1Q7YW

Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1q7yW00
1KC8W 3OW2U 1YI2V 3CCVV 1N8RW 1KD1W 1JJ2U 1VQNV 1VQ4V 3CCQV 3CCRV 3CCSV 1R73A 2QA4V 3G6EV 1VQ8V 3CMEV 4WFAV 1Q7YW 1QVGU 3CCJV 3CCUV 1YJ9V 1VQKV 1S72V 1QVFU 3I55V 1Q82W 1NJIW 3CC4V 3CD6V 3CCLV 1K8AW 1VQ9V 3CC7V 2OTLV 2D3OW 3CC2V 1VQPV 3CPWU 1VQLV 1YIJV 1YJWV 1K9MW 1VQOV 1KQSU 3CXCU 5DM6V 1VQMV 1VQ5V 1M1KW 3G4SV 3CCMV 1VQ7V 3G71V 1YHQV 4WF9V 4WFBV 2QEXV 1M90W 1YITV 1Q86W 1W2BU 1VQ6V 3CMAV 1Q81W 2OTJV 1K73W 1YJNV 3CCEV 3I56V 4WCEV
chains in the Genus database with same CATH superfamily
3JARB 2GUZA 4DK0A 4N21A 2K9PA 4I55B 4J10A 2ZCEA 1PNLA 1VQ8V 3T1HO 1FXVA 4LWSA 3ZN1A 5IY5C 1XL4A 3ABMB 2OCHA 3LDDA 4RQEA 4MVUA 2AZ2A 2EIKB 4PA9A 1GK9A 3HKBA 3LDCA 4LF8O 3OM3B 2BOBC 4X66B 4CZZA 1MG1A 2LGQA 5IY5B 3OEEG 2X7RB 5JH7A 1WAZA 1PP9H 4FLUA 3A8TA 5J2TB 3T1YB 2KG7B 3U0ZA 3HB3B 2OTLV 2YXYA 3K58A 1KQSU 4AQYO 1JFFA 3ABTA 3ML0A 3LSSA 4J42A 2QWNB 1R3KC 1R3IC 3JATA 4UFZA 5J2UB 3FFQA 1SC5B 1JVMA 4NTYA 4FM1A 2YXHA 3SJQC 1K4DC 2HJFC 3A0BZ 5LMUB 2DYRC 2FYUH 3D3QA 1Y76B 1VIBA 2B1IA 5A2QN 4GKJO 5IWAO 3JD0A 4DV6O 4JI8O 2PF4E 5KMGB 2UUCB 1EM1A 1Q43A 4Z1VA 1E1QG 2DYRB 1IZ3A 4GX5A 4JYAB 3CCLV 5LGTA 4QPJA 3B2EE 1GM9A 3DGEA 3J7AU 1QNMA 4JV5B 1GM7A 4WBNB 4YIPA 4ZOLA 1OCRC 3IAYA 3OMAB 2ZE8A 3RW0A 2P7TC 3TK1A 1YJ9V 1QBZA 4IIJA 4BIZA 4GX2A 1TGOA 3E8BA 3W7WA 2XAGA 1XMOB 3L72H 2X6AA 4QE7A 1OCRB 2NR5A 2LP7A 4HZ3A 4DUYO 3L70H 3KCXA 5LYJA 4EEQA 1XHZA 3CCRV 3BA9A 5BR8O 3OD4A 3STLC 4Q20A 1FXKA 5B5EZ 1ZL8B 3CJHB 4LNUA 2W0FC 3RT3C 3FD9A 2Q9LA 1ZUQA 2CUGA 1HR0O 4CH4A 1XILA 1LR1A 1FFXA 1F23A 1RSOB 5C8YA 4JI2B 3U11A 3M7MX 1P49A 3Q4HA 1EZVH 2UXBB 3CXHF 2DE0X 1VQ9V 3G6BA 5GTHZ 3SDLA 1M1KW 2OIEA 4EB6B 1MSDA 4JAAA 4CC5A 1IXBA 1Q3EA 2F95B 2P6JA 1E1RG 4J11A 5J9PC 5LMNO 1K34A 2ADQB 4O4HA 3C3SA 4F6RB 1TVKA 2R9AA 4I5SA 3CCUV 3F5WC 3OR6C 5KAIZ 2K1EA 3H1IH 4K8XA 3FB8C 1WJZA 4DW1A 1UFIA 2CGOA 2EIJC 2DW4A 4YJ2A 3K9SA 5HFLA 4DV2O 4FLZA 3OW2U 5ITZA 2F4VO 2YIAA 1RP3B 2Q4PA 3H9VA 2N05A 3H01A 4OXSA 4ICGA 4WFAV 3R66A 5IJ9A 3E22B 3ZRWA 4DV7B 4DR3O 4MVZA 4OX9B 5EYPB 4FJCC 1JMKC 5L3FA 1SKVA 5EK0A 1XNQO 3G71V 1BZKA 2Q67A 3L74H 4DR2B 4NXMO 2GSMB 1N34O 2WLMA 4TV9A 1MMMA 3NXSA 1AJNA 2QTOA 4PA7A 3IC7A 5BY1A 5FNVB 5L3DA 4DV3O 1M93A 4P30A 1D5AA 2RDCA 1KECA 2WLIA 1WLEA 2Z3YA 3EVKA 4O4JA 1XUQA 2QKAA 4YHHO 4LP8A 2UUAO 2L35A 4ZHQB 4X1KA 3E83A 4UVCA 1EN5A 2ZINA 4JPRA 4UVAA 3CB2A 2UXCB 4DW0A 1XHXA 4JAUA 4BW9A 3G80A 2CK3G 3G4SV 2E5LO 1YHQV 2QWQB 1OCZC 3OR7C 1THZA 2GDSA 5KHJA 2WLKA 3SPJA 3H1KH 3DSQA 2YI8A 3K5MA 3T1CA 2EJRA 3ZRVA 1J5EB 1Q6UA 1X59A 1OCZB 5CA1B 3HKCB 1P84F 3H1LH 4RUEA 5DM6V 2Y0PA 3I5DA 4JYBA 1WA8B 4LNUB 1QLEC 2EZPA 4LCUC 1AP5A 2ZM6B 3OTOO 4X1IB 1I94O 3BCCH 1PV0A 1OJHA 2KKWA 5B1AC 3FYEB 4KL1A 1H2MA 5C8YB 3ZHTA 1YCIA 2JGUA 1HNXB 4JTCB 4NXNO 4FPPA 1QLEB 3Q4HB 1YVWA 1VQ4V 1FD9A 2GTSA 5B1AB 4B08A 3E8FA 4D7SA 4JI0O 1Y74A 3T4DA 4AI8A 2YSUB 4UVBA 2DWDC 1M57C 2Q0OC 3RYHB 2IJHA 4DV5O 1YTFD 2EJ7A 3S3XA 2VWJA 3CC4V 2JS3A 3P3NA 4DR6O 1XREA 4GUNA 2IJIA 3SPHA 4MTFA 1TVKB 5JJEB 2VQFB 2GTAA 1P4RA 3DXRA 4OPAA 1M57B 1KU9A 4ASUG 2WWWA 3QG5A 4FLWA 3HKDB 2FKXA 1BE3H 4YJ3A 2QM4A 1UJWB 3WU2Z 1Q5OA 1WP8A 2BE3A 4QPKA 4X66O 1AR5A 1N32B 3F5TA 4LF5B 5ITZB 4UCTA 3JAWA 2A79B 4YXWG 3ZRWB 1Y6XA 3T1YO 1PL0A 5H6QA 4N23A 1SQVH 3EHBB 5EBMC 2QA4V 1GKFA 1AI7A 2VWKA 4B3SB 3AG1C 4DXWA 3JD2A 2YIBA 5IJ0B 2F4VB 2PGGA 1BL8A 1O9GA 1YDXA 1SQFA 4DR5B 3FB6C 1YJNV 2Q69A 1Q7YW 3AG1B 3A0HZ 5LMUO 5LP6A 4FK5C 3DC5A 1XNQB 2GV9A 3ZRSA 3EXAA 1F4NA 4O4JB 2W0XA 2ZT9B 3A0RA 4IGGA 3CEIA 3OGCC 1RM1C 2UUCO 2R70A 1IBLB 4H33A 2M6YA 4TT3G 3RFRA 5KHIA 5EBLC 4LH7A 4JYAO 5B1NA 4DV1B 4UB8Z 3JD3A 1RM1B 5BMVB 1ZTEA 1BS3A 4JV5O 5L3BA 2OCCC 1VQLV 3GWOA 4I50B 4BWAA 5CB4B 1L1FA 1IURA 5LHIA 1M4UA 3K3WA 4YY3B 2V1DA 1RPOA 4MVOA 1XMOO 1IXMA 1AR1B 3B40A 2OCCB 1K7DA 1QHTA 5H6RA 1Y67A 1QVFU 2NLJC 4JZ2A 4ZKIA 1QR8A 2BTQA 1YJWV 1BSMA 2ITCC 1PM9A 4HAMA 2B9ZA 5B1OA 1Q81W 1E79G 1LUVA 4WFGA 1S0VA 1GN2A 3QNEA 2IH3C 1NZ6A 2IJKA 4CH5A 1K92A 3R65A 5CA0A 5KLVH 4O2BB 3E35A 3E8HA 5AG2A 2ZNIA 3UT5B 1I94B 4JI2O 4AHCA 1SZXA 3JASA 2P5OA 1MSWD 3E89A 1W0KG 2WAMA 1YSCA 4UCRA 1LNQA 3SYCA 2JGDA 3TXQA 4DK1A 1V54C 2Z0AA 3L73H 2UXBO 4K3AA 2QM7A 3OAAG 1NR1A 2DWEC 2ZKOA 4GX1A 2XAQA 1V54B 4RWUA 1H2GA 4UCVA 4G27B 2HKOA 1VQNV 4O4IA 5JJNB 5LA6A 4U3JA 3T4ZA 2LW7A 3CC2V 4TUYA 3CXCU 4I4TB 2QWPB 2H3OA 4MS2A 2WLLB 3O65A 4O4LA 5KHHA 5GONA 2MW2B 3F7YC 3UQ8A 4DV7O 3JAMN 4LF4O 3GWKC 4B7EA 4OX9O 2YIDA 4XDJA 1MA1A 2ZDIA 1F7YA 2AW9A 3B09A 1SESA 4GLXA 4DR2O 1HWYA 1Z2GA 3BPZA 4R8CA 3J81N 3GVMA 3SJBC 1L8DA 2KB1A 1N33B 4R6ZA 1GN6A 3MAQA 3IJ4A 4GX0A 4EKWA 5EC1C 1HNZB 5B1BC 5LXTA 4Q6GA 1AI6A 2P90A 3JCUZ 3ZRXA 4X20A 5JVDA 3WFVA 3ZHUA 4FLYA 3ZHRA 4JI5B 3RYCB 3JALA 2QEXV 4F4LA 1K73W 1M9NA 5B1BB 4GYCB 2GBOA 1W0JG 1FYJA 2UXCO 2X6BA 2FB5A 2OYQA 4UUJC 1EN6A 2P67A 2EBOA 5IT9N 1DTOA 4ZI7A 1J95A 3CCJV 2QGNA 3KKYA 2ZR3A 1CXZB 2QSAA 4DR4B 4LR3A 1NJIW 2YEVA 3AG7A 4QGPA 4PDVA 1YIJV 1H8EG 5FPOA 5EBWC 2AHYA 1NTMH 1FAFA 1GRJA 1J5EO 2HR3A 1Z5VA 4OPHA 2P22C 3ZHQA 4FM2A 3D36C 5IYDO 4DV0B 2ZE7A 2ZXWC 1OCCC 3K03A 1I08A 3S3WA 2BSKB 3ABUA 5IYBO 5CA0B 2ZM6O 3K79A 3ETGA 4TWKA 1AP6A 3CCSV 2ZXWB 1TUEB 2JJ1G 4DRXA 1HNXO 2XUMA 1OCCB 3STZC 1SETA 2YIBD 2Y4UA 1L0LH 5LHHA 4LF7B 4MTGA 1WB8A 2EX3A 4WFHA 4AILC 2JGDB 1TA8A 3FB5C 3PN1A 4TV8B 4FFBA 4WF9V 4TQDA 1G4YB 3OUFA 1XNRB 4B7KA 3E2EA 4JF3A 1IBMB 3WG7C 3BY6A 1FKAO 2XHBA 4RO2A 4JGSA 3CMEV 1SQGA 4TSFG 2VQFO 3VQYA 2B5UA 3J80N 2GUZB 5E79Z 3WG7B 3P30A 2Q6AA 3UO2A 5CBGA 5L3EA 3ZS8C 2PUSA 4LWSB 1QQCA 1F4MA 4YIOA 5K1PA 5LGNA 4UB6Z 5DEDA 4TUYB 1KD1W 1N32O 4LF5O 1DK1A 3HKBB 1ENVA 1PNMA 2PYJA 4XBFA 5KAFZ 1SA0A 4I9WA 1BQZA 4U3FH 3SYAA 1P7BA 3MHSC 2DJVA 2D3OW 5JH7B 4PI2A 2CGNA 2P06A 2LFSA 2ZIMA 4B3SO 4RQFA 4E2LA 3RYIA 5KHKA 1NI8A 5GTIZ 2XAJA 4X88A 1G6UA 1IDSA 1JFFB 3TGUH 3HR0A 3W7TA 4LF4B 1JOYA 1CP9A 4DR5O 4PA6A 3ZMUA 3JATB 4O2AA 4HBNA 2YICA 5EZYA 2AGAA 1XEQA 1R1BA 5IYZA 2Q7EA 5LXTB 1VQ7V 2JK5C 1YTFB 4GCZA 4JI6B 4FZ1A 1QLNA 3ZMVA 1IX9A 4NTWA 3ZMZA 4H44B 3ABKC 3AK3A 2R9RB 2JJ2G 1SS3A 4H13B 1IBLO 2IH1C 1KYOF 2QDOA 2IW5A 1JCHA 1GAXA 2A7WA 3ABKB 5KX5A 4ZI7B 2LJ2A 4DV1O 1H2LA 3AG3C 3FAVA 3PJSK 3KCYA 4TQFA 4UCOA 3MHHC 3EFFK 4WFEA 4MSWC 1S76D 3KZIZ 3JSNA 2RCVA 3ZHSA 1TUBA 4YY3O 4ZOLB 3CC7V 3AG3B 4DR6B 1GO3F 4IIJB 1KMIZ 4LFCB 3ZMSA 4F6EA 4IHJA 4PA3A 4JTDB 1JJ2U 5LBQA 4LFAB 1FXKC 3P3PA 4R50A 1O9HA 1WN7A 5CMUA 2NNUA 5CBHA 2MK3A 1XBLA 2HJDA 5LYJB 2LO1A 1K97A 5KUMA 4DRXB 2PTMA 1GM8A 1H38A 5JJJB 3K06A 1I5YA 2GHYA 1FXKB 3OUSA 3N2KA 1YXBA 2R72A 2FTKA 3VBBA 3WB1A 3JAKA 4NR1A 4X1YA 2UUBB 4BIOA 3JSLA 4K8ZA 4C7UA 1FFXB 1VF6A 4G28B 2XNDG 2QKSA 2ITDC 4JI7B 3AEIA 2JEXA 1F51A 2DQ3A 1X4TA 2OTJV 3ZBHA 5CBFA 4MVSA 3CYOA 4NTXA 5FL7G 2H94A 3SJCC 4B3TB 4DR1B 5CN0A 2IU0A 4JI3B 3LNMB 4GKKB 4JI4B 1KP3A 2ILMA 1S5LZ 2EULA 4O4HB 1M90W 5KA5A 2CH7A 4LC1A 5BZBA 2BTOA 4K35A 2ZD9A 3UKMA 4GZRB 2W6JG 1S72V 2V7QG 4YJ2B 4PHZA 2HEPA 5FLXN 3BRCA 3K57A 3NR7A 1KKDA 2HP8A 2XT9A 3OEHG 2HLDG 2UXXA 5JCOA 1JJOA 5IJ9B 3ZJZA 5BXZA 1R3JC 4CBCA 3RYFA 1KUQA 3CCVV 1DF5A 4KFMA 1PD3A 3CX5F 1ZWIC 2QTSA 3SJAC 1MNGA 3B4SA 2WLNA 2M7WA 3H1JH 3JARA 4HNAA 4I7ZB 1N33O 4TV9B 3K08A 4I55A 2A0LA 3JD4A 1WPXA 2F23A 2ZIOA 1N0JA 1HP8A 1NTKH 2ZE6A 1HNZO 4MW3A 2X0LA 2E76B 3CMAV 1HDJA 4B3MB 2WLIB 4KP4A 3ETDA 4JI5O 1BHAA 1IVSA 4J9YB 4DR7B 3OE7G 4RAIA 1HNWB 1VF5B 5J2TA 1SZTA 4X1KB 2KG7A 2HFEC 3K5LA 4CS2A 3CCEV 4WCEV 4DR4O 4P9PA 1IBKB 2L6LA 2VRZA 4HYOA 5LL6Y 2DN9A 3JYCA 4ZIBA 3SYPA 1G8MA 2PZSA 2PYLA 4IHJB 5KUKA 1GMGA 4U7OA 3RN4A 2O57A 5J2UA 5KA6A 1XOUA 2ETNA 3CCMV 3TETA 1K4CC 3F7VC 4MVMA 3UO3A 2Q0AA 4CH6A 2HG5C 4B3RO 4DV0O 1ORQC 1Y76A 4PDLA 3DTUB 4QE9A 1A32A 4K0KB 1ZLZA 2AXTZ 3CSXA 1BMFG 1JPXA 3G67A 5KMGA 3I55V 4IL6Z 2FMLA 4L8JA 1KP2A 1SQBH 3ZEDA 4X1YB 3L9DA 1B06A 4LF7O 3K5OA 1OCOC 4BIUA 2QJ1A 2Y4TA 4WBNA 1ZSPA 2E3CA 1XNRO 2UXDB 1S3JA 1IBMO 1Y74B 4PA4A 3MD0A 1H8HG 1OCOB 3UM7A 4X65B 5DN6G 1DLBA 3UCSC 5L3GA 1I7FA 2E74B 2HHHB 1XDCA 3H1HH 3TCUA 1G1XB 3WB2A 4X62B 2YDEA 1D2DA 4J9ZB 3DXRB 1ZX3A 1FPOA 2ZQMA 3IFXA 3CD6V 4YJ3B 3CRRA 4FLTA 4LH6A 1Q6IA 1S5JA 1US6A 3I56V 4LF6B 1WB7A 1N8RW 3CWBH 3CJHA 2Y69C 3OMNB 2PY5A 3JAWB 1K5QA 2VQEB 5H9CA 1AILA 1B6QA 2H8PC 1K5SA 1RSOA 1JA8A 2UU9B 4KHPB 3MDSA 2IJJA 2Y69B 4I9QA 1URFA 5KHGA 1B3QA 4ABMA 1JX9A 4HNAB 5LP6C 2QKCA 2LFRA 4JASA 5EIBD 2EINC 2JS5A 4CS4A 3AG4C 3G6EV 3VQWA 4EB6A 2IBZH 2RNBA 1AR4A 4DUZB 2ODMA 4JI6O 4CH3A 4Z1MG 3L75H 5LP6B 4J7JA 4F6RA 1R6KA 2EINB 5JQGA 3RGBA 4J80A 4CC6A 3BEHA 3AG4B 5EC2C 2JIZG 1GN3A 3ETQA 1T5EA 1N36B 4H0LB 1DF4A 1PNKA 5K1XA 2A9HA 2XASA 3P32A 4DV4B 4QIWF 3ZCCA 1Q8IA 4PJ0Z 2CDYA 2C2AA 5JWPA 1VQPV 1KB9F 4PV1B 3WB0A 4W4KA 3E22A 1VQ6V 1I0HA 1AB3A 4UV8A 4UCSA 3K0DA 2OWOA 5EYPA 3CRQA 1Q6HA 1XMQB 5DECA 1W59A 3M8AA 4LF9B 2QM8A 4X9QA 3SYOA 1XQ8A 4LFCO 3FX7A 1SQPH 4JTAB 5FNVA 1FJGB 4LFAO 2Q73A 1Q86W 1H2KA 3K5NA 1WPBA 3VQXA 3ZIAG 4D7TA 3ASOC 2BTQB 1BHBA 3BABA 1YEWA 4OGQB 2ADPA 3JCZA 2NN4A 4B3RB 5IDJA 2JEUA 4LFBB 4KUMA 3VQVA 3B8MA 1V55C 3DC6A 3OT7A 4ZHQA 3ASOB 3W7XA 1OV9A 4BR6A 1WNSA 4JYYA 2UUBO 3BVOA 5E1AC 4JI7O 1H2SB 4MVQA 3JASB 1V55B 2WSSG 4UCUA 2QR4A 3LDEA 4ZBMA 4QJFB 2HVKC 3N2GA 2OIGA 2N04A 2CTQA 3SYQA 4LBEC 4I0XA 3FKSG 2DQ0A 3QO8A 2Z5UA 4B3TO 4DR1O 2JDIG 5CA1A 3HKCA 4JI3O 1NBMG 4J7KA 4GKKO 4JI4O 4Z2WA 1R73A 5A9GA 4PELA 4JI1B 4CS3A 2YUAA 1LUWA 4FM0A 2W6IG 1NVPB 1WA8A 5FPRA 4UXNA 4O4IB 4X1IA 3L71H 1P7GA 3FYIB 3CS5A 5LA6B 1YITV 2WLJA 4U3JB 4X64B 3CRMA 5H5NA 1PKXA 1M56C 2ZDIC 2XOKG 1BCCH 4O4LB 2A3QA 1SQQH 5GONB 2RJZA 4PD4F 2WA4A 3LSUA 4BAYA 1M56B 1B04A 2CTRA 3RYHA 3VOUA 1NQTA 3OTFA 4X89A 3TJTA 3D3IA 1AROP 2EZOA 1OZ0A 1AI5A 3SPCA 1MOFA 3IC9A 5JQGB 1CEZA 3CRAA 3HKDA 2LGWA 3CE2A 3OGIB 3E8GA 2AHZA 4FIPC 2HVJC 2B1GA 1U96A 2YC0A 3T1HB 4B3MO 1GH6A 3JD1A 2WPDG 1CPYA 3AK1A 2RN9A 3HKEA 1COWG 1MABG 4E4EA 1VF7A 4LF8B 4X20B 5JVDB 4DR7O 1VEWA 3JALB 5LHGA 4JAVA 3RVYA 1HNWO 3QVNA 3IGAC 1MZEA 2EIJB 1NKDA 1RPRA 2WLHA 2JRIA 3D8CA 3CP1A 2ZNJA 1IBKO 4MVRA 3OFNG 2RQ6A 5IYCO 3QF7A 2DOSA 5IJ0A 1YF2A 1YI2V 2Q68A 2YEVB 4AQYB 2P4VA 3RBZA 1N0NA 1V9PA 2KQXA 3THOA 1NS1A 3CPWU 3C3TA 4U7NA 1BT8A 1AJPA 1UPGA 3M99B 3T2MA 4K0KO 2Q7GA 4QNHB 1NVPD 3ABLC 1TAEA 1SERA 4GKJB 5IWAB 1PL4A 4G2KA 5D5PA 4DV6B 4JI8B 4IT5A 3LNNA 1QU7A 2LW1A 4A5UB 4L87A 1NH2B 1NTZH 2CAZC 1D5NA 3ICXA 1HW7A 1AVMA 1L0NH 5LGUA 3ABLB 1K33A 5BMVA 3BAAA 1H2NA 4MT8A 3N2GB 1EZJA 3TXSA 3APOA 4JZGA 2UXDO 4I50A 4I0XB 3FB7C 3LSQA 5CB4A 4FFBB 3HPLC 1QVGU 3APQA 4X65O 1Q82W 1VMGA 3BHPA 1K8AW 4EFBA 2HHHO 5LOVA 1VQ5V 1ROPA 1K3EA 1Y66A 4X62O 1SF9A 3ZMTA 4TOIA 1FFTB 1FXHA 2Y0IA 1NU1H 1R6TA 2Q5ZA 2CE4A 4FFKA 4BW5A 3CHXA 2G38A 2DYSC 1N4CA 4DUYB 2X6CA 4RUFA 1Q90D 2RMKB 1R6NA 5BR8B 4LF6O 2P4KA 4KXRA 2DYSB 2LQTA 1SA0B 3ZX6A 4H37A 4O2BA 2VQEO 2Q8VA 3ETEA 1JR9A 2QWRB 2BCCH 3UT5A 1HR0B 1GN4A 1I5XA 2UU9O 2IM9A 2OT5A 4DYLA 4KHPO 4IYIA 2XTAA 2N74A 1PPJH 2QWOB 2F43G 3RYIB 3SGIA 2WA3A 1M5IA 1WP7A 1NT2B 2FL4A 2KSDA 1MZFA 2YI9A 4PI0A 1XL6A 1EN4A 3U10A 3ZHVA 3QO5A 4DUZO 4O2AB 5EZYB 3B8NA 2ZE5A 4MTOA 5IYZB 1XI1A 1S5HC 2D2CB 3HKEB 1AJQA 1AI4A 5B66Z 4XDKA 5LMNB 2JVDA 1N36O 1YZBA 5D5QA 4NB5A 1DGSA 1GTOA 3W7UA 1W2BU 1NH2D 1VARA 4NYKA 2XAFA 1KC8W 4DV4O 3QO7A 1RFYA 3CCQV 4I4TA 1SQXH 2WLLA 3K04A 5KX5B 2V4DA 4DV2B 2CTPA 3FAVB 4J41A 1Y4MA 1K9MW 1XMQO 4X8AA 4DR3B 4XDLA 4WFBV 3KG2A 3SR2C 3ZN0A 4LF9O 2F66C 1KKCA 3B77A 1TUBB 5EIBC 4J7ZA 4MTXA 3K9AA 2QE7G 5GW7A 4NXMB 1VP7A 1N34B 2YXLA 1FJGO 1R3LC 3AK2A 2ARHA 2Y48A 4GT1A 3E86A 4MW8A 4DV3B 4NVPA 2EILC 3X2QC 4IYHA 3BA8A 4LFBO 3C90A 5L3CA 1QR9A 5C93A 3W7SA 3RYCA 5HFMA 4YHHB 3CRCA 1VF6C 2YS8A 1QCEA 1EBOA 2EILB 3GB7C 3X2QB 3N2KB 3OMIB 2UUAB 1Z5WA 1ZAUA 2EIMC 2BOCC 2F93B 3JAKB 4WFFA 4UV9A 2A06H 2E5LB 4FMTA 5IE9A 5LOVB 2IU3A 5F2VO 3A2FA 4FZ0A 2EIMB 3AG2C 4JYCA 2Q7HA 1VQKV 3K0GA 3SPIA 2R9IA 4FLXA 1OHHG 1VQMV 1NR7A 3QTCA 2F1MA 3BFRA 5CA3A 3K59A 4JI1O 1U97A 3AG2B 1SRYA 4P9OA 3SPGA 2CTWA 2PI5A 2E75B 2BSKA 5B3SC 2ATKC 1EFRG 1BGYH 4P2ZA 2CH7B 3D36A 3RWRD 1S77D 4X64O 3OTOB 2VS0A 5JCOC 4FVMA 5TISZ 2UXNA 4NKGB 5B3SB 1VQOV 3N27A 4W4LA 4R7CA 1JQ0A 1ZL8A 4FLVA 4NXNB 1KBHA 3O9OA 4TV8A 3ASNC 4EFEA 1BQ0A 4JI0B 5H2FZ 4PDMA 4PDRA 3RYFB 4DV5B 1FS0G 2AZ0A 3ABMC 2XAHA 4D6TH 2ZR2A 2EIKC 2PI4A 3RVZA 3LUTB 3ASNB 2DMXA 4DO2A
chains in the Genus database with same CATH topology
4N21A 4PA3A 1NBMG 4JTDB 1JJ2U 5LBQA 4FK5C 1R73A 1PNLA 4PELA 3ZRSA 1VQ8V 1FXVA 1FXKC 3ZN1A 5IY5C 1XL4A 2W6IG 4R50A 1F4NA 5CMUA 2NNUA 3ABMB 5CBHA 2MK3A 1NVPB 3LDDA 4RQEA 4MVUA 2EIKB 4PA9A 3A0RA 3OGCC 1RM1C 4UXNA 1K97A 5KUMA 1GK9A 3LDCA 4H33A 3OM3B 4TT3G 1GM8A 2BOBC 1H38A 3FYIB 3K06A 1YITV 2WLJA 4CZZA 1MG1A 1I5YA 2GHYA 1FXKB 5EBLC 1PKXA 3OUSA 5IY5B 3OEEG 1M56C 2X7RB 5B1NA 2ZDIC 2FTKA 3VBBA 2XOKG 3JD3A 1RM1B 5L3BA 3HB3B 4G28B 2XNDG 2OTLV 2QKSA 2ITDC 2OCCC 1VQLV 3GWOA 3AEIA 4BAYA 2JEXA 1F51A 2DQ3A 1KQSU 1M56B 3VOUA 1NQTA 1L1FA 4X89A 2OTJV 5CBFA 5LHIA 3D3IA 1AROP 3K3WA 2EZOA 1OZ0A 3ABTA 3CYOA 3ML0A 4MVSA 3LSSA 1AI5A 1R3KC 1R3IC 2V1DA 5FL7G 3SPCA 1RPOA 4MVOA 1IXMA 1MOFA 2H94A 1AR1B 1JVMA 2OCCB 1K7DA 5CN0A 5H6RA 2IU0A 1CEZA 3SJQC 1QVFU 2NLJC 1K4DC 2HJFC 3LNMB 1KP3A 2DYRC 3E8GA 2AHZA 4FIPC 4ZKIA 2HVJC 2B1GA 1QR8A 2B1IA 1YJWV 2ITCC 4HAMA 3JD0A 1M90W 3JD1A 2WPDG 5B1OA 1Q81W 5KA5A 1CPYA 1E79G 1COWG 1MABG 4WFGA 4LC1A 1S0VA 5BZBA 3QNEA 2ZD9A 1E1QG 2IH3C 2DYRB 2IJKA 1K92A 3UKMA 3R65A 2W6JG 4GX5A 4JAVA 3RVYA 5LHGA 1S72V 2V7QG 3IGAC 2EIJB 1NKDA 1RPRA 3E35A 3CCLV 2WLHA 3E8HA 3CP1A 1KKDA 3OEHG 5LGTA 2HLDG 2UXXA 4MVRA 4QPJA 1GM9A 3DGEA 3OFNG 3ZJZA 3E89A 1MSWD 1W0KG 5IYCO 1GM7A 2WAMA 1YSCA 1LNQA 1R3JC 3SYCA 4CBCA 1YI2V 2Q68A 1OCRC 2YEVB 3CCVV 1DF5A 4KFMA 1V54C 3OMAB 1PD3A 3RBZA 1ZWIC 3RW0A 2P7TC 3TK1A 2QM7A 1YJ9V 1QBZA 4BIZA 4GX2A 2WLNA 3OAAG 1NR1A 2M7WA 3E8BA 2DWEC 3W7WA 2XAGA 3K08A 2A0LA 3JD4A 1WPXA 2X6AA 3CPWU 4U7NA 4GX1A 4QE7A 1OCRB 1AJPA 2XAQA 3M99B 1V54B 4MW3A 2X0LA 3T2MA 1H2GA 2LP7A 4QNHB 3CMAV 4HZ3A 1NVPD 4G27B 3ABLC 2HKOA 1SERA 1VQNV 3CCRV 2WLIB 4G2KA 4KP4A 3ETDA 3STLC 4L87A 4Q20A 1BHAA 1FXKA 1NH2B 3T4ZA 4J9YB 3CC2V 3OE7G 2W0FC 5LGUA 4RAIA 3ABLB 3CXCU 1K33A 4MS2A 2WLLB 1SZTA 2HFEC 3F7YC 3CCEV 4MT8A 4WCEV 1F23A 1EZJA 4P9PA 4XDJA 3FB7C 3LSQA 2ZDIA 4HYOA 3JYCA 1QVGU 3HPLC 3SYPA 1G8MA 1SESA 1Q82W 1HWYA 1K8AW 1VQ9V 5KUKA 1GMGA 4U7OA 5KA6A 4R8CA 1VQ5V 1M1KW 1ROPA 1K3EA 3CCMV 3TETA 1Y66A 1K4CC 3F7VC 4MVMA 2KB1A 2HG5C 4R6ZA 3ZMTA 1FFTB 1ORQC 1FXHA 4GX0A 2P6JA 1E1RG 4EKWA 4PDLA 5EC1C 4BW5A 3DTUB 4QE9A 2DYSC 5J9PC 1K34A 5B1BC 3CCUV 4I5SA 3F5WC 2X6CA 1AI6A 4RUFA 1BMFG 1JPXA 3OR6C 3I55V 2K1EA 1KP2A 1R6NA 2P90A 3ZRXA 3FB8C 3WFVA 2EIJC 2QEXV 4F4LA 2DYSB 4H37A 1K73W 2DW4A 1M9NA 5B1BB 5HFLA 3OW2U 3ETEA 1OCOC 1W0JG 4BIUA 2X6BA 1YJNV 4UUJC 2P67A 1I5XA 3H01A 2EBOA 4OXSA 1DTOA 2OT5A 4WFAV 1J95A 3CCJV 3ZRWA 2ZR3A 4MVZA 1NJIW 1S3JA 2F43G 2YEVA 4FJCC 5L3FA 4PDVA 4PA4A 1YIJV 5EK0A 3MD0A 1H8HG 1OCOB 3UM7A 1H8EG 3G71V 5DN6G 2Q67A 1DLBA 5L3GA 5EBWC 2AHYA 2GSMB 1XL6A 2WLMA 3NXSA 3QO5A 1AJNA 2HR3A 3TCUA 2QTOA 4PA7A 3B8NA 3IC7A 4MTOA 1S5HC 5IYDO 4J9ZB 5L3DA 4P30A 1AJQA 1AI4A 2ZXWC 2ZQMA 3IFXA 4XDKA 1OCCC 1KECA 3K03A 2WLIA 3CD6V 1WLEA 3ABUA 1GTOA 5IYBO 3K79A 2Z3YA 3W7UA 1W2BU 3ETGA 1NH2D 3I56V 2XAFA 4TWKA 1KC8W 3QO7A 4LP8A 1N8RW 3CCQV 3CCSV 2Y69C 2ZXWB 1TUEB 2JJ1G 3OMNB 2WLLA 1K5QA 1OCCB 3K04A 1SETA 3STZC 3E83A 4UVCA 5H9CA 5LHHA 1B6QA 4JPRA 4UVAA 4MTGA 2H8PC 4WFHA 1K5SA 1Y4MA 3FB5C 1K9MW 4JAUA 2CK3G 4X8AA 3G4SV 1YHQV 2IJJA 4XDLA 4WFBV 2Y69B 3KG2A 1G4YB 4WF9V 3ZN0A 3OUFA 3E2EA 1OCZC 1JX9A 3OR7C 4JF3A 1THZA 3B77A 3WG7C 2LFRA 4JASA 3BY6A 2EINC 2WLKA 3SPJA 4RO2A 4MTXA 3K9AA 4JGSA 2QE7G 3AG4C 3G6EV 5GW7A 3CMEV 4TSFG 1R3LC 2B5UA 2EJRA 3T1CA 3ZRVA 4Z1MG 1OCZB 2Y48A 4GT1A 3WG7B 3E86A 3P30A 2Q6AA 4RUEA 5DM6V 5L3EA 5CBGA 4MW8A 1R6KA 2EINB 2EILC 3BEHA 3X2QC 3AG4B 5EC2C 2JIZG 1F4MA 4JYBA 5LGNA 1KD1W 1QLEC 2EZPA 4LCUC 5L3CA 1DF4A 1QR9A 1ENVA 1PNKA 5C93A 1PNMA 3W7SA 5HFMA 2A9HA 2XASA 4XBFA 3FYEB 3P32A 5B1AC 4I9WA 4QIWF 1QCEA 3ZCCA 3SYAA 1P7BA 1EBOA 2EILB 3GB7C 2C2AA 3MHSC 3X2QB 3OMIB 2D3OW 2EIMC 4JTCB 1VQPV 2BOCC 4FPPA 1QLEB 1VQ6V 4UV8A 2LFSA 3K0DA 4WFFA 4RQFA 1VQ4V 4E2LA 4UV9A 5B1AB 3E8FA 3T4DA 4FMTA 2XAJA 2YSUB 4UVBA 4X88A 2IU3A 2DWDC 1M57C 1YTFD 2IJHA 2QM8A 2EIMB 3AG2C 4JYCA 3SYOA 1VQKV 3W7TA 3K0GA 3SPIA 2R9IA 3CC4V 1CP9A 1JOYA 4PA6A 3ZMUA 1OHHG 4JTAB 1VQMV 1NR7A 2IJIA 3SPHA 4MTFA 5CA3A 1VQ7V 2JK5C 1YTFB 4GCZA 1Q86W 1P4RA 1M57B 4ASUG 1QLNA 2WWWA 3AG2B 3ZIAG 3ZMVA 3ZMZA 3ABKC 1SRYA 3ASOC 4P9OA 3SPGA 2R9RB 1UJWB 1BHBA 2PI5A 5B3SC 2ATKC 2JJ2G 1EFRG 3JCZA 2IH1C 4P2ZA 4QPKA 5IDJA 3D36A 2IW5A 2JEUA 1S77D 1JCHA 4KUMA 3B8MA 1V55C 2UXNA 2A79B 3ABKB 3ASOB 4YXWG 3W7XA 3ZRWB 5B3SB 1VQOV 3AG3C 1PL0A 3PJSK 5H6QA 4N23A 4R7CA 1JQ0A 3MHHC 3EFFK 4WFEA 4MSWC 1S76D 3EHBB 5EBMC 2QA4V 1GKFA 1AI7A 5E1AC 4MVQA 3ASNC 3AG1C 4DXWA 1V55B 2WSSG 3JD2A 3LDEA 4ZBMA 4QJFB 4PDMA 4PDRA 2HVKC 1BL8A 3CC7V 3AG3B 1FS0G 3SYQA 4LBEC 3FKSG 2DQ0A 3ABMC 3LUTB 1GO3F 2XAHA 3QO8A 2Z5UA 2ZR2A 2EIKC 2PI4A 2JDIG 3FB6C 3ZMSA 3RVZA 2Q69A 1Q7YW 3ASNB 3AG1B 4DO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KC8 W;  3OW2 U;  1YI2 V;  3CCV V;  1N8R W;  1KD1 W;  1JJ2 U;  1VQN V;  1VQ4 V;  3CCQ V;  3CCR V;  3CCS V;  1R73 A;  2QA4 V;  3G6E V;  1VQ8 V;  3CME V;  4WFA V;  1Q7Y W;  1QVG U;  3CCJ V;  3CCU V;  1YJ9 V;  1VQK V;  1S72 V;  1QVF U;  3I55 V;  1Q82 W;  1NJI W;  3CC4 V;  3CD6 V;  3CCL V;  1K8A W;  1VQ9 V;  3CC7 V;  2OTL V;  2D3O W;  3CC2 V;  1VQP V;  3CPW U;  1VQL V;  1YIJ V;  1YJW V;  1K9M W;  1VQO V;  1KQS U;  3CXC U;  5DM6 V;  1VQM V;  1VQ5 V;  1M1K W;  3G4S V;  3CCM V;  1VQ7 V;  3G71 V;  1YHQ V;  4WF9 V;  4WFB V;  2QEX V;  1M90 W;  1YIT V;  1Q86 W;  1W2B U;  1VQ6 V;  3CMA V;  1Q81 W;  2OTJ V;  1K73 W;  1YJN V;  3CCE V;  3I56 V;  4WCE V; 
#chains in the Genus database with same CATH topology
 3JAR B;  2GUZ A;  4DK0 A;  4N21 A;  2K9P A;  4I55 B;  4J10 A;  2ZCE A;  1PNL A;  1VQ8 V;  3T1H O;  1FXV A;  4LWS A;  3ZN1 A;  5IY5 C;  1XL4 A;  3ABM B;  2OCH A;  3LDD A;  4RQE A;  4MVU A;  2AZ2 A;  2EIK B;  4PA9 A;  1GK9 A;  3HKB A;  3LDC A;  4LF8 O;  3OM3 B;  2BOB C;  4X66 B;  4CZZ A;  1MG1 A;  2LGQ A;  5IY5 B;  3OEE G;  2X7R B;  5JH7 A;  1WAZ A;  1PP9 H;  4FLU A;  3A8T A;  5J2T B;  3T1Y B;  2KG7 B;  3U0Z A;  3HB3 B;  2OTL V;  2YXY A;  3K58 A;  1KQS U;  4AQY O;  1JFF A;  3ABT A;  3ML0 A;  3LSS A;  4J42 A;  2QWN B;  1R3K C;  1R3I C;  3JAT A;  4UFZ A;  5J2U B;  3FFQ A;  1SC5 B;  1JVM A;  4NTY A;  4FM1 A;  2YXH A;  3SJQ C;  1K4D C;  2HJF C;  3A0B Z;  5LMU B;  2DYR C;  2FYU H;  3D3Q A;  1Y76 B;  1VIB A;  2B1I A;  5A2Q N;  4GKJ O;  5IWA O;  3JD0 A;  4DV6 O;  4JI8 O;  2PF4 E;  5KMG B;  2UUC B;  1EM1 A;  1Q43 A;  4Z1V A;  1E1Q G;  2DYR B;  1IZ3 A;  4GX5 A;  4JYA B;  3CCL V;  5LGT A;  4QPJ A;  3B2E E;  1GM9 A;  3DGE A;  3J7A U;  1QNM A;  4JV5 B;  1GM7 A;  4WBN B;  4YIP A;  4ZOL A;  1OCR C;  3IAY A;  3OMA B;  2ZE8 A;  3RW0 A;  2P7T C;  3TK1 A;  1YJ9 V;  1QBZ A;  4IIJ A;  4BIZ A;  4GX2 A;  1TGO A;  3E8B A;  3W7W A;  2XAG A;  1XMO B;  3L72 H;  2X6A A;  4QE7 A;  1OCR B;  2NR5 A;  2LP7 A;  4HZ3 A;  4DUY O;  3L70 H;  3KCX A;  5LYJ A;  4EEQ A;  1XHZ A;  3CCR V;  3BA9 A;  5BR8 O;  3OD4 A;  3STL C;  4Q20 A;  1FXK A;  5B5E Z;  1ZL8 B;  3CJH B;  4LNU A;  2W0F C;  3RT3 C;  3FD9 A;  2Q9L A;  1ZUQ A;  2CUG A;  1HR0 O;  4CH4 A;  1XIL A;  1LR1 A;  1FFX A;  1F23 A;  1RSO B;  5C8Y A;  4JI2 B;  3U11 A;  3M7M X;  1P49 A;  3Q4H A;  1EZV H;  2UXB B;  3CXH F;  2DE0 X;  1VQ9 V;  3G6B A;  5GTH Z;  3SDL A;  1M1K W;  2OIE A;  4EB6 B;  1MSD A;  4JAA A;  4CC5 A;  1IXB A;  1Q3E A;  2F95 B;  2P6J A;  1E1R G;  4J11 A;  5J9P C;  5LMN O;  1K34 A;  2ADQ B;  4O4H A;  3C3S A;  4F6R B;  1TVK A;  2R9A A;  4I5S A;  3CCU V;  3F5W C;  3OR6 C;  5KAI Z;  2K1E A;  3H1I H;  4K8X A;  3FB8 C;  1WJZ A;  4DW1 A;  1UFI A;  2CGO A;  2EIJ C;  2DW4 A;  4YJ2 A;  3K9S A;  5HFL A;  4DV2 O;  4FLZ A;  3OW2 U;  5ITZ A;  2F4V O;  2YIA A;  1RP3 B;  2Q4P A;  3H9V A;  2N05 A;  3H01 A;  4OXS A;  4ICG A;  4WFA V;  3R66 A;  5IJ9 A;  3E22 B;  3ZRW A;  4DV7 B;  4DR3 O;  4MVZ A;  4OX9 B;  5EYP B;  4FJC C;  1JMK C;  5L3F A;  1SKV A;  5EK0 A;  1XNQ O;  3G71 V;  1BZK A;  2Q67 A;  3L74 H;  4DR2 B;  4NXM O;  2GSM B;  1N34 O;  2WLM A;  4TV9 A;  1MMM A;  3NXS A;  1AJN A;  2QTO A;  4PA7 A;  3IC7 A;  5BY1 A;  5FNV B;  5L3D A;  4DV3 O;  1M93 A;  4P30 A;  1D5A A;  2RDC A;  1KEC A;  2WLI A;  1WLE A;  2Z3Y A;  3EVK A;  4O4J A;  1XUQ A;  2QKA A;  4YHH O;  4LP8 A;  2UUA O;  2L35 A;  4ZHQ B;  4X1K A;  3E83 A;  4UVC A;  1EN5 A;  2ZIN A;  4JPR A;  4UVA A;  3CB2 A;  2UXC B;  4DW0 A;  1XHX A;  4JAU A;  4BW9 A;  3G80 A;  2CK3 G;  3G4S V;  2E5L O;  1YHQ V;  2QWQ B;  1OCZ C;  3OR7 C;  1THZ A;  2GDS A;  5KHJ A;  2WLK A;  3SPJ A;  3H1K H;  3DSQ A;  2YI8 A;  3K5M A;  3T1C A;  2EJR A;  3ZRV A;  1J5E B;  1Q6U A;  1X59 A;  1OCZ B;  5CA1 B;  3HKC B;  1P84 F;  3H1L H;  4RUE A;  5DM6 V;  2Y0P A;  3I5D A;  4JYB A;  1WA8 B;  4LNU B;  1QLE C;  2EZP A;  4LCU C;  1AP5 A;  2ZM6 B;  3OTO O;  4X1I B;  1I94 O;  3BCC H;  1PV0 A;  1OJH A;  2KKW A;  5B1A C;  3FYE B;  4KL1 A;  1H2M A;  5C8Y B;  3ZHT A;  1YCI A;  2JGU A;  1HNX B;  4JTC B;  4NXN O;  4FPP A;  1QLE B;  3Q4H B;  1YVW A;  1VQ4 V;  1FD9 A;  2GTS A;  5B1A B;  4B08 A;  3E8F A;  4D7S A;  4JI0 O;  1Y74 A;  3T4D A;  4AI8 A;  2YSU B;  4UVB A;  2DWD C;  1M57 C;  2Q0O C;  3RYH B;  2IJH A;  4DV5 O;  1YTF D;  2EJ7 A;  3S3X A;  2VWJ A;  3CC4 V;  2JS3 A;  3P3N A;  4DR6 O;  1XRE A;  4GUN A;  2IJI A;  3SPH A;  4MTF A;  1TVK B;  5JJE B;  2VQF B;  2GTA A;  1P4R A;  3DXR A;  4OPA A;  1M57 B;  1KU9 A;  4ASU G;  2WWW A;  3QG5 A;  4FLW A;  3HKD B;  2FKX A;  1BE3 H;  4YJ3 A;  2QM4 A;  1UJW B;  3WU2 Z;  1Q5O A;  1WP8 A;  2BE3 A;  4QPK A;  4X66 O;  1AR5 A;  1N32 B;  3F5T A;  4LF5 B;  5ITZ B;  4UCT A;  3JAW A;  2A79 B;  4YXW G;  3ZRW B;  1Y6X A;  3T1Y O;  1PL0 A;  5H6Q A;  4N23 A;  1SQV H;  3EHB B;  5EBM C;  2QA4 V;  1GKF A;  1AI7 A;  2VWK A;  4B3S B;  3AG1 C;  4DXW A;  3JD2 A;  2YIB A;  5IJ0 B;  2F4V B;  2PGG A;  1BL8 A;  1O9G A;  1YDX A;  1SQF A;  4DR5 B;  3FB6 C;  1YJN V;  2Q69 A;  1Q7Y W;  3AG1 B;  3A0H Z;  5LMU O;  5LP6 A;  4FK5 C;  3DC5 A;  1XNQ B;  2GV9 A;  3ZRS A;  3EXA A;  1F4N A;  4O4J B;  2W0X A;  2ZT9 B;  3A0R A;  4IGG A;  3CEI A;  3OGC C;  1RM1 C;  2UUC O;  2R70 A;  1IBL B;  4H33 A;  2M6Y A;  4TT3 G;  3RFR A;  5KHI A;  5EBL C;  4LH7 A;  4JYA O;  5B1N A;  4DV1 B;  4UB8 Z;  3JD3 A;  1RM1 B;  5BMV B;  1ZTE A;  1BS3 A;  4JV5 O;  5L3B A;  2OCC C;  1VQL V;  3GWO A;  4I50 B;  4BWA A;  5CB4 B;  1L1F A;  1IUR A;  5LHI A;  1M4U A;  3K3W A;  4YY3 B;  2V1D A;  1RPO A;  4MVO A;  1XMO O;  1IXM A;  1AR1 B;  3B40 A;  2OCC B;  1K7D A;  1QHT A;  5H6R A;  1Y67 A;  1QVF U;  2NLJ C;  4JZ2 A;  4ZKI A;  1QR8 A;  2BTQ A;  1YJW V;  1BSM A;  2ITC C;  1PM9 A;  4HAM A;  2B9Z A;  5B1O A;  1Q81 W;  1E79 G;  1LUV A;  4WFG A;  1S0V A;  1GN2 A;  3QNE A;  2IH3 C;  1NZ6 A;  2IJK A;  4CH5 A;  1K92 A;  3R65 A;  5CA0 A;  5KLV H;  4O2B B;  3E35 A;  3E8H A;  5AG2 A;  2ZNI A;  3UT5 B;  1I94 B;  4JI2 O;  4AHC A;  1SZX A;  3JAS A;  2P5O A;  1MSW D;  3E89 A;  1W0K G;  2WAM A;  1YSC A;  4UCR A;  1LNQ A;  3SYC A;  2JGD A;  3TXQ A;  4DK1 A;  1V54 C;  2Z0A A;  3L73 H;  2UXB O;  4K3A A;  2QM7 A;  3OAA G;  1NR1 A;  2DWE C;  2ZKO A;  4GX1 A;  2XAQ A;  1V54 B;  4RWU A;  1H2G A;  4UCV A;  4G27 B;  2HKO A;  1VQN V;  4O4I A;  5JJN B;  5LA6 A;  4U3J A;  3T4Z A;  2LW7 A;  3CC2 V;  4TUY A;  3CXC U;  4I4T B;  2QWP B;  2H3O A;  4MS2 A;  2WLL B;  3O65 A;  4O4L A;  5KHH A;  5GON A;  2MW2 B;  3F7Y C;  3UQ8 A;  4DV7 O;  3JAM N;  4LF4 O;  3GWK C;  4B7E A;  4OX9 O;  2YID A;  4XDJ A;  1MA1 A;  2ZDI A;  1F7Y A;  2AW9 A;  3B09 A;  1SES A;  4GLX A;  4DR2 O;  1HWY A;  1Z2G A;  3BPZ A;  4R8C A;  3J81 N;  3GVM A;  3SJB C;  1L8D A;  2KB1 A;  1N33 B;  4R6Z A;  1GN6 A;  3MAQ A;  3IJ4 A;  4GX0 A;  4EKW A;  5EC1 C;  1HNZ B;  5B1B C;  5LXT A;  4Q6G A;  1AI6 A;  2P90 A;  3JCU Z;  3ZRX A;  4X20 A;  5JVD A;  3WFV A;  3ZHU A;  4FLY A;  3ZHR A;  4JI5 B;  3RYC B;  3JAL A;  2QEX V;  4F4L A;  1K73 W;  1M9N A;  5B1B B;  4GYC B;  2GBO A;  1W0J G;  1FYJ A;  2UXC O;  2X6B A;  2FB5 A;  2OYQ A;  4UUJ C;  1EN6 A;  2P67 A;  2EBO A;  5IT9 N;  1DTO A;  4ZI7 A;  1J95 A;  3CCJ V;  2QGN A;  3KKY A;  2ZR3 A;  1CXZ B;  2QSA A;  4DR4 B;  4LR3 A;  1NJI W;  2YEV A;  3AG7 A;  4QGP A;  4PDV A;  1YIJ V;  1H8E G;  5FPO A;  5EBW C;  2AHY A;  1NTM H;  1FAF A;  1GRJ A;  1J5E O;  2HR3 A;  1Z5V A;  4OPH A;  2P22 C;  3ZHQ A;  4FM2 A;  3D36 C;  5IYD O;  4DV0 B;  2ZE7 A;  2ZXW C;  1OCC C;  3K03 A;  1I08 A;  3S3W A;  2BSK B;  3ABU A;  5IYB O;  5CA0 B;  2ZM6 O;  3K79 A;  3ETG A;  4TWK A;  1AP6 A;  3CCS V;  2ZXW B;  1TUE B;  2JJ1 G;  4DRX A;  1HNX O;  2XUM A;  1OCC B;  3STZ C;  1SET A;  2YIB D;  2Y4U A;  1L0L H;  5LHH A;  4LF7 B;  4MTG A;  1WB8 A;  2EX3 A;  4WFH A;  4AIL C;  2JGD B;  1TA8 A;  3FB5 C;  3PN1 A;  4TV8 B;  4FFB A;  4WF9 V;  4TQD A;  1G4Y B;  3OUF A;  1XNR B;  4B7K A;  3E2E A;  4JF3 A;  1IBM B;  3WG7 C;  3BY6 A;  1FKA O;  2XHB A;  4RO2 A;  4JGS A;  3CME V;  1SQG A;  4TSF G;  2VQF O;  3VQY A;  2B5U A;  3J80 N;  2GUZ B;  5E79 Z;  3WG7 B;  3P30 A;  2Q6A A;  3UO2 A;  5CBG A;  5L3E A;  3ZS8 C;  2PUS A;  4LWS B;  1QQC A;  1F4M A;  4YIO A;  5K1P A;  5LGN A;  4UB6 Z;  5DED A;  4TUY B;  1KD1 W;  1N32 O;  4LF5 O;  1DK1 A;  3HKB B;  1ENV A;  1PNM A;  2PYJ A;  4XBF A;  5KAF Z;  1SA0 A;  4I9W A;  1BQZ A;  4U3F H;  3SYA A;  1P7B A;  3MHS C;  2DJV A;  2D3O W;  5JH7 B;  4PI2 A;  2CGN A;  2P06 A;  2LFS A;  2ZIM A;  4B3S O;  4RQF A;  4E2L A;  3RYI A;  5KHK A;  1NI8 A;  5GTI Z;  2XAJ A;  4X88 A;  1G6U A;  1IDS A;  1JFF B;  3TGU H;  3HR0 A;  3W7T A;  4LF4 B;  1JOY A;  1CP9 A;  4DR5 O;  4PA6 A;  3ZMU A;  3JAT B;  4O2A A;  4HBN A;  2YIC A;  5EZY A;  2AGA A;  1XEQ A;  1R1B A;  5IYZ A;  2Q7E A;  5LXT B;  1VQ7 V;  2JK5 C;  1YTF B;  4GCZ A;  4JI6 B;  4FZ1 A;  1QLN A;  3ZMV A;  1IX9 A;  4NTW A;  3ZMZ A;  4H44 B;  3ABK C;  3AK3 A;  2R9R B;  2JJ2 G;  1SS3 A;  4H13 B;  1IBL O;  2IH1 C;  1KYO F;  2QDO A;  2IW5 A;  1JCH A;  1GAX A;  2A7W A;  3ABK B;  5KX5 A;  4ZI7 B;  2LJ2 A;  4DV1 O;  1H2L A;  3AG3 C;  3FAV A;  3PJS K;  3KCY A;  4TQF A;  4UCO A;  3MHH C;  3EFF K;  4WFE A;  4MSW C;  1S76 D;  3KZI Z;  3JSN A;  2RCV A;  3ZHS A;  1TUB A;  4YY3 O;  4ZOL B;  3CC7 V;  3AG3 B;  4DR6 B;  1GO3 F;  4IIJ B;  1KMI Z;  4LFC B;  3ZMS A;  4F6E A;  4IHJ A;  4PA3 A;  4JTD B;  1JJ2 U;  5LBQ A;  4LFA B;  1FXK C;  3P3P A;  4R50 A;  1O9H A;  1WN7 A;  5CMU A;  2NNU A;  5CBH A;  2MK3 A;  1XBL A;  2HJD A;  5LYJ B;  2LO1 A;  1K97 A;  5KUM A;  4DRX B;  2PTM A;  1GM8 A;  1H38 A;  5JJJ B;  3K06 A;  1I5Y A;  2GHY A;  1FXK B;  3OUS A;  3N2K A;  1YXB A;  2R72 A;  2FTK A;  3VBB A;  3WB1 A;  3JAK A;  4NR1 A;  4X1Y A;  2UUB B;  4BIO A;  3JSL A;  4K8Z A;  4C7U A;  1FFX B;  1VF6 A;  4G28 B;  2XND G;  2QKS A;  2ITD C;  4JI7 B;  3AEI A;  2JEX A;  1F51 A;  2DQ3 A;  1X4T A;  2OTJ V;  3ZBH A;  5CBF A;  4MVS A;  3CYO A;  4NTX A;  5FL7 G;  2H94 A;  3SJC C;  4B3T B;  4DR1 B;  5CN0 A;  2IU0 A;  4JI3 B;  3LNM B;  4GKK B;  4JI4 B;  1KP3 A;  2ILM A;  1S5L Z;  2EUL A;  4O4H B;  1M90 W;  5KA5 A;  2CH7 A;  4LC1 A;  5BZB A;  2BTO A;  4K35 A;  2ZD9 A;  3UKM A;  4GZR B;  2W6J G;  1S72 V;  2V7Q G;  4YJ2 B;  4PHZ A;  2HEP A;  5FLX N;  3BRC A;  3K57 A;  3NR7 A;  1KKD A;  2HP8 A;  2XT9 A;  3OEH G;  2HLD G;  2UXX A;  5JCO A;  1JJO A;  5IJ9 B;  3ZJZ A;  5BXZ A;  1R3J C;  4CBC A;  3RYF A;  1KUQ A;  3CCV V;  1DF5 A;  4KFM A;  1PD3 A;  3CX5 F;  1ZWI C;  2QTS A;  3SJA C;  1MNG A;  3B4S A;  2WLN A;  2M7W A;  3H1J H;  3JAR A;  4HNA A;  4I7Z B;  1N33 O;  4TV9 B;  3K08 A;  4I55 A;  2A0L A;  3JD4 A;  1WPX A;  2F23 A;  2ZIO A;  1N0J A;  1HP8 A;  1NTK H;  2ZE6 A;  1HNZ O;  4MW3 A;  2X0L A;  2E76 B;  3CMA V;  1HDJ A;  4B3M B;  2WLI B;  4KP4 A;  3ETD A;  4JI5 O;  1BHA A;  1IVS A;  4J9Y B;  4DR7 B;  3OE7 G;  4RAI A;  1HNW B;  1VF5 B;  5J2T A;  1SZT A;  4X1K B;  2KG7 A;  2HFE C;  3K5L A;  4CS2 A;  3CCE V;  4WCE V;  4DR4 O;  4P9P A;  1IBK B;  2L6L A;  2VRZ A;  4HYO A;  5LL6 Y;  2DN9 A;  3JYC A;  4ZIB A;  3SYP A;  1G8M A;  2PZS A;  2PYL A;  4IHJ B;  5KUK A;  1GMG A;  4U7O A;  3RN4 A;  2O57 A;  5J2U A;  5KA6 A;  1XOU A;  2ETN A;  3CCM V;  3TET A;  1K4C C;  3F7V C;  4MVM A;  3UO3 A;  2Q0A A;  4CH6 A;  2HG5 C;  4B3R O;  4DV0 O;  1ORQ C;  1Y76 A;  4PDL A;  3DTU B;  4QE9 A;  1A32 A;  4K0K B;  1ZLZ A;  2AXT Z;  3CSX A;  1BMF G;  1JPX A;  3G67 A;  5KMG A;  3I55 V;  4IL6 Z;  2FML A;  4L8J A;  1KP2 A;  1SQB H;  3ZED A;  4X1Y B;  3L9D A;  1B06 A;  4LF7 O;  3K5O A;  1OCO C;  4BIU A;  2QJ1 A;  2Y4T A;  4WBN A;  1ZSP A;  2E3C A;  1XNR O;  2UXD B;  1S3J A;  1IBM O;  1Y74 B;  4PA4 A;  3MD0 A;  1H8H G;  1OCO B;  3UM7 A;  4X65 B;  5DN6 G;  1DLB A;  3UCS C;  5L3G A;  1I7F A;  2E74 B;  2HHH B;  1XDC A;  3H1H H;  3TCU A;  1G1X B;  3WB2 A;  4X62 B;  2YDE A;  1D2D A;  4J9Z B;  3DXR B;  1ZX3 A;  1FPO A;  2ZQM A;  3IFX A;  3CD6 V;  4YJ3 B;  3CRR A;  4FLT A;  4LH6 A;  1Q6I A;  1S5J A;  1US6 A;  3I56 V;  4LF6 B;  1WB7 A;  1N8R W;  3CWB H;  3CJH A;  2Y69 C;  3OMN B;  2PY5 A;  3JAW B;  1K5Q A;  2VQE B;  5H9C A;  1AIL A;  1B6Q A;  2H8P C;  1K5S A;  1RSO A;  1JA8 A;  2UU9 B;  4KHP B;  3MDS A;  2IJJ A;  2Y69 B;  4I9Q A;  1URF A;  5KHG A;  1B3Q A;  4ABM A;  1JX9 A;  4HNA B;  5LP6 C;  2QKC A;  2LFR A;  4JAS A;  5EIB D;  2EIN C;  2JS5 A;  4CS4 A;  3AG4 C;  3G6E V;  3VQW A;  4EB6 A;  2IBZ H;  2RNB A;  1AR4 A;  4DUZ B;  2ODM A;  4JI6 O;  4CH3 A;  4Z1M G;  3L75 H;  5LP6 B;  4J7J A;  4F6R A;  1R6K A;  2EIN B;  5JQG A;  3RGB A;  4J80 A;  4CC6 A;  3BEH A;  3AG4 B;  5EC2 C;  2JIZ G;  1GN3 A;  3ETQ A;  1T5E A;  1N36 B;  4H0L B;  1DF4 A;  1PNK A;  5K1X A;  2A9H A;  2XAS A;  3P32 A;  4DV4 B;  4QIW F;  3ZCC A;  1Q8I A;  4PJ0 Z;  2CDY A;  2C2A A;  5JWP A;  1VQP V;  1KB9 F;  4PV1 B;  3WB0 A;  4W4K A;  3E22 A;  1VQ6 V;  1I0H A;  1AB3 A;  4UV8 A;  4UCS A;  3K0D A;  2OWO A;  5EYP A;  3CRQ A;  1Q6H A;  1XMQ B;  5DEC A;  1W59 A;  3M8A A;  4LF9 B;  2QM8 A;  4X9Q A;  3SYO A;  1XQ8 A;  4LFC O;  3FX7 A;  1SQP H;  4JTA B;  5FNV A;  1FJG B;  4LFA O;  2Q73 A;  1Q86 W;  1H2K A;  3K5N A;  1WPB A;  3VQX A;  3ZIA G;  4D7T A;  3ASO C;  2BTQ B;  1BHB A;  3BAB A;  1YEW A;  4OGQ B;  2ADP A;  3JCZ A;  2NN4 A;  4B3R B;  5IDJ A;  2JEU A;  4LFB B;  4KUM A;  3VQV A;  3B8M A;  1V55 C;  3DC6 A;  3OT7 A;  4ZHQ A;  3ASO B;  3W7X A;  1OV9 A;  4BR6 A;  1WNS A;  4JYY A;  2UUB O;  3BVO A;  5E1A C;  4JI7 O;  1H2S B;  4MVQ A;  3JAS B;  1V55 B;  2WSS G;  4UCU A;  2QR4 A;  3LDE A;  4ZBM A;  4QJF B;  2HVK C;  3N2G A;  2OIG A;  2N04 A;  2CTQ A;  3SYQ A;  4LBE C;  4I0X A;  3FKS G;  2DQ0 A;  3QO8 A;  2Z5U A;  4B3T O;  4DR1 O;  2JDI G;  5CA1 A;  3HKC A;  4JI3 O;  1NBM G;  4J7K A;  4GKK O;  4JI4 O;  4Z2W A;  1R73 A;  5A9G A;  4PEL A;  4JI1 B;  4CS3 A;  2YUA A;  1LUW A;  4FM0 A;  2W6I G;  1NVP B;  1WA8 A;  5FPR A;  4UXN A;  4O4I B;  4X1I A;  3L71 H;  1P7G A;  3FYI B;  3CS5 A;  5LA6 B;  1YIT V;  2WLJ A;  4U3J B;  4X64 B;  3CRM A;  5H5N A;  1PKX A;  1M56 C;  2ZDI C;  2XOK G;  1BCC H;  4O4L B;  2A3Q A;  1SQQ H;  5GON B;  2RJZ A;  4PD4 F;  2WA4 A;  3LSU A;  4BAY A;  1M56 B;  1B04 A;  2CTR A;  3RYH A;  3VOU A;  1NQT A;  3OTF A;  4X89 A;  3TJT A;  3D3I A;  1ARO P;  2EZO A;  1OZ0 A;  1AI5 A;  3SPC A;  1MOF A;  3IC9 A;  5JQG B;  1CEZ A;  3CRA A;  3HKD A;  2LGW A;  3CE2 A;  3OGI B;  3E8G A;  2AHZ A;  4FIP C;  2HVJ C;  2B1G A;  1U96 A;  2YC0 A;  3T1H B;  4B3M O;  1GH6 A;  3JD1 A;  2WPD G;  1CPY A;  3AK1 A;  2RN9 A;  3HKE A;  1COW G;  1MAB G;  4E4E A;  1VF7 A;  4LF8 B;  4X20 B;  5JVD B;  4DR7 O;  1VEW A;  3JAL B;  5LHG A;  4JAV A;  3RVY A;  1HNW O;  3QVN A;  3IGA C;  1MZE A;  2EIJ B;  1NKD A;  1RPR A;  2WLH A;  2JRI A;  3D8C A;  3CP1 A;  2ZNJ A;  1IBK O;  4MVR A;  3OFN G;  2RQ6 A;  5IYC O;  3QF7 A;  2DOS A;  5IJ0 A;  1YF2 A;  1YI2 V;  2Q68 A;  2YEV B;  4AQY B;  2P4V A;  3RBZ A;  1N0N A;  1V9P A;  2KQX A;  3THO A;  1NS1 A;  3CPW U;  3C3T A;  4U7N A;  1BT8 A;  1AJP A;  1UPG A;  3M99 B;  3T2M A;  4K0K O;  2Q7G A;  4QNH B;  1NVP D;  3ABL C;  1TAE A;  1SER A;  4GKJ B;  5IWA B;  1PL4 A;  4G2K A;  5D5P A;  4DV6 B;  4JI8 B;  4IT5 A;  3LNN A;  1QU7 A;  2LW1 A;  4A5U B;  4L87 A;  1NH2 B;  1NTZ H;  2CAZ C;  1D5N A;  3ICX A;  1HW7 A;  1AVM A;  1L0N H;  5LGU A;  3ABL B;  1K33 A;  5BMV A;  3BAA A;  1H2N A;  4MT8 A;  3N2G B;  1EZJ A;  3TXS A;  3APO A;  4JZG A;  2UXD O;  4I50 A;  4I0X B;  3FB7 C;  3LSQ A;  5CB4 A;  4FFB B;  3HPL C;  1QVG U;  3APQ A;  4X65 O;  1Q82 W;  1VMG A;  3BHP A;  1K8A W;  4EFB A;  2HHH O;  5LOV A;  1VQ5 V;  1ROP A;  1K3E A;  1Y66 A;  4X62 O;  1SF9 A;  3ZMT A;  4TOI A;  1FFT B;  1FXH A;  2Y0I A;  1NU1 H;  1R6T A;  2Q5Z A;  2CE4 A;  4FFK A;  4BW5 A;  3CHX A;  2G38 A;  2DYS C;  1N4C A;  4DUY B;  2X6C A;  4RUF A;  1Q90 D;  2RMK B;  1R6N A;  5BR8 B;  4LF6 O;  2P4K A;  4KXR A;  2DYS B;  2LQT A;  1SA0 B;  3ZX6 A;  4H37 A;  4O2B A;  2VQE O;  2Q8V A;  3ETE A;  1JR9 A;  2QWR B;  2BCC H;  3UT5 A;  1HR0 B;  1GN4 A;  1I5X A;  2UU9 O;  2IM9 A;  2OT5 A;  4DYL A;  4KHP O;  4IYI A;  2XTA A;  2N74 A;  1PPJ H;  2QWO B;  2F43 G;  3RYI B;  3SGI A;  2WA3 A;  1M5I A;  1WP7 A;  1NT2 B;  2FL4 A;  2KSD A;  1MZF A;  2YI9 A;  4PI0 A;  1XL6 A;  1EN4 A;  3U10 A;  3ZHV A;  3QO5 A;  4DUZ O;  4O2A B;  5EZY B;  3B8N A;  2ZE5 A;  4MTO A;  5IYZ B;  1XI1 A;  1S5H C;  2D2C B;  3HKE B;  1AJQ A;  1AI4 A;  5B66 Z;  4XDK A;  5LMN B;  2JVD A;  1N36 O;  1YZB A;  5D5Q A;  4NB5 A;  1DGS A;  1GTO A;  3W7U A;  1W2B U;  1NH2 D;  1VAR A;  4NYK A;  2XAF A;  1KC8 W;  4DV4 O;  3QO7 A;  1RFY A;  3CCQ V;  4I4T A;  1SQX H;  2WLL A;  3K04 A;  5KX5 B;  2V4D A;  4DV2 B;  2CTP A;  3FAV B;  4J41 A;  1Y4M A;  1K9M W;  1XMQ O;  4X8A A;  4DR3 B;  4XDL A;  4WFB V;  3KG2 A;  3SR2 C;  3ZN0 A;  4LF9 O;  2F66 C;  1KKC A;  3B77 A;  1TUB B;  5EIB C;  4J7Z A;  4MTX A;  3K9A A;  2QE7 G;  5GW7 A;  4NXM B;  1VP7 A;  1N34 B;  2YXL A;  1FJG O;  1R3L C;  3AK2 A;  2ARH A;  2Y48 A;  4GT1 A;  3E86 A;  4MW8 A;  4DV3 B;  4NVP A;  2EIL C;  3X2Q C;  4IYH A;  3BA8 A;  4LFB O;  3C90 A;  5L3C A;  1QR9 A;  5C93 A;  3W7S A;  3RYC A;  5HFM A;  4YHH B;  3CRC A;  1VF6 C;  2YS8 A;  1QCE A;  1EBO A;  2EIL B;  3GB7 C;  3X2Q B;  3N2K B;  3OMI B;  2UUA B;  1Z5W A;  1ZAU A;  2EIM C;  2BOC C;  2F93 B;  3JAK B;  4WFF A;  4UV9 A;  2A06 H;  2E5L B;  4FMT A;  5IE9 A;  5LOV B;  2IU3 A;  5F2V O;  3A2F A;  4FZ0 A;  2EIM B;  3AG2 C;  4JYC A;  2Q7H A;  1VQK V;  3K0G A;  3SPI A;  2R9I A;  4FLX A;  1OHH G;  1VQM V;  1NR7 A;  3QTC A;  2F1M A;  3BFR A;  5CA3 A;  3K59 A;  4JI1 O;  1U97 A;  3AG2 B;  1SRY A;  4P9O A;  3SPG A;  2CTW A;  2PI5 A;  2E75 B;  2BSK A;  5B3S C;  2ATK C;  1EFR G;  1BGY H;  4P2Z A;  2CH7 B;  3D36 A;  3RWR D;  1S77 D;  4X64 O;  3OTO B;  2VS0 A;  5JCO C;  4FVM A;  5TIS Z;  2UXN A;  4NKG B;  5B3S B;  1VQO V;  3N27 A;  4W4L A;  4R7C A;  1JQ0 A;  1ZL8 A;  4FLV A;  4NXN B;  1KBH A;  3O9O A;  4TV8 A;  3ASN C;  4EFE A;  1BQ0 A;  4JI0 B;  5H2F Z;  4PDM A;  4PDR A;  3RYF B;  4DV5 B;  1FS0 G;  2AZ0 A;  3ABM C;  2XAH A;  4D6T H;  2ZR2 A;  2EIK C;  2PI4 A;  3RVZ A;  3LUT B;  3ASN B;  2DMX A;  4DO2 A; 
#chains in the Genus database with same CATH homology
 4N21 A;  4PA3 A;  1NBM G;  4JTD B;  1JJ2 U;  5LBQ A;  4FK5 C;  1R73 A;  1PNL A;  4PEL A;  3ZRS A;  1VQ8 V;  1FXV A;  1FXK C;  3ZN1 A;  5IY5 C;  1XL4 A;  2W6I G;  4R50 A;  1F4N A;  5CMU A;  2NNU A;  3ABM B;  5CBH A;  2MK3 A;  1NVP B;  3LDD A;  4RQE A;  4MVU A;  2EIK B;  4PA9 A;  3A0R A;  3OGC C;  1RM1 C;  4UXN A;  1K97 A;  5KUM A;  1GK9 A;  3LDC A;  4H33 A;  3OM3 B;  4TT3 G;  1GM8 A;  2BOB C;  1H38 A;  3FYI B;  3K06 A;  1YIT V;  2WLJ A;  4CZZ A;  1MG1 A;  1I5Y A;  2GHY A;  1FXK B;  5EBL C;  1PKX A;  3OUS A;  5IY5 B;  3OEE G;  1M56 C;  2X7R B;  5B1N A;  2ZDI C;  2FTK A;  3VBB A;  2XOK G;  3JD3 A;  1RM1 B;  5L3B A;  3HB3 B;  4G28 B;  2XND G;  2OTL V;  2QKS A;  2ITD C;  2OCC C;  1VQL V;  3GWO A;  3AEI A;  4BAY A;  2JEX A;  1F51 A;  2DQ3 A;  1KQS U;  1M56 B;  3VOU A;  1NQT A;  1L1F A;  4X89 A;  2OTJ V;  5CBF A;  5LHI A;  3D3I A;  1ARO P;  3K3W A;  2EZO A;  1OZ0 A;  3ABT A;  3CYO A;  3ML0 A;  4MVS A;  3LSS A;  1AI5 A;  1R3K C;  1R3I C;  2V1D A;  5FL7 G;  3SPC A;  1RPO A;  4MVO A;  1IXM A;  1MOF A;  2H94 A;  1AR1 B;  1JVM A;  2OCC B;  1K7D A;  5CN0 A;  5H6R A;  2IU0 A;  1CEZ A;  3SJQ C;  1QVF U;  2NLJ C;  1K4D C;  2HJF C;  3LNM B;  1KP3 A;  2DYR C;  3E8G A;  2AHZ A;  4FIP C;  4ZKI A;  2HVJ C;  2B1G A;  1QR8 A;  2B1I A;  1YJW V;  2ITC C;  4HAM A;  3JD0 A;  1M90 W;  3JD1 A;  2WPD G;  5B1O A;  1Q81 W;  5KA5 A;  1CPY A;  1E79 G;  1COW G;  1MAB G;  4WFG A;  4LC1 A;  1S0V A;  5BZB A;  3QNE A;  2ZD9 A;  1E1Q G;  2IH3 C;  2DYR B;  2IJK A;  1K92 A;  3UKM A;  3R65 A;  2W6J G;  4GX5 A;  4JAV A;  3RVY A;  5LHG A;  1S72 V;  2V7Q G;  3IGA C;  2EIJ B;  1NKD A;  1RPR A;  3E35 A;  3CCL V;  2WLH A;  3E8H A;  3CP1 A;  1KKD A;  3OEH G;  5LGT A;  2HLD G;  2UXX A;  4MVR A;  4QPJ A;  1GM9 A;  3DGE A;  3OFN G;  3ZJZ A;  3E89 A;  1MSW D;  1W0K G;  5IYC O;  1GM7 A;  2WAM A;  1YSC A;  1LNQ A;  1R3J C;  3SYC A;  4CBC A;  1YI2 V;  2Q68 A;  1OCR C;  2YEV B;  3CCV V;  1DF5 A;  4KFM A;  1V54 C;  3OMA B;  1PD3 A;  3RBZ A;  1ZWI C;  3RW0 A;  2P7T C;  3TK1 A;  2QM7 A;  1YJ9 V;  1QBZ A;  4BIZ A;  4GX2 A;  2WLN A;  3OAA G;  1NR1 A;  2M7W A;  3E8B A;  2DWE C;  3W7W A;  2XAG A;  3K08 A;  2A0L A;  3JD4 A;  1WPX A;  2X6A A;  3CPW U;  4U7N A;  4GX1 A;  4QE7 A;  1OCR B;  1AJP A;  2XAQ A;  3M99 B;  1V54 B;  4MW3 A;  2X0L A;  3T2M A;  1H2G A;  2LP7 A;  4QNH B;  3CMA V;  4HZ3 A;  1NVP D;  4G27 B;  3ABL C;  2HKO A;  1SER A;  1VQN V;  3CCR V;  2WLI B;  4G2K A;  4KP4 A;  3ETD A;  3STL C;  4L87 A;  4Q20 A;  1BHA A;  1FXK A;  1NH2 B;  3T4Z A;  4J9Y B;  3CC2 V;  3OE7 G;  2W0F C;  5LGU A;  4RAI A;  3ABL B;  3CXC U;  1K33 A;  4MS2 A;  2WLL B;  1SZT A;  2HFE C;  3F7Y C;  3CCE V;  4MT8 A;  4WCE V;  1F23 A;  1EZJ A;  4P9P A;  4XDJ A;  3FB7 C;  3LSQ A;  2ZDI A;  4HYO A;  3JYC A;  1QVG U;  3HPL C;  3SYP A;  1G8M A;  1SES A;  1Q82 W;  1HWY A;  1K8A W;  1VQ9 V;  5KUK A;  1GMG A;  4U7O A;  5KA6 A;  4R8C A;  1VQ5 V;  1M1K W;  1ROP A;  1K3E A;  3CCM V;  3TET A;  1Y66 A;  1K4C C;  3F7V C;  4MVM A;  2KB1 A;  2HG5 C;  4R6Z A;  3ZMT A;  1FFT B;  1ORQ C;  1FXH A;  4GX0 A;  2P6J A;  1E1R G;  4EKW A;  4PDL A;  5EC1 C;  4BW5 A;  3DTU B;  4QE9 A;  2DYS C;  5J9P C;  1K34 A;  5B1B C;  3CCU V;  4I5S A;  3F5W C;  2X6C A;  1AI6 A;  4RUF A;  1BMF G;  1JPX A;  3OR6 C;  3I55 V;  2K1E A;  1KP2 A;  1R6N A;  2P90 A;  3ZRX A;  3FB8 C;  3WFV A;  2EIJ C;  2QEX V;  4F4L A;  2DYS B;  4H37 A;  1K73 W;  2DW4 A;  1M9N A;  5B1B B;  5HFL A;  3OW2 U;  3ETE A;  1OCO C;  1W0J G;  4BIU A;  2X6B A;  1YJN V;  4UUJ C;  2P67 A;  1I5X A;  3H01 A;  2EBO A;  4OXS A;  1DTO A;  2OT5 A;  4WFA V;  1J95 A;  3CCJ V;  3ZRW A;  2ZR3 A;  4MVZ A;  1NJI W;  1S3J A;  2F43 G;  2YEV A;  4FJC C;  5L3F A;  4PDV A;  4PA4 A;  1YIJ V;  5EK0 A;  3MD0 A;  1H8H G;  1OCO B;  3UM7 A;  1H8E G;  3G71 V;  5DN6 G;  2Q67 A;  1DLB A;  5L3G A;  5EBW C;  2AHY A;  2GSM B;  1XL6 A;  2WLM A;  3NXS A;  3QO5 A;  1AJN A;  2HR3 A;  3TCU A;  2QTO A;  4PA7 A;  3B8N A;  3IC7 A;  4MTO A;  1S5H C;  5IYD O;  4J9Z B;  5L3D A;  4P30 A;  1AJQ A;  1AI4 A;  2ZXW C;  2ZQM A;  3IFX A;  4XDK A;  1OCC C;  1KEC A;  3K03 A;  2WLI A;  3CD6 V;  1WLE A;  3ABU A;  1GTO A;  5IYB O;  3K79 A;  2Z3Y A;  3W7U A;  1W2B U;  3ETG A;  1NH2 D;  3I56 V;  2XAF A;  4TWK A;  1KC8 W;  3QO7 A;  4LP8 A;  1N8R W;  3CCQ V;  3CCS V;  2Y69 C;  2ZXW B;  1TUE B;  2JJ1 G;  3OMN B;  2WLL A;  1K5Q A;  1OCC B;  3K04 A;  1SET A;  3STZ C;  3E83 A;  4UVC A;  5H9C A;  5LHH A;  1B6Q A;  4JPR A;  4UVA A;  4MTG A;  2H8P C;  4WFH A;  1K5S A;  1Y4M A;  3FB5 C;  1K9M W;  4JAU A;  2CK3 G;  4X8A A;  3G4S V;  1YHQ V;  2IJJ A;  4XDL A;  4WFB V;  2Y69 B;  3KG2 A;  1G4Y B;  4WF9 V;  3ZN0 A;  3OUF A;  3E2E A;  1OCZ C;  1JX9 A;  3OR7 C;  4JF3 A;  1THZ A;  3B77 A;  3WG7 C;  2LFR A;  4JAS A;  3BY6 A;  2EIN C;  2WLK A;  3SPJ A;  4RO2 A;  4MTX A;  3K9A A;  4JGS A;  2QE7 G;  3AG4 C;  3G6E V;  5GW7 A;  3CME V;  4TSF G;  1R3L C;  2B5U A;  2EJR A;  3T1C A;  3ZRV A;  4Z1M G;  1OCZ B;  2Y48 A;  4GT1 A;  3WG7 B;  3E86 A;  3P30 A;  2Q6A A;  4RUE A;  5DM6 V;  5L3E A;  5CBG A;  4MW8 A;  1R6K A;  2EIN B;  2EIL C;  3BEH A;  3X2Q C;  3AG4 B;  5EC2 C;  2JIZ G;  1F4M A;  4JYB A;  5LGN A;  1KD1 W;  1QLE C;  2EZP A;  4LCU C;  5L3C A;  1DF4 A;  1QR9 A;  1ENV A;  1PNK A;  5C93 A;  1PNM A;  3W7S A;  5HFM A;  2A9H A;  2XAS A;  4XBF A;  3FYE B;  3P32 A;  5B1A C;  4I9W A;  4QIW F;  1QCE A;  3ZCC A;  3SYA A;  1P7B A;  1EBO A;  2EIL B;  3GB7 C;  2C2A A;  3MHS C;  3X2Q B;  3OMI B;  2D3O W;  2EIM C;  4JTC B;  1VQP V;  2BOC C;  4FPP A;  1QLE B;  1VQ6 V;  4UV8 A;  2LFS A;  3K0D A;  4WFF A;  4RQF A;  1VQ4 V;  4E2L A;  4UV9 A;  5B1A B;  3E8F A;  3T4D A;  4FMT A;  2XAJ A;  2YSU B;  4UVB A;  4X88 A;  2IU3 A;  2DWD C;  1M57 C;  1YTF D;  2IJH A;  2QM8 A;  2EIM B;  3AG2 C;  4JYC A;  3SYO A;  1VQK V;  3W7T A;  3K0G A;  3SPI A;  2R9I A;  3CC4 V;  1CP9 A;  1JOY A;  4PA6 A;  3ZMU A;  1OHH G;  4JTA B;  1VQM V;  1NR7 A;  2IJI A;  3SPH A;  4MTF A;  5CA3 A;  1VQ7 V;  2JK5 C;  1YTF B;  4GCZ A;  1Q86 W;  1P4R A;  1M57 B;  4ASU G;  1QLN A;  2WWW A;  3AG2 B;  3ZIA G;  3ZMV A;  3ZMZ A;  3ABK C;  1SRY A;  3ASO C;  4P9O A;  3SPG A;  2R9R B;  1UJW B;  1BHB A;  2PI5 A;  5B3S C;  2ATK C;  2JJ2 G;  1EFR G;  3JCZ A;  2IH1 C;  4P2Z A;  4QPK A;  5IDJ A;  3D36 A;  2IW5 A;  2JEU A;  1S77 D;  1JCH A;  4KUM A;  3B8M A;  1V55 C;  2UXN A;  2A79 B;  3ABK B;  3ASO B;  4YXW G;  3W7X A;  3ZRW B;  5B3S B;  1VQO V;  3AG3 C;  1PL0 A;  3PJS K;  5H6Q A;  4N23 A;  4R7C A;  1JQ0 A;  3MHH C;  3EFF K;  4WFE A;  4MSW C;  1S76 D;  3EHB B;  5EBM C;  2QA4 V;  1GKF A;  1AI7 A;  5E1A C;  4MVQ A;  3ASN C;  3AG1 C;  4DXW A;  1V55 B;  2WSS G;  3JD2 A;  3LDE A;  4ZBM A;  4QJF B;  4PDM A;  4PDR A;  2HVK C;  1BL8 A;  3CC7 V;  3AG3 B;  1FS0 G;  3SYQ A;  4LBE C;  3FKS G;  2DQ0 A;  3ABM C;  3LUT B;  1GO3 F;  2XAH A;  3QO8 A;  2Z5U A;  2ZR2 A;  2EIK C;  2PI4 A;  2JDI G;  3FB6 C;  3ZMS A;  3RVZ A;  2Q69 A;  1Q7Y W;  3ASN B;  3AG1 B;  4DO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...