 2OL7A 3CCEE 3IG9A 3OW2E 3IGEA 1VQME 3CD6E 3CPWE 1VQPE 3AUMO 3CMAE 1VQ6E 1M1KG 2OY7A 3CCVE 3J7ZG 1VQLE 1FJ1E 4IOAE 5B10O 2CQLA 1M90G 4WCEE 5B11O 1Q82G 1YJWE 5B3MO 1VQKE 3CXCE 5MLCH 1YIJE 5GADG 5AN9B 1JJ2E 3CCQE 1YITE 3CCSE 1VQ8E 1RJLC 4WFNE 1YJ9E 3CC7E 1OSPO 3I55E 3CC4E 1KC8G 2ZJRE 3I56E 1Q81G 5DM6E 1K9MG 2AF5A 4IOCE 3G4SE 3DLLE 1YHQE 1Q86G 3PIPE 1VQ9E 3CKFA 4U67E 1NJIG 2OY5O 4WFBE 2FKGA 5GAGG 3CCJE 2OTLE 2G8CO 1Q7YG 4UY8G 3CMEE 1VQ7E 5HL7E 2OL6O 1RL6A 3CKGA 1KQSE 5H1SI 3CC2E 2OTJE 3CCLE 3CCME 3PIOE 2OY8A 5GAEG 1N8RG 1K8AG 5DM7E 1YI2E 5B2AO 4IO9E 1W2BE 2I5VO 2QEXE 2FKJA 3CF5E 2HKDA 3CCRE 2I5ZO 1S72E 3EC5A 3G6EE 2OY1O 1K73G 2PI3O 1QVFE 4WF9E 5GAHG 2ZJPE
chains in the Genus database with same CATH topology
5JVGE 3G71E 5JVHE 1VQ5E 2ZJQE 1YJNE 1KD1G 4WFAE 1VQ4E 3CCUE 1QVGE 1VQOE 1VQNE 2QA4E 3CCEE 3OW2E 1VQME 3CD6E 3CPWE 1VQPE 3CMAE 1VQ6E 1M1KG 3CCVE 3J7ZG 1VQLE 4IOAE 2CQLA 1M90G 4WCEE 1Q82G 1YJWE 1VQKE 3CXCE 5MLCH 1YIJE 5GADG 5AN9B 1JJ2E 3CCQE 1YITE 3CCSE 1VQ8E 4WFNE 1YJ9E 3CC7E 3I55E 3CC4E 1KC8G 2ZJRE 3I56E 1Q81G 5DM6E 1K9MG 4IOCE 3G4SE 3DLLE 1YHQE 1Q86G 3PIPE 1VQ9E 4U67E 1NJIG 4WFBE 5GAGG 3CCJE 2OTLE 1Q7YG 4UY8G 3CMEE 1VQ7E 5HL7E 1RL6A 1KQSE 5H1SI 3CC2E 2OTJE 3CCLE 3CCME 3PIOE 5GAEG 1N8RG 1K8AG 5DM7E 1YI2E 4IO9E 1W2BE 2QEXE 3CF5E 3CCRE 1S72E 3G6EE 1K73G 1QVFE 4WF9E 5GAHG 2ZJPE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JVG E;  3G71 E;  5JVH E;  1VQ5 E;  2ZJQ E;  1YJN E;  1KD1 G;  4WFA E;  1VQ4 E;  3CCU E;  1QVG E;  1VQO E;  1VQN E;  2QA4 E;  3CCE E;  3OW2 E;  1VQM E;  3CD6 E;  3CPW E;  1VQP E;  3CMA E;  1VQ6 E;  1M1K G;  3CCV E;  3J7Z G;  1VQL E;  4IOA E;  2CQL A;  1M90 G;  4WCE E;  1Q82 G;  1YJW E;  1VQK E;  3CXC E;  5MLC H;  1YIJ E;  5GAD G;  5AN9 B;  1JJ2 E;  3CCQ E;  1YIT E;  3CCS E;  1VQ8 E;  4WFN E;  1YJ9 E;  3CC7 E;  3I55 E;  3CC4 E;  1KC8 G;  2ZJR E;  3I56 E;  1Q81 G;  5DM6 E;  1K9M G;  4IOC E;  3G4S E;  3DLL E;  1YHQ E;  1Q86 G;  3PIP E;  1VQ9 E;  4U67 E;  1NJI G;  4WFB E;  5GAG G;  3CCJ E;  2OTL E;  1Q7Y G;  4UY8 G;  3CME E;  1VQ7 E;  5HL7 E;  1RL6 A;  1KQS E;  5H1S I;  3CC2 E;  2OTJ E;  3CCL E;  3CCM E;  3PIO E;  5GAE G;  1N8R G;  1K8A G;  5DM7 E;  1YI2 E;  4IO9 E;  1W2B E;  2QEX E;  3CF5 E;  3CCR E;  1S72 E;  3G6E E;  1K73 G;  1QVF E;  4WF9 E;  5GAH G;  2ZJP E; 
#chains in the Genus database with same CATH topology
 5JVG E;  3G71 E;  5JVH E;  1VQ5 E;  2ZJQ E;  1YJN E;  1KD1 G;  1P4P A;  4WFA E;  1VQ4 E;  3CCU E;  2OYB O;  1QVG E;  1VQO E;  1VQN E;  2OL8 O;  2QA4 E;  2OL7 A;  3CCE E;  3IG9 A;  3OW2 E;  3IGE A;  1VQM E;  3CD6 E;  3CPW E;  1VQP E;  3AUM O;  3CMA E;  1VQ6 E;  1M1K G;  2OY7 A;  3CCV E;  3J7Z G;  1VQL E;  1FJ1 E;  4IOA E;  5B10 O;  2CQL A;  1M90 G;  4WCE E;  5B11 O;  1Q82 G;  1YJW E;  5B3M O;  1VQK E;  3CXC E;  5MLC H;  1YIJ E;  5GAD G;  5AN9 B;  1JJ2 E;  3CCQ E;  1YIT E;  3CCS E;  1VQ8 E;  1RJL C;  4WFN E;  1YJ9 E;  3CC7 E;  1OSP O;  3I55 E;  3CC4 E;  1KC8 G;  2ZJR E;  3I56 E;  1Q81 G;  5DM6 E;  1K9M G;  2AF5 A;  4IOC E;  3G4S E;  3DLL E;  1YHQ E;  1Q86 G;  3PIP E;  1VQ9 E;  3CKF A;  4U67 E;  1NJI G;  2OY5 O;  4WFB E;  2FKG A;  5GAG G;  3CCJ E;  2OTL E;  2G8C O;  1Q7Y G;  4UY8 G;  3CME E;  1VQ7 E;  5HL7 E;  2OL6 O;  1RL6 A;  3CKG A;  1KQS E;  5H1S I;  3CC2 E;  2OTJ E;  3CCL E;  3CCM E;  3PIO E;  2OY8 A;  5GAE G;  1N8R G;  1K8A G;  5DM7 E;  1YI2 E;  5B2A O;  4IO9 E;  1W2B E;  2I5V O;  2QEX E;  2FKJ A;  3CF5 E;  2HKD A;  3CCR E;  2I5Z O;  1S72 E;  3EC5 A;  3G6E E;  2OY1 O;  1K73 G;  2PI3 O;  1QVF E;  4WF9 E;  5GAH G;  2ZJP E; 
#chains in the Genus database with same CATH homology
 5JVG E;  3G71 E;  5JVH E;  1VQ5 E;  2ZJQ E;  1YJN E;  1KD1 G;  4WFA E;  1VQ4 E;  3CCU E;  1QVG E;  1VQO E;  1VQN E;  2QA4 E;  3CCE E;  3OW2 E;  1VQM E;  3CD6 E;  3CPW E;  1VQP E;  3CMA E;  1VQ6 E;  1M1K G;  3CCV E;  3J7Z G;  1VQL E;  4IOA E;  2CQL A;  1M90 G;  4WCE E;  1Q82 G;  1YJW E;  1VQK E;  3CXC E;  5MLC H;  1YIJ E;  5GAD G;  5AN9 B;  1JJ2 E;  3CCQ E;  1YIT E;  3CCS E;  1VQ8 E;  4WFN E;  1YJ9 E;  3CC7 E;  3I55 E;  3CC4 E;  1KC8 G;  2ZJR E;  3I56 E;  1Q81 G;  5DM6 E;  1K9M G;  4IOC E;  3G4S E;  3DLL E;  1YHQ E;  1Q86 G;  3PIP E;  1VQ9 E;  4U67 E;  1NJI G;  4WFB E;  5GAG G;  3CCJ E;  2OTL E;  1Q7Y G;  4UY8 G;  3CME E;  1VQ7 E;  5HL7 E;  1RL6 A;  1KQS E;  5H1S I;  3CC2 E;  2OTJ E;  3CCL E;  3CCM E;  3PIO E;  5GAE G;  1N8R G;  1K8A G;  5DM7 E;  1YI2 E;  4IO9 E;  1W2B E;  2QEX E;  3CF5 E;  3CCR E;  1S72 E;  3G6E E;  1K73 G;  1QVF E;  4WF9 E;  5GAH G;  2ZJP E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...