1Q81T

Crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1q81T00
2KM8B 4LMZA 2CQ2A 2DGVA 1QVFR 1VQ6S 2CPDA 2M4MA 2RRAA 2M0GB 2U1AA 5GAGU 4LJMA 2XS7A 2E5GA 1H2UX 2A3JA 3TO8A 2EK6A 2ZJQQ 1ZZFA 2LEBA 1VQLS 1NU4A 3Q2SC 2OSQA 3IWNC 2VODA 2KXFA 3PIPQ 3LPYA 2DGXA 5GMKa 3VAHA 1P27B 2LYVA 5GVQA 2DNKA 3FEXB 2DGTA 1VQOS 2CPXA 2MY8A 4TU8A 3I56S 4QPTA 4TU9A 4U67Q 4BS2A 2DNPA 5DDQC 2BOPA 2KFYA 2LCWA 2RNEA 4F02A 3VAKA 2FC8A 2CPYA 1IQTA 1RKJA 2OTJS 2PE8A 2DO4A 2DNGA 1U2FA 1B7FA 2YKAA 4TLQA 1M5VC 1WHXA 2XNQA 2DH9A 2OSRA 2KN4A 2XNRA 2MZQA 3J7YU 1K73T 2RUGA 2AYMA 2LA4A 1X5TA 2MKHA 3HI9A 2DIUA 4CQ1A 2MQMA 3MOJB 1NO8A 2RT3A 5FJ4A 5JVHQ 1N8RT 1VC6A 5DDPC 3MURP 2X1AA 2HVZA 2ADBA 5CXTA 1WHWA 1G2EA 2EVZA 3CCES 2G4BA 2KI2A 3S01A 4PKDB 4ZKAA 2MPUA 1X4CA 2DISA 3LQVA 1S72S 1M90T 1DHMA 2CQGA 5EN1A 2CQ4A 1FJCA 2AYBA 2HZCA 2ADCA 1WI8A 3DLLQ 4F25A 1FJEB 1U6BA 1A9NB 2N3LA 1ZZNA 2E5HA 3UWTA 2N7CA 4WIIA 3U1LA 5LSLA 2MXYA 3NMRA 2X1GA 1YJ9S 2HGMA 2DGQA 2KU7A 4P6QA 1WF0A 1U1KA 2NZ4A 3P3DA 2FY1A 1U1OA 4QU6A 2M9KA 2AYGA 1YTYA 1L3KA 2KRBA 3RW6A 2CQIA 2PEHA 3THPA 1VQKS 4IO9Q 1SJFA 2MMYA 3MUMP 2F3JA 3TP2A 1R8HA 2CQDA 1U1PA 4W92B 3CC2S 2AD9A 5DDOC 2MHNA 2G1DA 3L3CA 1UP1A 4OZ0A 3UCGA 5H1SV 5GAEU 3RW7A 2J0SD 3V4MA 1M5OC 1NJIT 1VQ4S 1HA1A 1YIJS 1UFWA 1R8PA 1WI6A 1N54B 2L41A 1P1TA 3CCUS 3MD1A 2EK1A 2N82B 4CIOA 2XSFA 3ZZYA 3UCZP 3CMES 4Y00A 2DNQA 2L9WA 2LKZA 2KH9A 2LMIA 3SDEB 4M5DB 2FHOB 2YWKA 3S6EA 1WEYA 5IM0B 2O3DA 3CMAS 1WG4A 1UW4A 1X4HA 1M1KT 1VQNS 3S7RA 3CCMS 2LEAA 4C4WA 2JWNA 2JX2A 1VQ8S 1KQSR 1PGZA 2MSSA 1X5PA 1X5OA 2DB1A 3BS9A 4QQBA 3TYTA 1X4BA 2AYEA 2VOOA 4C7QA 1X0FA 3CC7S 5D78A 1FNXH 2XS5A 3VF0B 1VC5A 3CF5Q 1A7GE 2HGLA 2MYFA 5ITHA 2GO9A 1U6FA 5IQQA 3EGZA 2ZJPQ 2E5IA 2V94A 1FHTA 1N52B 1OIAA 2RS8A 3MUVP 1KC8T 1X4AA 4FXWA 2MZ1A 1F9FA 5GADU 3SDEA 3THTA 1FXLA 5BJRA 4TU7A 5IM0A 4IOCQ 1VQ5S 1DZ5A 2WBRA 5LXRA 3UD3P 2G0CA 2MJNA 1WF1A 3BO3A 2KG0A 2SXLA 2E5JA 1UAWA 1U1MA 3VAJA 2CPEA 1Q86T 4UQTA 2RVJA 2KRRA 2MQOA 2QEXS 1VQPS 3VAGA 1VC0A 2YH0A 3CD6S 2DNRA 2MQPA 3HHNB 3UE2A 1K9MT 2DGUA 3CUNA 1VQ7S 3G8SA 2DNNA 2RQCA 3NNCA 3CCJS 1YHQS 5CA5A 2LECA 1OWXA 2F9DA 2CPFA 1VQ9S 2QA4S 4C0OC 1FJ7A 2YH1A 5D77A 5JVGQ 2CPJA 4Y0FA 1YWXA 3S8SA 1WTBA 2MZRA 4ERDA 2DHXA 3NS5A 1HD0A 2DK2A 2DNZA 2RS2A 1HD1A 2MQNA 3G71S 1W2BR 2DHAA 2CJKA 5DM6Q 2HYIB 1WHVA 2MZJA 4YOEA 1SXLA 3UCUP 2M88A 1FT8A 3CCSS 5MLCV 1WEZA 1D8ZA 1QM9A 1JJHA 1K8AT 1D9AA 1JMTA 4YB1P 1URNA 2J8AA 4ED5A 3ULHA 2RU3A 3EGNA 3US5A 1Q7YT 2RQ4A 3G96A 4WCEQ 3VAMA 2D9OA 1KOHA 1JJ4A 2MKCA 2KXNB 2I2YA 2DNHA 2DO0A 2QFJA 2M8DB 3CCRS 2K8GA 2D9PA 2GHPA 1WHYA 1WF2A 2LXIA 1H6KX 3DXBA 1X4EA 3CPWR 2X1FA 3MD3A 4CH1A 4Z2XA 1OPIA 2KHCA 1SJQA 2KT5A 4UY8T 3CXCR 1Q82T 3SXLA 4QU7A 4RU2A 1YI2S 1N88A 1FO1A 1YJNS 1U1NA 2J76E 3BO2A 3CCLS 3BO4A 2HGNA 2MZSA 4YUDA 3CC4S 4F26A 1CVJA 3MUTP 3B4MA 2DIVA 2FC9A 3G9CA 3G6ES 1X4DA 1SJ3P 3NNAA 2DHGA 1Q81T 3G8TA 1U1RA 2M52A 2KXHA 3VAIA 5LJ5Y 1HL6A 2MQLA 3JB9k 4WKRA 3H2UB 5DETA 1RK8A 3NNHA 2LQ5A 2MGZB 3MDFA 2DNOA 1H2VZ 1SJRA 4W90B 1X5SA 2VONA 2ERRA 3CULA 2M70A 3ZZZA 3VAFA 2BZ2A 2CPHA 2KM8C 2UP1A 1KOOA 4CH0S 2DNMA 1DRZA 1S79A 2KG1A 1WWHA 4PR6A 5DDRC 2M2BA 1BY9A 4LIRA 4WF9Q 1DBDA 3IRWP 2DITA 2LA6A 2JVRA 2DHSA 2DH8A 2CQBA 4EGLA 1VBYA 3R1HA 2DNLA 1KD1T 2OTLS 2X1BA 2LXUA 5HL7Q 4IOAQ 1YITS 3SMZA 2L08A 2XS2A 2J0QD 2M7SA 2MSTA 2MZTA 1JJ2R 1VQMS 3P6YC 2OJ3A 3R1LA 2KYXA 3R27A 3EX7B 2FPHX 1M5PC 3UD4P 3N9UC 3FEYB 4J5OA 2MGZA 2MQQA 3CCQS 1XN9A 1VBZA 2MKKA 1U1QA 1QVGR 1SJ4P 1AUDA 1X4GA 5LSOA 5HO4A 2CQ0A 1WG5A 3NS6A 3BEGB 1VBXA 2VOPA 2JVOA 3B4DA 1U1LA 2Q79A 2CQ3A 2N3OA 3H2VE 2KVIA 1WEXA 2RRBA 1WG1A 4IUFA 3MXHP 5DM7Q 4WFAQ 1ZH5A 4PRFA 1X4FA 5CYJA 3VALA 4FXVA 2CQHA 2DGSA 2M8HA 4V19X 5GAHU 3MI7X 4OZ1A 2U2FA 1WELA 2CPZA 2ZJRQ 2DGWA 3CTRA 2DNYA 2MB0B 1H2TZ 2CPIA 3CCVS 2MY7A 2D3OR 1M5KC 5IFMA 1OO0B 3OW2R 5LJ3Y 3I55S 2OIHA 4A8XA 2MJUA 2XB2D 2MKIA 2F9JA 2MKSA 3J7ZT 3G4SS 1O0PA 2E44A 2JRSA 2CQCA 2DH7A 3Q2TC 2NLWA 2DGOA 5LXYA 2YTCA 3U1MA 3P5TL 2CQPA 4WFBQ 3P49B 3K0JA 2B0GA 2CQ1A 2I38A 2K3KA 3D2WA 1PO6A 4WFNQ 1YJWS 2MKJA 3PIOQ
chains in the Genus database with same CATH superfamily
2IJRA 5EHHA 2JOQA 3NGUA 1Q95G 2R7SA 1JLEB 3IBFB 3GMGA 3IMQJ 2RRAA 2XS7A 2VQFJ 3HT0A 3K5PA 4X65J 1X8DA 2VC1A 2KXFA 5C25B 3R5JB 4LF8F 1IBMF 2MY8A 4ZJQA 4P52A 1IR1A 2Y1LB 4EBCA 2DD8S 4A4JA 1KSPA 4DR4F 1RKJA 2AJFE 1NMEB 3KDOA 1BMQB 4GVLA 3EXYA 2ZNZA 4CTAB 5J1NA 2YVSA 2H5IB 2PGCA 5DJBA 1NJXA 2MKHA 1Z1ZA 3QGGA 5J2QB 1NCLA 3UFCX 3VWSA 1CC8A 3IG1A 1P9YA 1O5JA 3LWLA 2G4BA 1S12A 2KI2A 3QO9A 4IOBA 2UVRA 2KT2A 3W5ZA 3KJVB 4KQZA 4IR1A 1DHMA 4DFPA 1BLUA 3VVUA 1RAOA 5JUMA 2D7SA 3V5RA 2W7AA 3OTBA 3KHGA 4IH7A 2EEYA 4ZPTR 1OY9A 2AQ4A 3I0SA 4W92B 2HBYB 4DJBA 3VTIA 1KQFB 3QSYB 2J0SD 2GO8A 3KKFA 3HX9A 4URQU 2MEWA 1YIJS 2M5YA 3T1YF 1P1TA 4X64F 3KOAA 2XMAA 3M4XA 2KH9A 1CQMA 2B6AA 3JAMY 4I2PA 2HKEA 4E8UA 2WSCC 3NAIA 2FLNA 2VQEF 5EGYA 1MWZA 1PGZA 3DRRB 4F36A 4I64A 2VOOA 1F9EB 4C7QA 4M5JA 1RWNB 4ZA1A 3ILLA 2C3YA 1RBLA 3IWXA 3OR1A 2CJBA 5IQQA 4RUCA 3BBCA 1QTNB 4YP3A 3QJLA 1FHTA 2VFTA 4FXWA 3I0RA 4ZN3A 3PACA 3QFHA 1VQ5S 4KGKA 3C16B 5D0EA 4DG1B 4NCGA 3BO3A 3HD1A 4DV1F 3DCAA 2X3GA 3HD2A 4K8RA 1VRQC 1VC0A 2HS0A 1Q53A 4USJC 5KFCA 1RLDA 1H73A 3J81Y 1JXEA 3K57A 4M5LA 3M8PA 3HFZB 3QGHA 3FCVA 4NLTA 1RTDA 2HS4A 4RW6B 2ZBQA 3BN7A 2V4JB 2E1CA 2WVCA 4OYAA 5KFKA 1W2BR 2IDLA 2NZCA 1KN6A 2E7WA 1S0NA 2I5JA 3ET6B 2MHEA 2AEJA 1RT7A 4ETZA 1VOMA 1URNA 1S9EB 1WUUA 2VA3A 5EWFA 4MH8A 2RF2A 1Y0HA 3G82A 1RT3B 4OYZA 4UZBA 2N7YA 2KXNB 4O3RA 1F5BA 2RIJA 3ONQA 4Y2CA 4DUZJ 4URSA 1HMVA 3K58A 2KHDA 2Y1IA 3BGOP 5F3TA 4RU2A 5IC6B 4LF4J 4OHZA 3K7RA 3PZPA 1S7HA 1VQYA 1A6LA 3MWBA 1LV5A 1GMWD 1T02A 5AT1B 4YR0A 2YKNB 1SJ3P 1NKBA 3D4JA 3QRQA 3TZWA 5CQGA 3VAIA 5KG1A 4BC9A 4F4ZA 3N6NA 4DDFA 1SKWA 4LFBF 1HNIB 1H2VZ 3THVA 1FI4A 3HM9A 2NXJA 4U7UD 2LVWA 4PUOB 4WF9Q 1HPZA 3FNNA 2ZD1A 4JI6F 3V6DB 2QMUB 2EKYA 5F9NA 1TP7A 1JX4A 4WP3A 3ZXWA 4IYQA 1RT4A 2ABYA 3UD4P 2NR0A 2MGZA 2HG4A 3N6LA 2ZC3A 3VQSA 5CCMA 4NYZA 3HFKA 2Q79A 1B4SA 1H72C 2XMVA 5E5NA 2PO4A 2RDJA 4K4YA 4ZP9A 1S1TA 1RCOB 3JTPA 2AV5A 4WFAQ 2NXNA 1REVB 3GR0A 2XZTB 3H40A 2ZWOA 3CTRA 1MROB 2VKZG 1FVSA 4A8XA 1CULB 2F4VF 3HCXA 4ZPBA 1CJTB 3ZZUA 3MEGA 3OLBA 1R3NA 4KH1B 3DU5A 3NNCA 3D67A 5K14B 1SQEA 2CQ2A 2DGVA 4TY9A 2CPDA 3MEDA 4JV2A 3DOKA 3IRXA 4IG0A 3ZTQA 3PRDA 2C2OB 2R7WA 5DQGA 2RDIA 1S48A 3AQOA 3ISNC 1BQNB 1QE1A 3N6MA 4I2QB 3I87A 2IVYA 1XTZA 2OPRB 4F4AA 4N56A 2KN4A 1JLEA 2AYMA 1YSJA 1XNRJ 3CO9A 4HHJA 2LLZA 4CZCA 1NDCA 2GVZB 3X3UA 5C25A 1I3OB 4Y2IA 2HHTA 2CQGA 1LQ9A 2RSQA 4ZCLA 3OSPA 1PG5B 4F50A 3M8RA 1DLOA 4CTAA 4G1PA 2AEMA 1UWAA 3U1LA 4ZMMA 4ER8A 2ZVSA 1L3VA 1L3KA 5J2QA 2GMJA 3RG6A 3PW0A 4C8NA 1I5OB 4FF2A 5CZVA 1NJIT 3KJVA 1B3TA 2L48A 3CMQA 3W5XA 3OL8A 2HHVA 3MD1A 1VFJA 1S7IA 3AXMA 1NK7A 2IVMA 5J1PA 2XY6A 4F04B 1RAEB 4B3OB 2FHOB 4ZVTB 3LA0A 3HVTB 2UU9J 3CMAS 1FRMA 1UW4A 3VGUA 3SSQA 3M8WA 4RWXA 5A8RB 2MSSA 1S59A 2BM0A 3BS9A 2BW2A 5F8MA 2ZITA 2FLPA 3W7BA 4ILMA 3GYNA 2C2EA 1KFDA 4D3HA 1QLNA 3ENAA 4NLQA 2XLIA 2ZOGA 2HRUA 4GO5X 3THTA 2CNLB 1TL5A 4EEYA 2B4OA 4R5PB 5FD1A 3DDKA 4NA2A 2SXLA 2UUAJ 1RT2A 4USHA 3UDVA 3DRRA 2J9DA 2KRRA 5I42B 3H0PA 3CJ4A 2IM2A 3PTWA 3GG0A 2VF3A 4B9SA 4X4TA 1VR6A 2CZ4A 3FBEA 1YHQS 3CJRA 4ZLLA 2CPJA 3A3OB 3Q23A 3C16A 3HZGA 4DG1A 2EPIA 5HI7A 1GXTA 3G71S 2ALYB 3HVAA 1ACMB 3A3NB 2AGOA 1HI8A 3KLVA 4OFZA 3T1HF 1QY7A 3NKYA 4O3OA 5KFWA 2PEBA 4P75A 3QLHB 3LO3A 2B7BB 2B43A 2R8IA 2A0FB 1CBKA 2HHXA 2LXIA 3DXBA 4RW6A 4Z2XA 2V4JA 2XZWA 2PN6A 4IH6A 5F8LA 1IKWB 4X4VA 1XERA 4LF5J 2FC9A 5GADI 4OYXA 1PJ7A 1S9EA 4U9RA 3GIIA 3DHWC 1RT3A 4Y2MA 4LBHA 5AE2A 4DEZA 4LFAJ 3HHDA 3N5FA 2V2VA 2KL8A 2KM8C 1DRZA 1S79A 1WWHA 2GFFA 2XGQA 5HN0A 1DTTA 2AX1A 3VZHA 2XEXA 2J6SA 2VIHA 3GJTB 2E9TA 5K5MA 2YKNA 5E2QA 1V6HA 1CJKB 4PXDA 4U6PA 3O2IA 4WTYA 4OX8A 4OHVA 4PG5A 1HNIA 1WOPA 4K50A 4ZLJA 3MCMA 4ED1A 2QSFA 4PUOA 1HBOB 2VBZA 2D69A 2PA3A 5KFAA 6FDRA 4QR2A 3GQCA 1LWCB 2BKPA 5KOWA 3V6DA 4RNNA 1TUVA 3VGVA 1O6XA 2O66A 3T9ZA 2R8HA 2A6OA 2F7VA 3N79A 4EK2A 2D41A 2ILZA 1GEHA 2F9JA 3G4SS 5J2PB 3ZFVA 3AQPA 3DGVA 5KG7A 3D66A 1EAYC 4WFNQ 3KLEB 1REVA 3W9IA 2QX0A 3A8KA 1IUJA 2YQ1A 2OPSB 4J9PA 1VQLS 3QATA 5KFDA 4MKBA 3VAHA 1P27B 2CPXA 1CULA 5HQMA 5HANA 4I0WA 1CJTA 4OYBA 3JYTB 4F02A 4XAKA 3IR6B 3T6BA 5K14A 4C8MA 2DH9A 5BXIA 1PJ6A 4XK8C 5AE1A 3IAM9 5F9LA 1RWKB 3UVJB 5HQLA 3KNAA 1P6TA 4ZCIA 4ZKAA 3BH7B 3AA8A 2VFRA 1JLFB 1IQZA 1BQNA 2FJVA 4I2QA 2VV5A 1FJCA 2CQ4A 5IV3A 2BYCA 4LSZB 3OTEA 2OPRA 2BM1A 1AW0A 1RWMB 4AQYJ 1IN0A 2MDAA 4QWAA 1U48A 2OH2A 3FGVA 4DI6A 1WF0A 3DDIA 1K1SA 1U1PA 2PT0A 4H4MB 5DDOC 4DQIA 1IBKF 4M95A 3QRPA 4RUHA 1RT6B 1UEUA 4RNHA 1DTQB 4KGVB 3NS7B 2NCKL 4A48A 4J37A 2Y0SD 1VISA 3MECB 2RB7A 4ZP6A 2JFKA 4EI2A 1FKOA 1HNZJ 2IRYA 3S6EA 2YNFB 3GCWP 4YHHJ 1M1KT 1GXUA 1BQXA 4AYBD 1QAJA 2CZVC 1VCTA 2E1AA 2AYEA 1S9GB 1S6OA 5D3GA 3CJ8A 1RWPB 3KDNA 4KYZA 3HSJA 4KPCA 3T41A 2BXJA 2LFVA 4ECUA 2V94A 1KC8T 1J2VA 4U95A 4QYZJ 2F8HA 3MPVA 3HVTA 2OD6A 1FRJA 5LXRA 3ZC4A 4DV7J 5A8RA 1LFPA 5D4PA 3VAJA 4OHYA 2FZKB 2GJ2A 4QWEA 1CEZA 4RNOA 3VAGA 1NBEB 3CD6S 4F8RA 3G8SA 3K89A 4I7FB 4OHXA 4OYWA 4K0KJ 4MFBB 4C0BA 4LBPA 1SV5A 4R5PA 3LOUA 3RB3A 2CKWA 3OTOF 2MZJA 4K4TA 4YMEA 2GIRA 2V9WA 2YWGA 3TUZC 1UPPA 5J2NB 2B56A 1APSA 4NLDA 2MKCA 2EWHA 2IM0A 4FDFA 3KK2A 4CCHA 4CT8A 3CPWR 2XY7A 2Q3PA 5M2PA 2H65B 3GFYA 4ZCKA 2J76E 4USKA 3AJDA 4KB7A 3CJ5A 2CUYA 4CLYA 1FRLA 4M8LA 3KLGB 3Q24A 4ZPWR 4P71A 2IA0A 4DV0F 2DHGA 2UV8A 1FESA 3QLHA 3ILIA 1M5SA 2CNOB 2O01C 4A8YA 2M70A 3TJAA 8AT1B 4OYIA 4G1IA 1NSAA 2ZZNA 2OPPB 2CQBA 2HBQB 3CNQP 1VBYA 1IKWA 2XMTA 2BEFA 5U47A 1FCAA 4YN3B 7AT1B 4G1QB 2DPJA 2LQBA 4NOHA 4ED7A 2L08A 4UOFA 4ZJOA 1JXLA 2KYXA 1Q16B 3RAMA 3OHAA 3CJTA 2NUUG 3AB4B 4WFZA 4PG8A 4PWDB 4J90A 4ZIWA 5AJ3F 5CYMB 3SCLE 3WC2A 1VYAA 3F44A 1TFYA 1R43A 2HWTA 2KB2A 1F5CA 2XG8A 1Q79A 4PXEA 1V3ZA 1IKYB 1CJKA 1TELA 4PWUA 1RAAB 5A6WA 1K0VA 1L5UA 4LSLB 4F4WA 2OIHA 1EARA 2MJUA 1HBOA 1FFGB 3LGMA 2JRSA 4P2SA 4WFBQ 3SFUA 1LWCA 1WKJA 3RB6A 4F3MA 2C1EB 3O3LA 4IH5A 2EK6A 4ECVA 1HNWJ 4ES3A 1NU4A 4Y2AA 2ROGA 4TYBA 4MAKA 4NXMJ 1RAIB 4EWTA 2BJ9A 1I6JA 1IR2A 1VQOS 4USVA 1WKLA 5J2PA 4WIQA 1YRXA 4QIEA 2AJ1A 4LR7A 4DV4F 1NK6A 2EXUA 3FDSA 4ITSA 3CDAA 3KLEA 3D6TB 3A4TA 2OPSA 4QIWD 2LA4A 2R3VA 3M8QB 5JVHQ 4JI5J 2ZNYA 1N5TA 1N8RT 4CNYA 1SCJB 3BR9A 3OT9A 4NEZA 2EVZA 5M2RA 2VBXA 4DR6J 2DY9A 2IRUA 4P7VA 2YNHB 2DISA 3JYTA 4ED6A 1ZM4A 3W8GA 3DLLQ 4DSIA 1U45A 1RWXB 2YNGB 2YNIB 4DLGA 5DGAA 3KXDA 3D6FB 5D15A 2CVEA 3P3DA 1IKVB 1GQEA 2FQQB 3UVJA 1TZ0A 1N5VA 2HFZA 1C1CB 3BSCA 3CD0A 3UCGA 5CD4H 2V9KA 1M5OC 1JLFA 2K1RB 3C46A 3OJUA 1UFWA 2PFDA 1DY3A 2F5GA 3MM6B 4CLPA 1O51A 4FS2A 3SCKE 3CIMA 4UOCA 3IXQA 1U0SA 4QR1A 4I69A 2A2CA 1WC3A 1WG4A 3KUHA 4O3QA 4C4WA 2FVCA 4H4MA 1KQSR 1X5OA 2DB1A 3BGUA 3HFVA 3CD5A 3KLIB 1RT6A 1DTQA 1ZM3A 3J7YI 3CC7S 3CF5Q 4OX6A 2I0XA 3SI8A 2DR6A 4KFBB 1TFWA 3MECA 1Q7LB 3FVYA 3H59A 3HPOA 2UUCF 3C14B 1PBUA 1HR0J 2HHHJ 2YNFA 4TVAB 3BM7A 5KAKA 2G0CA 3PJ9A 2KG0A 3Q8VA 1RXOB 3NBPB 3CDEA 3WX4A 2RVJA 2GQ2A 1S9GA 5KFEA 1X9SA 1OYDA 1ZAVA 3KHHA 1KEKA 3W8PA 2CPFA 2QIFA 4B3SF 1Q8BA 3HP6A 2ZDOA 4C97A 3LPEA 3H5SA 4M5IA 4DV5J 1RI7A 3RU0A 1VJQA 3Q8YA 2QA1A 1UFLA 5MLCV 5HVGA 1QM9A 3M2RB 4Q7AA 2QYGA 5CH7B 4PEOA 3US5A 1X9WA 4M5HA 3VAMA 4KPYA 2M8DB 3CCRS 3K2YA 4MFBA 1SL1A 1H6KX 5ETTA 2X7IA 1X4EA 3MD3A 3J81U 4WP9A 4JI1J 1VBKA 4CP5A 1UZDA 2MZSA 3R7NB 3P8BB 3D54A 3MUTP 5IC4B 3ISND 2E29A 4KY3A 2E7XA 5J2NA 2BE2B 2Z8QA 4RPFA 1RU2A 3MGJA 3PW5A 3UDEA 3MDFA 2EFOA 5FLXU 1S0MA 4X84A 2IRXA 4OJ1A 1WC1A 4WKYA 2Y8WA 2DITA 1BWVA 2CWKA 1KRPA 1RT5B 1S1WB 3KLGA 3I96A 3W62A 3PCOB 3SMZA 4CO1A 3FEZA 3QAUA 1HBMB 1JK9B 3PHEA 3DYAB 3FMBA 2CAJA 2OPQB 3AY0A 3DRXA 2ZH5A 4P10A 1R27B 2WW8A 1S1XB 1MN9A 2YWFA 1AUDA 2CQ0A 2G9OA 1H98A 1VBXA 2VOPA 3IWLA 1R31A 3U02A 1NPKA 2OPPA 4YDDB 1VK3A 1AZSA 4G1QA 4ZVGA 2P8IA 1S9FA 2E9RX 4N47A 3JTOA 2POKA 4UUXA 2BJEA 2V34A 2DGWA 2D3OR 1LWFB 3EVOA 4C48A 4PWDA 4L72B 1WSVA 2CNNB 4DFJA 1XEZA 4X2BA 1RHKB 5CYMA 5KFZA 4E2FB 1ZETA 1LWEB 2C2MB 3V81B 1QUPA 2CQ1A 2J0WA 5I4MA 1B70B 2F65A 5L1JA 2FIUA 1ZTWA 3MMBB 5C2GA 1VQ6S 4KC5A 2ZM6J 1IKYA 2M0GB 3R9LA 1YQHA 2A3JA 5H9EJ 3TRGA 4LBIA 3ZNJ1 1HI0P 2DNKA 4LSLA 4NASA 4CLUA 1IM6A 4ZDNA 2B8QA 4PG4A 1D09B 5KFXA 1B64A 4XPEA 2VDHA 4B9UA 3PX6A 1KVIA 2HK3A 5ETRA 4XDDA 5L9XA 4GKKF 4LVNP 5LT5A 1RISA 2AJ4A 1X5TA 4ZVPB 4CQ1A 2GIQA 3MOJB 3LWMA 2B9WA 4C8YA 3F73A 2ADBA 4CM2A 1F60B 1C4CA 1F3VA 4B3RJ 3MR7A 1FJEB 4N5SA 3PRVA 1IJEB 2XO6A 3PX0A 2MXYA 2I8EA 2EFPA 5THWA 1CG2A 2NZ4A 3M8QA 4HHUA 3B78A 3RW6A 4OZ3A 4HL9A 4PQUB 1NB2A 5GAEU 4JB8B 3V4MA 2YNHA 2EC2A 4UQGA 1FRHA 2O1PA 3D0GE 4FKYA 3OVAA 2EK1A 1SIWB 2YNGA 1Q0NA 2YNIA 4C8KA 4JI4J 2L9WA 4QOTA 1PAEX 2VL1A 2YWKA 1KVJA 1IKVA 1WEYA 1UETA 1RZMA 2R4FA 3MZIA 4NYPA 1RTHA 1C1CA 4HTJA 1X4BA 2V63A 2K1RA 1X0FA 5D4OA 2JH3A 4PWWA 3MM6A 3C6UB 2GO9A 1SC4B 1OIAA 2ZZMA 1F9FA 4ZVRB 3H42A 3KK1A 1N56A 5ETMA 3R2CJ 2LDIA 1UJ6A 4HT5A 1S76D 2KDOA 3LW5C 3FCWA 5DG7A 3I31A 1E6YB 1Q86T 5DLGA 2ZUAA 4FPRA 3KLIA 4I6WA 3WBZA 4OI1A 2K7KA 2W9BB 1RJJA 4KFBA 3GJSB 3DHXA 4RUBA 3EM1A 2LECA 3C14A 1D3WA 2J6UA 5ADZA 4ERDA 1T9YA 4CO2A 1HD0A 2EFGA 4NRUA 3CEDA 3NBPA 2CJKA 1WHVA 3MR6A 1EQ0A 3EWGA 2J9EA 4ZVEA 3LANA 4QWBA 4YB1P 1MSWD 2DJWA 3UD5A 3BF4A 2JDJA 3FBBA 3H5YA 2DNHA 3G87A 4I4BA 1FDAA 2O67A 2J8SA 1SJQA 2E1PA 1YKWA 3QWPA 5KT4A 2EFVA 4QU7A 4EMDA 2K2PA 4MYUA 4QWCA 1CVJA 3OUYA 1Q78A 4ZPCA 2XMMA 4EO6A 2E1MC 3G8TA 2ZDPA 1VQSA 1HWKA 3RUBL 5LJ5Y 5L1KA 5KFNA 4PYAA 4EZ6A 3IGNA 1K47A 3QT8A 4J9NA 2KFNA 2W4PA 1RHJB 2RDDA 4AFFA 4YS2A 3PYEA 4P9SA 2MZTA 1JJ2R 2BE2A 2R7QA 1UVIA 5B08A 4DF4A 3CD7A 1KDNA 3D1QA 3BKTA 2Z58B 3UN3A 1X4GA 5LSOA 3PVXA 3D68A 5DQIA 3A3PB 5GAHI 3G86A 3PJXA 4KAIA 2ZC4A 1S1WA 1CS4B 2HLUA 1EIYB 3MXHP 5M2UA 2P6TA 5K20B 2RMLA 3TA1A 4WU3A 3DYAA 2OPQA 2MQ8A 3MEEB 1M5KC 4NA1A 3I55S 3SSSA 1S1XA 1R8AA 2CQCA 3TI0A 1XNRF 2ASLA 5DLFA 1GAOA 3Q8QB 3D2WA 1PO6A 3BREA 3ZZ0A 3DFEA 5HROA 5C42B 1G3OA 4UZCA 2HFNA 1D9DA 4DUYJ 4ID5A 2GV1A 2JEGA 5KG0A 2R7TA 4K4SA 1LWFA 4DL7A 4OX9F 3PIPQ 4RW7B 5GVQA 2CXEA 1SC3B 4TU8A 4C8OA 2VHGA 1LWEA 4PAAA 2CPYA 3V81A 1QDUB 1NK0A 4FS1A 1B7FA 1WC4A 4WU2A 4OMFG 2BABA 3MMBA 3HHLC 5C2CA 4IRKA 2XGPA 2FYXA 4DSKA 2N4CA 3SSRA 1F1BB 2HVZA 2XZDB 3Q86A 3P5BP 4DCOB 4B08A 2QLJB 1X4CA 3R8YA 1M1HA 4HT7A 4OZ2A 2JEFA 2UXBF 2UU9F 1FXRA 1FJGJ 1I94J 3Q0AA 2ALZA 3F0NA 1M0SA 2XMWA 5D4NA 5KFPA 2V69A 4JI2J 2HVHA 4DCPB 1OS5A 3THPA 2MMYA 3GB0A 2NQPA 1S97A 4ZVHA 2ZBCA 3VV2B 2G1DA 2E1RA 2A18A 3M05A 2Z4PA 1N48A 3GG1A 3NP5A 4J7CA 2P9EA 2UUAF 1MG7A 1D1UA 2GQCA 2DXEA 4JOUA 3HKZD 4NL5A 2ATLA 4U7UK 3M9MB 3PEHA 4PQUA 2CJQA 4ED2A 1EZZB 1N5YB 4JV1A 3TX0A 2XCAA 4BC7A 1NDKA 2CVIA 2FB0A 1JB0C 2V6AA 2AW0A 4KE5A 5F8HA 2FVSA 1V9OA 2E5IA 2R8JA 2P5VA 1CSJA 3NXZA 2HRYA 2K3IA 3NCPA 4TKTA 2J9DE 2ZH1A 3MFIA 3R7BB 3Q83A 3MM5B 4LF6J 1WORA 5IOLA 1Q8KA 2WBMA 2HEKA 3PW2A 5E0OA 1QSLA 3H90A 3CUNA 3R2DJ 4WYLA 2VG5B 3C6UA 3WZ0A 3TJ9A 1HWJA 5HAOA 3AB2B 3BQ2A 1IBMJ 4LF5F 1VQ9S 2YH1A 5D77A 4DX6A 3VHQA 3M6VA 2GAHC 5KT7A 4DR4J 2MQNA 4GVBA 2ZOMA 5DM6Q 2YPYA 2W9BA 2C3OA 3AAWB 1NKEA 4X66F 4LF9F 5B0FA 2DR7A 3TX8A 3NY0A 3CXCR 5D6GA 2VA2A 3ISZA 1TL4A 3BO4A 3CC4S 4EZ9A 4DQPA 1S99A 1EHWA 3G9CA 3FQKA 3P96A 2AP6A 2W9AA 2V8VA 1Q8IA 3OXLA 1HL6A 3H2UB 1SJRA 3EZUA 3D0HE 2UP1A 2KG1A 3V6HA 5DDRC 1LOUA 1P1LA 4DL2A 3T1YJ 3POTB 5K8PA 1QAIA 2DY1A 2JLFA 1FTCA 4FVMA 3EDRB 2OTLS 3IC1A 4E0DA 4YB6A 2RAQA 4Y65A 4PYDA 2FDNA 1ITPA 2FPHX 1ELOA 2HURA 4LIWA 2QA4G 3HLUA 5D0RA 1RA6A 4WXWA 5LMNJ 5KT5A 2XC9A 2JVOA 3O6QA 3SEOA 4JI0J 3K59A 4NLPA 5ETVA 1FFWB 3CE8A 4I2PB 1JJCB 3OHBA 2R9LA 3OL7A 3UNYA 4OZ1A 1WOOA 3TVKA 2MB0B 1H2TZ 2WHOA 1NH7A 1RP5A 4K5RA 2VPZB 2L9DA 4H4KC 1PJ5A 3BR8A 1BGXT 4FPIA 4Q45A 1RWOB 5IT4A 3NGTA 1CS4A 2PIIA 3EMTA 4AUKA 1FTRA 3PIOQ 5K8NA 4P2FA 2ZHBA 2YX7A 1QVFR 4UOHA 1GFWB 2HZVA 4F0HA 2E5GA 5HQ8A 3MEEA 1XNQJ 2JSXA 1TQLA 2HHPA 3I56S 3ILOA 1SQFA 4U67Q 4TYAA 2Q6CA 2WCXA 4ZLPA 5C42A 1WDTA 5DGBA 3DI6B 1JLQB 2MQMA 4Z7YA 2XI3A 4CLWA 1OY8A 3HJFA 4DV2F 3ZZOA 2CG4A 4HDGA 4RW7A 3LP2B 3CCES 5IXUA 2GQQA 2XHCA 1HNZF 2AYBA 1B0VA 3AXKA 4IO1A 4YHHF 1N33J 1K1QA 2BJDA 3FQLA 2XLKA 3HDSA 4WIIA 5J2MB 1WNEA 3DOMB 3MR2A 2X1GA 1ICEB 2KRBA 3OL9A 4USMA 3CC2S 1R89A 4OZ0A 4JI6J 4KV8B 3IGVA 4OV1A 3ZZPA 1NUEA 3CDWA 1LW0B 3I9V9 4DV7F 3O5TB 1NRKA 4QW8A 3TANA 1RADB 2HFUA 4HR2A 3PJWA 1YJRA 4ICLB 5E3RA 2B51A 1RCXB 3OFHA 4QQBA 2KO1A 4DL5A 1RHQB 3DKDA 4KR0B 1T94A 4JI8F 1EP4B 4TQSA 1WC0A 1ZAWA 3BQ1A 3EGZA 4F3QA 4I6YA 1N5QA 2CDRB 2F4VJ 4F0MA 2UUBJ 4QBUA 3AJ1A 3DRPA 3UD3P 1MLAA 4RUAA 5ETPA 2FGOA 4O3PA 5L38A 4QIVA 1N5YA 2YY3A 3BV8A 1TKZB 2AJQA 4YR2A 4X4UA 4LFCF 4J9KA 4Y0FA 4GC6A 4ZVSB 2YWEA 1QJHA 3W63A 2A1BA 3RBEA 1U24A 2RRNA 3MM5A 1RABB 2HYIB 4MJKA 2NXEA 3GJRB 4YOEA 2FLOA 3L95X 3MR3A 1KR4A 2RU3A 2VG5A 2XYHB 3C19A 4DQRA 1NJWA 2ZZTA 1QSSA 4IG0B 2W7OA 3OLAA 3GJQB 2DO0A 4YR3A 2P9CA 1TK0A 4CH1A 5BYQA 5AXKA 2GJFA 1Q82T 3DMJB 3RBZA 4F26A 2QT7A 2O5DA 4Q2MA 4YDXA 1NPPA 1X4DA 4WZMA 1DFDA 1TTHB 2ZH2A 3V2UC 2MQLA 3JB9k 1LK5A 1DURA 2BJ1A 1X5SA 3CULA 3SV4A 4ECYA 4PR6A 3KTQA 2QE5A 4RKUC 3CVKA 4M5KA 3T5JA 2OLWA 2HQFA 3R1HA 1PYTA 3CGIA 4ATNA 1DLOB 1Y9OA 3MCSA 2R2UA 2LU1A 1W7WA 3BSOA 4LQ3A 2MSTA 4KO0B 1RQ0A 4JV5J 6AT1B 1SH3A 4K4XA 4J5OA 5L1IA 4OL8A 5BYSA 3POTA 3PV8A 2LU2A 1HNWF 2FHJA 1UL3A 1H74A 3FBCA 4A8OA 1X4FA 3U27A 3OFEA 4ECZA 3W9HA 3K5OA 1V5IB 4J9SA 1KHWA 2QFIA 5AXNA 2BOAA 2H5JB 4DV6J 1HWUA 2NUHA 2XY5A 4OJHA 3QAEA 3U1MA 2IVFB 4JI5F 3P49B 2G2ZA 2I38A 2VG7B 5BR8F 1YJWS 1ZA2B 4DL3A 1T11A 3PEJA 3EICA 4DR6F 3I9ZA 3KWMA 1TAUA 1QAXA 3KLFB 1MWYA 4DCJB 3FZ2A 2ACYA 2QN6B 2R2TA 1BQMA 1UA1A 3Q2SC 4L3KA 2KZZA 3EJMA 2FVQA 1RT2B 1H7WA 2H4WB 3T1HJ 4QCLA 2DNPA 3IP0A 3BSAA 4F0KA 4Q43A 4WTOB 2FC8A 4O0NA 4KHRA 2YKAA 5EX0A 2W01A 3WX8A 5B0DA 2NS1B 1L3UA 4Q5VA 1U6ZA 2XNRA 4OI0A 3IR7B 4B3MF 4M5GA 1TK5A 1DQAA 2PMHA 1Y3KA 4FYWB 5IWAF 4CYUB 3FBFA 5CXTA 2C2DA 1HQEB 2W2MP 1UPMB 2B4VA 3C8YA 5DRKA 5SZTA 5K8MA 3J7Z5 4BDPA 2QMWA 4DHVA 4OQJA 2E5HA 2K7JA 3DLKB 3FK4A 4V1Ak 3NMRA 4RJVA 3IS9B 4M94A 3TA2A 3DI6A 3JQMA 2FY1A 4WK1A 4QU6A 1JLQA 3KFWX 5J1EB 1XC9A 2CQIA 1KQGB 1AT1B 1KLMB 4YB7A 3LP2A 1ZOTA 2A6MA 1HR0F 5FLXY 4B9MA 2EKNA 5HMWA 1S6QB 1NZAA 2ILYA 3SFGA 3F56A 2FZCB 5J2MA 2HNDB 3DOMA 4CM0A 3MPDA 2F63A 2Y8YA 4M5DB 1WSRA 1C0UB 1DTTB 3TEGA 1VQ8S 3DNCA 4KV8A 1RTJA 3MTKA 4AT1B 1PC5A 4DF8A 2H4YB 3FFIB 1N34J 2R42A 5D78A 3IM8A 2XS5A 1LW0A 4DV5F 2RS8A 3HHKA 4FBTA 1R0CB 3FSIA 3PFOA 4ICLA 2IDEA 1DZ5A 2J9CA 4OZLA 3RB4A 1L3SA 4P2MA 1UVMA 5A0YB 3W1YC 3DLEB 1SIZA 3ENWA 3HHNB 3UE2A 1EP4A 4RL1A 1Y11A 3SQOP 3MMAA 4ILRA 2JHEA 2RQCA 3TR5A 4DU7A 1U2CA 3T19A 1S0OA 2BV3A 1MMNA 3FUYA 1HBNB 1B99A 4DS5A 2DEJA 2RS2A 4DSEA 3MM9A 3QT7A 1OJ4A 3I4HX 4B9LA 1RHUB 5MAOA 1G6BA 4P2XA 3UCUP 1TKZA 3CCSS 2AT1B 4ZPAA 3ICLA 4K5SA 3OJSA 1J5EJ 3A8EA 4WCEQ 3QJPA 4BWJA 4DR7F 1T9XA 3EYZA 1N5SA 2K8GA 2GHWA 3LH2S 5T41A 2KT5A 3ADAC 4ELUA 3SXLA 1YJNS 1ZAXA 4FYYB 2YKOA 2DRAA 3KJNB 5CZXA 3I5CA 3CDUA 1VK8A 1FKPB 4UOGA 3NNHA 2OFGX 1IBKJ 1GTEA 4USIA 4LF7J 3ZZZA 1FWLA 4MMOA 2CPHA 1KOOA 3D28A 2Q66A 3JTNA 5DZ6A 1N36F 4J9QA 2JVRA 4ANDA 5KG3A 3DMJA 1VI7A 4B3TF 3PW7A 3NGKA 2IC3B 5HJXA 3HK2A 1LFWA 2OFHX 2Y3YA 2YWHA 2OJ3A 2C2NA 3MPYA 3R27A 1RAHB 2FHJD 1EQMA 2WW4A 6FD1A 3CCQS 4IG3B 1XR5A 3JSYA 4JI3F 5C7PA 4S0MA 2E5LJ 3DRYA 5F8GA 4CI0B 4JBCA 2ZM6F 3B4DA 2HAIA 1NJZA 4DX7A 3H2VE 3G6XA 3D3BJ 1N32J 2DCUB 3PO5A 5EX3A 1EX8A 1FKOB 2QL7B 4DR2F 1Y5LB 5KFTA 3GIRA 4KO0A 3C6TB 5ETSA 3TOQA 4ZP7A 5GAHU 4IDKB 1WELA 3RTVA 4FXDA 3OW2R 5LJ3Y 2V2KA 4OJGA 3PKYA 3PR5B 5D3GB 1TMJA 4J9LA 2E7VA 3MAQA 1U8WA 1PKUA 4X4RA 2NXCA 3D0IE 2K3KA 2EC0A 3KYLA 2ZH3A 4LF1A 2IBOA 2XMJA 2U1AA 4IQMA 5GAGU 4WFXA 4DL6A 4WPAA 3OTOJ 2AGPA 3OQ2A 4CO3A 1NSQA 2OMLA 1GNKA 2V68A 1GX6A 5KFJA 4O0IA 3PFEA 4YY3F 5DDQC 4PABA 3T6JA 4I56A 1JQGA 3TQEA 3TWZA 4AE5A 2DNGA 2VG7A 3MAAB 1ZYQA 1VLOA 1M5VC 4GC7A 1UZHA 1KWMA 3TARA 4RX6A 3KLFA 3QFWA 2RUGA 1QSYA 2QL5B 1SV5B 4BLGA 1TV6B 2UZAA 3PY8A 5F0UA 1UVLA 5RUBA 1WHWA 1URRA 3S01A 1TL3B 5LMUF 4DZ6A 2XTJP 3L9ZA 4DV0J 8ATCB 1U25A 2P6SA 4OZ5A 3HZEA 1YG0A 1YJTA 2AGQA 1AUSL 1ZZNA 1SC1B 4LRCA 1U49A 2OEMA 3QIPB 2BJ7A 5LSRA 5HMZA 3KK2B 2HQIA 1U1KA 4K4UA 1JIHA 1JLBA 3MUMP 3MEKA 1X9MA 4CYUA 1TL1B 1HQEA 2AD9A 1XMOJ 5H1SV 4LRAA 2YPZA 1HKAA 4Y6IA 3QJJA 3VQTA 2C2KB 1YZ7A 2CNKB 3DLKA 1FFSB 1S49A 3D9BA 4W98A 3IS9A 1D0EA 2F40A 5AJ3J 2NXUA 3H5UA 3K5MA 1TUGB 5J1EA 2KFZA 3G6VA 4DS4A 4DL4A 1KLMA 1N0UA 2CRLA 4N7TA 4LRDA 1S6QA 1Y3JA 4NLWA 4C9DA 1FRKA 2UXDF 1A7GE 1VIOA 2CDQA 4QYRA 1U6FA 5EDWA 4DR3F 2HNDA 3R6GB 1X4AA 5G4DA 1PSDA 4M5DA 2HAFA 1C0UA 3ENVA 1Q5YA 3M8YA 3W9JA 3A8JA 2X3DA 4J91A 2MJNA 3CJ3A 1KBRA 4B9NA 4DFKA 4QPXA 1GX5A 2YH0A 3OV7A 3FFIA 2MQPA 1PYOB 1WC5A 2UUWA 4FYXB 5IV4A 2QV6A 1TK8A 1OWXA 4Q8FA 2OI2A 4NA3A 2HFVA 3S8SA 4PG7A 2YX4A 2BRKA 1C1BB 1CPZA 2L3MA 2DHAA 1CJVB 4HYKA 4KHPJ 5A0YA 3DLEA 4DPUA 2ZVIA 4NX9A 1D9AA 1JMTA 4ED5A 2VJUA 1RYSA 5AXLA 3BBFA 2MLZA 3SV3A 1H0HB 2HHSA 1HBNA 2WVFA 1GMUA 5CAAA 2IJFA 4RBVA 3HHEA 2AIRB 1MU2B 1FF2A 4NCAA 1N88A 2B4PA 3HSZA 1WJ9A 3NEKA 4C3KA 1YBAA 1KQKA 5HSPA 2M52A 1X0PA 2KXHA 4FYVB 1TKXB 4WKRA 4N76A 2QZ8A 3MCNA 5I3PA 4NYOA 3KUEA 3CSKA 1S5ZA 4CH0S 1U02A 1GH8A 1RWVB 1NK8A 3RZAA 1X7VA 2DH8A 1X31C 1HHSA 3LP0B 4MKAA 1KD1T 3H4BA 5I3QA 1BD6A 1EB0A 4C8LA 3BSNA 4WJBA 4DR5F 1K0TA 4K4WA 2AJ2A 5F0WA 1FKPA 5KOXA 2W9CA 3KNGA 3RAXA 1KNZA 2BUNA 2IFXA 5ETLA 3U7JA 2NYHA 2R7UA 4RO0A 3OR2B 4A8SA 1OQ3A 3VR1A 1GMVA 1WG5A 1H38A 2V2QA 1IKXB 1QD1A 3OFFA 3I4PA 1ZTTA 4F7VA 3MMJA 3DLBA 5DM7Q 2IC3A 2G2YA 3JSBA 5CYJA 4FXVA 1QUVA 3F41A 4Q2LA 4GKJF 5EWEA 3AHPA 4IG3A 2VBWA 2AHOB 1FA0A 2MKIA 2H1YA 2B0GA 3Q8UA 4C2MA 4LF2A 3PW4A 3GP9A 1TKTB 1RTIB 4TLRA 2KM8B 3T1AA 1CQNA 1U0HB 2BKNA 3DRSB 3C6TA 1H2UX 4IDKA 4LUBA 1FJGF 4F3OA 1I94F 4ZVQB 3SCJE 3TAMA 3LPYA 2ASDA 5GMKa 2LYVA 1Z2LA 1KVKA 1QAYA 1KLNA 3E51A 4L6V3 4BS2A 4JI2F 3GFXA 5B0CA 3K5LA 3T5HA 3GFZA 4Y2KA 4IKAA 2J6TA 3HSDA 5KFBA 1TR0A 2LQJA 2QRRA 2ASJA 3R6LB 2Y0BB 3L7PA 1K73T 4FNHA 5FJ4A 3IO1A 2RHQB 4DOZA 2DT9A 3D1OA 1J5OB 2WVEA 2MPUA 3PX4A 4KHMA 1PCAA 3MAAA 3GLJA 4PG6A 2DPIA 1BXNA 1YJ9S 4PPZA 3ELHA 2M9KA 1XR6A 1YTYA 1TV6A 2XULA 3KK3B 2ROEA 1T9WA 2F3JA 4MK9A 3EZ5A 1AXQA 5B0AA 2CQDA 1S10A 3H5XA 1TL3A 4M5MA 1UP1A 4HHHA 4JUZA 3UPFA 2HRTA 3R5GA 3TUIC 4K59A 8RUCA 2HK2A 1RT1B 2XSFA 3QIPA 3UCZP 4LF6F 5KFGA 2Y1JA 4ED4A 4URGA 3W61A 2KJWA 1T95A 4KGZB 4WFYA 3S7RA 3AT1B 1TL1A 1BWEA 1RB0A 4IR9A 1TUWA 2B4UA 1IBLF 2W8LA 3LALA 5KFVA 2ZE2B 2DR9A 1FWKA 2BANB 2VC0A 2V5HG 1EKSA 3A8IA 2D3ZA 3MCOA 2MZ1A 1O8BA 4KBIA 5A6PA 5BJRA 4ES1A 2IPOB 3FJ2A 4ZVOB 3UR0A 3KG1A 3O1LA 3A13A 2P9GA 1U1MA 2BE9B 1AZSB 1S1VB 3MFHA 3J80U 4G6VB 9RUBA 4NLOA 3KHLA 1B7YB 1HBUB 2DGUA 2C42A 5A8WA 4YQWA 2J7KA 1NNDA 2XWXA 4UUWA 2DNNA 2F4FA 1C0TB 4XIUA 4DV3J 2MLXA 4F2SA 1LKZA 3QNWB 5EWGA 1XIQA 4RBUA 4GKKJ 2IAJA 2W4CA 2Q6BA 2NPIA 3PYGA 2OMOA 3IBCB 2HLTA 2OKQA 2MKYA 4NZ6A 1SL2A 3R5CA 2GHPA 2HQDA 3GE9A 4UY8T 1C1BA 3FKBA 1CJVA 2D3O1 3BO2A 4YUDA 3GV7B 4JI7J 4ZIVA 4ECRA 2DVIA 3QZ7A 5LMNF 3CT9A 1Q81T 2XCPA 3AH6A 4CO5A 2QLFB 4JI0F 2HQCA 3FZBA 2ERRA 4NMLA 4KGMA 2DNMA 1MU2A 3DLGA 3CJQA 3ILJA 1BY9A 1FE0A 4P73A 4EGLA 1XMQF 2EW9A 4IFVB 3GFHA 3MPWA 4OYMA 4J9MA 4CLFA 3CCZA 1KHVA 3TJ8A 2C3UA 4NLRA 5B0BA 1REGX 2M7SA 5K9FA 1TKXA 1YDLA 3NCQA 2R7RA 5D8HB 5DG8A 3GWCA 1U1QA 1SL0A 3KUGA 5HO4A 2QLXA 4ZOSA 3DGPB 5E33A 5B0GA 2C2RA 3M9NB 3JS9A 1WEXA 3EVMA 3LP0A 3CCTA 3HSGA 3WIUA 4XTTA 3KJQB 4IUFA 1SVDA 1XNQF 3OFGA 1S1UB 5C5JA 4MKYA 2IMWP 1VS3A 4Q44A 1N6QB 2GVDB 2U2FA 2FHKA 3GSDA 4AL6A 2OP5A 2R2SA 4DWIA 1NM2A 3M1VB 4EFAC 2CJAA 1RTHB 2Z2LA 3RBDA 3OR2A 2NSCA 3DLJA 4Z37A 3CJ0A 1BUXA 1IKXA 4O3NA 1XQIA 2NLWA 1S6PB 2DGOA 3WIVA 3K0JA 1GXLA 3CJKB 4ECXA 1JKHB 4LMZA 3KK1B 2F1FA 3AD7C 3T5LA 4KH0B 2VICA 1R8BA 1LEOA 3TO8A 1N33F 2LEBA 1HHTP 5HVFA 3QQCD 4CLKA 1WOSA 1RE1B 3BYPA 1YLXA 2UXCJ 2DGTA 3GIKA 1YBUA 4HI1A 2P2CB 2IM1A 2Q43A 5F8NA 3QPIA 1OQ6A 3VAKA 2DO4A 2PE8A 1U2FA 3DM2A 3QWUA 1RTIA 1TKTA 2RHSB 5HP1B 5CABA 2HFOA 2J5AA 3TZXA 1FNMA 3D5MA 1U0HA 3DRSA 4AL5A 4O4GB 5E3QA 1EJ7L 2RT3A 2W4DA 1CLFA 3MURP 2X1AA 3H2LA 3B54A 4OYPA 4O3SA 2AZ3A 1FRXA 1M1GA 2HWHA 1S72S 1RUSA 4U8YA 1OSCA 2QLWA 4JP8A 5LSLA 3HULA 4P74A 1G4CA 3QRRA 2A10A 2B9EA 3IFEA 1SI9A 5DO2A 4IRDA 3V6JA 4KTQA 1IBCB 3L3CA 1J5OA 3OUYB 2V8HA 1T8EA 1VLYA 4RNFA 3GILA 2Z0GA 2UUBF 3FRYA 1BE4A 4FF4A 1N54B 5H9FK 3T5KA 2G0IA 4ANEA 1HWIA 2HIQA 2QLBB 2VPYB 4WK3A 4H4OB 2KZMA 5HMYA 3PO4A 4BHQA 5IM0B 2O3DA 4EO8A 3KK3A 3TUJC 5KFSA 5F41A 3CCMS 2JLGA 2JX2A 1YK9A 5L1LA 4FN5A 2GS8A 5LOQA 2K06A 3H8YA 1AFJA 1RT1A 3R5AA 5CYQA 1KP6A 4TN2A 4XO0A 3UNGC 3I82A 4DX8H 3V4IB 3BBBA 1PC4A 1LK7A 2IYIA 1HIYA 1C2PA 3UW1A 2V67A 2WRMA 4CRJA 3KG0A 4ZITA 2QEXS 3RR7A 2ZE2A 1DJ0A 1V3RA 2QG9B 2PC6A 2BANA 1LW2B 1NSKL 3W5YA 2YX1A 3JSRA 2FVPA 1F2HA 3M32B 4OX9J 5KFMA 5JMNA 3RAQA 2QSWA 2VH7A 3PG9A 5GAEI 1WTBA 2MZRA 3NS5A 2DK2A 2DNZA 2BQ3A 2VQFF 4UF4A 4UW2A 4X65F 3AJ2A 1HW9A 3JQJA 3DU6A 3N01A 1S1VA 5HROB 1FT8A 2EG2A 1K8AT 1HBUA 2HFSA 4ID5B 1FERA 1FEEA 5DS7A 2RQ4A 4X62J 1RTZA 1JLAB 1C0TA 1HNXJ 4C0HA 2UXBJ 1AFIA 5A76A 2V50A 3HF5A 4JV5F 1VRTB 1FRIA 3NRBA 4NLGA 2ZFHA 1UJ5A 4WWSA 3NNAA 3VZIA 1J27A 2AX0A 2GGPB 7FD1A 2Z2ZA 1S77D 4W90B 2VONA 3UDLA 3RB0A 4K4VA 4LIRA 1S4FA 2PFFB 1VHFA 3IRWP 3S1TA 3TAQA 3NGRA 1HHQA 3H25A 1D9FA 3VVTA 2OAUA 3OL6A 1G1XA 2XS2A 4DV6F 2OHDA 1FDNA 1VQMS 3T3FA 5KFYA 3CJ2A 2CADA 3EX7B 2PDAA 3OPKA 1VBZA 2VBYA 2MKKA 3R3TA 1SUQB 1QVGR 1RACB 1FD2A 3GTYX 1UW9A 2CQ3A 2N3OA 1ZM9A 1RBOB 2RRBA 4IFVA 3UN2A 3AOAA 1VIXA 1ZH5A 3W64A 5KFFA 3KLHB 3D6HB 4OZNA 2CQHA 2DGSA 3ETMA 1FWPA 2AMCB 2DNYA 3BGLA 4MK8A 2HSEB 2DR8A 5IFMA 3DLHA 2LP4A 4ED0A 1V5VA 2RE1A 1YRUA 4RZRA 1T3OA 3J7ZT 3DGPA 3BYRA 4A8WA 2YTCA 2BRLA 3ZZTA 2DBBA 2ZH7A 3ET6A 1S1UA 2MKJA 4Z7CA 1ZPWX 4K7QA 4C3LA 4FYDA 3H20A 5L46A 2M4MA 4AXJA 1N6QA 2GVDA 4DR1J 4FP9A 1ZZFA 3Q8RB 3Q8SB 2DTJA 3MTJA 2DXFA 2OSQA 1RDRA 2VUGA 3M1VA 4Q0BB 2VODA 2DGXA 4HACB 3TUPA 3DOLB 4ZHRB 1MNEA 2BVZA 1S6PA 4F4YA 3KG4A 4U7CA 1RAJA 3NCRA 2OTJS 3CJKA 5IT9U 1RA7A 4FNIA 4PXCA 5CCLA 5IZHA 2Y9HA 1JKHA 4X66J 4LF9J 1UKUA 4I67A 2OSRA 3MM8B 3TQ1A 4BBYA 4YEAA 4NMXA 3NL0A 1U8SA 3Q89A 4GVBB 5DDPC 4ECQA 1G2EA 3AFGA 3NOCA 2HMIB 3LQVA 1F0XA 4DUZF 2H5EA 3MPUB 4HDHA 2EBEA 2FUG9 3MHYA 2N3LA 2V2ZA 4LF4F 5HP1A 1W2IA 2HNZB 3OSNA 2KU7A 2LQ8A 4O4GA 2AYGA 1N34F 1NXIA 1VQKS 4IO9Q 4NXNJ 1UCNA 5A2QU 2RILA 2CWXA 1RHMB 2BQRA 3C2PA 2W2NP 3E01B 1GK8A 1SKRA 3U1NA 1LWXA 3MR5A 2V4QA 2B8PA 2N82B 4F4XA 2AKWB 5E3AA 3AOCA 4Y00A 4A8FA 1Y10A 2HVDA 4X4OA 2KYZA 2WZ1A 4LQ9A 1FNOA 3FSXA 3D3CJ 1X4HA 4ZVFA 2CJXB 2FTRA 3LAMA 3I5BA 4TNOA 1MROA 2EG1A 2IY5B 4ECWA 4QR0A 2BDPA 9ATCB 4DPXA 5GMEA 4H4OA 2W7PA 4OI2A 5GADU 4LR9A 4NE9C 5IM0A 2OEJA 2WBRA 4USTA 1RGVA 2VFUA 1J5EF 3CCWA 4CLZA 3BGFA 4L73A 1CC7A 2GA7A 2JLEA 1VQPS 2DNRA 2D3UA 1K9MT 2XMKA 4EUVA 2HHQA 3DDNA 1I51B 1UMJA 1NDPA 5JVGQ 1IJFB 3V4IA 2DHXA 2GW8A 1T05B 3VGTA 1JNZB 3PNIA 2GVZA 1RBAA 2R7VA 4X4SA 3MMCB 4C6AA 2FJBB 1HQUB 2N4DA 3QGPA 4LF7F 4DPTA 3HJVA 3TW0A 2IIHA 4FZVA 1LW2A 3ZTOA 3G96A 4LREA 4DV2J 1UVJA 3M32A 3K17A 4ETXA 4JYAJ 1SC6A 5KFUA 4ZVUB 2ZBRA 2DHHA 1WF2A 3KJFB 4NLUA 2EI5A 1NK5A 3Q22A 4RWWA 2ZHAA 1Q1KA 3BJYA 5D4LA 1U1NA 1KTVA 2YQ0A 2HGNA 3WHIA 1MW7A 4QIGA 2E5LF 1Q8LA 4KKOB 2WSEC 1QTMA 3OBIA 3W66A 3LF0A 1W26A 1JLAA 1N32F 2GJIA 1G7CB 3BN4A 4M1KA 4B3OA 2BZ2A 5KT2A 2JJ4D 1VRTA 2DHSA 1R6VA 1KFSA 3K8VA 1DARA 1FX2A 5HL7Q 4EYHB 3QGIA 3M6XA 3TZYA 1IR0A 2RJZA 3B8HA 1TAQA 2L9NA 4OX7A 2GGPA 3LAKA 4EU0A 2XI2A 2BACA 4W4MA 2WTFA 3Q8PB 5KFIA 4DBQA 1VRUB 5IS2A 4CT9A 2YXLA 1TL7B 4JI8J 1NB7A 4OZJA 4G3IA 1WG1A 4ZLNA 1UTAA 5I42A 2HBRB 5HATA 1OY6A 4MKVA 2CPZA 3CCVS 2HWIA 1SUQA 3M8ZA 2W2OP 3R5DA 4C98A 2W24A 2CZ9A 3OTCA 2MKSA 1RYRA 3NG8A 1EKRA 2H51B 4LVOP 4PCQA 4LFCJ 3M2VB 2OUGA 4I1TA 4DQSA 3KLHA 3DRPB 1KS2A 2JC1A 2C2ZB 2BW7A 2DCLA 3IWNC 4L3NA 2HPUA 4CLSA 3SZ2A 3AD9C 4HTIA 4QPTA 4DPOA 4EBEA 2PI4A 5IT0A 2UVWA 2JFDA 2DXDA 2VB6A 3IA0A 2G1HA 3E8OA 3ITHB 3JSMB 2CFXA 2ZBIA 2FJWA 4ANCA 5HBMB 3C3LA 1RAFB 1DQ9A 1HLWA 1WHXA 1MMDA 1XMOF 5L9NA 3ZO7A 4IRCA 3BPSP 4P7TA 2IM3A 3HI9A 4ES2A 2DIUA 2VFSA 4Q0BA 2V8PA 3OD2A 4HACA 3DOLA 4ZHRA 3W2WB 1UVKA 3IN5A 3NGSA 5C24B 2V8DA 1WC6A 4H54A 3AD8C 5E3CA 4RW8B 3GR1A 2N7CA 2BQUA 4LF8J 1S57A 2J7UA 1ZS6A 1Y5NB 3MM8A 2VU5A 1EETB 2QC3A 3E2EA 1IM4A 4IFYB 4YFUA 4HVZA 4NEYA 5IQ6A 3DN9A 2WK4A 4O4RA 2BKOA 1RWUA 1M5HA 1T3NA 3RW7A 5KFRA 4LFAF 4K4ZA 2HMIA 1ZPVA 1WI6A 2WSFC 2BMBA 4K2XA 3CCUS 4CIOA 4UT4A 3CMES 2HNZA 3M9OB 2DNQA 1Y00A 2LKZA 2B3TB 5KFQA 1ZM2A 4ED8A 2RU9A 2F8EX 4DZDA 3RRHA 3BDPA 3BH6B 3HHLB 3OTDA 1DAXA 3TYTA 3E01A 2Z2MA 3EZOA 3G8QA 3H98A 2H48B 4N77A 3RYLA 4ZJLA 4NPOA 2ZHOA 2UVUA 4CDIA 2WOMB 3J81j 1FNXH 3VF0B 4QIFA 4F4KA 1V3SA 3QBCA 4LSNB 5A8KB 4KHPF 4DN0A 4QWDA 2VFVA 2FY8A 3GIMA 1T9VA 3QIDA 3UDCA 4GRSA 4RLEA 4X64J 4A8QA 3PYDA 4OI4A 3CDBA 1HNVB 2E5JA 5BR8J 1TU0B 3NLCA 3A12A 5KG2A 3OXFA 1H3DA 1YGYA 2VQEJ 2JC0A 2VZ9A 3UN5A 5CHCB 2ZOFA 3UR3C 1SKSA 1FJ7A 2H3EB 3N28A 2YKPA 2YQ3A 1HI1A 2ZKUA 4CO4A 1NK9A 2PI5A 3G6YA 5KT6A 4OYOA 4B3MJ 3R7SB 5CD4A 4IQXA 1UWBB 4DLEA 5IWAJ 1BQMB 1NHKL 4DV1J 1T9TA 2XO7A 2ACMA 4WE1B 1NPRA 1UEKA 2I2YA 1NHUA 3WDOA 1WHYA 1T05A 1ZBTA 2KHCA 4OJ3A 1T9UA 1YVFA 3M8SA 3MMCA 1HQUA 4I6AA 3BB5A 3JXOA 4KIAA 2YKMB 1SQGA 3PYFA 5FIIA 4CNZA 2NREA 3FRZA 4KGXB 2ZEJA 4RR5A 1RK8A 4B9TA 4AQYF 2Y1RI 2IHR1 1F5AA 1ROFA 3GYXB 4PQAA 2QGFB 2EBGA 4QYZK 4UTGA 3ZNUA 1NLKL 2J7WA 3JAMU 2D1CA 2W2QP 1H7XA 2LXUA 5ETOA 3L4BC 3EPIA 4KKOA 4A8KA 4MIBA 4QJVA 3PR4A 3GZ7A 3R5BA 3RRGA 5SUHA 1XN9A 2IMOA 4O44B 3NS6A 2HHWA 2QO3A 3M30B 1HFEL 1N4LA 4LFBJ 2NPFA 1YRTA 3QMQA 1CJUB 5T14A 3GU0A 1PYSB 1FEHA 2HNYB 4PRFA 5JXSA 2CJYB 2ZWPA 3TZZA 1YZ6A 4V19X 2FHMA 1MMLA 4R8UB 2ZJRQ 1F3FA 2MY7A 4I7FA 1FE4A 4ELVA 2HQ3A 2EFQA 2Z56B 1RTJB 4NLVA 1VRUA 2QTWA 3TVYA 1TL7A 5KFOA 2VPWB 3PRBA 4NLXA 3AA9A 3QT5A 2G0JA 1T03B 3MOZA 3ZZRA 5JJBA 4YB5A 4F67A 2C3MA 3UO0A 2R2RA 1AROP 2ZBPA 5T7LB 3NGDA 3J80Y 2ZJQQ 4X4PA 2AEFA 1P9QC 2VJVA 1HQ2A 2Z30B 4K0KF 1JLGB 1NSPA 1JNRB 3VGSA 3W65A 4J9RA 2LCWA 1WTFA 2PSZA 1R8CA 3MMAB 1IQTA 3L7OA 4DR7J 2R7XA 4TLQA 1P8GA 2XNQA 3M2VA 1JXVA 4KSEB 4BCAA 3ZTPA 3GV8B 5B7WA 3J7YU 4HH0A 1NO8A 3D7SB 2G13A 1VC6A 2GMLA 3MM9B 3NMAA 1B0TA 1W25A 2ASYA 1FXDA 3ITHA 3QZ8A 4LRFA 3JSMA 2FVRA 3O44A 2OEKA 4A46A 5HBMA 5ETQA 3FC9A 4FVCA 1NZ8A 3EXCX 1MN7A 2WVBA 4P6QA 3DC2A 1U1OA 1N36J 4MTPA 1VMBA 1F9HA 3SIPB 4B3TJ 2VD3A 3W2WA 4C3MA 2G2OA 5DG9A 5C24A 2HHUA 2KT3A 1RSCA 1HA1A 2XLJA 1R8PA 3IR5B 1Z2ZA 1RKIA 3EUNA 4RW8A 1VDHA 4HKQA 3NOGA 1F6TA 4JI3J 2F8MA 4RW4B 3JQKA 4B17A 2LMIA 1FVQA 3SDEB 2PD1A 1EETA 2BBEA 4IFYA 3GSIA 3HVWA 2R8GA 3VCDA 2VG6B 4ED3A 2DYAA 4HEA9 4ID8A 4DV3F 3W2VB 2ZKTA 5E7OB 3FCHA 4DR2J 4DN9A 3M7VA 4OHWA 2MTLA 5HMXA 2HVIA 4OI6A 2AWZA 2MYFA 2WONB 4EYIB 5KTQA 3C15B 2B5JB 4TU7A 2JNJA 1WF1A 4DXLA 1NJYA 3E3XA 2DRBA 2LDYA 1NEEA 1U4BA 3HHLA 5K8OA 4UQTA 2MQOA 1YJVA 2NYIA 2WOMA 4ZPDA 4FKXA 4GO7X 4ALZA 4LSNA 5A8KA 5FDLB 4JI7F 1RLCL 1YWXA 4OIXA 4YY3J 1VHIA 4DMZA 4ZS6A 2ROPA 2APOA 1HNVA 4C8ZA 4NXMF 4DPYA 3FMWA 2JL9A 3O8WA 1AA1B 1WEZA 3GONA 1JJHA 2B7CB 3HVRA 2J8AA 3MF5A 5I3UB 3HXMA 1YBTA 4MK7A 3NWGA 2QFJA 2JZ5A 5LMUJ 2D9PA 1K44A 4DQQA 3SQGB 2X1FA 2EFNA 2FJXA 3HKWA 2DR5A 2XQCA 2XYGB 1NDLA 1IVZA 3J7A1 4KRWA 2MLYA 3EDQB 1UWBA 1U1RA 1SH0A 2RH3A 1S4EA 4WE1A 4L74A 2DNOA 3LP1B 2V4RA 3VAFA 2M2BA 1DBDA 4CO0A 4N8NA 2GNKA 4RBTA 2C22A 1R0AB 3EE3A 2YKMA 4LT6A 1A0OB 1UEVA 4ZP8A 1JLBB 3N9UC 4HI2A 3MM7B 2KKHA 3GIJA 3C66A 3PXGa 2UXDJ 4B02A 4Y34A 4DR3J 3CB4A 1WDDA 1GT8A 4Y3CA 4BWMA 2UXCF 2FGCA 2QJ3A 1N0VC 3MI7X 2XSJB 4RNMA 2CPIA 1UVNA 4ZK7M 1OO0B 2BA9A 2HHHF 2XB2D 4O44A 1UA0A 5KT3A 4NLYA 2DH7A 5L8RC 3M30A 3Q2TC 1XMBA 2CQPA 3P5TL 4NZ0A 1SB6A 1FD8A 3IM9A 4NLSA 2DKOB 2LEPA 1CJUA 2IJNA 2HNYA 3M2RA 2XWYA 4R8UA 2RD5C 3RGIA 4L75A 1U2RA 4NZ7A 4O23A 2BJ8A 4MYTA 1Y4ZB 2I9SA 4TU9A 2I6WA 2BOPA 2KFYA 1E6VB 2RNEA 1T03A 1RHRB 5L39A 4ZCMA 4HH1A 4OLPA 5HJYA 4U8VA 1TMMA 3L7UA 2MZQA 5T7LA 2RUSA 4DUTA 1OMSA 1UJ4A 4NI2B 3I5AA 4Q8EA 1JLGA 4AXIA 1ZA1B 3KMQA 3BGRB 4MIAA 1MWQA 4HLBA 5EN1A 2HZCA 1FK9B 2ADCA 1WI8A 4JI1F 1L3TA 1KONA 1YJUA 1U6BA 1A9NB 1RT5A 5LL6d 1IWGA 3UWTA 3T9NA 2WB4A 2DGQA 1XK8A 5HLFB 3K8WA 1HBMA 2CJ9A 2E66A 2PEHA 1SJFA 1R8HA 1U26A 2QMXA 2MHNA 4QW9A 2J0XA 4DR5J 2CIMA 2L41A 5GAGI 4PPDA 3IBWA 3TNVA 1Q5VA 4H4KA 3ZZYA 2ZH6A 3QYYA 2YKQA 2QYCA 5GMDA 3V6KA 3WC0A 1VQNS 2LEAA 1U7LA 3SBMA 2ATCB 3PDNA 5H9EK 1X5PA 4P72A 2OO4A 4GKJJ 4J9OA 1VC5A 2HGLA 2RKIB 7FDRA 5ITHA 3I6PA 2W9CB 1JLCB 3K5NA 3MUVP 3HHLD 3TEHB 4RW4A 1BHNA 3SDEA 2JEIA 1NKCA 3WQPA 1JWWA 5HVHA 1IXKA 2VG6A 2QL9B 4X62F 2OD4A 4TY8B 2CPEA 3W2VA 1HNXF 4AL7A 1NK4A 2XM3A 2FZGB 2HW3A 3I32A 4LRBA 3EVWA 2WONA 3P4UB 2KTQA 5CA5A 2V0NA 3AOBA 2F9DA 3C15A 4FBUA 2QA4S 2B5JA 5G0RB 4WZQA 3RRKA 4QZVB 2W25A 1Y7PA 3CW2C 4ZPVR 4D3GA 3GV5B 4CH7A 1PILA 3FSYA 2LXFA 2FJDB 1SXLA 2M88A 2OGUA 4PZVA 4OLOA 1F2GA 2B9YA 1Q7YT 2VASA 2NSBA 4N8OA 4DSLA 4RU9A 2D9OA 1KOHA 2AZ1A 4ECTA 3TAMB 1OPZA 5FDLA 5E41A 2GHVC 1B0PA 5IT9Y 3LGNA 1HYSB 3G2XA 4I68A 4XPCA 1HW8A 1OPIA 2HQGA 3D1HA 1YI2S 1FO1A 4JV0A 3CCLS 5F8JA 2ZUGA 2DEIA 4CLLA 3HT3A 3MAHA 2XYPB 5I3UA 4K2JA 3H7HB 2ZH9A 3BQ0A 4B3RF 1TVRB 1SH2A 5DETA 1FDBA 4TXSA 1ULRA 1XBWA 3TAPA 3SQGA 2IBKA 2I1RA 1PBAA 2B9XA 2KJVA 3NWRA 3M2UB 3QSIA 1KTQA 5HK4A 3RBXA 3N0VA 2YWWA 1WD6A 3UI3A 5A2QY 1YITS 4USUA 3A1YG 2X51A 3TA0A 2GMHA 1IWAA 2C28A 1R6YA 2V8GA 1M5PC 3FEYB 4RW9B 4ECSA 1IBLJ 3LP1A 4JI4F 4C11B 3RJMB 1I1GA 1OYEA 4PXBA 2CA9A 3BEGB 4X4NA 4DR1F 2D74B 2R8KA 4M63A 1C4AA 1E6YA 3X1LB 4WXOA 4WYWA 3H4DA 4USWA 1R0AA 2A2DA 1T7PA 2VPXB 4AD6A 1NH8A 3AODA 2BR0A 5ETNA 3MM7A 4OI3A 3GPAA 4WBFA 2H54B 4TQRA 1VGYA 4ZN1A 5DQHA 3CIZA 2R7OA 1NHVA 1DQ8A 2BJ3A 3M6WA 2E44A 2CG8A 4CLTA 2HBZB 4EBDA 3ZTRA 2JEJA 1WACA 5AXMA 4LJMA 2HVEA 2XSJA 4ELTA 3IG1B 4DU8A 1Q4RA 3QO9B 3FEXB 5EUHA 4ENOA 2FLLA 2GX8A 1U47A 4R0JA 2GC8A 1XWLA 5A8WB 4NXNF 4DFMA 1WKKA 1SJ1A 1GTHA 2XMUA 1OSDA 1HWLA 5D0GA 3LUYA 2AJ0A 2W2PP 1TKDA 2YBVA 4FF3A 1S6UA 3I0SB 4NWBA 3HMJG 4PKDB 4U96A 1PAUB 4CWBA 1M90T 1D8YA 1YX2A 2IAJB 4FF1A 4DPWA 4A47A 1E6VA 3SCIE 4UY85 1FX4A 4F25A 2WB1D 5BYRA 2QA2A 4Y28C 2HZAA 2CYYA 1SPBP 2B6AB 2HGMA 1RWWB 4DV4J 4R25A 2ZH8A 1XMQJ 3TP2A 4NI2A 3LGHA 1SKUB 3IAS9 3BGRA 4N41A 5KG5A 3PM9A 1VQ4S 5KG6A 2OELA 5DZ7A 3BKUA 1HARA 1FK9A 1Z4UA 3OR1B 5LM7E 3PHTA 5D0HA 2Z57B 3I0RB 5HLFA 3DLGB 3N5BA 2W1BA 4F2RA 3W60A 1LNQA 4NCGB 2JWNA 2UVVA 1R7IA 1XR7A 2ZH4A 3OXGA 1KKHA 3CJSA 2FJAB 3L09A 1AB8A 2Z2YB 3GYGA 2IA6A 2ZJPQ 2BE7D 2WAQD 1N52B 5B0EA 2UV8G 3UQSA 2H9ZA 3M8PB 1X60A 1FXLA 4IOCQ 1LXNA 1RTDB 1YJ7A 4MT1A 2PA8D 4R0EA 2BX6A 4DX5A 1UAWA 3J7AN 3SYZA 2VKRA 2I5JB 4JYAF 1S0VA 1SBRA 1RT7B 3ZTSA 5B09A 3ETOA 2RKIA 4G65A 1VQ7S 4V19J 2RF2B 1JLCA 1LXJA 3CCJS 3BPDA 3G82B 5E3PA 4C0OC 1RU1A 3EGWB 3EGVA 4MIWA 4DUYF 1HMVB 2W8KA 1HD1A 1FKAF 2FD2A 4L76A 3R97A 4TY8A 4XDCA 3GCXP 2UUCJ 2AU0A 3RR8A 1D8ZA 2HS3A 2M3DA 3ULHA 4M5NA 3EGNA 2AF6A 5ETKA 3CWJA 3KHRA 1JJ4A 2XHWA 1R0BG 4A8MP 4J9VA 1NAQA 2PMWA 5G0RA 2PMZD 3TVZA 3EPGA 5KFLA 3HO1A 5F3ZA 2KVQE 3OVBA 2Q1LA 1HPZB 3DM2B 3LTOA 3QT6A 2UUTA 2ZD1B 3B4MA 2DIVA 4B3SJ 2COLA 2GIFA 3W3SA 3G6ES 3PKMA 2VDIA 1RT4B 3DXSX 2LQ5A 2MGZB 3D6MB 1GMWA 4J9UE 1HYSA 1T0TV 1BC6A 4NCBA 2LA6A 4X4QA 3OVSA 3B6BA 1S1TB 2DNLA 2RQMA 4OV6A 4DL0C 2X1BA 3B82A 4IOAQ 2GZOA 4LR8A 2J0QD 3P45B 3P6YC 2WVDA 4KJIA 3R1LA 1TVRA 3NAHA 2GAGC 5AE3A 4ILLA 1FDDA 2MQQA 3N4WA 2GCFA 2E9ZA 3BKFA 4DSJA 2RQKA 5KG4A 1SJ4P 1UFKA 3BDEA 1U1LA 3M2UA 1VJWA 2XBPA 3MEGB 3ENQA 1RAGB 2KVIA 4KT0C 2C3PA 2FJEB 2LQ9A 3CO0P 1Y5IB 3VALA 2HIYA 3MEDB 2M8HA 4RW9A 1XJWB 3DOKB 3IRXB 5KFHA 4WP8A 2DRDA 5H9FJ 4E98A 1PIEA 4C11A 3M6UA 4GMKA 3BZQA 1U09A 4B9VA 1O0PA 4NRTA 5F8IA 1QE1B 4DSFA 5LXYA 3KMSA 5CYQB 1AYEA 2IYGA
chains in the Genus database with same CATH topology
5EHHA 2JOQA 3M2VB 5L1JA 2FIUA 1ZTWA 2IBOA 2R7SA 3MMBB 4I1TA 1JLEB 2XMJA 1VQ6S 4DQSA 4KC5A 3KLHA 3GMGA 1IKYA 2RRAA 2M0GB 2U1AA 4IQMA 5GAGU 2XS7A 1YQHA 2A3JA 3DRPB 5H9EJ 3TRGA 1KS2A 2JC1A 3K5PA 4WFXA 4DL6A 1X8DA 2AGPA 2DCLA 3OQ2A 2VC1A 3IWNC 4L3NA 2HPUA 2KXFA 4CO3A 5C25B 1HI0P 4LF8F 1IBMF 2DNKA 4LSLA 2OMLA 2MY8A 1GNKA 3SZ2A 4ZDNA 4HTIA 4QPTA 4DPOA 4EBEA 2PI4A 1GX6A 4PG4A 5IT0A 3PFEA 5KFJA 4O0IA 2JFDA 2UVWA 2VB6A 4YY3F 3IA0A 5DDQC 3ITHB 3E8OA 4EBCA 2DD8S 4A4JA 5KFXA 3JSMB 1KSPA 1B64A 2CFXA 4DR4F 2ZBIA 4I56A 3T6JA 4XPEA 2FJWA 4B9UA 4AE5A 5HBMB 3PX6A 1RKJA 1KVIA 2DNGA 2AJFE 2VG7A 3C3LA 1ZYQA 3EXYA 2ZNZA 1M5VC 1DQ9A 4XDDA 1WHXA 4GC7A 4CTAB 1MMDA 1XMOF 5L9XA 3TARA 5L9NA 4RX6A 5J1NA 2YVSA 3KLFA 4IRCA 2PGCA 4GKKF 5DJBA 1NJXA 2RUGA 4LVNP 1QSYA 5LT5A 4P7TA 1RISA 2IM3A 1SV5B 2AJ4A 1X5TA 2MKHA 3HI9A 2DIUA 2GIQA 1Z1ZA 3QGGA 4CQ1A 1TV6B 2B9WA 4ES2A 3LWMA 3UFCX 5J2QB 4C8YA 3VWSA 3F73A 1CC8A 3IG1A 2VFSA 2UZAA 4Q0BA 3PY8A 5F0UA 1UVLA 2ADBA 1WHWA 1O5JA 3DOLA 4ZHRA 1URRA 3LWLA 2G4BA 3QO9A 2KI2A 3S01A 3W2WB 4IOBA 1TL3B 5LMUF 2UVRA 1UVKA 1F60B 3IN5A 2KT2A 5C24B 2V8DA 3KJVB 4KQZA 4H54A 4IR1A 1C4CA 1DHMA 4DFPA 1U25A 2P6SA 1BLUA 4OZ5A 5E3CA 4RW8B 3HZEA 1YG0A 1FJEB 4N5SA 1YJTA 2AGQA 1ZZNA 3GR1A 1U49A 1IJEB 3QIPB 2N7CA 3PX0A 2BQUA 5JUMA 2J7UA 2MXYA 2I8EA 2D7SA 5LSRA 1Y5NB 3MM8A 2EFPA 5HMZA 3KK2B 5THWA 2HQIA 1CG2A 1U1KA 2NZ4A 1EETB 4K4UA 3M8QA 3V5RA 2W7AA 3E2EA 1IM4A 4IFYB 3B78A 4YFUA 3RW6A 3OTBA 3KHGA 1JIHA 4IH7A 4HL9A 1JLBA 4ZPTR 4HVZA 2AQ4A 3MUMP 3MEKA 1X9MA 4PQUB 5IQ6A 3DN9A 3I0SA 1TL1B 4W92B 1HQEA 2WK4A 4DJBA 2AD9A 4O4RA 1RWUA 3VTIA 1KQFB 5H1SV 1M5HA 5GAEU 1T3NA 3RW7A 5KFRA 4LFAF 3V4MA 2GO8A 3KKFA 2HMIA 2J0SD 4K4ZA 2YNHA 3HX9A 1ZPVA 4URQU 4Y6IA 2UXDF 4UQGA 3QJJA 1FRHA 2O1PA 1YIJS 3VQTA 2M5YA 3D0GE 1WI6A 3T1YF 2WSFC 3OVAA 1P1TA 4K2XA 3CCUS 2EK1A 4X64F 3KOAA 1SIWB 2YNGA 4CIOA 2YNIA 4C8KA 3M4XA 3CMES 2HNZA 3DLKA 3M9OB 1S49A 2DNQA 1Y00A 2L9WA 2LKZA 3IS9A 2B3TB 4QOTA 2KH9A 1CQMA 2B6AA 1D0EA 2VL1A 3JAMY 2F40A 2YWKA 1KVJA 4I2PA 1IKVA 1WEYA 5KFQA 2NXUA 1UETA 1ZM2A 3H5UA 3K5MA 4ED8A 5J1EA 2KFZA 2RU9A 3G6VA 4DS4A 4E8UA 2WSCC 3NAIA 2F8EX 2FLNA 2R4FA 4DL4A 1KLMA 2VQEF 1N0UA 3MZIA 5EGYA 2CRLA 4NYPA 3RRHA 1RTHA 1C1CA 1MWZA 4HTJA 1PGZA 3BDPA 3HHLB 3OTDA 1DAXA 3DRRB 3TYTA 3E01A 1X4BA 2Z2MA 3G8QA 3H98A 4N77A 3RYLA 4I64A 4NPOA 2K1RA 2VOOA 2ZHOA 2UVUA 4C7QA 1S6QA 1Y3JA 2WOMB 4ZA1A 4NLWA 1X0FA 4C9DA 5D4OA 2C3YA 1FNXH 1FRKA 2JH3A 3VF0B 1A7GE 3MM6A 3C6UB 1VIOA 4QIFA 2CDQA 3IWXA 3OR1A 4QYRA 4F4KA 1V3SA 2GO9A 1U6FA 2CJBA 5IQQA 4RUCA 4LSNB 5EDWA 5A8KB 4DR3F 4KHPF 2HNDA 4DN0A 4YP3A 3QJLA 1OIAA 2VFVA 2VFTA 4QWDA 1FHTA 1X4AA 4FXWA 3I0RA 5G4DA 2ZZMA 1F9FA 1PSDA 4M5DA 3KK1A 3GIMA 1C0UA 3ENVA 3PACA 1N56A 1VQ5S 4KGKA 2LDIA 3QIDA 1UJ6A 2MJNA 3UDCA 4DG1B 3CJ3A 4HT5A 4NCGA 4RLEA 3BO3A 1S76D 2KDOA 4A8QA 3LW5C 5DG7A 4OI4A 3CDBA 4DV1F 3DCAA 1HNVB 2X3GA 4B9NA 2E5JA 3I31A 1E6YB 1Q86T 5DLGA 4DFKA 4FPRA 4QPXA 3KLIA 3NLCA 4I6WA 1VC0A 1GX5A 2YH0A 3OV7A 5KG2A 2HS0A 3FFIA 3WBZA 2MQPA 4OI1A 3OXFA 1Q53A 2UUWA 2K7KA 2QV6A 2W9BB 4USJC 1H3DA 5KFCA 1YGYA 1RJJA 4KFBA 2JC0A 2VZ9A 1TK8A 3J81Y 3DHXA 5CHCB 2ZOFA 1JXEA 3K57A 2LECA 1OWXA 3UR3C 1SKSA 1FJ7A 1D3WA 3M8PA 4Q8FA 4NA3A 3QGHA 2J6UA 4NLTA 3S8SA 5ADZA 1RTDA 3N28A 4ERDA 4CO2A 2HS4A 1HD0A 4PG7A 4RW6B 2YKPA 2YQ3A 2YX4A 2EFGA 2BRKA 3BN7A 4NRUA 1HI1A 2V4JB 3CEDA 2E1CA 1C1BB 1CPZA 2L3MA 1W2BR 5KFKA 2DHAA 3NBPA 2ZKUA 4CO4A 4HYKA 2CJKA 1KN6A 2E7WA 1WHVA 1NK9A 3MR6A 1S0NA 2I5JA 2PI5A 3G6YA 5A0YA 5KT6A 2J9EA 2MHEA 3DLEA 4ZVEA 1RT7A 4ETZA 4NX9A 1VOMA 1D9AA 1JMTA 3LANA 4QWBA 4YB1P 1URNA 1MSWD 4IQXA 4ED5A 1UWBB 2DJWA 3BF4A 1RYSA 1S9EB 5AXLA 2JDJA 4DLEA 2VA3A 5EWFA 4MH8A 1BQMB 2RF2A 1Y0HA 2XO7A 4WE1B 3SV3A 1RT3B 2KXNB 3H5YA 1H0HB 2N7YA 2DNHA 2I2YA 4O3RA 4I4BA 1HBNA 2HHSA 1F5BA 1NHUA 1FDAA 3WDOA 1WHYA 2IJFA 2RIJA 4RBVA 3ONQA 3HHEA 4Y2CA 4URSA 1MU2B 1HMVA 1T05A 1ZBTA 2O67A 2KHCA 1FF2A 4OJ3A 3K58A 1SJQA 2KHDA 2Y1IA 3QWPA 5F3TA 2EFVA 5KT4A 4RU2A 4NCAA 1N88A 1YVFA 4QU7A 4OHZA 3K7RA 3M8SA 2K2PA 4MYUA 2B4PA 4QWCA 3PZPA 3MMCA 1S7HA 1VQYA 1CVJA 1A6LA 1HQUA 3MWBA 3OUYA 1LV5A 1Q78A 4I6AA 3BB5A 1T02A 4C3KA 4ZPCA 2XMMA 1YBAA 4YR0A 4KIAA 1KQKA 2YKNB 2YKMB 1SJ3P 4EO6A 1NKBA 2E1MC 5FIIA 2ZDPA 1VQSA 3G8TA 2M52A 4CNZA 1HWKA 1X0PA 5CQGA 2KXHA 3VAIA 1TKXB 5KG1A 5LJ5Y 5L1KA 3FRZA 4BC9A 5KFNA 4F4ZA 4WKRA 4N76A 3N6NA 4DDFA 1SKWA 4LFBF 1RK8A 2EC0A 1HNIB 2QZ8A 4B9TA 4AQYF 1H2VZ 5I3PA 4EZ6A 2Y1RI 3THVA 2IHR1 4NYOA 1F5AA 3HM9A 3CSKA 4CH0S 3IGNA 1ROFA 3GYXB 1GH8A 2LVWA 4J9NA 4PUOB 4PQAA 2KFNA 4WF9Q 2W4PA 1NK8A 2EBGA 3RZAA 1X7VA 2DH8A 1HHSA 3LP0B 1HPZA 2J7WA 2D1CA 3FNNA 4MKAA 1KD1T 3H4BA 5I3QA 1BD6A 1H7XA 2LXUA 2ZD1A 3MOJB 4JI6F 4AFFA 3V6DB 3EPIA 4C8LA <