1Q7YW

Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1q7yW00
3CCUV 1YJWV 1Q81W 1K9MW 1VQ6V 2D3OW 3I56V 4WF9V 1R73A 3CCSV 3CC2V 1K73W 1VQ9V 1Q86W 3CMAV 1VQ8V 1VQ4V 1YITV 1M1KW 3OW2U 3G71V 1KC8W 5DM6V 3CCRV 1QVFU 3CMEV 1YI2V 3I55V 3CC4V 3CCQV 3G4SV 1YHQV 2OTLV 1M90W 1VQKV 2QA4V 1NJIW 3CXCU 1VQLV 3G6EV 1YJ9V 1YIJV 3CCMV 1VQMV 1VQ7V 1N8RW 1KQSU 2QEXV 4WFBV 3CCVV 1YJNV 1JJ2U 4WCEV 2OTJV 1S72V 3CCJV 1Q7YW 3CCLV 3CC7V 1VQOV 1QVGU 1K8AW 1VQ5V 1VQPV 1KD1W 4WFAV 3CPWU 1W2BU 1VQNV 3CD6V 3CCEV 1Q82W
chains in the Genus database with same CATH superfamily
4UCTA 2Q4PA 3W7WA 1WPBA 2QGNA 4U3JA 4X1IA 4LF5O 1VEWA 1MZFA 2BOBC 4KHPB 2GBOA 1EN5A 3LSQA 4JGSA 1M93A 1WA8B 3SPGA 1K5QA 4I5SA 3JD4A 4LR3A 1Q8IA 1Y66A 4LF8B 5IJ9A 3AG4B 2F66C 2K9PA 4R50A 1WP7A 3K0GA 2ODMA 5LHGA 1OCRB 4JI3O 2IJIA 4JI1B 1UJWB 2DJVA 2CTPA 2PGGA 3CP1A 4OPAA 4LF4O 1YSCA 1OCOB 2ADPA 2F4VB 2DQ0A 4FMTA 1FS0G 1Q81W 1NBMG 4JAVA 1M56C 1BQZA 2CTRA 3BEHA 3E8HA 4UVCA 4RWUA 5KHIA 4H0LB 2RN9A 3SJAC 2WLNA 1HNXB 3Q4HB 4R6ZA 5B66Z 1AI7A 1MG1A 1K8AW 2Q68A 4L8JA 3ASOC 4JTAB 2XAHA 2VWKA 3ZHRA 3UKMA 1Y6XA 5L3EA 1CP9A 5GW7A 4DR2O 2UUBB 4KL1A 5EBMC 1HNXO 1YJNV 1VQPV 1PNMA 1KD1W 3APOA 2VWJA 2MW2B 3N2KA 3CEIA 1TUEB 1Q3EA 3FYIB 4RO2A 2XTAA 4DRXA 3FB7C 4O2BA 4KUMA 3JATA 2NNUA 4EFEA 3LDEA 2XASA 3G67A 4GKJB 1Q6HA 2WLIA 1H2LA 4DV4B 3B77A 4RUEA 2LJ2A 3T1YB 1FJGO 4I55B 3BRCA 1ROPA 4X9QA 4K3AA 4DUYO 1YJWV 4DR7O 2ARHA 1IDSA 1ZX3A 3G6BA 3F7YC 4D6TH 3O9OA 4FLXA 4MS2A 3S3XA 1SZXA 3K0DA 1US6A 1LUWA 1OCCC 1R1BA 1F23A 5H6RA 4FPPA 1S72V 1Q7YW 1KUQA 2OWOA 3GB7C 4O2AA 1PNKA 1F7YA 4JI4B 3H1KH 1JOYA 2ITDC 2DE0X 2WLIB 2Y4TA 1Q86W 2LW7A 4I4TA 5LP6C 1FYJA 1O9GA 2JGDA 1H2MA 2Y4UA 4HBNA 1TUBA 3H1IH 4F6RA 4LF7B 1BZKA 3WG7C 3SYOA 2H3OA 2QDOA 2ZQMA 5LP6B 2QM7A 2HR3A 4TQFA 1QNMA 1KBHA 4NR1A 1R73A 4U7NA 2KB1A 2DYSB 2YI9A 3F5WC 2Q67A 2UXBO 2ZXWC 2Y0PA 4O4JA 3ABMC 1RP3B 2HVKC 3W7SA 1GN3A 4R8CA 1F4NA 3ZHUA 4LF8O 3WFVA 3RYIA 3E86A 2HHHB 1KYOF 4CC6A 2PI4A 4FZ1A 5E1AC 1N4CA 2DYRB 2AZ0A 1TUBB 5JWPA 4JI3B 1RM1B 1R6NA 4DR6O 2R70A 2N04A 5EIBD 1W0KG 4ASUG 4IL6Z 4K8XA 1M56B 4J7ZA 3OFNG 2DWDC 3BA9A 1HR0O 4J41A 2BOCC 1MMMA 4YHHO 3OD4A 4MW3A 2ZIMA 2ZNJA 3UM7A 2DQ3A 2UU9O 2M7WA 3MD0A 3LDCA 4PDVA 4AILC 2E76B 2EJRA 3CXCU 4JYYA 3ABKC 2IM9A 3QO8A 4TWKA 3JCUZ 3S3WA 3TXSA 2EULA 2X0LA 4EB6A 3TXQA 3KG2A 1HWYA 1KP3A 3I56V 1AJNA 4OXSA 3B2EE 4X1YA 4TV8A 2JVDA 2E5LO 1Q90D 3H1HH 3L71H 3T1HO 1PP9H 1E1RG 3ETEA 4U7OA 2HJFC 3I5DA 4ZBMA 2Y48A 1HP8A 4LP8A 2W6JG 1Q6UA 4PA6A 4J7KA 3H01A 1IX9A 2HFEC 2LGWA 5L3GA 2ZD9A 1K4CC 1LNQA 2JJ2G 1N34B 4B3SO 1I0HA 3RYIB 3OGIB 2G38A 3SYAA 3WB2A 2HEPA 2EIKC 3QF7A 5J2UA 1DF4A 1XDCA 3T1HB 4ZHQA 4JI0O 1VIBA 1AROP 5BXZA 1SC5B 3A2FA 4DV7B 1ZUQA 1T5EA 2QJ1A 5A9GA 2QKCA 3LNNA 3WG7B 4X65B 3UO2A 1GTOA 4UVBA 2Q69A 1QLEC 2PYLA 3CWBH 2IW5A 5H6QA 1KQSU 4MTFA 2ZR3A 1MABG 2OIGA 3IJ4A 5KMGB 2EINC 1AB3A 3ABUA 4YXWG 4PD4F 1QLEB 2RNBA 4PI0A 1J95A 1IXBA 3LDDA 1VQ4V 5KHJA 1SQXH 1S0VA 4JZGA 4B3SB 3FFQA 4I0XB 4UB8Z 4TOIA 3W7TA 1N32B 4DV5O 4L87A 4WBNA 2F93B 4LFCO 4LF7O 1KMIZ 1JQ0A 4O4HA 4UUJC 1K9MW 3C3SA 1BSMA 2JGDB 4N23A 4DV1B 4BIZA 2BCCH 2E75B 1VQ8V 3IAYA 1TAEA 3HKBA 3JD0A 4JYBA 2B1IA 4FK5C 4B3RO 3B8NA 3CYOA 4XBFA 4WFBV 5KHHA 2UXBB 4TV9A 4JI4O 1RM1C 4DK0A 3TK1A 4LFBB 1KB9F 4DV5B 2P5OA 2Q5ZA 2P4VA 3K08A 4CH6A 2NN4A 1TVKA 1HNZO 1M9NA 1SETA 5GTIZ 5CA0A 3VQWA 1XHZA 1I08A 2ZR2A 1K7DA 3M8AA 3B09A 3CJHA 1VQ7V 1BT8A 3JSNA 2CTQA 4J80A 4U3FH 5FNVB 2GV9A 5CN0A 1AJQA 2BTOA 4X64B 1SZTA 2R9AA 3TJTA 1N32O 3CRMA 4GX5A 3HKCA 2CAZC 3FB6C 1BHAA 4LNUB 2XHBA 4PHZA 1ENVA 3GVMA 4U3JB 3ZMVA 4YJ3B 1COWG 4E4EA 3BHPA 4HZ3A 4P2ZA 1PD3A 1CPYA 3ZRVA 2AXTZ 4X66O 5H5NA 4XDLA 2Q8VA 1QLNA 5EC2C 2LO1A 1M1KW 4PDRA 4X89A 1BMFG 5K1XA 2JJ1G 2PYJA 1THZA 2FKXA 1K34A 4YIPA 2Q7EA 1WJZA 2NR5A 4B3TB 5CMUA 5B1AC 1PKXA 3U10A 3LNMB 3SPHA 1J5EB 1G6UA 4HNAA 1AI4A 4ZKIA 5IDJA 4IYIA 1AVMA 4LF9B 2GUZB 4K0KO 2WLHA 3K5NA 2XAFA 4CS4A 2ZE6A 2IJKA 2QWOB 4H44B 2CK3G 3X2QB 3CD6V 4BAYA 4LNUA 4KP4A 2Q7GA 1P49A 2RDCA 2WA4A 4GKJO 3OEEG 1NVPD 1XNQO 2PUSA 2HVJC 2UUCB 1TA8A 3BA8A 2CH7A 3K3WA 1AILA 3JALB 4X88A 3PJSK 1BQ0A 1AR1B 4W4LA 4JYAB 1Y76A 3P30A 4P9PA 3H9VA 2Q7HA 4CBCA 5CB4B 1GAXA 3UO3A 3BCCH 4LF5B 1B06A 1S3JA 5LA6A 5FPRA 1KECA 2F95B 3SPCA 4WFGA 1GN2A 1KKCA 4DV0B 4PA9A 3DC5A 2UXDO 2YEVB 2V1DA 1YVWA 1XOUA 1O9HA 3ICXA 4I7ZB 1VQNV 4GYCB 4TV8B 1JR9A 1JPXA 1BHBA 1H8EG 1V55B 1QU7A 2HP8A 1N36B 2GTAA 1ZSPA 3B8MA 3F7VC 3CMAV 3L70H 1G1XB 3E8FA 3TETA 4O4HB 5LBQA 1XMOO 5J2TA 3FX7A 5AG2A 4DW1A 2MK3A 4G2KA 3JARB 4JI6B 5JJEB 3OTOB 5LL6Y 4LF9O 4K0KB 1ZL8A 4GCZA 1XEQA 2LQTA 4UCUA 3JD2A 4PJ0Z 4NXNB 3UCSC 4BWAA 4GX1A 4J10A 5CA3A 2E5LB 1IBLB 3CCJV 2UU9B 1AI6A 4MVRA 3RT3C 4Q6GA 1L1FA 3JAKA 4MTGA 3RVZA 5LHHA 1WLEA 4HNAB 1XMOB 4DR5O 3AK2A 3SGIA 2QTSA 2UXCB 5EYPA 5KHGA 1EZVH 4WBNB 3VOUA 5B1NA 5KHKA 3CCLV 1JJOA 2P90A 3A0RA 4JZ2A 4CH4A 3UQ8A 2W0XA 1GKFA 1P4RA 2UXDB 4TUYA 2PI5A 2P22C 3CE2A 1IURA 2B9ZA 3W7XA 4X66B 4DUZO 4ZOLA 4FZ0A 1K3EA 3I55V 4FFKA 1R3JC 3BY6A 2M6YA 1AP5A 2JEXA 4TT3G 2EIMB 2OT5A 4BR6A 1K92A 2LFRA 2GTSA 1M4UA 3ZRSA 2PZSA 1SQVH 4DR1B 4DV2B 1GN4A 2W0FC 2FMLA 1XHXA 4DR4B 2L35A 1WPXA 3P3PA 1URFA 1RPOA 3L72H 3OTFA 4J9YB 3MAQA 3ETGA 2DYRC 5L3BA 2KQXA 2YXYA 3ZIAG 3K06A 3AK3A 3UT5A 2C2AA 4I55A 1WP8A 5IYDO 1N0NA 2Q73A 3SJBC 1YITV 2D2CB 4FLVA 2JDIG 2A79B 3E89A 4DV1O 2F43G 1H2KA 5BR8O 2YIBD 2QTOA 2PTMA 4OGQB 5IYZA 1KU9A 4WFAV 4B3RB 3RVYA 4JI2O 1XQ8A 2ZE7A 4LCUC 2E3CA 2ZE5A 2N05A 3CCSV 2LGQA 5E79Z 1XI1A 1Z5WA 2H94A 4ZHQB 4DW0A 5D5QA 3IFXA 3ABTA 1V55C 2WAMA 1VQMV 4MW8A 4QE7A 1DF5A 4WCEV 4FLUA 3M99B 1LUVA 3SPIA 4FJCC 1WNSA 1HDJA 4D7TA 4QJFB 1FJGB 2D3OW 3U11A 3QO5A 3GWKC 1Y67A 1EZJA 3G4SV 3OMNB 4UV8A 2YIDA 3T4DA 2BE3A 4RQFA 4PA3A 4Q20A 1NS1A 3OEHG 1YTFB 3MHHC 4MVMA 4GLXA 2EIJB 3N2GB 2IJHA 3ZMTA 3AEIA 3RYHB 3CCRV 1QVFU 4GKKO 2LFSA 5GONB 4MT8A 1YIJV 3E35A 5LA6B 2WLLB 4FLYA 2V4DA 4J7JA 4I9QA 1ZL8B 3GWOA 2OYQA 1Q82W 4ZIBA 4I50A 5LGTA 2XAJA 2CH7B 2B1GA 2YIBA 2QM8A 1QBZA 1Z2GA 5L3FA 2Q0AA 5CA1B 4B3TO 1JA8A 5L3CA 1SERA 3ZHQA 2DW4A 1BL8A 1N33B 1B04A 1XNRO 3F5TA 5LMUO 1Q43A 2L6LA 3CCEV 3RWRD 1IBKB 4F6RB 2Q9LA 3RYHA 3DC6A 4WF9V 1JX9A 1FXHA 4FM2A 2ITCC 1XL4A 3BVOA 3K58A 4JI8B 3JATB 3B4SA 1PV0A 3Q4HA 3P32A 1EN6A 4NKGB 3HKCB 2H8PC 2UUCO 4TUYB 1SQPH 3AG3C 1XBLA 4CS3A 4DV3O 3N2GA 5K1PA 4PDMA 1VP7A 2KKWA 5BZBA 2ZKOA 2CGOA 1YHQV 4JV5B 1NJIW 1MSDA 2HJDA 4JI7B 4F6EA 1DK1A 3N2KB 1EM1A 2X6CA 5IY5B 1MA1A 1QCEA 3ZRXA 2Q0OC 4EKWA 5KA5A 5LGUA 4DV6B 4JI8O 4NXMB 2QR4A 3JD3A 3RYFA 3HKEA 1U97A 1IBMO 5IY5C 1E79G 2VQEO 3K5OA 3ZEDA 3STZC 4DRXB 1YEWA 2QM4A 1VQLV 5IJ0A 1KKDA 5C93A 1B6QA 3EFFK 3HKDB 1BCCH 4JI7O 4J42A 2JK5C 4IYHA 3DXRA 3ASNC 4MVQA 4ZOLB 5FPOA 3FAVA 2PY5A 3ABLC 5EC1C 4LH6A 1N0JA 4X64O 3JASA 1N33O 4LWSB 2WLLA 2YSUB 1I94B 1FXKB 1NQTA 1NR1A 5ITZB 3D36A 3P3NA 4UCRA 1YZBA 5TISZ 1NI8A 3ZRWB 4X1IB 5JCOA 4QE9A 2UXNA 2FTKA 2OCHA 4I4TB 2OCCB 5CA1A 3HB3B 3WU2Z 2BSKB 4O4IB 1U96A 1W0JG 3C3TA 5B1OA 2CUGA 3SYQA 3TCUA 5EIBC 5HFMA 3JAWB 1S5JA 3ZMZA 2HG5C 1NTKH 5IT9N 2WPDG 5JCOC 3OR7C 1A32A 2R72A 1K73W 3BPZA 4QNHB 2F1MA 3OW2U 5CBHA 5JQGA 2A9HA 1IVSA 3RYCA 1VQKV 1OCRC 3HKDA 4UXNA 2YI8A 1J5EO 4J11A 1M57C 4DK1A 3THOA 4FLTA 4QPKA 4JI6O 2UUBO 1DLBA 1VARA 3N27A 3KCXA 1HR0B 3ZJZA 2VQEB 2ILMA 4X65O 1V54B 3SDLA 3FKSG 2EILB 4XDJA 4E2LA 1NT2B 2DN9A 1SF9A 3LSSA 4PV1B 3IC7A 5FLXN 1NH2B 3SYPA 1SESA 2QWRB 4HAMA 4DUZB 1P7GA 3T2MA 2WWWA 5JQGB 4O4IA 4JYCA 1I7FA 4NTWA 5JH7A 4DUYB 1P84F 4P30A 1L0LH 1DGSA 2CDYA 3A8TA 2LP7A 3ZMUA 4IT5A 1VF6C 4EB6B 5J2UB 5GTHZ 1WB7A 3K04A 3JAWA 3D36C 3LUTB 4JASA 2Y69B 4UCOA 4X20A 4I9WA 2YXHA 2W6IG 3CB2A 4X1YB 2ADQB 3W7UA 4YJ2A 1GM9A 3CC7V 2FB5A 5EZYB 2EIKB 4G28B 1HNWB 1FXKC 4X1KA 2UUAO 4X62O 4K8ZA 1FAFA 1QR8A 3E83A 3OE7G 3SJQC 1FKAO 4JI1O 2AW9A 1D5AA 4PI2A 2UXCO 5L3DA 2OCCC 3VQVA 4AHCA 5DECA 1AJPA 1VQOV 3CHXA 4ABMA 4PA4A 2VQFB 4DR3B 1M5IA 1ORQC 4KHPO 2Y0IA 1E1QG 3RBZA 5IJ0B 3VQYA 3FYEB 4JI5B 2DYSC 2CTWA 4DR6B 2YEVA 4IGGA 1IBMB 1UFIA 1IXMA 3OT7A 1OCOC 3ABMB 2EIMC 2EINB 4I0XA 3K59A 4GUNA 2HHHO 2P4KA 4QPJA 4UCSA 3CMEV 2FYUH 2WA3A 3IC9A 1NR7A 2XOKG 4UB6Z 3ZS8C 5B3SC 4RAIA 1VMGA 4OX9B 2ZE8A 5H2FZ 1SQBH 4CC5A 4LH7A 1GK9A 2GUZA 5JH7B 3T4ZA 2NLJC 5FNVA 5B3SB 3KCYA 5KMGA 1Q5OA 4IHJA 2DWEC 2YS8A 3CC2V 4G27B 3SYCA 2VQFO 2QWPB 1FPOA 3ASOB 3EHBB 3DSQA 4PDLA 2R9IA 5KAIZ 3JD1A 5IWAB 1YXBA 4ZI7B 3CCMV 1N8RW 3L75H 2UUAB 4YY3O 5J9PC 3ML0A 3CPWU 3J7AU 5DEDA 3ETQA 3VQXA 1H2SB 3ZCCA 3ABKB 3RYCB 2ZDIC 5LXTA 4CH3A 2K1EA 1P7BA 1YDXA 4H13B 1N34O 4O4JB 3FD9A 1WAZA 3K5LA 3HR0A 2VS0A 4UV9A 5BMVB 4AI8A 3JSLA 1EBOA 3BABA 2OTJV 1NTMH 2P06A 4IHJB 5LMNO 1VF5B 5H9CA 1IZ3A 1ZLZA 3B40A 3K9AA 4AQYO 3ZN0A 1SA0A 3A0HZ 4K35A 1NTZH 3T1CA 5EBWC 2ZCEA 2YDEA 3ASNB 4D7SA 4PELA 3T1YO 5LMUB 2AHYA 4LF6O 3ZRWA 2KG7B 2GHYA 1FXVA 3ETDA 1R3LC 3AG2C 1IBLO 2ZT9B 2ZNIA 4P9OA 1Z5VA 3H1JH 2YC0A 2F4VO 2HLDG 5BMVA 3OR6C 1YTFD 3L74H 2X6BA 2QA4V 1QQCA 3K5MA 1YF2A 2X6AA 4B7KA 3LSUA 3APQA 3QNEA 2P67A 4GZRB 3NXSA 3JAMN 4IIJB 1GM8A 4LFAB 2IU0A 3EVKA 1V9PA 1R6KA 2XUMA 3JAKB 4MTXA 4FM1A 1FFXA 4WFHA 2ZM6B 4MVOA 3QVNA 1RPRA 5B1AB 2QEXV 1NZ6A 3K9SA 1NU1H 2EX3A 2RQ6A 4JAAA 4JPRA 1GRJA 2JS3A 2O57A 2Z3YA 5IYZB 4R7CA 4BIOA 2YIAA 4FIPC 1DTOA 3AG1B 1SA0B 4EFBA 3X2QC 1XMQB 4LFAO 1W59A 4LC1A 1I5YA 2DMXA 3AK1A 5IYCO 1V54C 3H1LH 2EBOA 1SRYA 4X62B 3J80N 3D3IA 1X4TA 1Y76B 4GKKB 4JF3A 4NTYA 1S5LZ 3CS5A 1VF7A 5JVDA 4Z1VA 5EBLC 1Y4MA 1OJHA 5EZYA 3M7MX 4B3MB 1RFYA 2E74B 1XMQO 4F4LA 3CXHF 3HKBB 3CCVV 4YIOA 4DO2A 1SQFA 4DR1O 1F4MA 1BGYH 3NR7A 4DV0O 4X20B 1AP6A 4DV6O 5B1BC 1FFXB 1CEZA 5F2VO 2ZIOA 4JI5O 2XT9A 4IIJA 3E8GA 4ICGA 1OHHG 4JYAO 1NVPB 2KSDA 1WB8A 3FAVB 3WB1A 5KUKA 5B1BB 3CRQA 4JTCB 4MVUA 4HYOA 4BIUA 3R65A 3OUFA 1RSOB 1JFFA 5IWAO 4X1KB 3ZBHA 3MDSA 2PF4E 1GN6A 1R6TA 4YY3B 4LBEC 3JCZA 1SKVA 3ZHTA 1JCHA 2JRIA 1OCZB 3D8CA 2VRZA 2JIZG 4DXWA 4TSFG 1M90W 1H8HG 3SR2C 4DR7B 3KKYA 3PN1A 1NKDA 3CRAA 4NB5A 5KAFZ 1OCZC 1I5XA 4B3MO 3A0BZ 2YXLA 2OIEA 5IYBO 1MZEA 4Z2WA 3K03A 4DYLA 3STLC 3CC4V 2ZDIA 3KZIZ 3JYCA 1MSWD 2YUAA 4WFEA 4FFBA 1XREA 3U0ZA 5HFLA 3RGBA 4UVAA 2EZOA 3ZHVA 2EIJC 1Y74B 1S76D 3MHSC 1TGOA 4BW9A 5DN6G 3DGEA 5FL7G 1VQ6V 5LHIA 4H33A 1G8MA 1WN7A 4GX0A 4FLZA 5LGNA 5D5PA 2BTQB 1LR1A 2B5UA 4YJ3A 5C8YB 5CB4A 2WSSG 3K57A 1HNWO 1VQ5V 3TGUH 1H2GA 1WA8A 2RMKB 5LXTB 5A2QN 1EFRG 2ATKC 4C7UA 1EN4A 2R9RB 1M57B 3RYFB 4UFZA 4MVZA 2QE7G 4FFBB 1S77D 4WFFA 1QR9A 1PL0A 4TV9B 1AI5A 2LW1A 3CX5F 2A3QA 1HNZB 1VF6A 5LP6A 1GO3F 3UT5B 4MTOA 2IH3C 5KLVH 2AGAA 2EILC 4H37A 1PM9A 1AR4A 1W2BU 1F51A 3L9DA 1XNQB 1PNLA 2WLJA 2QSAA 3QTCA 1UPGA 1AR5A 4NYKA 2RCVA 3QG5A 3OUSA 1S5HC 3L73H 3EXAA 4YJ2B 1SQGA 4O4LB 2XAGA 3HKEB 1SQQH 1JFFB 4YHHB 2AHZA 1K33A 2A0LA 1XL6A 5LOVA 2F23A 5EK0A 1CXZB 1R3KC 1XILA 5LYJA 3J81N 4JTDB 4X8AA 3HPLC 1ZTEA 2CE4A 4B7EA 1R3IC 2A06H 1ZAUA 4JI0B 1SS3A 1GMGA 2IH1C 5BR8B 1JVMA 1YCIA 4FLWA 2X7RB 3VBBA 4A5UB 3BFRA 1YI2V 2OTLV 4CZZA 5J2TB 3QO7A 2GDSA 2Z5UA 4JI2B 1H38A 3CSXA 3JASB 2BTQA 1G4YB 4TQDA 5JJJB 2FL4A 3JARA 1TVKB 1GH6A 1OZ0A 2IJJA 3CRRA 5CA0B 1KP2A 3E22A 2RJZA 1OV9A 2QWQB 4AQYB 3RW0A 1PPJH 3SJCC 3CCQV 2IU3A 4DR5B 5KX5A 4EEQA 4NXMO 4KXRA 3FB5C 5KUMA 3ZN1A 1L0NH 2EJ7A 3OTOO 1MNGA 4QGPA 4LF6B 1OCCB 4NVPA 4NXNO 1D2DA 4DR3O 4O4LA 4LFCB 3E2EA 2GSMB 2P7TC 4DR4O 4O2BB 3OMAB 1B3QA 2YICA 3OMIB 2Z0AA 3E22B 4DR2B 4I50B 3E8BA 1FXKA 3AG7A 2HKOA 4UCVA 1H2NA 3ZX6A 5IE9A 5B5EZ 1I94O 4N21A 2DOSA 4LFBO 3AG4C 4DV2O 5CBGA 2XNDG 3K79A 3G6EV 2BSKA 2EZPA 5KA6A 2WLKA 1JJ2U 3AG1C 3OAAG 3D3QA 5GONA 4RQEA 4B08A 5IJ9B 4NTXA 2ZXWB 4ZI7A 1D5NA 2JGUA 4DV4O 5JVDB 3IGAC 5CBFA 5BY1A 5EYPB 2P6JA 4GX2A 2Q6AA 2WLMA 4O2AB 3FB8C 4RUFA 1RSOA 1XNRB 5LOVB 3ZMSA 1Y74A 1YJ9V 4GT1A 3C90A 5LYJB 5JJNB 1K5SA 2XAQA 5KX5B 3BAAA 2ZINA 4JV5O 1QHTA 1ZWIC 4OX9O 2V7QG 2QKAA 3JALA 2JEUA 3AG3B 3O65A 3WB0A 5DM6V 3RFRA 1MOFA 4J9ZB 2JS5A 2AZ2A 1BE3H 4PA7A 4CS2A 1K97A 4QIWF 4KFMA 1IBKO 1QVGU 2A7WA 3OGCC 1FD9A 1FFTB 4BW5A 1N36O 3CCUV 1JMKC 2KG7A 3RN4A 1HW7A 1XUQA 4CH5A 3G80A 2ZM6O 1X59A 4DV7O 3G71V 1L8DA 2IBZH 2N74A 4Z1MG 2Y69C 3OM3B 1PL4A 3ABLB 3DXRB 4DV3B 1GM7A 3R66A 4FM0A 2QWNB 1K4DC 2UXXA 3DTUB 5C8YA 5LMNB 4LF4B 3CJHB 1VQ9V 1KC8W 3AG2B 2CGNA 5ITZA 2ETNA 1Q6IA 4JAUA 3SPJA 4XDKA 4MSWC 4W4KA 4LWSA 1BS3A 4MVSA 3CRCA 4FVMA 1NH2D 4OPHA 3ZHSA 2QKSA
chains in the Genus database with same CATH topology
2Z3YA 4R7CA 4GX5A 4FIPC 3W7WA 4PDMA 3FB6C 1DTOA 1BHAA 3AG1B 5BZBA 2BOBC 3X2QC 1ENVA 3LSQA 4LC1A 1I5YA 4JGSA 1YHQV 3SPGA 1NJIW 1K5QA 4I5SA 5IYCO 3JD4A 3ZMVA 1V54C 1Y66A 2EBOA 2X6CA 1COWG 1QCEA 5IY5B 3ZRXA 3AG4B 4EKWA 5KA5A 5LGUA 4R50A 4HZ3A 4P2ZA 3JD3A 1PD3A 1SRYA 3K0GA 1CPYA 3D3IA 3ZRVA 5LHGA 1OCRB 4JF3A 4XDLA 2IJIA 1QLNA 5IY5C 1UJWB 5EC2C 1E79G 1M1KW 4PDRA 4X89A 5EBLC 3CP1A 1Y4MA 1BMFG 3STZC 1VQLV 1YSCA 1KKDA 2JJ1G 1OCOB 1B6QA 4F4LA 5C93A 3CCVV 3EFFK 4DO2A 1THZA 1F4MA 2DQ0A 2JK5C 4FMTA 1FS0G 1K34A 3ASNC 4MVQA 1Q81W 1NBMG 5B1BC 1CEZA 4JAVA 1M56C 5CMUA 5B1AC 3BEHA 1PKXA 3ABLC 5EC1C 3E8HA 3LNMB 4UVCA 3SPHA 1AI4A 3E8GA 4ZKIA 1OHHG 2WLNA 1NVPB 2WLLA 5IDJA 2YSUB 4R6ZA 1FXKB 1NQTA 5B1BB 4JTCB 2WLHA 4MVUA 5KUKA 4HYOA 4BIUA 1AI7A 1NR1A 2XAFA 3R65A 2IJKA 3D36A 3OUFA 1MG1A 1K8AW 2Q68A 2CK3G 3ASOC 3X2QB 3CD6V 4JTAB 3ZRWB 2XAHA 4BAYA 4KP4A 4QE9A 2UXNA 2FTKA 4LBEC 3JCZA 2OCCB 1JCHA 3UKMA 3HB3B 3OEEG 1NVPD 1OCZB 1W0JG 2JIZG 4DXWA 2HVJC 4TSFG 5B1OA 1M90W 3K3WA 5L3EA 1CP9A 4X88A 5GW7A 3PJSK 3SYQA 1H8HG 1AR1B 3TCUA 5EBMC 1YJNV 4P9PA 3P30A 1NKDA 5HFMA 1VQPV 4CBCA 1OCZC 1PNMA 1KD1W 1I5XA 1S3JA 1TUEB 5IYBO 1KECA 3ZMZA 3FYIB 2HG5C 2WPDG 4RO2A 3SPCA 3OR7C 3FB7C 1K73W 4WFGA 3K03A 4KUMA 4QNHB 2NNUA 3OW2U 5CBHA 2A9HA 4PA9A 3STLC 3CC4V 2ZDIA 3JYCA 3LDEA 1MSWD 1VQKV 2XASA 1OCRC 4UXNA 2YEVB 2V1DA 2WLIA 4WFEA 1M57C 5HFLA 3B77A 4RUEA 4UVAA 2EZOA 4QPKA 2EIJC 1DLBA 1ROPA 1VQNV 3MHSC 1S76D 1YJWV 5DN6G 1JPXA 3DGEA 3ZJZA 1H8EG 1BHBA 1V55B 5FL7G 1VQ6V 1V54B 3F7YC 5LHIA 3F7VC 3B8MA 4H33A 1G8MA 3FKSG 4GX0A 3CMAV 2EILB 4MS2A 5LGNA 4XDJA 3K0DA 2B5UA 2WSSG 4E2LA 1OCCC 3E8FA 3TETA 3LSSA 1F23A 5H6RA 3IC7A 5LBQA 4FPPA 1S72V 1Q7YW 1VQ5V 1H2GA 3GB7C 1NH2B 3SYPA 1EFRG 1SESA 2ATKC 2MK3A 4HAMA 4G2KA 1PNKA 3T2MA 2WWWA 4JYCA 2R9RB 1M57B 1JOYA 2ITDC 4P30A 2WLIB 1Q86W 4MVZA 2QE7G 4GCZA 1S77D 4WFFA 1QR9A 1PL0A 2LP7A 1AI5A 3ZMUA 3JD2A 4GX1A 5CA3A 1GO3F 4MTOA 2IH3C 3SYOA 3WG7C 1AI6A 3K04A 4MVRA 2EILC 4H37A 3CCJV 2ZQMA 1W2BU 1F51A 2QM7A 3LUTB 1L1FA 4JASA 4MTGA 3RVZA 5LHHA 1WLEA 1PNLA 2HR3A 2WLJA 2Y69B 1R73A 4U7NA 2KB1A 2DYSB 3OUSA 1S5HC 4I9WA 2W6IG 3F5WC 2Q67A 2ZXWC 2XAGA 3VOUA 2AHZA 5B1NA 1K33A 2A0LA 1XL6A 3W7UA 3ABMC 2HVKC 1GM9A 3W7SA 5EK0A 3CCLV 3CC7V 4R8CA 2P90A 3A0RA 1F4NA 1R3KC 2EIKB 4G28B 3WFVA 4JTDB 3E86A 4X8AA 3HPLC 1GKFA 1FXKC 2PI4A 1R3IC 1P4RA 1GMGA 5E1AC 2PI5A 2IH1C 2DYRB 1JVMA 3W7XA 2X7RB 3VBBA 1RM1B 1QR8A 1R6NA 3E83A 1YI2V 1K3EA 3OE7G 3I55V 3SJQC 2OTLV 1W0KG 4ASUG 1R3JC 3BY6A 3QO7A 4CZZA 1M56B 2Z5UA 3OFNG 2DWDC 5L3DA 1H38A 2JEXA 2BOCC 2OCCC 4TT3G 1G4YB 2EIMB 2OT5A 1AJPA 1VQOV 4PA4A 4MW3A 1K92A 1ORQC 1OZ0A 2IJJA 2LFRA 3ZRSA 1KP2A 3UM7A 2DQ3A 2W0FC 1E1QG 2M7WA 3MD0A 3RBZA 3LDCA 3RW0A 4PDVA 3FYEB 1WPXA 3CCQV 2IU3A 2EJRA 3CXCU 1RPOA 3ABKC 4J9YB 2DYSC 3FB5C 3QO8A 3ETGA 2DYRC 4TWKA 5KUMA 3ZN1A 5L3BA 2YEVA 3ZIAG 3K06A 2X0LA 1IXMA 2C2AA 3KG2A 1OCCB 1HWYA 5IYDO 1KP3A 3I56V 1AJNA 4OXSA 1OCOC 3ABMB 2EIMC 2EINB 1YITV 3E2EA 2GSMB 2JDIG 4QPJA 2P7TC 3CMEV 2A79B 3E89A 1E1RG 1NR7A 2F43G 2XOKG 3ETEA 4U7OA 5B3SC 4RAIA 3OMAB 2QTOA 2HJFC 3OMIB 2Y48A 4ZBMA 4LP8A 2W6JG 1GK9A 4PA6A 3E8BA 4WFAV 1FXKA 3RVYA 3H01A 2HFEC 3T4ZA 2HKOA 5L3GA 2NLJC 2ZD9A 1K4CC 4LCUC 1LNQA 5B3SB 2JJ2G 3CCSV 2DWEC 3CC2V 4G27B 3SYCA 4N21A 3AG4C 3SYAA 3ASOB 2H94A 3EHBB 4PDLA 2EIKC 3IFXA 3ABTA 2R9IA 1DF4A 5CBGA 2XNDG 3K79A 3JD1A 1V55C 3G6EV 2WAMA 3CCMV 1VQMV 4MW8A 1N8RW 2EZPA 4QE7A 5KA6A 1DF5A 2WLKA 4WCEV 3AG1C 1JJ2U 3OAAG 3M99B 5J9PC 3SPIA 4RQEA 1AROP 3ML0A 3CPWU 4FJCC 2ZXWB 4QJFB 3ZCCA 3ABKB 2D3OW 3IGAC 3QO5A 5CBFA 2ZDIC 2P6JA 4GX2A 3WG7B 2Q6AA 2WLMA 2K1EA 3FB8C 4RUFA 1P7BA 3ZMSA 1EZJA 1GTOA 3OMNB 4UVBA 2Q69A 3G4SV 1QLEC 1YJ9V 2IW5A 4UV8A 5H6QA 4UV9A 4GT1A 3T4DA 4RQFA 1KQSU 2ZR3A 1EBOA 1K5SA 1MABG 4MTFA 4PA3A 2XAQA 4Q20A 2OTJV 3OEHG 2EINC 1YTFB 5H9CA 3K9AA 3ABUA 4YXWG 1ZWIC 3ZN0A 1QLEB 2V7QG 3MHHC 1J95A 2JEUA 4MVMA 3LDDA 1VQ4V 3T1CA 3AG3B 2EIJB 5EBWC 2IJHA 3ZMTA 3AEIA 5DM6V 3CCRV 1QVFU 1S0VA 1MOFA 4J9ZB 2LFSA 3ASNB 4PELA 4PA7A 2AHYA 4MT8A 1K97A 1YIJV 4QIWF 4KFMA 3E35A 3W7TA 3ZRWA 2WLLB 1QVGU 4L87A 2GHYA 1FXVA 3OGCC 3ETDA 1R3LC 3AG2C 1FFTB 3GWOA 1JQ0A 4BW5A 3CCUV 4P9OA 1Q82W 4UUJC 1K9MW 5LGTA 2XAJA 4N23A 2HLDG 4BIZA 2B1GA 2QM8A 1QBZA 1VQ8V 3G71V 5L3FA 3OR6C 1YTFD 3JD0A 4JYBA 2B1IA 2X6BA 4FK5C 4Z1MG 3B8NA 2Y69C 2QA4V 3CYOA 4XBFA 3OM3B 5L3CA 1SERA 2DW4A 3ABLB 4WFBV 1BL8A 1GM7A 2X6AA 1RM1C 3TK1A 3QNEA 2P67A 3CCEV 3NXSA 3K08A 1K4DC 1GM8A 2UXXA 3DTUB 4WF9V 2IU0A 1JX9A 1M9NA 1FXHA 1VQ9V 1SETA 1R6KA 4MTXA 2ITCC 1XL4A 1KC8W 3AG2B 4WFHA 2ZR2A 4MVOA 4JAUA 1K7DA 3SPJA 1RPRA 4XDKA 4MSWC 1VQ7V 5B1AB 2QEXV 3P32A 4MVSA 2H8PC 3AG3C 5CN0A 1NH2D 1AJQA 4JPRA 2QKSA 1SZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCU V;  1YJW V;  1Q81 W;  1K9M W;  1VQ6 V;  2D3O W;  3I56 V;  4WF9 V;  1R73 A;  3CCS V;  3CC2 V;  1K73 W;  1VQ9 V;  1Q86 W;  3CMA V;  1VQ8 V;  1VQ4 V;  1YIT V;  1M1K W;  3OW2 U;  3G71 V;  1KC8 W;  5DM6 V;  3CCR V;  1QVF U;  3CME V;  1YI2 V;  3I55 V;  3CC4 V;  3CCQ V;  3G4S V;  1YHQ V;  2OTL V;  1M90 W;  1VQK V;  2QA4 V;  1NJI W;  3CXC U;  1VQL V;  3G6E V;  1YJ9 V;  1YIJ V;  3CCM V;  1VQM V;  1VQ7 V;  1N8R W;  1KQS U;  2QEX V;  4WFB V;  3CCV V;  1YJN V;  1JJ2 U;  4WCE V;  2OTJ V;  1S72 V;  3CCJ V;  1Q7Y W;  3CCL V;  3CC7 V;  1VQO V;  1QVG U;  1K8A W;  1VQ5 V;  1VQP V;  1KD1 W;  4WFA V;  3CPW U;  1W2B U;  1VQN V;  3CD6 V;  3CCE V;  1Q82 W; 
#chains in the Genus database with same CATH topology
 4UCT A;  2Q4P A;  3W7W A;  1WPB A;  2QGN A;  4U3J A;  4X1I A;  4LF5 O;  1VEW A;  1MZF A;  2BOB C;  4KHP B;  2GBO A;  1EN5 A;  3LSQ A;  4JGS A;  1M93 A;  1WA8 B;  3SPG A;  1K5Q A;  4I5S A;  3JD4 A;  4LR3 A;  1Q8I A;  1Y66 A;  4LF8 B;  5IJ9 A;  3AG4 B;  2F66 C;  2K9P A;  4R50 A;  1WP7 A;  3K0G A;  2ODM A;  5LHG A;  1OCR B;  4JI3 O;  2IJI A;  4JI1 B;  1UJW B;  2DJV A;  2CTP A;  2PGG A;  3CP1 A;  4OPA A;  4LF4 O;  1YSC A;  1OCO B;  2ADP A;  2F4V B;  2DQ0 A;  4FMT A;  1FS0 G;  1Q81 W;  1NBM G;  4JAV A;  1M56 C;  1BQZ A;  2CTR A;  3BEH A;  3E8H A;  4UVC A;  4RWU A;  5KHI A;  4H0L B;  2RN9 A;  3SJA C;  2WLN A;  1HNX B;  3Q4H B;  4R6Z A;  5B66 Z;  1AI7 A;  1MG1 A;  1K8A W;  2Q68 A;  4L8J A;  3ASO C;  4JTA B;  2XAH A;  2VWK A;  3ZHR A;  3UKM A;  1Y6X A;  5L3E A;  1CP9 A;  5GW7 A;  4DR2 O;  2UUB B;  4KL1 A;  5EBM C;  1HNX O;  1YJN V;  1VQP V;  1PNM A;  1KD1 W;  3APO A;  2VWJ A;  2MW2 B;  3N2K A;  3CEI A;  1TUE B;  1Q3E A;  3FYI B;  4RO2 A;  2XTA A;  4DRX A;  3FB7 C;  4O2B A;  4KUM A;  3JAT A;  2NNU A;  4EFE A;  3LDE A;  2XAS A;  3G67 A;  4GKJ B;  1Q6H A;  2WLI A;  1H2L A;  4DV4 B;  3B77 A;  4RUE A;  2LJ2 A;  3T1Y B;  1FJG O;  4I55 B;  3BRC A;  1ROP A;  4X9Q A;  4K3A A;  4DUY O;  1YJW V;  4DR7 O;  2ARH A;  1IDS A;  1ZX3 A;  3G6B A;  3F7Y C;  4D6T H;  3O9O A;  4FLX A;  4MS2 A;  3S3X A;  1SZX A;  3K0D A;  1US6 A;  1LUW A;  1OCC C;  1R1B A;  1F23 A;  5H6R A;  4FPP A;  1S72 V;  1Q7Y W;  1KUQ A;  2OWO A;  3GB7 C;  4O2A A;  1PNK A;  1F7Y A;  4JI4 B;  3H1K H;  1JOY A;  2ITD C;  2DE0 X;  2WLI B;  2Y4T A;  1Q86 W;  2LW7 A;  4I4T A;  5LP6 C;  1FYJ A;  1O9G A;  2JGD A;  1H2M A;  2Y4U A;  4HBN A;  1TUB A;  3H1I H;  4F6R A;  4LF7 B;  1BZK A;  3WG7 C;  3SYO A;  2H3O A;  2QDO A;  2ZQM A;  5LP6 B;  2QM7 A;  2HR3 A;  4TQF A;  1QNM A;  1KBH A;  4NR1 A;  1R73 A;  4U7N A;  2KB1 A;  2DYS B;  2YI9 A;  3F5W C;  2Q67 A;  2UXB O;  2ZXW C;  2Y0P A;  4O4J A;  3ABM C;  1RP3 B;  2HVK C;  3W7S A;  1GN3 A;  4R8C A;  1F4N A;  3ZHU A;  4LF8 O;  3WFV A;  3RYI A;  3E86 A;  2HHH B;  1KYO F;  4CC6 A;  2PI4 A;  4FZ1 A;  5E1A C;  1N4C A;  2DYR B;  2AZ0 A;  1TUB B;  5JWP A;  4JI3 B;  1RM1 B;  1R6N A;  4DR6 O;  2R70 A;  2N04 A;  5EIB D;  1W0K G;  4ASU G;  4IL6 Z;  4K8X A;  1M56 B;  4J7Z A;  3OFN G;  2DWD C;  3BA9 A;  1HR0 O;  4J41 A;  2BOC C;  1MMM A;  4YHH O;  3OD4 A;  4MW3 A;  2ZIM A;  2ZNJ A;  3UM7 A;  2DQ3 A;  2UU9 O;  2M7W A;  3MD0 A;  3LDC A;  4PDV A;  4AIL C;  2E76 B;  2EJR A;  3CXC U;  4JYY A;  3ABK C;  2IM9 A;  3QO8 A;  4TWK A;  3JCU Z;  3S3W A;  3TXS A;  2EUL A;  2X0L A;  4EB6 A;  3TXQ A;  3KG2 A;  1HWY A;  1KP3 A;  3I56 V;  1AJN A;  4OXS A;  3B2E E;  4X1Y A;  4TV8 A;  2JVD A;  2E5L O;  1Q90 D;  3H1H H;  3L71 H;  3T1H O;  1PP9 H;  1E1R G;  3ETE A;  4U7O A;  2HJF C;  3I5D A;  4ZBM A;  2Y48 A;  1HP8 A;  4LP8 A;  2W6J G;  1Q6U A;  4PA6 A;  4J7K A;  3H01 A;  1IX9 A;  2HFE C;  2LGW A;  5L3G A;  2ZD9 A;  1K4C C;  1LNQ A;  2JJ2 G;  1N34 B;  4B3S O;  1I0H A;  3RYI B;  3OGI B;  2G38 A;  3SYA A;  3WB2 A;  2HEP A;  2EIK C;  3QF7 A;  5J2U A;  1DF4 A;  1XDC A;  3T1H B;  4ZHQ A;  4JI0 O;  1VIB A;  1ARO P;  5BXZ A;  1SC5 B;  3A2F A;  4DV7 B;  1ZUQ A;  1T5E A;  2QJ1 A;  5A9G A;  2QKC A;  3LNN A;  3WG7 B;  4X65 B;  3UO2 A;  1GTO A;  4UVB A;  2Q69 A;  1QLE C;  2PYL A;  3CWB H;  2IW5 A;  5H6Q A;  1KQS U;  4MTF A;  2ZR3 A;  1MAB G;  2OIG A;  3IJ4 A;  5KMG B;  2EIN C;  1AB3 A;  3ABU A;  4YXW G;  4PD4 F;  1QLE B;  2RNB A;  4PI0 A;  1J95 A;  1IXB A;  3LDD A;  1VQ4 V;  5KHJ A;  1SQX H;  1S0V A;  4JZG A;  4B3S B;  3FFQ A;  4I0X B;  4UB8 Z;  4TOI A;  3W7T A;  1N32 B;  4DV5 O;  4L87 A;  4WBN A;  2F93 B;  4LFC O;  4LF7 O;  1KMI Z;  1JQ0 A;  4O4H A;  4UUJ C;  1K9M W;  3C3S A;  1BSM A;  2JGD B;  4N23 A;  4DV1 B;  4BIZ A;  2BCC H;  2E75 B;  1VQ8 V;  3IAY A;  1TAE A;  3HKB A;  3JD0 A;  4JYB A;  2B1I A;  4FK5 C;  4B3R O;  3B8N A;  3CYO A;  4XBF A;  4WFB V;  5KHH A;  2UXB B;  4TV9 A;  4JI4 O;  1RM1 C;  4DK0 A;  3TK1 A;  4LFB B;  1KB9 F;  4DV5 B;  2P5O A;  2Q5Z A;  2P4V A;  3K08 A;  4CH6 A;  2NN4 A;  1TVK A;  1HNZ O;  1M9N A;  1SET A;  5GTI Z;  5CA0 A;  3VQW A;  1XHZ A;  1I08 A;  2ZR2 A;  1K7D A;  3M8A A;  3B09 A;  3CJH A;  1VQ7 V;  1BT8 A;  3JSN A;  2CTQ A;  4J80 A;  4U3F H;  5FNV B;  2GV9 A;  5CN0 A;  1AJQ A;  2BTO A;  4X64 B;  1SZT A;  2R9A A;  3TJT A;  1N32 O;  3CRM A;  4GX5 A;  3HKC A;  2CAZ C;  3FB6 C;  1BHA A;  4LNU B;  2XHB A;  4PHZ A;  1ENV A;  3GVM A;  4U3J B;  3ZMV A;  4YJ3 B;  1COW G;  4E4E A;  3BHP A;  4HZ3 A;  4P2Z A;  1PD3 A;  1CPY A;  3ZRV A;  2AXT Z;  4X66 O;  5H5N A;  4XDL A;  2Q8V A;  1QLN A;  5EC2 C;  2LO1 A;  1M1K W;  4PDR A;  4X89 A;  1BMF G;  5K1X A;  2JJ1 G;  2PYJ A;  1THZ A;  2FKX A;  1K34 A;  4YIP A;  2Q7E A;  1WJZ A;  2NR5 A;  4B3T B;  5CMU A;  5B1A C;  1PKX A;  3U10 A;  3LNM B;  3SPH A;  1J5E B;  1G6U A;  4HNA A;  1AI4 A;  4ZKI A;  5IDJ A;  4IYI A;  1AVM A;  4LF9 B;  2GUZ B;  4K0K O;  2WLH A;  3K5N A;  2XAF A;  4CS4 A;  2ZE6 A;  2IJK A;  2QWO B;  4H44 B;  2CK3 G;  3X2Q B;  3CD6 V;  4BAY A;  4LNU A;  4KP4 A;  2Q7G A;  1P49 A;  2RDC A;  2WA4 A;  4GKJ O;  3OEE G;  1NVP D;  1XNQ O;  2PUS A;  2HVJ C;  2UUC B;  1TA8 A;  3BA8 A;  2CH7 A;  3K3W A;  1AIL A;  3JAL B;  4X88 A;  3PJS K;  1BQ0 A;  1AR1 B;  4W4L A;  4JYA B;  1Y76 A;  3P30 A;  4P9P A;  3H9V A;  2Q7H A;  4CBC A;  5CB4 B;  1GAX A;  3UO3 A;  3BCC H;  4LF5 B;  1B06 A;  1S3J A;  5LA6 A;  5FPR A;  1KEC A;  2F95 B;  3SPC A;  4WFG A;  1GN2 A;  1KKC A;  4DV0 B;  4PA9 A;  3DC5 A;  2UXD O;  2YEV B;  2V1D A;  1YVW A;  1XOU A;  1O9H A;  3ICX A;  4I7Z B;  1VQN V;  4GYC B;  4TV8 B;  1JR9 A;  1JPX A;  1BHB A;  1H8E G;  1V55 B;  1QU7 A;  2HP8 A;  1N36 B;  2GTA A;  1ZSP A;  3B8M A;  3F7V C;  3CMA V;  3L70 H;  1G1X B;  3E8F A;  3TET A;  4O4H B;  5LBQ A;  1XMO O;  5J2T A;  3FX7 A;  5AG2 A;  4DW1 A;  2MK3 A;  4G2K A;  3JAR B;  4JI6 B;  5JJE B;  3OTO B;  5LL6 Y;  4LF9 O;  4K0K B;  1ZL8 A;  4GCZ A;  1XEQ A;  2LQT A;  4UCU A;  3JD2 A;  4PJ0 Z;  4NXN B;  3UCS C;  4BWA A;  4GX1 A;  4J10 A;  5CA3 A;  2E5L B;  1IBL B;  3CCJ V;  2UU9 B;  1AI6 A;  4MVR A;  3RT3 C;  4Q6G A;  1L1F A;  3JAK A;  4MTG A;  3RVZ A;  5LHH A;  1WLE A;  4HNA B;  1XMO B;  4DR5 O;  3AK2 A;  3SGI A;  2QTS A;  2UXC B;  5EYP A;  5KHG A;  1EZV H;  4WBN B;  3VOU A;  5B1N A;  5KHK A;  3CCL V;  1JJO A;  2P90 A;  3A0R A;  4JZ2 A;  4CH4 A;  3UQ8 A;  2W0X A;  1GKF A;  1P4R A;  2UXD B;  4TUY A;  2PI5 A;  2P22 C;  3CE2 A;  1IUR A;  2B9Z A;  3W7X A;  4X66 B;  4DUZ O;  4ZOL A;  4FZ0 A;  1K3E A;  3I55 V;  4FFK A;  1R3J C;  3BY6 A;  2M6Y A;  1AP5 A;  2JEX A;  4TT3 G;  2EIM B;  2OT5 A;  4BR6 A;  1K92 A;  2LFR A;  2GTS A;  1M4U A;  3ZRS A;  2PZS A;  1SQV H;  4DR1 B;  4DV2 B;  1GN4 A;  2W0F C;  2FML A;  1XHX A;  4DR4 B;  2L35 A;  1WPX A;  3P3P A;  1URF A;  1RPO A;  3L72 H;  3OTF A;  4J9Y B;  3MAQ A;  3ETG A;  2DYR C;  5L3B A;  2KQX A;  2YXY A;  3ZIA G;  3K06 A;  3AK3 A;  3UT5 A;  2C2A A;  4I55 A;  1WP8 A;  5IYD O;  1N0N A;  2Q73 A;  3SJB C;  1YIT V;  2D2C B;  4FLV A;  2JDI G;  2A79 B;  3E89 A;  4DV1 O;  2F43 G;  1H2K A;  5BR8 O;  2YIB D;  2QTO A;  2PTM A;  4OGQ B;  5IYZ A;  1KU9 A;  4WFA V;  4B3R B;  3RVY A;  4JI2 O;  1XQ8 A;  2ZE7 A;  4LCU C;  2E3C A;  2ZE5 A;  2N05 A;  3CCS V;  2LGQ A;  5E79 Z;  1XI1 A;  1Z5W A;  2H94 A;  4ZHQ B;  4DW0 A;  5D5Q A;  3IFX A;  3ABT A;  1V55 C;  2WAM A;  1VQM V;  4MW8 A;  4QE7 A;  1DF5 A;  4WCE V;  4FLU A;  3M99 B;  1LUV A;  3SPI A;  4FJC C;  1WNS A;  1HDJ A;  4D7T A;  4QJF B;  1FJG B;  2D3O W;  3U11 A;  3QO5 A;  3GWK C;  1Y67 A;  1EZJ A;  3G4S V;  3OMN B;  4UV8 A;  2YID A;  3T4D A;  2BE3 A;  4RQF A;  4PA3 A;  4Q20 A;  1NS1 A;  3OEH G;  1YTF B;  3MHH C;  4MVM A;  4GLX A;  2EIJ B;  3N2G B;  2IJH A;  3ZMT A;  3AEI A;  3RYH B;  3CCR V;  1QVF U;  4GKK O;  2LFS A;  5GON B;  4MT8 A;  1YIJ V;  3E35 A;  5LA6 B;  2WLL B;  4FLY A;  2V4D A;  4J7J A;  4I9Q A;  1ZL8 B;  3GWO A;  2OYQ A;  1Q82 W;  4ZIB A;  4I50 A;  5LGT A;  2XAJ A;  2CH7 B;  2B1G A;  2YIB A;  2QM8 A;  1QBZ A;  1Z2G A;  5L3F A;  2Q0A A;  5CA1 B;  4B3T O;  1JA8 A;  5L3C A;  1SER A;  3ZHQ A;  2DW4 A;  1BL8 A;  1N33 B;  1B04 A;  1XNR O;  3F5T A;  5LMU O;  1Q43 A;  2L6L A;  3CCE V;  3RWR D;  1IBK B;  4F6R B;  2Q9L A;  3RYH A;  3DC6 A;  4WF9 V;  1JX9 A;  1FXH A;  4FM2 A;  2ITC C;  1XL4 A;  3BVO A;  3K58 A;  4JI8 B;  3JAT B;  3B4S A;  1PV0 A;  3Q4H A;  3P32 A;  1EN6 A;  4NKG B;  3HKC B;  2H8P C;  2UUC O;  4TUY B;  1SQP H;  3AG3 C;  1XBL A;  4CS3 A;  4DV3 O;  3N2G A;  5K1P A;  4PDM A;  1VP7 A;  2KKW A;  5BZB A;  2ZKO A;  2CGO A;  1YHQ V;  4JV5 B;  1NJI W;  1MSD A;  2HJD A;  4JI7 B;  4F6E A;  1DK1 A;  3N2K B;  1EM1 A;  2X6C A;  5IY5 B;  1MA1 A;  1QCE A;  3ZRX A;  2Q0O C;  4EKW A;  5KA5 A;  5LGU A;  4DV6 B;  4JI8 O;  4NXM B;  2QR4 A;  3JD3 A;  3RYF A;  3HKE A;  1U97 A;  1IBM O;  5IY5 C;  1E79 G;  2VQE O;  3K5O A;  3ZED A;  3STZ C;  4DRX B;  1YEW A;  2QM4 A;  1VQL V;  5IJ0 A;  1KKD A;  5C93 A;  1B6Q A;  3EFF K;  3HKD B;  1BCC H;  4JI7 O;  4J42 A;  2JK5 C;  4IYH A;  3DXR A;  3ASN C;  4MVQ A;  4ZOL B;  5FPO A;  3FAV A;  2PY5 A;  3ABL C;  5EC1 C;  4LH6 A;  1N0J A;  4X64 O;  3JAS A;  1N33 O;  4LWS B;  2WLL A;  2YSU B;  1I94 B;  1FXK B;  1NQT A;  1NR1 A;  5ITZ B;  3D36 A;  3P3N A;  4UCR A;  1YZB A;  5TIS Z;  1NI8 A;  3ZRW B;  4X1I B;  5JCO A;  4QE9 A;  2UXN A;  2FTK A;  2OCH A;  4I4T B;  2OCC B;  5CA1 A;  3HB3 B;  3WU2 Z;  2BSK B;  4O4I B;  1U96 A;  1W0J G;  3C3T A;  5B1O A;  2CUG A;  3SYQ A;  3TCU A;  5EIB C;  5HFM A;  3JAW B;  1S5J A;  3ZMZ A;  2HG5 C;  1NTK H;  5IT9 N;  2WPD G;  5JCO C;  3OR7 C;  1A32 A;  2R72 A;  1K73 W;  3BPZ A;  4QNH B;  2F1M A;  3OW2 U;  5CBH A;  5JQG A;  2A9H A;  1IVS A;  3RYC A;  1VQK V;  1OCR C;  3HKD A;  4UXN A;  2YI8 A;  1J5E O;  4J11 A;  1M57 C;  4DK1 A;  3THO A;  4FLT A;  4QPK A;  4JI6 O;  2UUB O;  1DLB A;  1VAR A;  3N27 A;  3KCX A;  1HR0 B;  3ZJZ A;  2VQE B;  2ILM A;  4X65 O;  1V54 B;  3SDL A;  3FKS G;  2EIL B;  4XDJ A;  4E2L A;  1NT2 B;  2DN9 A;  1SF9 A;  3LSS A;  4PV1 B;  3IC7 A;  5FLX N;  1NH2 B;  3SYP A;  1SES A;  2QWR B;  4HAM A;  4DUZ B;  1P7G A;  3T2M A;  2WWW A;  5JQG B;  4O4I A;  4JYC A;  1I7F A;  4NTW A;  5JH7 A;  4DUY B;  1P84 F;  4P30 A;  1L0L H;  1DGS A;  2CDY A;  3A8T A;  2LP7 A;  3ZMU A;  4IT5 A;  1VF6 C;  4EB6 B;  5J2U B;  5GTH Z;  1WB7 A;  3K04 A;  3JAW A;  3D36 C;  3LUT B;  4JAS A;  2Y69 B;  4UCO A;  4X20 A;  4I9W A;  2YXH A;  2W6I G;  3CB2 A;  4X1Y B;  2ADQ B;  3W7U A;  4YJ2 A;  1GM9 A;  3CC7 V;  2FB5 A;  5EZY B;  2EIK B;  4G28 B;  1HNW B;  1FXK C;  4X1K A;  2UUA O;  4X62 O;  4K8Z A;  1FAF A;  1QR8 A;  3E83 A;  3OE7 G;  3SJQ C;  1FKA O;  4JI1 O;  2AW9 A;  1D5A A;  4PI2 A;  2UXC O;  5L3D A;  2OCC C;  3VQV A;  4AHC A;  5DEC A;  1AJP A;  1VQO V;  3CHX A;  4ABM A;  4PA4 A;  2VQF B;  4DR3 B;  1M5I A;  1ORQ C;  4KHP O;  2Y0I A;  1E1Q G;  3RBZ A;  5IJ0 B;  3VQY A;  3FYE B;  4JI5 B;  2DYS C;  2CTW A;  4DR6 B;  2YEV A;  4IGG A;  1IBM B;  1UFI A;  1IXM A;  3OT7 A;  1OCO C;  3ABM B;  2EIM C;  2EIN B;  4I0X A;  3K59 A;  4GUN A;  2HHH O;  2P4K A;  4QPJ A;  4UCS A;  3CME V;  2FYU H;  2WA3 A;  3IC9 A;  1NR7 A;  2XOK G;  4UB6 Z;  3ZS8 C;  5B3S C;  4RAI A;  1VMG A;  4OX9 B;  2ZE8 A;  5H2F Z;  1SQB H;  4CC5 A;  4LH7 A;  1GK9 A;  2GUZ A;  5JH7 B;  3T4Z A;  2NLJ C;  5FNV A;  5B3S B;  3KCY A;  5KMG A;  1Q5O A;  4IHJ A;  2DWE C;  2YS8 A;  3CC2 V;  4G27 B;  3SYC A;  2VQF O;  2QWP B;  1FPO A;  3ASO B;  3EHB B;  3DSQ A;  4PDL A;  2R9I A;  5KAI Z;  3JD1 A;  5IWA B;  1YXB A;  4ZI7 B;  3CCM V;  1N8R W;  3L75 H;  2UUA B;  4YY3 O;  5J9P C;  3ML0 A;  3CPW U;  3J7A U;  5DED A;  3ETQ A;  3VQX A;  1H2S B;  3ZCC A;  3ABK B;  3RYC B;  2ZDI C;  5LXT A;  4CH3 A;  2K1E A;  1P7B A;  1YDX A;  4H13 B;  1N34 O;  4O4J B;  3FD9 A;  1WAZ A;  3K5L A;  3HR0 A;  2VS0 A;  4UV9 A;  5BMV B;  4AI8 A;  3JSL A;  1EBO A;  3BAB A;  2OTJ V;  1NTM H;  2P06 A;  4IHJ B;  5LMN O;  1VF5 B;  5H9C A;  1IZ3 A;  1ZLZ A;  3B40 A;  3K9A A;  4AQY O;  3ZN0 A;  1SA0 A;  3A0H Z;  4K35 A;  1NTZ H;  3T1C A;  5EBW C;  2ZCE A;  2YDE A;  3ASN B;  4D7S A;  4PEL A;  3T1Y O;  5LMU B;  2AHY A;  4LF6 O;  3ZRW A;  2KG7 B;  2GHY A;  1FXV A;  3ETD A;  1R3L C;  3AG2 C;  1IBL O;  2ZT9 B;  2ZNI A;  4P9O A;  1Z5V A;  3H1J H;  2YC0 A;  2F4V O;  2HLD G;  5BMV A;  3OR6 C;  1YTF D;  3L74 H;  2X6B A;  2QA4 V;  1QQC A;  3K5M A;  1YF2 A;  2X6A A;  4B7K A;  3LSU A;  3APQ A;  3QNE A;  2P67 A;  4GZR B;  3NXS A;  3JAM N;  4IIJ B;  1GM8 A;  4LFA B;  2IU0 A;  3EVK A;  1V9P A;  1R6K A;  2XUM A;  3JAK B;  4MTX A;  4FM1 A;  1FFX A;  4WFH A;  2ZM6 B;  4MVO A;  3QVN A;  1RPR A;  5B1A B;  2QEX V;  1NZ6 A;  3K9S A;  1NU1 H;  2EX3 A;  2RQ6 A;  4JAA A;  4JPR A;  1GRJ A;  2JS3 A;  2O57 A;  2Z3Y A;  5IYZ B;  4R7C A;  4BIO A;  2YIA A;  4FIP C;  1DTO A;  3AG1 B;  1SA0 B;  4EFB A;  3X2Q C;  1XMQ B;  4LFA O;  1W59 A;  4LC1 A;  1I5Y A;  2DMX A;  3AK1 A;  5IYC O;  1V54 C;  3H1L H;  2EBO A;  1SRY A;  4X62 B;  3J80 N;  3D3I A;  1X4T A;  1Y76 B;  4GKK B;  4JF3 A;  4NTY A;  1S5L Z;  3CS5 A;  1VF7 A;  5JVD A;  4Z1V A;  5EBL C;  1Y4M A;  1OJH A;  5EZY A;  3M7M X;  4B3M B;  1RFY A;  2E74 B;  1XMQ O;  4F4L A;  3CXH F;  3HKB B;  3CCV V;  4YIO A;  4DO2 A;  1SQF A;  4DR1 O;  1F4M A;  1BGY H;  3NR7 A;  4DV0 O;  4X20 B;  1AP6 A;  4DV6 O;  5B1B C;  1FFX B;  1CEZ A;  5F2V O;  2ZIO A;  4JI5 O;  2XT9 A;  4IIJ A;  3E8G A;  4ICG A;  1OHH G;  4JYA O;  1NVP B;  2KSD A;  1WB8 A;  3FAV B;  3WB1 A;  5KUK A;  5B1B B;  3CRQ A;  4JTC B;  4MVU A;  4HYO A;  4BIU A;  3R65 A;  3OUF A;  1RSO B;  1JFF A;  5IWA O;  4X1K B;  3ZBH A;  3MDS A;  2PF4 E;  1GN6 A;  1R6T A;  4YY3 B;  4LBE C;  3JCZ A;  1SKV A;  3ZHT A;  1JCH A;  2JRI A;  1OCZ B;  3D8C A;  2VRZ A;  2JIZ G;  4DXW A;  4TSF G;  1M90 W;  1H8H G;  3SR2 C;  4DR7 B;  3KKY A;  3PN1 A;  1NKD A;  3CRA A;  4NB5 A;  5KAF Z;  1OCZ C;  1I5X A;  4B3M O;  3A0B Z;  2YXL A;  2OIE A;  5IYB O;  1MZE A;  4Z2W A;  3K03 A;  4DYL A;  3STL C;  3CC4 V;  2ZDI A;  3KZI Z;  3JYC A;  1MSW D;  2YUA A;  4WFE A;  4FFB A;  1XRE A;  3U0Z A;  5HFL A;  3RGB A;  4UVA A;  2EZO A;  3ZHV A;  2EIJ C;  1Y74 B;  1S76 D;  3MHS C;  1TGO A;  4BW9 A;  5DN6 G;  3DGE A;  5FL7 G;  1VQ6 V;  5LHI A;  4H33 A;  1G8M A;  1WN7 A;  4GX0 A;  4FLZ A;  5LGN A;  5D5P A;  2BTQ B;  1LR1 A;  2B5U A;  4YJ3 A;  5C8Y B;  5CB4 A;  2WSS G;  3K57 A;  1HNW O;  1VQ5 V;  3TGU H;  1H2G A;  1WA8 A;  2RMK B;  5LXT B;  5A2Q N;  1EFR G;  2ATK C;  4C7U A;  1EN4 A;  2R9R B;  1M57 B;  3RYF B;  4UFZ A;  4MVZ A;  2QE7 G;  4FFB B;  1S77 D;  4WFF A;  1QR9 A;  1PL0 A;  4TV9 B;  1AI5 A;  2LW1 A;  3CX5 F;  2A3Q A;  1HNZ B;  1VF6 A;  5LP6 A;  1GO3 F;  3UT5 B;  4MTO A;  2IH3 C;  5KLV H;  2AGA A;  2EIL C;  4H37 A;  1PM9 A;  1AR4 A;  1W2B U;  1F51 A;  3L9D A;  1XNQ B;  1PNL A;  2WLJ A;  2QSA A;  3QTC A;  1UPG A;  1AR5 A;  4NYK A;  2RCV A;  3QG5 A;  3OUS A;  1S5H C;  3L73 H;  3EXA A;  4YJ2 B;  1SQG A;  4O4L B;  2XAG A;  3HKE B;  1SQQ H;  1JFF B;  4YHH B;  2AHZ A;  1K33 A;  2A0L A;  1XL6 A;  5LOV A;  2F23 A;  5EK0 A;  1CXZ B;  1R3K C;  1XIL A;  5LYJ A;  3J81 N;  4JTD B;  4X8A A;  3HPL C;  1ZTE A;  2CE4 A;  4B7E A;  1R3I C;  2A06 H;  1ZAU A;  4JI0 B;  1SS3 A;  1GMG A;  2IH1 C;  5BR8 B;  1JVM A;  1YCI A;  4FLW A;  2X7R B;  3VBB A;  4A5U B;  3BFR A;  1YI2 V;  2OTL V;  4CZZ A;  5J2T B;  3QO7 A;  2GDS A;  2Z5U A;  4JI2 B;  1H38 A;  3CSX A;  3JAS B;  2BTQ A;  1G4Y B;  4TQD A;  5JJJ B;  2FL4 A;  3JAR A;  1TVK B;  1GH6 A;  1OZ0 A;  2IJJ A;  3CRR A;  5CA0 B;  1KP2 A;  3E22 A;  2RJZ A;  1OV9 A;  2QWQ B;  4AQY B;  3RW0 A;  1PPJ H;  3SJC C;  3CCQ V;  2IU3 A;  4DR5 B;  5KX5 A;  4EEQ A;  4NXM O;  4KXR A;  3FB5 C;  5KUM A;  3ZN1 A;  1L0N H;  2EJ7 A;  3OTO O;  1MNG A;  4QGP A;  4LF6 B;  1OCC B;  4NVP A;  4NXN O;  1D2D A;  4DR3 O;  4O4L A;  4LFC B;  3E2E A;  2GSM B;  2P7T C;  4DR4 O;  4O2B B;  3OMA B;  1B3Q A;  2YIC A;  3OMI B;  2Z0A A;  3E22 B;  4DR2 B;  4I50 B;  3E8B A;  1FXK A;  3AG7 A;  2HKO A;  4UCV A;  1H2N A;  3ZX6 A;  5IE9 A;  5B5E Z;  1I94 O;  4N21 A;  2DOS A;  4LFB O;  3AG4 C;  4DV2 O;  5CBG A;  2XND G;  3K79 A;  3G6E V;  2BSK A;  2EZP A;  5KA6 A;  2WLK A;  1JJ2 U;  3AG1 C;  3OAA G;  3D3Q A;  5GON A;  4RQE A;  4B08 A;  5IJ9 B;  4NTX A;  2ZXW B;  4ZI7 A;  1D5N A;  2JGU A;  4DV4 O;  5JVD B;  3IGA C;  5CBF A;  5BY1 A;  5EYP B;  2P6J A;  4GX2 A;  2Q6A A;  2WLM A;  4O2A B;  3FB8 C;  4RUF A;  1RSO A;  1XNR B;  5LOV B;  3ZMS A;  1Y74 A;  1YJ9 V;  4GT1 A;  3C90 A;  5LYJ B;  5JJN B;  1K5S A;  2XAQ A;  5KX5 B;  3BAA A;  2ZIN A;  4JV5 O;  1QHT A;  1ZWI C;  4OX9 O;  2V7Q G;  2QKA A;  3JAL A;  2JEU A;  3AG3 B;  3O65 A;  3WB0 A;  5DM6 V;  3RFR A;  1MOF A;  4J9Z B;  2JS5 A;  2AZ2 A;  1BE3 H;  4PA7 A;  4CS2 A;  1K97 A;  4QIW F;  4KFM A;  1IBK O;  1QVG U;  2A7W A;  3OGC C;  1FD9 A;  1FFT B;  4BW5 A;  1N36 O;  3CCU V;  1JMK C;  2KG7 A;  3RN4 A;  1HW7 A;  1XUQ A;  4CH5 A;  3G80 A;  2ZM6 O;  1X59 A;  4DV7 O;  3G71 V;  1L8D A;  2IBZ H;  2N74 A;  4Z1M G;  2Y69 C;  3OM3 B;  1PL4 A;  3ABL B;  3DXR B;  4DV3 B;  1GM7 A;  3R66 A;  4FM0 A;  2QWN B;  1K4D C;  2UXX A;  3DTU B;  5C8Y A;  5LMN B;  4LF4 B;  3CJH B;  1VQ9 V;  1KC8 W;  3AG2 B;  2CGN A;  5ITZ A;  2ETN A;  1Q6I A;  4JAU A;  3SPJ A;  4XDK A;  4MSW C;  4W4K A;  4LWS A;  1BS3 A;  4MVS A;  3CRC A;  4FVM A;  1NH2 D;  4OPH A;  3ZHS A;  2QKS A; 
#chains in the Genus database with same CATH homology
 2Z3Y A;  4R7C A;  4GX5 A;  4FIP C;  3W7W A;  4PDM A;  3FB6 C;  1DTO A;  1BHA A;  3AG1 B;  5BZB A;  2BOB C;  3X2Q C;  1ENV A;  3LSQ A;  4LC1 A;  1I5Y A;  4JGS A;  1YHQ V;  3SPG A;  1NJI W;  1K5Q A;  4I5S A;  5IYC O;  3JD4 A;  3ZMV A;  1V54 C;  1Y66 A;  2EBO A;  2X6C A;  1COW G;  1QCE A;  5IY5 B;  3ZRX A;  3AG4 B;  4EKW A;  5KA5 A;  5LGU A;  4R50 A;  4HZ3 A;  4P2Z A;  3JD3 A;  1PD3 A;  1SRY A;  3K0G A;  1CPY A;  3D3I A;  3ZRV A;  5LHG A;  1OCR B;  4JF3 A;  4XDL A;  2IJI A;  1QLN A;  5IY5 C;  1UJW B;  5EC2 C;  1E79 G;  1M1K W;  4PDR A;  4X89 A;  5EBL C;  3CP1 A;  1Y4M A;  1BMF G;  3STZ C;  1VQL V;  1YSC A;  1KKD A;  2JJ1 G;  1OCO B;  1B6Q A;  4F4L A;  5C93 A;  3CCV V;  3EFF K;  4DO2 A;  1THZ A;  1F4M A;  2DQ0 A;  2JK5 C;  4FMT A;  1FS0 G;  1K34 A;  3ASN C;  4MVQ A;  1Q81 W;  1NBM G;  5B1B C;  1CEZ A;  4JAV A;  1M56 C;  5CMU A;  5B1A C;  3BEH A;  1PKX A;  3ABL C;  5EC1 C;  3E8H A;  3LNM B;  4UVC A;  3SPH A;  1AI4 A;  3E8G A;  4ZKI A;  1OHH G;  2WLN A;  1NVP B;  2WLL A;  5IDJ A;  2YSU B;  4R6Z A;  1FXK B;  1NQT A;  5B1B B;  4JTC B;  2WLH A;  4MVU A;  5KUK A;  4HYO A;  4BIU A;  1AI7 A;  1NR1 A;  2XAF A;  3R65 A;  2IJK A;  3D36 A;  3OUF A;  1MG1 A;  1K8A W;  2Q68 A;  2CK3 G;  3ASO C;  3X2Q B;  3CD6 V;  4JTA B;  3ZRW B;  2XAH A;  4BAY A;  4KP4 A;  4QE9 A;  2UXN A;  2FTK A;  4LBE C;  3JCZ A;  2OCC B;  1JCH A;  3UKM A;  3HB3 B;  3OEE G;  1NVP D;  1OCZ B;  1W0J G;  2JIZ G;  4DXW A;  2HVJ C;  4TSF G;  5B1O A;  1M90 W;  3K3W A;  5L3E A;  1CP9 A;  4X88 A;  5GW7 A;  3PJS K;  3SYQ A;  1H8H G;  1AR1 B;  3TCU A;  5EBM C;  1YJN V;  4P9P A;  3P30 A;  1NKD A;  5HFM A;  1VQP V;  4CBC A;  1OCZ C;  1PNM A;  1KD1 W;  1I5X A;  1S3J A;  1TUE B;  5IYB O;  1KEC A;  3ZMZ A;  3FYI B;  2HG5 C;  2WPD G;  4RO2 A;  3SPC A;  3OR7 C;  3FB7 C;  1K73 W;  4WFG A;  3K03 A;  4KUM A;  4QNH B;  2NNU A;  3OW2 U;  5CBH A;  2A9H A;  4PA9 A;  3STL C;  3CC4 V;  2ZDI A;  3JYC A;  3LDE A;  1MSW D;  1VQK V;  2XAS A;  1OCR C;  4UXN A;  2YEV B;  2V1D A;  2WLI A;  4WFE A;  1M57 C;  5HFL A;  3B77 A;  4RUE A;  4UVA A;  2EZO A;  4QPK A;  2EIJ C;  1DLB A;  1ROP A;  1VQN V;  3MHS C;  1S76 D;  1YJW V;  5DN6 G;  1JPX A;  3DGE A;  3ZJZ A;  1H8E G;  1BHB A;  1V55 B;  5FL7 G;  1VQ6 V;  1V54 B;  3F7Y C;  5LHI A;  3F7V C;  3B8M A;  4H33 A;  1G8M A;  3FKS G;  4GX0 A;  3CMA V;  2EIL B;  4MS2 A;  5LGN A;  4XDJ A;  3K0D A;  2B5U A;  2WSS G;  4E2L A;  1OCC C;  3E8F A;  3TET A;  3LSS A;  1F23 A;  5H6R A;  3IC7 A;  5LBQ A;  4FPP A;  1S72 V;  1Q7Y W;  1VQ5 V;  1H2G A;  3GB7 C;  1NH2 B;  3SYP A;  1EFR G;  1SES A;  2ATK C;  2MK3 A;  4HAM A;  4G2K A;  1PNK A;  3T2M A;  2WWW A;  4JYC A;  2R9R B;  1M57 B;  1JOY A;  2ITD C;  4P30 A;  2WLI B;  1Q86 W;  4MVZ A;  2QE7 G;  4GCZ A;  1S77 D;  4WFF A;  1QR9 A;  1PL0 A;  2LP7 A;  1AI5 A;  3ZMU A;  3JD2 A;  4GX1 A;  5CA3 A;  1GO3 F;  4MTO A;  2IH3 C;  3SYO A;  3WG7 C;  1AI6 A;  3K04 A;  4MVR A;  2EIL C;  4H37 A;  3CCJ V;  2ZQM A;  1W2B U;  1F51 A;  2QM7 A;  3LUT B;  1L1F A;  4JAS A;  4MTG A;  3RVZ A;  5LHH A;  1WLE A;  1PNL A;  2HR3 A;  2WLJ A;  2Y69 B;  1R73 A;  4U7N A;  2KB1 A;  2DYS B;  3OUS A;  1S5H C;  4I9W A;  2W6I G;  3F5W C;  2Q67 A;  2ZXW C;  2XAG A;  3VOU A;  2AHZ A;  5B1N A;  1K33 A;  2A0L A;  1XL6 A;  3W7U A;  3ABM C;  2HVK C;  1GM9 A;  3W7S A;  5EK0 A;  3CCL V;  3CC7 V;  4R8C A;  2P90 A;  3A0R A;  1F4N A;  1R3K C;  2EIK B;  4G28 B;  3WFV A;  4JTD B;  3E86 A;  4X8A A;  3HPL C;  1GKF A;  1FXK C;  2PI4 A;  1R3I C;  1P4R A;  1GMG A;  5E1A C;  2PI5 A;  2IH1 C;  2DYR B;  1JVM A;  3W7X A;  2X7R B;  3VBB A;  1RM1 B;  1QR8 A;  1R6N A;  3E83 A;  1YI2 V;  1K3E A;  3OE7 G;  3I55 V;  3SJQ C;  2OTL V;  1W0K G;  4ASU G;  1R3J C;  3BY6 A;  3QO7 A;  4CZZ A;  1M56 B;  2Z5U A;  3OFN G;  2DWD C;  5L3D A;  1H38 A;  2JEX A;  2BOC C;  2OCC C;  4TT3 G;  1G4Y B;  2EIM B;  2OT5 A;  1AJP A;  1VQO V;  4PA4 A;  4MW3 A;  1K92 A;  1ORQ C;  1OZ0 A;  2IJJ A;  2LFR A;  3ZRS A;  1KP2 A;  3UM7 A;  2DQ3 A;  2W0F C;  1E1Q G;  2M7W A;  3MD0 A;  3RBZ A;  3LDC A;  3RW0 A;  4PDV A;  3FYE B;  1WPX A;  3CCQ V;  2IU3 A;  2EJR A;  3CXC U;  1RPO A;  3ABK C;  4J9Y B;  2DYS C;  3FB5 C;  3QO8 A;  3ETG A;  2DYR C;  4TWK A;  5KUM A;  3ZN1 A;  5L3B A;  2YEV A;  3ZIA G;  3K06 A;  2X0L A;  1IXM A;  2C2A A;  3KG2 A;  1OCC B;  1HWY A;  5IYD O;  1KP3 A;  3I56 V;  1AJN A;  4OXS A;  1OCO C;  3ABM B;  2EIM C;  2EIN B;  1YIT V;  3E2E A;  2GSM B;  2JDI G;  4QPJ A;  2P7T C;  3CME V;  2A79 B;  3E89 A;  1E1R G;  1NR7 A;  2F43 G;  2XOK G;  3ETE A;  4U7O A;  5B3S C;  4RAI A;  3OMA B;  2QTO A;  2HJF C;  3OMI B;  2Y48 A;  4ZBM A;  4LP8 A;  2W6J G;  1GK9 A;  4PA6 A;  3E8B A;  4WFA V;  1FXK A;  3RVY A;  3H01 A;  2HFE C;  3T4Z A;  2HKO A;  5L3G A;  2NLJ C;  2ZD9 A;  1K4C C;  4LCU C;  1LNQ A;  5B3S B;  2JJ2 G;  3CCS V;  2DWE C;  3CC2 V;  4G27 B;  3SYC A;  4N21 A;  3AG4 C;  3SYA A;  3ASO B;  2H94 A;  3EHB B;  4PDL A;  2EIK C;  3IFX A;  3ABT A;  2R9I A;  1DF4 A;  5CBG A;  2XND G;  3K79 A;  3JD1 A;  1V55 C;  3G6E V;  2WAM A;  3CCM V;  1VQM V;  4MW8 A;  1N8R W;  2EZP A;  4QE7 A;  5KA6 A;  1DF5 A;  2WLK A;  4WCE V;  3AG1 C;  1JJ2 U;  3OAA G;  3M99 B;  5J9P C;  3SPI A;  4RQE A;  1ARO P;  3ML0 A;  3CPW U;  4FJC C;  2ZXW B;  4QJF B;  3ZCC A;  3ABK B;  2D3O W;  3IGA C;  3QO5 A;  5CBF A;  2ZDI C;  2P6J A;  4GX2 A;  3WG7 B;  2Q6A A;  2WLM A;  2K1E A;  3FB8 C;  4RUF A;  1P7B A;  3ZMS A;  1EZJ A;  1GTO A;  3OMN B;  4UVB A;  2Q69 A;  3G4S V;  1QLE C;  1YJ9 V;  2IW5 A;  4UV8 A;  5H6Q A;  4UV9 A;  4GT1 A;  3T4D A;  4RQF A;  1KQS U;  2ZR3 A;  1EBO A;  1K5S A;  1MAB G;  4MTF A;  4PA3 A;  2XAQ A;  4Q20 A;  2OTJ V;  3OEH G;  2EIN C;  1YTF B;  5H9C A;  3K9A A;  3ABU A;  4YXW G;  1ZWI C;  3ZN0 A;  1QLE B;  2V7Q G;  3MHH C;  1J95 A;  2JEU A;  4MVM A;  3LDD A;  1VQ4 V;  3T1C A;  3AG3 B;  2EIJ B;  5EBW C;  2IJH A;  3ZMT A;  3AEI A;  5DM6 V;  3CCR V;  1QVF U;  1S0V A;  1MOF A;  4J9Z B;  2LFS A;  3ASN B;  4PEL A;  4PA7 A;  2AHY A;  4MT8 A;  1K97 A;  1YIJ V;  4QIW F;  4KFM A;  3E35 A;  3W7T A;  3ZRW A;  2WLL B;  1QVG U;  4L87 A;  2GHY A;  1FXV A;  3OGC C;  3ETD A;  1R3L C;  3AG2 C;  1FFT B;  3GWO A;  1JQ0 A;  4BW5 A;  3CCU V;  4P9O A;  1Q82 W;  4UUJ C;  1K9M W;  5LGT A;  2XAJ A;  4N23 A;  2HLD G;  4BIZ A;  2B1G A;  2QM8 A;  1QBZ A;  1VQ8 V;  3G71 V;  5L3F A;  3OR6 C;  1YTF D;  3JD0 A;  4JYB A;  2B1I A;  2X6B A;  4FK5 C;  4Z1M G;  3B8N A;  2Y69 C;  2QA4 V;  3CYO A;  4XBF A;  3OM3 B;  5L3C A;  1SER A;  2DW4 A;  3ABL B;  4WFB V;  1BL8 A;  1GM7 A;  2X6A A;  1RM1 C;  3TK1 A;  3QNE A;  2P67 A;  3CCE V;  3NXS A;  3K08 A;  1K4D C;  1GM8 A;  2UXX A;  3DTU B;  4WF9 V;  2IU0 A;  1JX9 A;  1M9N A;  1FXH A;  1VQ9 V;  1SET A;  1R6K A;  4MTX A;  2ITC C;  1XL4 A;  1KC8 W;  3AG2 B;  4WFH A;  2ZR2 A;  4MVO A;  4JAU A;  1K7D A;  3SPJ A;  1RPR A;  4XDK A;  4MSW C;  1VQ7 V;  5B1A B;  2QEX V;  3P32 A;  4MVS A;  2H8P C;  3AG3 C;  5CN0 A;  1NH2 D;  1AJQ A;  4JPR A;  2QKS A;  1SZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...