1Q81P

Crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
115
structure length
115
Chain Sequence
b'SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
total genus 37
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1q81P00
1K73P 1Q81P 1M90P 3CPWK 1VQ7O 3I55L 1KC8P 2OTJO 3CC2L 2QEXO 1VQPL 3G4SL 3CXCK 1Q82P 1VQOO 3CC7O 1QVGK 1NJIM 1M1KM 3CCVL 3CCML 1JJ2N 3CMAO 1K8AP 3I56O 1S72L 3CMEL 3CCJL 3CCUO 1KD1M 1YJWO 1N8RM 1VQML 3CD6L 3G6EL 3CCSO 2QA4L 3CCEO 1W2BN 1YHQO 1VQ6O 2OTLL 3CCQO 1K9MM 3CCLL 1VQ5O 1Q7YP 1YJNL 1YITL 1KQSN 1VQ8O 1YIJL 3OW2N 1VQKO 3CCRO 1YJ9O 1S72O 1VQ9O 1VQNO 3G71O 1YI2O 3CC4O 1KQSK 1VQ4O 2OTJL 1Q86M 1VQLO 2QEXL 1JJ2K 1K73M 1VQOL 1Q81M 1M90M 1QVFN 1NJIP 1M1KP 3CC7L 3I55O 1KC8M 3CC2O 3CMAL 3I56L 1VQPO 3G4SO 3CPWN 1Q82M 1KD1P 3CCUL 1YJWL 1N8RP 1W2BK 3CCVO 3CCMO 3CXCN 3CCSL 1K8AM 1VQ7L 3CMEO 3CCJO 1QVGN 3CCEL 1YHQL 1VQ6L 1K9MP 3CCQL 1VQMO 3CD6O 3G6EO 3OW2K 1VQ5L 2QA4O 2OTLO 1VQ8L 1VQKL 3CCRL 3CCLO 1YJ9L 1VQ9L 1VQNL 1Q7YM 1YJNO 1YITO 3G71L 1YI2L 3CC4L 1QVFK 1VQ4L 1Q86P 1VQLL 1YIJO
chains in the Genus database with same CATH superfamily
1K73P 1Q81P 1M90P 4XTKA 3CPWK 1VQ7O 4P6IC 3I55L 1KC8P 2OTJO 3CC2L 2QEXO 1VQPL 3G4SL 3CXCK 1Q82P 1VQOO 3CC7O 1QVGK 1NJIM 1M1KM 3CCVL 3CCML 1JJ2N 3GODA 3CMAO 1K8AP 3I56O 1S72L 3CMEL 5DS4A 3CCJL 3CCUO 1KD1M 1YJWO 1N8RM 1VQML 3CD6L 3G6EL 2YZSA 3CCSO 5DQZA 2QA4L 3CCEO 1W2BN 1YHQO 1VQ6O 2OTLL 3CCQO 1K9MM 3CCLL 1VQ5O 1Q7YP 1YJNL 1YITL 1KQSN 4W8KA 1VQ8O 1YIJL 3OW2N 5DLJA 3CCRO 1VQKO 1YJ9O 1S72O 1VQ9O 1VQNO 5FCLA 3G71O 1YI2O 3CC4O 1KQSK 1VQ4O 2OTJL 1Q86M 1VQLO 2QEXL 1JJ2K 1K73M 1VQOL 1Q81M 1M90M 1QVFN 1NJIP 1M1KP 3CC7L 3I55O 1KC8M 5DS6A 3CC2O 3CMAL 3I56L 1VQPO 3G4SO 3CPWN 3NKDA 1Q82M 1KD1P 3CCUL 1YJWL 1N8RP 1W2BK 3CCVO 3CCMO 3CXCN 4WJ0A 3CCSL 1K8AM 1VQ7L 3CMEO 3CCJO 1QVGN 3CCEL 1YHQL 1VQ6L 1K9MP 3CCQL 1VQMO 3CD6O 3G6EO 4QDLA 3OW2K 4N06A 1VQ5L 2QA4O 5DQTA 2OTLO 1VQ8L 1VQKL 3CCRL 3CCLO 1YJ9L 1VQ9L 1VQNL 5DS5A 1YJNO 1YITO 1YI2L 3G71L 1Q7YM 3CC4L 1QVFK 1VQ4L 1Q86P 1VQLL 1YIJO
chains in the Genus database with same CATH topology
1K73P 1Q81P 1M90P 4XTKA 3CPWK 1VQ7O 4P6IC 3I55L 1KC8P 2OTJO 3CC2L 2QEXO 1VQPL 3G4SL 3CXCK 1Q82P 1VQOO 3CC7O 1QVGK 1NJIM 1M1KM 3CCVL 3CCML 1JJ2N 3GODA 3CMAO 1K8AP 3I56O 1S72L 3CMEL 5DS4A 3CCJL 3CCUO 1KD1M 1YJWO 1N8RM 1VQML 3CD6L 3G6EL 2YZSA 3CCSO 5DQZA 2QA4L 3CCEO 1W2BN 1YHQO 1VQ6O 2OTLL 3CCQO 1K9MM 3CCLL 1VQ5O 1Q7YP 1YJNL 1YITL 1KQSN 4W8KA 1VQ8O 1YIJL 3OW2N 5DLJA 3CCRO 1VQKO 1YJ9O 1S72O 1VQ9O 1VQNO 5FCLA 3G71O 1YI2O 3CC4O 1KQSK 1VQ4O 2OTJL 1Q86M 1VQLO 2QEXL 1JJ2K 1K73M 1VQOL 1Q81M 1M90M 1QVFN 1NJIP 1M1KP 3CC7L 3I55O 1KC8M 5DS6A 3CC2O 3CMAL 3I56L 1VQPO 3G4SO 3CPWN 3NKDA 1Q82M 1KD1P 3CCUL 1YJWL 1N8RP 1W2BK 3CCVO 3CCMO 3CXCN 4WJ0A 3CCSL 1K8AM 1VQ7L 3CMEO 3CCJO 1QVGN 3CCEL 1YHQL 1VQ6L 1K9MP 3CCQL 1VQMO 3CD6O 3G6EO 4QDLA 3OW2K 4N06A 1VQ5L 2QA4O 5DQTA 2OTLO 1VQ8L 1VQKL 3CCRL 3CCLO 1YJ9L 1VQ9L 1VQNL 5DS5A 1YJNO 1YITO 1YI2L 3G71L 1Q7YM 3CC4L 1QVFK 1VQ4L 1Q86P 1VQLL 1YIJO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K73 P;  1Q81 P;  1M90 P;  3CPW K;  1VQ7 O;  3I55 L;  1KC8 P;  2OTJ O;  3CC2 L;  2QEX O;  1VQP L;  3G4S L;  3CXC K;  1Q82 P;  1VQO O;  3CC7 O;  1QVG K;  1NJI M;  1M1K M;  3CCV L;  3CCM L;  1JJ2 N;  3CMA O;  1K8A P;  3I56 O;  1S72 L;  3CME L;  3CCJ L;  3CCU O;  1KD1 M;  1YJW O;  1N8R M;  1VQM L;  3CD6 L;  3G6E L;  3CCS O;  2QA4 L;  3CCE O;  1W2B N;  1YHQ O;  1VQ6 O;  2OTL L;  3CCQ O;  1K9M M;  3CCL L;  1VQ5 O;  1Q7Y P;  1YJN L;  1YIT L;  1KQS N;  1VQ8 O;  1YIJ L;  3OW2 N;  1VQK O;  3CCR O;  1YJ9 O;  1S72 O;  1VQ9 O;  1VQN O;  3G71 O;  1YI2 O;  3CC4 O;  1KQS K;  1VQ4 O;  2OTJ L;  1Q86 M;  1VQL O;  2QEX L;  1JJ2 K;  1K73 M;  1VQO L;  1Q81 M;  1M90 M;  1QVF N;  1NJI P;  1M1K P;  3CC7 L;  3I55 O;  1KC8 M;  3CC2 O;  3CMA L;  3I56 L;  1VQP O;  3G4S O;  3CPW N;  1Q82 M;  1KD1 P;  3CCU L;  1YJW L;  1N8R P;  1W2B K;  3CCV O;  3CCM O;  3CXC N;  3CCS L;  1K8A M;  1VQ7 L;  3CME O;  3CCJ O;  1QVG N;  3CCE L;  1YHQ L;  1VQ6 L;  1K9M P;  3CCQ L;  1VQM O;  3CD6 O;  3G6E O;  3OW2 K;  1VQ5 L;  2QA4 O;  2OTL O;  1VQ8 L;  1VQK L;  3CCR L;  3CCL O;  1YJ9 L;  1VQ9 L;  1VQN L;  1Q7Y M;  1YJN O;  1YIT O;  3G71 L;  1YI2 L;  3CC4 L;  1QVF K;  1VQ4 L;  1Q86 P;  1VQL L;  1YIJ O; 
#chains in the Genus database with same CATH topology
 1K73 P;  1Q81 P;  1M90 P;  4XTK A;  3CPW K;  1VQ7 O;  4P6I C;  3I55 L;  1KC8 P;  2OTJ O;  3CC2 L;  2QEX O;  1VQP L;  3G4S L;  3CXC K;  1Q82 P;  1VQO O;  3CC7 O;  1QVG K;  1NJI M;  1M1K M;  3CCV L;  3CCM L;  1JJ2 N;  3GOD A;  3CMA O;  1K8A P;  3I56 O;  1S72 L;  3CME L;  5DS4 A;  3CCJ L;  3CCU O;  1KD1 M;  1YJW O;  1N8R M;  1VQM L;  3CD6 L;  3G6E L;  2YZS A;  3CCS O;  5DQZ A;  2QA4 L;  3CCE O;  1W2B N;  1YHQ O;  1VQ6 O;  2OTL L;  3CCQ O;  1K9M M;  3CCL L;  1VQ5 O;  1Q7Y P;  1YJN L;  1YIT L;  1KQS N;  4W8K A;  1VQ8 O;  1YIJ L;  3OW2 N;  5DLJ A;  3CCR O;  1VQK O;  1YJ9 O;  1S72 O;  1VQ9 O;  1VQN O;  5FCL A;  3G71 O;  1YI2 O;  3CC4 O;  1KQS K;  1VQ4 O;  2OTJ L;  1Q86 M;  1VQL O;  2QEX L;  1JJ2 K;  1K73 M;  1VQO L;  1Q81 M;  1M90 M;  1QVF N;  1NJI P;  1M1K P;  3CC7 L;  3I55 O;  1KC8 M;  5DS6 A;  3CC2 O;  3CMA L;  3I56 L;  1VQP O;  3G4S O;  3CPW N;  3NKD A;  1Q82 M;  1KD1 P;  3CCU L;  1YJW L;  1N8R P;  1W2B K;  3CCV O;  3CCM O;  3CXC N;  4WJ0 A;  3CCS L;  1K8A M;  1VQ7 L;  3CME O;  3CCJ O;  1QVG N;  3CCE L;  1YHQ L;  1VQ6 L;  1K9M P;  3CCQ L;  1VQM O;  3CD6 O;  3G6E O;  4QDL A;  3OW2 K;  4N06 A;  1VQ5 L;  2QA4 O;  5DQT A;  2OTL O;  1VQ8 L;  1VQK L;  3CCR L;  3CCL O;  1YJ9 L;  1VQ9 L;  1VQN L;  5DS5 A;  1YJN O;  1YIT O;  1YI2 L;  3G71 L;  1Q7Y M;  3CC4 L;  1QVF K;  1VQ4 L;  1Q86 P;  1VQL L;  1YIJ O; 
#chains in the Genus database with same CATH homology
 1K73 P;  1Q81 P;  1M90 P;  4XTK A;  3CPW K;  1VQ7 O;  4P6I C;  3I55 L;  1KC8 P;  2OTJ O;  3CC2 L;  2QEX O;  1VQP L;  3G4S L;  3CXC K;  1Q82 P;  1VQO O;  3CC7 O;  1QVG K;  1NJI M;  1M1K M;  3CCV L;  3CCM L;  1JJ2 N;  3GOD A;  3CMA O;  1K8A P;  3I56 O;  1S72 L;  3CME L;  5DS4 A;  3CCJ L;  3CCU O;  1KD1 M;  1YJW O;  1N8R M;  1VQM L;  3CD6 L;  3G6E L;  2YZS A;  3CCS O;  5DQZ A;  2QA4 L;  3CCE O;  1W2B N;  1YHQ O;  1VQ6 O;  2OTL L;  3CCQ O;  1K9M M;  3CCL L;  1VQ5 O;  1Q7Y P;  1YJN L;  1YIT L;  1KQS N;  4W8K A;  1VQ8 O;  1YIJ L;  3OW2 N;  5DLJ A;  3CCR O;  1VQK O;  1YJ9 O;  1S72 O;  1VQ9 O;  1VQN O;  5FCL A;  3G71 O;  1YI2 O;  3CC4 O;  1KQS K;  1VQ4 O;  2OTJ L;  1Q86 M;  1VQL O;  2QEX L;  1JJ2 K;  1K73 M;  1VQO L;  1Q81 M;  1M90 M;  1QVF N;  1NJI P;  1M1K P;  3CC7 L;  3I55 O;  1KC8 M;  5DS6 A;  3CC2 O;  3CMA L;  3I56 L;  1VQP O;  3G4S O;  3CPW N;  3NKD A;  1Q82 M;  1KD1 P;  3CCU L;  1YJW L;  1N8R P;  1W2B K;  3CCV O;  3CCM O;  3CXC N;  4WJ0 A;  3CCS L;  1K8A M;  1VQ7 L;  3CME O;  3CCJ O;  1QVG N;  3CCE L;  1YHQ L;  1VQ6 L;  1K9M P;  3CCQ L;  1VQM O;  3CD6 O;  3G6E O;  4QDL A;  3OW2 K;  4N06 A;  1VQ5 L;  2QA4 O;  5DQT A;  2OTL O;  1VQ8 L;  1VQK L;  3CCR L;  3CCL O;  1YJ9 L;  1VQ9 L;  1VQN L;  5DS5 A;  1YJN O;  1YIT O;  1YI2 L;  3G71 L;  1Q7Y M;  3CC4 L;  1QVF K;  1VQ4 L;  1Q86 P;  1VQL L;  1YIJ O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...