1Q82P

Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
115
structure length
115
Chain Sequence
b'SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1q82P00
3CCSO 1M1KP 1YJNL 3G71O 3CCRL 1VQ8L 1KD1P 3G6EL 3CCLO 1K8AM 1VQLO 1Q81M 3CC2O 3CMAL 3CCEL 1KC8M 3CMEL 1Q86P 1VQ4L 3G4SL 1KQSN 1Q7YM 2QEXO 1QVFK 3CC7O 1VQ6L 1Q82M 1YHQO 1S72L 3CPWN 1M90M 1YI2L 2QA4O 1KD1M 3I55O 3CCML 3CD6L 3CCJL 3CCUO 3CMAO 1YITL 3CCVO 1Q86M 1YIJL 1W2BN 3CXCK 2OTLL 3CC4L 1YJ9O 1K73P 3CCQO 1VQKL 3I56L 1YI2O 1VQ7O 1VQ5L 2OTJL 1M1KM 1YJNO 1NJIP 1K9MP 3CCRO 1VQ8O 1VQML 1YJWL 1VQ9L 1VQNL 1JJ2K 3G6EO 1N8RP 1QVFN 3CCSL 1QVGK 3CCEO 3CMEO 3G71L 1VQ4O 3G4SO 3CCLL 1K8AP 1VQOL 1VQ6O 1S72O 1KC8P 3OW2K 2QEXL 1YJWO 1Q7YP 1VQNO 1VQPL 1N8RM 3CCMO 3CC7L 3CD6O 3CCJO 1YHQL 3CXCN 1Q82P 1YITO 1KQSK 1M90P 2QA4L 3I55L 3OW2N 1YIJO 3CC4O 2OTLO 3CPWK 1K73M 3CCUL 1VQOO 3CCVL 1VQKO 3I56O 1VQLL 1VQPO 1Q81P 1VQ5O 3CC2L 2OTJO 1YJ9L 1JJ2N 3CCQL 1NJIM 1K9MM 1QVGN 1VQMO 1W2BK 1VQ9O 1VQ7L
chains in the Genus database with same CATH superfamily
3CCSO 1M1KP 1YJNL 3G71O 3CCRL 1VQ8L 1KD1P 3G6EL 3CCLO 1K8AM 5DS6A 1VQLO 1Q81M 3CC2O 3CMAL 3CCEL 1KC8M 3CMEL 1Q86P 1VQ4L 3G4SL 1KQSN 1Q7YM 2QEXO 1QVFK 3CC7O 5DS5A 1VQ6L 1Q82M 1YHQO 1S72L 3CPWN 1M90M 1YI2L 2QA4O 1KD1M 3I55O 3CCML 3CD6L 3CCJL 3CCUO 3CMAO 1YITL 3CCVO 1Q86M 1YIJL 4QDLA 1W2BN 3GODA 3CXCK 2OTLL 3CC4L 1YJ9O 1K73P 3CCQO 1VQKL 3I56L 1YI2O 1VQ7O 1VQ5L 2OTJL 1M1KM 4XTKA 5FCLA 1YJNO 1NJIP 1K9MP 3CCRO 4W8KA 4P6IC 1VQ8O 1VQML 1YJWL 1VQ9L 1VQNL 1JJ2K 3G6EO 1N8RP 1QVFN 3CCSL 1QVGK 3CCEO 3CMEO 3G71L 1VQ4O 3G4SO 3CCLL 1K8AP 1VQOL 5DQTA 1VQ6O 1S72O 1KC8P 3OW2K 2QEXL 1YJWO 1Q7YP 1VQNO 5DS4A 1VQPL 1N8RM 3CCMO 3CC7L 3CD6O 3CCJO 1YHQL 3CXCN 1Q82P 1YITO 5DLJA 1KQSK 3NKDA 1M90P 2QA4L 3I55L 3OW2N 1YIJO 3CC4O 2OTLO 3CPWK 1K73M 2YZSA 3CCUL 1VQOO 3CCVL 1VQKO 4WJ0A 3I56O 1VQLL 1VQPO 1Q81P 1VQ5O 3CC2L 2OTJO 4N06A 1YJ9L 1JJ2N 5DQZA 3CCQL 1NJIM 1K9MM 1QVGN 1VQMO 1W2BK 1VQ9O 1VQ7L
chains in the Genus database with same CATH topology
3CCSO 1M1KP 1YJNL 3G71O 3CCRL 1VQ8L 1KD1P 3G6EL 3CCLO 1K8AM 5DS6A 1VQLO 1Q81M 3CC2O 3CMAL 3CCEL 1KC8M 3CMEL 1Q86P 1VQ4L 3G4SL 1KQSN 1Q7YM 2QEXO 1QVFK 3CC7O 5DS5A 1VQ6L 1Q82M 1YHQO 1S72L 3CPWN 1M90M 1YI2L 2QA4O 1KD1M 3I55O 3CCML 3CD6L 3CCJL 3CCUO 3CMAO 1YITL 3CCVO 1Q86M 1YIJL 4QDLA 1W2BN 3GODA 3CXCK 2OTLL 3CC4L 1YJ9O 1K73P 3CCQO 1VQKL 3I56L 1YI2O 1VQ7O 1VQ5L 2OTJL 1M1KM 4XTKA 5FCLA 1YJNO 1NJIP 1K9MP 3CCRO 4W8KA 4P6IC 1VQ8O 1VQML 1YJWL 1VQ9L 1VQNL 1JJ2K 3G6EO 1N8RP 1QVFN 3CCSL 1QVGK 3CCEO 3CMEO 3G71L 1VQ4O 3G4SO 3CCLL 1K8AP 1VQOL 5DQTA 1VQ6O 1S72O 1KC8P 3OW2K 2QEXL 1YJWO 1Q7YP 1VQNO 5DS4A 1VQPL 1N8RM 3CCMO 3CC7L 3CD6O 3CCJO 1YHQL 3CXCN 1Q82P 1YITO 5DLJA 1KQSK 3NKDA 1M90P 2QA4L 3I55L 3OW2N 1YIJO 3CC4O 2OTLO 3CPWK 1K73M 2YZSA 3CCUL 1VQOO 3CCVL 1VQKO 4WJ0A 3I56O 1VQLL 1VQPO 1Q81P 1VQ5O 3CC2L 2OTJO 4N06A 1YJ9L 1JJ2N 5DQZA 3CCQL 1NJIM 1K9MM 1QVGN 1VQMO 1W2BK 1VQ9O 1VQ7L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCS O;  1M1K P;  1YJN L;  3G71 O;  3CCR L;  1VQ8 L;  1KD1 P;  3G6E L;  3CCL O;  1K8A M;  1VQL O;  1Q81 M;  3CC2 O;  3CMA L;  3CCE L;  1KC8 M;  3CME L;  1Q86 P;  1VQ4 L;  3G4S L;  1KQS N;  1Q7Y M;  2QEX O;  1QVF K;  3CC7 O;  1VQ6 L;  1Q82 M;  1YHQ O;  1S72 L;  3CPW N;  1M90 M;  1YI2 L;  2QA4 O;  1KD1 M;  3I55 O;  3CCM L;  3CD6 L;  3CCJ L;  3CCU O;  3CMA O;  1YIT L;  3CCV O;  1Q86 M;  1YIJ L;  1W2B N;  3CXC K;  2OTL L;  3CC4 L;  1YJ9 O;  1K73 P;  3CCQ O;  1VQK L;  3I56 L;  1YI2 O;  1VQ7 O;  1VQ5 L;  2OTJ L;  1M1K M;  1YJN O;  1NJI P;  1K9M P;  3CCR O;  1VQ8 O;  1VQM L;  1YJW L;  1VQ9 L;  1VQN L;  1JJ2 K;  3G6E O;  1N8R P;  1QVF N;  3CCS L;  1QVG K;  3CCE O;  3CME O;  3G71 L;  1VQ4 O;  3G4S O;  3CCL L;  1K8A P;  1VQO L;  1VQ6 O;  1S72 O;  1KC8 P;  3OW2 K;  2QEX L;  1YJW O;  1Q7Y P;  1VQN O;  1VQP L;  1N8R M;  3CCM O;  3CC7 L;  3CD6 O;  3CCJ O;  1YHQ L;  3CXC N;  1Q82 P;  1YIT O;  1KQS K;  1M90 P;  2QA4 L;  3I55 L;  3OW2 N;  1YIJ O;  3CC4 O;  2OTL O;  3CPW K;  1K73 M;  3CCU L;  1VQO O;  3CCV L;  1VQK O;  3I56 O;  1VQL L;  1VQP O;  1Q81 P;  1VQ5 O;  3CC2 L;  2OTJ O;  1YJ9 L;  1JJ2 N;  3CCQ L;  1NJI M;  1K9M M;  1QVG N;  1VQM O;  1W2B K;  1VQ9 O;  1VQ7 L; 
#chains in the Genus database with same CATH topology
 3CCS O;  1M1K P;  1YJN L;  3G71 O;  3CCR L;  1VQ8 L;  1KD1 P;  3G6E L;  3CCL O;  1K8A M;  5DS6 A;  1VQL O;  1Q81 M;  3CC2 O;  3CMA L;  3CCE L;  1KC8 M;  3CME L;  1Q86 P;  1VQ4 L;  3G4S L;  1KQS N;  1Q7Y M;  2QEX O;  1QVF K;  3CC7 O;  5DS5 A;  1VQ6 L;  1Q82 M;  1YHQ O;  1S72 L;  3CPW N;  1M90 M;  1YI2 L;  2QA4 O;  1KD1 M;  3I55 O;  3CCM L;  3CD6 L;  3CCJ L;  3CCU O;  3CMA O;  1YIT L;  3CCV O;  1Q86 M;  1YIJ L;  4QDL A;  1W2B N;  3GOD A;  3CXC K;  2OTL L;  3CC4 L;  1YJ9 O;  1K73 P;  3CCQ O;  1VQK L;  3I56 L;  1YI2 O;  1VQ7 O;  1VQ5 L;  2OTJ L;  1M1K M;  4XTK A;  5FCL A;  1YJN O;  1NJI P;  1K9M P;  3CCR O;  4W8K A;  4P6I C;  1VQ8 O;  1VQM L;  1YJW L;  1VQ9 L;  1VQN L;  1JJ2 K;  3G6E O;  1N8R P;  1QVF N;  3CCS L;  1QVG K;  3CCE O;  3CME O;  3G71 L;  1VQ4 O;  3G4S O;  3CCL L;  1K8A P;  1VQO L;  5DQT A;  1VQ6 O;  1S72 O;  1KC8 P;  3OW2 K;  2QEX L;  1YJW O;  1Q7Y P;  1VQN O;  5DS4 A;  1VQP L;  1N8R M;  3CCM O;  3CC7 L;  3CD6 O;  3CCJ O;  1YHQ L;  3CXC N;  1Q82 P;  1YIT O;  5DLJ A;  1KQS K;  3NKD A;  1M90 P;  2QA4 L;  3I55 L;  3OW2 N;  1YIJ O;  3CC4 O;  2OTL O;  3CPW K;  1K73 M;  2YZS A;  3CCU L;  1VQO O;  3CCV L;  1VQK O;  4WJ0 A;  3I56 O;  1VQL L;  1VQP O;  1Q81 P;  1VQ5 O;  3CC2 L;  2OTJ O;  4N06 A;  1YJ9 L;  1JJ2 N;  5DQZ A;  3CCQ L;  1NJI M;  1K9M M;  1QVG N;  1VQM O;  1W2B K;  1VQ9 O;  1VQ7 L; 
#chains in the Genus database with same CATH homology
 3CCS O;  1M1K P;  1YJN L;  3G71 O;  3CCR L;  1VQ8 L;  1KD1 P;  3G6E L;  3CCL O;  1K8A M;  5DS6 A;  1VQL O;  1Q81 M;  3CC2 O;  3CMA L;  3CCE L;  1KC8 M;  3CME L;  1Q86 P;  1VQ4 L;  3G4S L;  1KQS N;  1Q7Y M;  2QEX O;  1QVF K;  3CC7 O;  5DS5 A;  1VQ6 L;  1Q82 M;  1YHQ O;  1S72 L;  3CPW N;  1M90 M;  1YI2 L;  2QA4 O;  1KD1 M;  3I55 O;  3CCM L;  3CD6 L;  3CCJ L;  3CCU O;  3CMA O;  1YIT L;  3CCV O;  1Q86 M;  1YIJ L;  4QDL A;  1W2B N;  3GOD A;  3CXC K;  2OTL L;  3CC4 L;  1YJ9 O;  1K73 P;  3CCQ O;  1VQK L;  3I56 L;  1YI2 O;  1VQ7 O;  1VQ5 L;  2OTJ L;  1M1K M;  4XTK A;  5FCL A;  1YJN O;  1NJI P;  1K9M P;  3CCR O;  4W8K A;  4P6I C;  1VQ8 O;  1VQM L;  1YJW L;  1VQ9 L;  1VQN L;  1JJ2 K;  3G6E O;  1N8R P;  1QVF N;  3CCS L;  1QVG K;  3CCE O;  3CME O;  3G71 L;  1VQ4 O;  3G4S O;  3CCL L;  1K8A P;  1VQO L;  5DQT A;  1VQ6 O;  1S72 O;  1KC8 P;  3OW2 K;  2QEX L;  1YJW O;  1Q7Y P;  1VQN O;  5DS4 A;  1VQP L;  1N8R M;  3CCM O;  3CC7 L;  3CD6 O;  3CCJ O;  1YHQ L;  3CXC N;  1Q82 P;  1YIT O;  5DLJ A;  1KQS K;  3NKD A;  1M90 P;  2QA4 L;  3I55 L;  3OW2 N;  1YIJ O;  3CC4 O;  2OTL O;  3CPW K;  1K73 M;  2YZS A;  3CCU L;  1VQO O;  3CCV L;  1VQK O;  4WJ0 A;  3I56 O;  1VQL L;  1VQP O;  1Q81 P;  1VQ5 O;  3CC2 L;  2OTJ O;  4N06 A;  1YJ9 L;  1JJ2 N;  5DQZ A;  3CCQ L;  1NJI M;  1K9M M;  1QVG N;  1VQM O;  1W2B K;  1VQ9 O;  1VQ7 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...