1Q82Q

Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 49
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1q82Q03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1q82Q01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1q82Q02
2OTJP 2QEXP 1QVGO 3CXCO 2QA4P 3CD6P 1KD1Q 3CC4P 3CCLP 1S72P 1YIJP 1JJ2O 3CCSP 1Q86Q 1VQ4P 1VQ6P 3CCQP 3CMEP 1VQLP 3G4SP 1N8RQ 3CCUP 2OTLP 3CPWO 1K73Q 1KQSO 3CCMP 1K8AQ 1VQMP 1YHQP 3CCEP 1Q7YQ 1YJNP 1NJIQ 3I55P 1KC8Q 1VQ8P 1VQNP 1M90Q 1YJWP 3I56P 3CC7P 3CMAP 1VQPP 1M1KQ 1Q81Q 1VQ9P 1VQ7P 3CC2P 1Q82Q 1W2BO 1K9MQ 1QVFO 1VQOP 1VQ5P 1YI2P 3CCRP 3G6EP 3G71P 3CCVP 3CCJP 3OW2O 1YITP 1VQKP 1YJ9P
chains in the Genus database with same CATH superfamily
4WY4B 2IBZE 2K9YA 3DPHA 3IR9A 4H13B 2QJPC 1VQPP 3GHGC 1KYOI 1L4AD 2W6AA 2W83C 2JAZA 3R4YA 2B88A 3H1HJ 2P10A 2FYUG 2KG6A 1SLQA 1OMIA 3H1HG 2Q1KA 1QL2A 2WVRA 3CXCO 2FYUD 5HVCA 2J5UA 1SQXJ 5KLVJ 3G28A 4DG9A 4KHXA 4N78D 3TNUB 3V2PA 1KILA 2KK7A 1A02J 2MF4A 3JCUE 4ASVA 3M91A 2FKWB 1KQFB 2GUVA 5KP8B 1NO4A 4U3FG 3HYBA 2ZAEB 4BPGA 2R3SA 1NTKE 1NTMD 1OVRA 4PD4E 2KSEA 3AE4C 3MZWB 1VQ7P 1JB0J 3L74G 2N6ZA 4GR2A 3P8CD 3FXDA 1LTSC 3Q5SA 1ZLLA 1GMJA 2KS1B 4TLFA 3B5ND 1LGHB 2FXPA 2KLVA 3CCLP 2Y9YA 3H1JJ 5APXA 2WITA 3M0DA 3FX0A 2HLOA 3H1JD 1RNIA 2KXPB 2N9BA 4R0MA 1NU1J 3PH0A 3L71G 1FDIA 4I1LA 4GOFA 3CCVP 1P84H 2DW3A 2XDJA 4GT1A 4PD4H 1JM0A 5B5EH 3H4EA 1FZFA 1VF5B 1X3OA 3M1MA 2P58A 5HGMA 5GTIH 3HZQA 5K5GB 1Z6MA 2JEEA 1RE4A 4XROA 3R2PA 2FBWC 2MR7A 5KLIB 3GLMA 3W67A 4PH0A 1LTAC 1HGZA 3AEEC 1RF0C 5KP6B 1M1KQ 2KODA 2R5DA 4NPDA 2IBZI 1GXHA 1U57A 2O3JA 5E79H 2IBZD 2MR8A 2QEXP 1DIPA 4PD4D 4GODA 4JQ0D 3HUSA 2JYGA 3JSVC 1BCCG 1SQXE 1OW7A 2GUSA 3WUTA 3I55P 3KHUA 1VF5D 2FYZA 2WQYC 5AVQB 2NRGA 1JMBA 3SWFA 1R5LA 2XU6A 1JY2O 2E1MA 2FXMA 1CSBA 2WSSH 1EZVG 4EIJA 1LP1A 1QL1A 3G4SP 2QE7H 1SFCD 3VP8A 4HKGA 2NO8A 2C9LY 2GYKA 1FBMA 1J1DB 1FU1A 1L0LJ 5APUA 1ZMEC 2PGDA 1NYHA 2KOPA 1FDOA 3WBHA 2NPSD 3EWKA 3U1AA 1AV1A 1GU5A 4JYCA 1J1EB 1E0HA 4D6TG 1URQD 4PV1D 3D71A 2WSEH 1YJ9P 3A0HH 2KOSA 3H1IE 4KT0J 1JTHB 3A3YB 3DS0A 2XKMA 4OGQB 1JUNA 2IBZG 3AE2C 5CCGA 2FQ2A 3BCCE 1LT1A 2LKMA 2CK3H 4M3LA 4YXWH 2PENA 2K37A 3HE4A 3CXHH 2QM7A 5KJ7D 2FYUE 2DGYA 1BGYD 1MV8A 3TGUD 3H1HE 4QNBA 2KLUA 4U3FJ 2LKIA 4WY4D 2YKQA 1ZR4A 2OYIA 1OIPA 3RL0g 2FACA 1N2DC 1PFIA 2OTKE 2AXTH 2Y0DA 4GOEA 2P1JA 3EJEA 3FXEA 4U3FE 1M6NA 1X8YA 2KB7P 1NTKG 1JEKA 2ZVOB 3U43A 1E6JP 2BHVA 4H44D 2QJYC 1AUMA 2PEJA 4OGQC 1KB9I 3G71P 1RQUA 1OZHA 2B87A 2WPRA 3CX5E 2FAEA 2Z5IA 4CPGA 2LOLA 2HG5D 1S4XA 1SQBJ 3DTJA 1GXGA 4L73A 5F2KA 1RHZB 3H1JE 2JWDA 1LTBC 2KOOA 2E74D 1K9MQ 3AE8C 1AF8A 3CCJP 2NZ2A 1RO2A 3GHGB 5KJ7A 1KQGB 2EHSA 3L71E 3OA7A 1S1CX 5AW8B 4A7PA 5AVXB 1JCCA 2AXCA 5CJ0A 2P7JA 1PGQA 3B5NB 2K1AA 2KP8A 4H2XC 1KYOE 3P7KA 2N50A 3GZLA 4W7ZA 2FYUK 3W68A 1DEBA 1Y9BA 1FOSF 1P84E 4DOJA 1BAJA 1FR2A 1NTKD 1MUUA 5KP7B 1DEEG 3HD7B 4ZKPA 1SVFA 4XFJA 1LTIC 2MVUA 3IN6A 2QJYB 4PWVB 1M1JB 2N1TB 1KILB 1G2CA 4LLHA 1YBKA 2OYHA 1KILD 1SQVE 2AF8A 4Y99C 2KI7B 4IZ6A 5AVUB 2KORA 1SQXD 3H1KD 5AW6B 1N7SC 4XFYA 2L91A 1U7JA 2L6EA 1BSNA 1VQ4P 4EDFA 1BCCE 1SFCB 3EFGA 1RE4C 3CMAP 1ZW0A 1L0NJ 1SQXK 2E5TA 3H1KE 1SQBD 1PPJD 3RK3C 3DS4A 4IOIH 2NPSC 1NTZD 1JJ2O 1NGMB 3B5NA 5BU8B 5AW9B 4H0LB 4C7NA 3M06A 1W2BO 1PP9J 3CXHE 1IFNA 3GMAA 3HD7A 3H1LG 2NPSA 2PY8A 3CC4P 1GK6A 2R5BA 3CMEP 1D1DA 1M7LA 4U7JA 3P05A 1KC8Q 1G1IA 2VLQA 1X9VA 3L72E 4DZOA 3M9QA 3MGEA 1KFNA 5APVA 1D7MA 4HB1A 1IMPA 2RKLA 4EYYQ 1JOCA 3H1IG 1VQLP 3OJAB 1SQQD 1KORA 1EOQA 4MRTC 3CCEP 3BVHA 1GW3A 3L72J 1EQ7A 2E75D 1VQ9P 1PEUA 2E5YA 2A06G 2IZ1A 3BCCG 2FYNC 3H32A 2K92A 1M1JC 1ZXGA 3VRLC 4M0IA 4RKUJ 4IFDK 1KB9H 2VLPA 3SSUA 5AW4B 2JU2A 3IFMA 1ZRTE 3B71A 2FADA 3JC22 3V2NA 3PRJA 1FZCC 1IFJA 3F89A 3EJBA 1H0TB 2MKVA 2N5IA 3VMXA 3A5TA 3MTUE 2ZT9B 1BE3D 2L4BA 5HGNA 1IUQA 3WU2H 5KAFH 1LWUA 3L70J 2V7QJ 1BDDA 3C1LA 3D6YA 1S3JA 2R44A 3S1KA 1MFZA 2JB0A 3VTPC 2KZJA 4GIFA 5KKZC 2JJLA 3TSIA 5CBOA 3I5CA 1K30A 2IYOA 5AVRB 2CPBA 3MHVA 4PD4I 1DD4A 1L0NG 2AXTE 3H1JG 4QMAA 3O6QB 4GDOA 4GKGA 1OVVA 7CEIA 2E43A 1GL2C 1IFIA 4U0AA 5KAFE 3G29A 1UNKA 1JCDA 1EDLA 4MN4C 3CCUP 3CXHI 1SQPE 2XNXA 2BCCE 1NHLA 1Q81Q 1AJYA 1GW4A 2WSEJ 1S5LH 3AE7C 2JR8A 1OR5A 1FS0E 3KDPB 3H25A 2XV6A 3RG2A 5KTBA 1N7SB 2EFJA 3B4QA 3A0BE 5BS2A 1NKZB 1LTTC 2P9XA 1SQQE 2QG4A 2R32A 4YPCA 2JO0A 3RK3B 1SQVG 3L75J 2LXBA 4BPFA 2X2BA 2ZYGA 3H1LD 1ZOYC 1P84D 1VKUA 5F2NA 4WBAA 2KG9A 2L0QA 2KUBA 1JY3N 2AEMA 1LTJC 1VQKP 1IJDB 1VPCA 2ZXXA 2M8PA 3H1KG 2VLOA 4K35A 2KIKA 3CL3D 2KW2A 3CLQA 3KQGA 3SWYA 1PGPA 1PV3A 3H1KJ 1YYCA 3CCSP 1GU4A 5KLVK 2LF4A 1X22A 4N6JA 1J2JB 2FVAA 3PLNA 3L73D 2J59M 3G0VA 1NAYA 1OW8A 2L22A 5KAIH 3G6EP 2Q5UA 3VMAA 3MIWA 1NH4A 5JPAA 1Z56A 5C39A 5DJUB 3H1LE 3LIEA 3AEBC 1VQMP 3TNUA 2O1KA 1FZBA 2D2CD 4Y28J 1N73C 3S9OA 1UJZA 2GZJA 1KZUB 3KZIE 4ZNCA 2Y9ZA 3L72G 1DNYA 2WSFJ 1IC2A 3HUSC 2BEQD 3TDKA 3H1ID 2QNWA 1KYOD 2OYIC 2H8PD 4H13C 2K9JB 4R4LA 2N1TA 2BQ1E 3TF5A 2O01J 1GK4A 1LTJB 2KNCA 2MD9A 2G3AA 2B9BA 2M8NA 2E74C 3AEGC 1NTKJ 2N5HA 1VF5C 1M56D 2A06E 1OW6A 1ZRTD 4RO0A 3KZIH 2N6YA 1H8AA 4H0LD 5CBNA 1QEXA 1LWUB 1N8RQ 3H1HD 1JTHA 1L4AB 5AW0B 2YO2A 5CJ4A 1IFPA 2C0XA 2M5AB 1M1JA 2QJKC 4DJGA 1T3UA 1HUCA 2ITAA 3VMYA 3KYQA 3RK2C 2OTJP 4NPEA 1KMIZ 2M8RA 1EDJA 1FC2C 3P32A 1FAVA 2JU1A 1AVYA 2QSIA 1CEIA 1IO4A 1RE3C 4N78E 2CG5B 3SFEC 2B87B 3NY7B 3V2RA 3FGAD 1XTGB 2FFDB 2CNRA 2E76B 2WPSA 4O9BA 2IFMA 4PH1A 1RF0A 2N1TD 3RL0C 3IAOA 3QH9A 2JWAA 1M57D 1AA0A 2L9FA 1IMQA 3VYIA 1LT9A 4ZMDA 5APTA 1T8ZA 1BGYE 1Q90D 2WPTA 1BE3E 2K0XA 1BCCJ 5CCGC 3OW2O 5CCHC 1L0NE 3E1RA 4B86A 5KKZB 3Q1MA 3HUSB 3CX5I 5AW5B 3H1LJ 2I1JA 3L74D 4I6MC 2YXQB 5DJTB 4UB8H 2L5GB 3C9IA 1SQPG 2LL8A 2BCCG 5AW3B 2LIWA 1YITP 1BCCD 3V4QA 2LXCB 4PV1B 3WMM0 3BATA 1K73Q 4AQRD 1Y47A 4NPFX 2K94A 2Q3IA 1Q2NA 2KR5A 1NOHA 4D6TD 3BRTB 3NFQA 2M0BA 3A7OA 5KAIE 1TU3F 2EG5A 2ZYAA 2FXOA 2YXRB 2YKOA 2YKPA 1T8KA 1H89A 1SQQG 2OYHC 3HD7C 5AW2B 4PJ0H 2HFED 1MKMA 2WWWA 5EJDA 3L73J 2JO1A 1SQVD 3CWBD 5H2FH 2PEOA 5TISH 3UIAA 2K0DX 3MUDA 1FZAA 1L0LD 1YTZT 2WPQA 2HODB 3TYYA 5CCHA 4OWFA 2IFNA 4TT3H 3V6IA 2I8DA 2LTEA 4DT0A 5BVZA 2KGCA 1JY3P 3CCQP 1X0TA 5AVWB 3DS1A 3G26A 1WT6A 4OVNF 3RBXA 1IZNB 1NU1G 3PJSK 2WT7A 4H44C 2K5XA 2A45H 1MZ9A 2O1JA 4EI2A 4W80A 2O01H 2UWJE 3Q3DA 2YMKA 3BCCJ 4HJGH 3B8EB 1H0TA 3CXHD 2WSCH 5KLVE 1K05A 1EZVI 2RN0A 4GR6A 1RF1B 1GZLA 2GM4A 1JO5A 3V2QA 2G8YA 1GL2B 2FFDC 1IK9A 4H0LC 4I7ZC 1RF1C 1FDMA 3S4RA 1NKNA 2YIUB 2ZVNB 1VDFA 2NPSB 2RH0A 3GG2A 1SQBE 2OTLP 3EJDA 5B66H 4WY4A 1JMMA 5TJHA 2M5AA 3TK1A 3OAKA 2BASA 1GDTA 1UIXA 2H88C 1J1EC 3LMOA 2QM8A 2HODA 1OXZA 2D2CC 3GF3A 5BS1A 3CWBJ 2ZYDA 1BSHA 5KJ7C 3L4FA 2IPPA 1GL2A 3H0DA 1DX7A 1WRGA 2K88A 4W7YA 3AE9C 3L74J 1T6AA 1LJ2A 2QJPB 2FVEA 2SPZA 5AVZB 2AFDA 2ZXEB 1G1JA 2OYIB 3T97A 3H32B 2CQ8A 1OWAA 4PV1C 1S9KE 3F5HA 2K93A 5AVYB 2O01N 1K8AQ 3AEFC 3KPEA 4NEOA 5DCKA 1NJIQ 3BCCD 1NTZK 2OQQA 3SWKA 2CWOA 3H6PA 4PJ0E 1SQBK 3PP5A 3RK3D 3G1IA 1T2KD 2ZT9C 3G9RA 1VL2A 1KD1Q 3U59A 2JQ4A 3L72D 2MJZA 4U0DA 5HGOA 3B4SA 3AEDC 1RO0A 4HH2A 4BWNA 3D70A 1YJNP 4WVZA 1AQTA 1MFTA 4D6TJ 2QRXA 2M3EA 2KGDA 2I1KA 5AVTB 1F80D 3Q5PA 1FZCB 1BGYG 1NQ4A 2JGPA 2C0WA 1BE3G 2BEZF 2N9YB 2FYUJ 1BE3J 3L70E 5CMZA 5H2FE 1EZVD 1JNMA 2KNCB 2FHSC 3CCMP 4XA4A 1FOSE 1SQVJ 3L75G 1PP9D 2K3RA 2ONTA 5AVVB 4ZKUA 4H2YC 3WUUA 2VRSA 1URQA 1S5LE 5CHXA 1NTZJ 3HE5B 5HV8A 2FFDA 2GDYA 1KN7A 1ZV8A 1L0ND 5M1BA 1VQOP 1AVOA 2YIUC 2XZRA 4HYTB 4U0EA 1RY3A 1EDIA 1CW5A 2ZJSE 3GJNA 1LWUC 4XFZA 2OGUA 1NTZE 4AYCA 2VSQA 1USDA 1M8OB 1EDKA 2MY5A 3G3ZA 2CGQA 1PP9E 4HKZH 3DS3A 3GF7A 2QVAA 2EIAA 4F37A 1L4AA 5E79E 3CX5H 2AEJA 3II6A 1YQ4C 1R5SA 2WSCJ 4JYBA 4C7RA 1EIAA 1GTWA 3LW5H 2OARA 1SQQJ 1AYIA 1URQC 3AEAC 1N73B 2N98A 1NU1E 1UIIA 2PEIA 1OX3A 4IFMA 1QVGO 4IFFA 1EMVA 3VN0A 2PNGA 1ZN5A 2PRRA 2OYHB 3I56P 2FY8A 1N7SA 5KLVG 1FJPA 2PAJA 1QVFO 2K9JA 3LRYA 1PPJE 4EOTA 2PFXA 4IL6E 1PGOA 2IYPA 1IFMA 3NMDA 3MP7B 1HBWA 2N1TC 4U0BA 1J1DC 4UB6E 4N3YB 1SFCA 2GZGA 1SQBG 1W5CE 3GKLC 1PZQA 1ZR2A 2ERHA 1JY2P 1Q82Q 1SQPD 1N73A 3BASA 3KXDA 1SS1A 3B5NC 2OYOA 1YTZI 4JBZA 4BRYB 3D6ZA 2EHTA 3VOPA 1KILE 1BGYJ 3T97B 4QKOA 3QWOC 1HWTC 2Z46A 3H47A 3L35A 3AE1C 1PL5A 4XFXA 5APYA 4RESB 1LT9C 5AW7B 2BUOA 4JF7A 2JYLA 3CWBE 3RG6C 2W27A 3Q20A 3E2DA 4WB4A 2WPVB 3DS5A 3IF4A 5CCHD 1KV4A 5APQA 2YNYA 1L0HA 2PEMA 2K0YA 5EW5E 2R3CA 1Q7YQ 3TGUJ 1M90Q 4BPHA 3P8MC 4ASWA 3RK3E 1URQB 3L75D 2E76C 1HY8A 2A45G 1WMKA 2D2CB 1SP4A 2GZIA 2M8LA 5TISE 1LNQA 2Q3EA 3RK2B 1KLPA 2QIWA 3Q5RA 3L73E 3L70D 2FVFA 5HGLA 3GZMA 1VQ5P 1USEA 2CPSA 3HD7D 3M0DC 3ABVC 3RL0B 4H2WC 2W90A 3HE4B 3NTNA 5EFWB 1SQPK 2XXMA 1XTCC 4I7ZB 2XZ0D 2W8ZA 2KZIA 4U3FD 1BXIA 3L70G 1K04A 1L2PA 3G1GA 2KYVA 2KOGA 1T2KC 3L75E 1CZQA 3N4XA 4IPYA 2E74B 2KGEA 2P2UA 2KWLA 3MGNA 1KQLA 3U1CA 1X79B 3USSA 1LTJA 1QGKB 2VLNA 1PEOA 4UB6H 1DV5A 2JKVA 2W6BA 4Y99B 2BCCD 4C7NB 1EXJA 2Z5HA 2KS1A 1GL2D 1S2EA 2GDXA 3JCUH 1EXIA 3O6QA 1G2CB 1LT9B 3V5BA 2WTYA 4KJMA 1NTZG 1BDCA 2LR2A 2WSFH 1P84I 2A06D 1YHQP 2PP6A 4COPA 2A45I 2GZFA 5APWA 1PP9G 3GHGA 2ROQA 3M9HA 3NXSA 4UB8E 4LGDE 2HR3A 3EQ2A 1NWQA 2KGAA 1L0LE 1OVUA 2BCCJ 1NTMK 1HTLC 1SQQK 2AVAA 2KOQA 3TGUE 4XE5B 2AFEA 2FYNB 1FZCA 4IL6H 1GPJA 1HF9A 3AE3C 1YQ3C 3HTKA 1JY3O 1RF1A 1L0NK 4WY4C 2W6JH 1PEQA 3L71J 3E1IA 1S72P 1H88A 3MUDC 3LIDA 1ZNVA 4I2LC 2XNDH 4L74A 3SFDC 5KLVD 1CI6A 3L71D 3CC2P 4K3AA 3MD0A 1PIXA 1FJKA 3HE5A 1HJ0A 2Q7CA 1IK7A 4YXDC 2JDIH 1PPJG 3RGUA 3DS2A 2B89A 1PGJA 3AE5C 1JY2N 3CX5D 1VQ8P 3ITKA 1NTME 3A0HE 5F2OA 5AW1B 2ZT9D 2YO3A 2POHA 3PTZA 1ZMBA 2PEQA 3VP9A 4BXLA 1HJBA 1OFCX 1CI6B 1Y8AA 1NTMJ 3FWNA 1L0IA 2Y0EA 2GZEA 2Z45A 4WWIA 3HRNA 2XT1A 2LIUA 2E75B 2IX7C 2HYNA 3CWBG 1QLED 1FE6A 2H7HA 2KSJA 2Y0CA 1RH5B 4U0FA 4U0CA 3RK2D 1SFCC 4L76A 1M74A 1S9KD 2E76D 1KFMA 2DNWA 1KB9E 3BRVB 1E5WA 1NTKK 3E7KA 1L4AC 3CCRP 1QRJA 1AQ5A 1GD2E 3RBZA 3EFFK 2WT7B 2E42A 1ZP0C 1VQ6P 3AE6C 1KYOH 1A8OA 2AEFA 1PEMA 3L74E 2H43A 1NU1D 1HVVA 1YJWP 3FWLA 1ACPA 5I4TG 1N7SD 3P8CE 2P67A 1A43A 1T3JA 1KB9D 2MVVA 3L73G 3AECC 1S5LX 3L37A 5AVSB 2IDBA 2LPKA 1LP1B 1EC5A 3L36A 2LMLA 2WZ7A 4COCA 2RMZA 4YTPC 2K2QA 1RQVA 4Z1MH 3M0AA 3GW6A 5B66E 5GTHH 3V4WA 1W2EA 5KLIC 2V7QH 3A2AA 3WU2E 2GA1A 1N7LA 1A02F 3C8VA 1HGVA 2HPCB 1HQBA 3RL0D 1RE3A 1IFDA 4OGQD 4RJTA 2XV5A 3HTKB 3G21A 1HH0A 2IZ0A 2PEKA 3K5BA 4PXHB 3O8ZA 1LTGC 5CCGD 1Q86Q 2M3BA 3B5IA 2Z44A 3M9BA 1NVOA 2KG8A 3CC7P 5APSA 2FQ0A 1NAFA 1VHNA 2JP3A 1YI2P 1L0LK 2GDWA 3CI9A 2V4HA 4AUWA 1SQXG 2QA4P 3CD6P 2J58A 2QJKB 3A0BH 1NU1K 3N7NA 2E75C 4BRYA 4CA3A 5BU5A 3CPWO 1KQSO 4R4MA 1SQVK 2JBGA 2HPCA 1KTMA 1L0LG 5B5EE 3Q2YA 4C46A 1FZGA 2Q6QA 3TGUG 1EZVE 1FZEA 1DH3A 3WUVA 2FQ1A 3VMZA 3CE7A 1AFOA 3LW5J 2YMYA 3ZDMA 1SQPJ 4H13D 1M6EX 4UHPB 4L75A 4LC1A 2Q9IA 3NTEA 2M5RA 4H44B 5GTIE 2Z4EA 1QX8A 4IL6X 2H89C 1MZ8A 2XZ1C 1YIJP 4JPZB 4XRQA 1DD3A 1E79H 3PHLA 1U7MA 1VQNP 1KILC 4D6TE 2C9NY 1R8EA 3H1IJ 4WYMA 5CZDB 5GTHE 2WMMA 1NTMG 2ZFCA 4OH8B 1N86A 4DCKA 5L8RJ
chains in the Genus database with same CATH topology
2PEKA 1QVGO 2M8LA 5HGNA 1JJ2O 3DPHA 3WBHA 1Q86Q 1IUQA 3B5IA 4U0FA 2Z44A 1N8RQ 2OTLP 1K73Q 3H4EA 3CCMP 3DTJA 4U0CA 5F2KA 2ONTA 5F2NA 3I56P 3CC7P 1VQPP 3M1MA 5HGMA 1M74A 3HZQA 1W2BO 1K9MQ 1QVFO 5HGLA 2EG5A 1VQ5P 1YI2P 3CCRP 3LRYA 1VQKP 3CCJP 1QRJA 1RO2A 1YJ9P 2OTJP 2M8PA 2XXMA 3CXCO 3DS0A 4XROA 2QA4P 3CD6P 2PY8A 3CC4P 1PEQA 1S72P 5BS1A 3CCSP 1VQ6P 4U0BA 3CMEP 1A8OA 3G28A 2LF4A 3CPWO 1KQSO 4PH0A 1D1DA 1PEMA 2PEOA 1K30A 3P05A 1KC8Q 1YJWP 1M1KQ 3G1GA 2KODA 3H0DA 3G0VA 3CC2P 1Q82Q 5I4TG 4IPYA 1VQOP 1A43A 3MGEA 2PENA 3G6EP 4U0EA 1BAJA 4XFZA 4PH1A 3HYBA 5JPAA 2QEXP 1PEOA 2JYGA 4U0AA 2DGYA 2Z46A 3DS2A 3CCQP 3G29A 3H47A 1VQLP 4QNBA 3CCUP 3DS1A 1EOQA 4XFXA 1VQMP 1K8AQ 3CCEP 3G26A 4COCA 5DCKA 1NJIQ 3I55P 1VQ8P 2BUOA 3DS3A 1Q81Q 1VQ9P 1VQ7P 1PEUA 1M6EX 2JYLA 2EIAA 5F2OA 4GR2A 2CWOA 3RG6C 3NTEA 3Q20A 3E2DA 3VRLC 3OW2O 4M0IA 1ZMBA 3G1IA 3DS5A 2E1MA 2PEQA 2XV6A 4XFYA 1KD1Q 3CCLP 2L6EA 1YIJP 1VQ4P 1EIAA 4XRQA 4U0DA 3G4SP 2EFJA 1M6NA 2PEMA 5HGOA 2BQ1E 2OARA 1RO0A 1YHQP 1Q7YQ 1YJNP 4GR6A 4COPA 1VQNP 1M90Q 1E6JP 1RNIA 3CMAP 5BS2A 2BHVA 2M8NA 4WYMA 2Z45A 2P9XA 1AUMA 2PEJA 2PEIA 3G71P 3CCVP 2XT1A 3G21A 1YITP 3DS4A 2JO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTJ P;  2QEX P;  1QVG O;  3CXC O;  2QA4 P;  3CD6 P;  1KD1 Q;  3CC4 P;  3CCL P;  1S72 P;  1YIJ P;  1JJ2 O;  3CCS P;  1Q86 Q;  1VQ4 P;  1VQ6 P;  3CCQ P;  3CME P;  1VQL P;  3G4S P;  1N8R Q;  3CCU P;  2OTL P;  3CPW O;  1K73 Q;  1KQS O;  3CCM P;  1K8A Q;  1VQM P;  1YHQ P;  3CCE P;  1Q7Y Q;  1YJN P;  1NJI Q;  3I55 P;  1KC8 Q;  1VQ8 P;  1VQN P;  1M90 Q;  1YJW P;  3I56 P;  3CC7 P;  3CMA P;  1VQP P;  1M1K Q;  1Q81 Q;  1VQ9 P;  1VQ7 P;  3CC2 P;  1Q82 Q;  1W2B O;  1K9M Q;  1QVF O;  1VQO P;  1VQ5 P;  1YI2 P;  3CCR P;  3G6E P;  3G71 P;  3CCV P;  3CCJ P;  3OW2 O;  1YIT P;  1VQK P;  1YJ9 P; 
#chains in the Genus database with same CATH topology
 4WY4 B;  2IBZ E;  2K9Y A;  3DPH A;  3IR9 A;  4H13 B;  2QJP C;  1VQP P;  3GHG C;  1KYO I;  1L4A D;  2W6A A;  2W83 C;  2JAZ A;  3R4Y A;  2B88 A;  3H1H J;  2P10 A;  2FYU G;  2KG6 A;  1SLQ A;  1OMI A;  3H1H G;  2Q1K A;  1QL2 A;  2WVR A;  3CXC O;  2FYU D;  5HVC A;  2J5U A;  1SQX J;  5KLV J;  3G28 A;  4DG9 A;  4KHX A;  4N78 D;  3TNU B;  3V2P A;  1KIL A;  2KK7 A;  1A02 J;  2MF4 A;  3JCU E;  4ASV A;  3M91 A;  2FKW B;  1KQF B;  2GUV A;  5KP8 B;  1NO4 A;  4U3F G;  3HYB A;  2ZAE B;  4BPG A;  2R3S A;  1NTK E;  1NTM D;  1OVR A;  4PD4 E;  2KSE A;  3AE4 C;  3MZW B;  1VQ7 P;  1JB0 J;  3L74 G;  2N6Z A;  4GR2 A;  3P8C D;  3FXD A;  1LTS C;  3Q5S A;  1ZLL A;  1GMJ A;  2KS1 B;  4TLF A;  3B5N D;  1LGH B;  2FXP A;  2KLV A;  3CCL P;  2Y9Y A;  3H1J J;  5APX A;  2WIT A;  3M0D A;  3FX0 A;  2HLO A;  3H1J D;  1RNI A;  2KXP B;  2N9B A;  4R0M A;  1NU1 J;  3PH0 A;  3L71 G;  1FDI A;  4I1L A;  4GOF A;  3CCV P;  1P84 H;  2DW3 A;  2XDJ A;  4GT1 A;  4PD4 H;  1JM0 A;  5B5E H;  3H4E A;  1FZF A;  1VF5 B;  1X3O A;  3M1M A;  2P58 A;  5HGM A;  5GTI H;  3HZQ A;  5K5G B;  1Z6M A;  2JEE A;  1RE4 A;  4XRO A;  3R2P A;  2FBW C;  2MR7 A;  5KLI B;  3GLM A;  3W67 A;  4PH0 A;  1LTA C;  1HGZ A;  3AEE C;  1RF0 C;  5KP6 B;  1M1K Q;  2KOD A;  2R5D A;  4NPD A;  2IBZ I;  1GXH A;  1U57 A;  2O3J A;  5E79 H;  2IBZ D;  2MR8 A;  2QEX P;  1DIP A;  4PD4 D;  4GOD A;  4JQ0 D;  3HUS A;  2JYG A;  3JSV C;  1BCC G;  1SQX E;  1OW7 A;  2GUS A;  3WUT A;  3I55 P;  3KHU A;  1VF5 D;  2FYZ A;  2WQY C;  5AVQ B;  2NRG A;  1JMB A;  3SWF A;  1R5L A;  2XU6 A;  1JY2 O;  2E1M A;  2FXM A;  1CSB A;  2WSS H;  1EZV G;  4EIJ A;  1LP1 A;  1QL1 A;  3G4S P;  2QE7 H;  1SFC D;  3VP8 A;  4HKG A;  2NO8 A;  2C9L Y;  2GYK A;  1FBM A;  1J1D B;  1FU1 A;  1L0L J;  5APU A;  1ZME C;  2PGD A;  1NYH A;  2KOP A;  1FDO A;  3WBH A;  2NPS D;  3EWK A;  3U1A A;  1AV1 A;  1GU5 A;  4JYC A;  1J1E B;  1E0H A;  4D6T G;  1URQ D;  4PV1 D;  3D71 A;  2WSE H;  1YJ9 P;  3A0H H;  2KOS A;  3H1I E;  4KT0 J;  1JTH B;  3A3Y B;  3DS0 A;  2XKM A;  4OGQ B;  1JUN A;  2IBZ G;  3AE2 C;  5CCG A;  2FQ2 A;  3BCC E;  1LT1 A;  2LKM A;  2CK3 H;  4M3L A;  4YXW H;  2PEN A;  2K37 A;  3HE4 A;  3CXH H;  2QM7 A;  5KJ7 D;  2FYU E;  2DGY A;  1BGY D;  1MV8 A;  3TGU D;  3H1H E;  4QNB A;  2KLU A;  4U3F J;  2LKI A;  4WY4 D;  2YKQ A;  1ZR4 A;  2OYI A;  1OIP A;  3RL0 g;  2FAC A;  1N2D C;  1PFI A;  2OTK E;  2AXT H;  2Y0D A;  4GOE A;  2P1J A;  3EJE A;  3FXE A;  4U3F E;  1M6N A;  1X8Y A;  2KB7 P;  1NTK G;  1JEK A;  2ZVO B;  3U43 A;  1E6J P;  2BHV A;  4H44 D;  2QJY C;  1AUM A;  2PEJ A;  4OGQ C;  1KB9 I;  3G71 P;  1RQU A;  1OZH A;  2B87 A;  2WPR A;  3CX5 E;  2FAE A;  2Z5I A;  4CPG A;  2LOL A;  2HG5 D;  1S4X A;  1SQB J;  3DTJ A;  1GXG A;  4L73 A;  5F2K A;  1RHZ B;  3H1J E;  2JWD A;  1LTB C;  2KOO A;  2E74 D;  1K9M Q;  3AE8 C;  1AF8 A;  3CCJ P;  2NZ2 A;  1RO2 A;  3GHG B;  5KJ7 A;  1KQG B;  2EHS A;  3L71 E;  3OA7 A;  1S1C X;  5AW8 B;  4A7P A;  5AVX B;  1JCC A;  2AXC A;  5CJ0 A;  2P7J A;  1PGQ A;  3B5N B;  2K1A A;  2KP8 A;  4H2X C;  1KYO E;  3P7K A;  2N50 A;  3GZL A;  4W7Z A;  2FYU K;  3W68 A;  1DEB A;  1Y9B A;  1FOS F;  1P84 E;  4DOJ A;  1BAJ A;  1FR2 A;  1NTK D;  1MUU A;  5KP7 B;  1DEE G;  3HD7 B;  4ZKP A;  1SVF A;  4XFJ A;  1LTI C;  2MVU A;  3IN6 A;  2QJY B;  4PWV B;  1M1J B;  2N1T B;  1KIL B;  1G2C A;  4LLH A;  1YBK A;  2OYH A;  1KIL D;  1SQV E;  2AF8 A;  4Y99 C;  2KI7 B;  4IZ6 A;  5AVU B;  2KOR A;  1SQX D;  3H1K D;  5AW6 B;  1N7S C;  4XFY A;  2L91 A;  1U7J A;  2L6E A;  1BSN A;  1VQ4 P;  4EDF A;  1BCC E;  1SFC B;  3EFG A;  1RE4 C;  3CMA P;  1ZW0 A;  1L0N J;  1SQX K;  2E5T A;  3H1K E;  1SQB D;  1PPJ D;  3RK3 C;  3DS4 A;  4IOI H;  2NPS C;  1NTZ D;  1JJ2 O;  1NGM B;  3B5N A;  5BU8 B;  5AW9 B;  4H0L B;  4C7N A;  3M06 A;  1W2B O;  1PP9 J;  3CXH E;  1IFN A;  3GMA A;  3HD7 A;  3H1L G;  2NPS A;  2PY8 A;  3CC4 P;  1GK6 A;  2R5B A;  3CME P;  1D1D A;  1M7L A;  4U7J A;  3P05 A;  1KC8 Q;  1G1I A;  2VLQ A;  1X9V A;  3L72 E;  4DZO A;  3M9Q A;  3MGE A;  1KFN A;  5APV A;  1D7M A;  4HB1 A;  1IMP A;  2RKL A;  4EYY Q;  1JOC A;  3H1I G;  1VQL P;  3OJA B;  1SQQ D;  1KOR A;  1EOQ A;  4MRT C;  3CCE P;  3BVH A;  1GW3 A;  3L72 J;  1EQ7 A;  2E75 D;  1VQ9 P;  1PEU A;  2E5Y A;  2A06 G;  2IZ1 A;  3BCC G;  2FYN C;  3H32 A;  2K92 A;  1M1J C;  1ZXG A;  3VRL C;  4M0I A;  4RKU J;  4IFD K;  1KB9 H;  2VLP A;  3SSU A;  5AW4 B;  2JU2 A;  3IFM A;  1ZRT E;  3B71 A;  2FAD A;  3JC2 2;  3V2N A;  3PRJ A;  1FZC C;  1IFJ A;  3F89 A;  3EJB A;  1H0T B;  2MKV A;  2N5I A;  3VMX A;  3A5T A;  3MTU E;  2ZT9 B;  1BE3 D;  2L4B A;  5HGN A;  1IUQ A;  3WU2 H;  5KAF H;  1LWU A;  3L70 J;  2V7Q J;  1BDD A;  3C1L A;  3D6Y A;  1S3J A;  2R44 A;  3S1K A;  1MFZ A;  2JB0 A;  3VTP C;  2KZJ A;  4GIF A;  5KKZ C;  2JJL A;  3TSI A;  5CBO A;  3I5C A;  1K30 A;  2IYO A;  5AVR B;  2CPB A;  3MHV A;  4PD4 I;  1DD4 A;  1L0N G;  2AXT E;  3H1J G;  4QMA A;  3O6Q B;  4GDO A;  4GKG A;  1OVV A;  7CEI A;  2E43 A;  1GL2 C;  1IFI A;  4U0A A;  5KAF E;  3G29 A;  1UNK A;  1JCD A;  1EDL A;  4MN4 C;  3CCU P;  3CXH I;  1SQP E;  2XNX A;  2BCC E;  1NHL A;  1Q81 Q;  1AJY A;  1GW4 A;  2WSE J;  1S5L H;  3AE7 C;  2JR8 A;  1OR5 A;  1FS0 E;  3KDP B;  3H25 A;  2XV6 A;  3RG2 A;  5KTB A;  1N7S B;  2EFJ A;  3B4Q A;  3A0B E;  5BS2 A;  1NKZ B;  1LTT C;  2P9X A;  1SQQ E;  2QG4 A;  2R32 A;  4YPC A;  2JO0 A;  3RK3 B;  1SQV G;  3L75 J;  2LXB A;  4BPF A;  2X2B A;  2ZYG A;  3H1L D;  1ZOY C;  1P84 D;  1VKU A;  5F2N A;  4WBA A;  2KG9 A;  2L0Q A;  2KUB A;  1JY3 N;  2AEM A;  1LTJ C;  1VQK P;  1IJD B;  1VPC A;  2ZXX A;  2M8P A;  3H1K G;  2VLO A;  4K35 A;  2KIK A;  3CL3 D;  2KW2 A;  3CLQ A;  3KQG A;  3SWY A;  1PGP A;  1PV3 A;  3H1K J;  1YYC A;  3CCS P;  1GU4 A;  5KLV K;  2LF4 A;  1X22 A;  4N6J A;  1J2J B;  2FVA A;  3PLN A;  3L73 D;  2J59 M;  3G0V A;  1NAY A;  1OW8 A;  2L22 A;  5KAI H;  3G6E P;  2Q5U A;  3VMA A;  3MIW A;  1NH4 A;  5JPA A;  1Z56 A;  5C39 A;  5DJU B;  3H1L E;  3LIE A;  3AEB C;  1VQM P;  3TNU A;  2O1K A;  1FZB A;  2D2C D;  4Y28 J;  1N73 C;  3S9O A;  1UJZ A;  2GZJ A;  1KZU B;  3KZI E;  4ZNC A;  2Y9Z A;  3L72 G;  1DNY A;  2WSF J;  1IC2 A;  3HUS C;  2BEQ D;  3TDK A;  3H1I D;  2QNW A;  1KYO D;  2OYI C;  2H8P D;  4H13 C;  2K9J B;  4R4L A;  2N1T A;  2BQ1 E;  3TF5 A;  2O01 J;  1GK4 A;  1LTJ B;  2KNC A;  2MD9 A;  2G3A A;  2B9B A;  2M8N A;  2E74 C;  3AEG C;  1NTK J;  2N5H A;  1VF5 C;  1M56 D;  2A06 E;  1OW6 A;  1ZRT D;  4RO0 A;  3KZI H;  2N6Y A;  1H8A A;  4H0L D;  5CBN A;  1QEX A;  1LWU B;  1N8R Q;  3H1H D;  1JTH A;  1L4A B;  5AW0 B;  2YO2 A;  5CJ4 A;  1IFP A;  2C0X A;  2M5A B;  1M1J A;  2QJK C;  4DJG A;  1T3U A;  1HUC A;  2ITA A;  3VMY A;  3KYQ A;  3RK2 C;  2OTJ P;  4NPE A;  1KMI Z;  2M8R A;  1EDJ A;  1FC2 C;  3P32 A;  1FAV A;  2JU1 A;  1AVY A;  2QSI A;  1CEI A;  1IO4 A;  1RE3 C;  4N78 E;  2CG5 B;  3SFE C;  2B87 B;  3NY7 B;  3V2R A;  3FGA D;  1XTG B;  2FFD B;  2CNR A;  2E76 B;  2WPS A;  4O9B A;  2IFM A;  4PH1 A;  1RF0 A;  2N1T D;  3RL0 C;  3IAO A;  3QH9 A;  2JWA A;  1M57 D;  1AA0 A;  2L9F A;  1IMQ A;  3VYI A;  1LT9 A;  4ZMD A;  5APT A;  1T8Z A;  1BGY E;  1Q90 D;  2WPT A;  1BE3 E;  2K0X A;  1BCC J;  5CCG C;  3OW2 O;  5CCH C;  1L0N E;  3E1R A;  4B86 A;  5KKZ B;  3Q1M A;  3HUS B;  3CX5 I;  5AW5 B;  3H1L J;  2I1J A;  3L74 D;  4I6M C;  2YXQ B;  5DJT B;  4UB8 H;  2L5G B;  3C9I A;  1SQP G;  2LL8 A;  2BCC G;  5AW3 B;  2LIW A;  1YIT P;  1BCC D;  3V4Q A;  2LXC B;  4PV1 B;  3WMM 0;  3BAT A;  1K73 Q;  4AQR D;  1Y47 A;  4NPF X;  2K94 A;  2Q3I A;  1Q2N A;  2KR5 A;  1NOH A;  4D6T D;  3BRT B;  3NFQ A;  2M0B A;  3A7O A;  5KAI E;  1TU3 F;  2EG5 A;  2ZYA A;  2FXO A;  2YXR B;  2YKO A;  2YKP A;  1T8K A;  1H89 A;  1SQQ G;  2OYH C;  3HD7 C;  5AW2 B;  4PJ0 H;  2HFE D;  1MKM A;  2WWW A;  5EJD A;  3L73 J;  2JO1 A;  1SQV D;  3CWB D;  5H2F H;  2PEO A;  5TIS H;  3UIA A;  2K0D X;  3MUD A;  1FZA A;  1L0L D;  1YTZ T;  2WPQ A;  2HOD B;  3TYY A;  5CCH A;  4OWF A;  2IFN A;  4TT3 H;  3V6I A;  2I8D A;  2LTE A;  4DT0 A;  5BVZ A;  2KGC A;  1JY3 P;  3CCQ P;  1X0T A;  5AVW B;  3DS1 A;  3G26 A;  1WT6 A;  4OVN F;  3RBX A;  1IZN B;  1NU1 G;  3PJS K;  2WT7 A;  4H44 C;  2K5X A;  2A45 H;  1MZ9 A;  2O1J A;  4EI2 A;  4W80 A;  2O01 H;  2UWJ E;  3Q3D A;  2YMK A;  3BCC J;  4HJG H;  3B8E B;  1H0T A;  3CXH D;  2WSC H;  5KLV E;  1K05 A;  1EZV I;  2RN0 A;  4GR6 A;  1RF1 B;  1GZL A;  2GM4 A;  1JO5 A;  3V2Q A;  2G8Y A;  1GL2 B;  2FFD C;  1IK9 A;  4H0L C;  4I7Z C;  1RF1 C;  1FDM A;  3S4R A;  1NKN A;  2YIU B;  2ZVN B;  1VDF A;  2NPS B;  2RH0 A;  3GG2 A;  1SQB E;  2OTL P;  3EJD A;  5B66 H;  4WY4 A;  1JMM A;  5TJH A;  2M5A A;  3TK1 A;  3OAK A;  2BAS A;  1GDT A;  1UIX A;  2H88 C;  1J1E C;  3LMO A;  2QM8 A;  2HOD A;  1OXZ A;  2D2C C;  3GF3 A;  5BS1 A;  3CWB J;  2ZYD A;  1BSH A;  5KJ7 C;  3L4F A;  2IPP A;  1GL2 A;  3H0D A;  1DX7 A;  1WRG A;  2K88 A;  4W7Y A;  3AE9 C;  3L74 J;  1T6A A;  1LJ2 A;  2QJP B;  2FVE A;  2SPZ A;  5AVZ B;  2AFD A;  2ZXE B;  1G1J A;  2OYI B;  3T97 A;  3H32 B;  2CQ8 A;  1OWA A;  4PV1 C;  1S9K E;  3F5H A;  2K93 A;  5AVY B;  2O01 N;  1K8A Q;  3AEF C;  3KPE A;  4NEO A;  5DCK A;  1NJI Q;  3BCC D;  1NTZ K;  2OQQ A;  3SWK A;  2CWO A;  3H6P A;  4PJ0 E;  1SQB K;  3PP5 A;  3RK3 D;  3G1I A;  1T2K D;  2ZT9 C;  3G9R A;  1VL2 A;  1KD1 Q;  3U59 A;  2JQ4 A;  3L72 D;  2MJZ A;  4U0D A;  5HGO A;  3B4S A;  3AED C;  1RO0 A;  4HH2 A;  4BWN A;  3D70 A;  1YJN P;  4WVZ A;  1AQT A;  1MFT A;  4D6T J;  2QRX A;  2M3E A;  2KGD A;  2I1K A;  5AVT B;  1F80 D;  3Q5P A;  1FZC B;  1BGY G;  1NQ4 A;  2JGP A;  2C0W A;  1BE3 G;  2BEZ F;  2N9Y B;  2FYU J;  1BE3 J;  3L70 E;  5CMZ A;  5H2F E;  1EZV D;  1JNM A;  2KNC B;  2FHS C;  3CCM P;  4XA4 A;  1FOS E;  1SQV J;  3L75 G;  1PP9 D;  2K3R A;  2ONT A;  5AVV B;  4ZKU A;  4H2Y C;  3WUU A;  2VRS A;  1URQ A;  1S5L E;  5CHX A;  1NTZ J;  3HE5 B;  5HV8 A;  2FFD A;  2GDY A;  1KN7 A;  1ZV8 A;  1L0N D;  5M1B A;  1VQO P;  1AVO A;  2YIU C;  2XZR A;  4HYT B;  4U0E A;  1RY3 A;  1EDI A;  1CW5 A;  2ZJS E;  3GJN A;  1LWU C;  4XFZ A;  2OGU A;  1NTZ E;  4AYC A;  2VSQ A;  1USD A;  1M8O B;  1EDK A;  2MY5 A;  3G3Z A;  2CGQ A;  1PP9 E;  4HKZ H;  3DS3 A;  3GF7 A;  2QVA A;  2EIA A;  4F37 A;  1L4A A;  5E79 E;  3CX5 H;  2AEJ A;  3II6 A;  1YQ4 C;  1R5S A;  2WSC J;  4JYB A;  4C7R A;  1EIA A;  1GTW A;  3LW5 H;  2OAR A;  1SQQ J;  1AYI A;  1URQ C;  3AEA C;  1N73 B;  2N98 A;  1NU1 E;  1UII A;  2PEI A;  1OX3 A;  4IFM A;  1QVG O;  4IFF A;  1EMV A;  3VN0 A;  2PNG A;  1ZN5 A;  2PRR A;  2OYH B;  3I56 P;  2FY8 A;  1N7S A;  5KLV G;  1FJP A;  2PAJ A;  1QVF O;  2K9J A;  3LRY A;  1PPJ E;  4EOT A;  2PFX A;  4IL6 E;  1PGO A;  2IYP A;  1IFM A;  3NMD A;  3MP7 B;  1HBW A;  2N1T C;  4U0B A;  1J1D C;  4UB6 E;  4N3Y B;  1SFC A;  2GZG A;  1SQB G;  1W5C E;  3GKL C;  1PZQ A;  1ZR2 A;  2ERH A;  1JY2 P;  1Q82 Q;  1SQP D;  1N73 A;  3BAS A;  3KXD A;  1SS1 A;  3B5N C;  2OYO A;  1YTZ I;  4JBZ A;  4BRY B;  3D6Z A;  2EHT A;  3VOP A;  1KIL E;  1BGY J;  3T97 B;  4QKO A;  3QWO C;  1HWT C;  2Z46 A;  3H47 A;  3L35 A;  3AE1 C;  1PL5 A;  4XFX A;  5APY A;  4RES B;  1LT9 C;  5AW7 B;  2BUO A;  4JF7 A;  2JYL A;  3CWB E;  3RG6 C;  2W27 A;  3Q20 A;  3E2D A;  4WB4 A;  2WPV B;  3DS5 A;  3IF4 A;  5CCH D;  1KV4 A;  5APQ A;  2YNY A;  1L0H A;  2PEM A;  2K0Y A;  5EW5 E;  2R3C A;  1Q7Y Q;  3TGU J;  1M90 Q;  4BPH A;  3P8M C;  4ASW A;  3RK3 E;  1URQ B;  3L75 D;  2E76 C;  1HY8 A;  2A45 G;  1WMK A;  2D2C B;  1SP4 A;  2GZI A;  2M8L A;  5TIS E;  1LNQ A;  2Q3E A;  3RK2 B;  1KLP A;  2QIW A;  3Q5R A;  3L73 E;  3L70 D;  2FVF A;  5HGL A;  3GZM A;  1VQ5 P;  1USE A;  2CPS A;  3HD7 D;  3M0D C;  3ABV C;  3RL0 B;  4H2W C;  2W90 A;  3HE4 B;  3NTN A;  5EFW B;  1SQP K;  2XXM A;  1XTC C;  4I7Z B;  2XZ0 D;  2W8Z A;  2KZI A;  4U3F D;  1BXI A;  3L70 G;  1K04 A;  1L2P A;  3G1G A;  2KYV A;  2KOG A;  1T2K C;  3L75 E;  1CZQ A;  3N4X A;  4IPY A;  2E74 B;  2KGE A;  2P2U A;  2KWL A;  3MGN A;  1KQL A;  3U1C A;  1X79 B;  3USS A;  1LTJ A;  1QGK B;  2VLN A;  1PEO A;  4UB6 H;  1DV5 A;  2JKV A;  2W6B A;  4Y99 B;  2BCC D;  4C7N B;  1EXJ A;  2Z5H A;  2KS1 A;  1GL2 D;  1S2E A;  2GDX A;  3JCU H;  1EXI A;  3O6Q A;  1G2C B;  1LT9 B;  3V5B A;  2WTY A;  4KJM A;  1NTZ G;  1BDC A;  2LR2 A;  2WSF H;  1P84 I;  2A06 D;  1YHQ P;  2PP6 A;  4COP A;  2A45 I;  2GZF A;  5APW A;  1PP9 G;  3GHG A;  2ROQ A;  3M9H A;  3NXS A;  4UB8 E;  4LGD E;  2HR3 A;  3EQ2 A;  1NWQ A;  2KGA A;  1L0L E;  1OVU A;  2BCC J;  1NTM K;  1HTL C;  1SQQ K;  2AVA A;  2KOQ A;  3TGU E;  4XE5 B;  2AFE A;  2FYN B;  1FZC A;  4IL6 H;  1GPJ A;  1HF9 A;  3AE3 C;  1YQ3 C;  3HTK A;  1JY3 O;  1RF1 A;  1L0N K;  4WY4 C;  2W6J H;  1PEQ A;  3L71 J;  3E1I A;  1S72 P;  1H88 A;  3MUD C;  3LID A;  1ZNV A;  4I2L C;  2XND H;  4L74 A;  3SFD C;  5KLV D;  1CI6 A;  3L71 D;  3CC2 P;  4K3A A;  3MD0 A;  1PIX A;  1FJK A;  3HE5 A;  1HJ0 A;  2Q7C A;  1IK7 A;  4YXD C;  2JDI H;  1PPJ G;  3RGU A;  3DS2 A;  2B89 A;  1PGJ A;  3AE5 C;  1JY2 N;  3CX5 D;  1VQ8 P;  3ITK A;  1NTM E;  3A0H E;  5F2O A;  5AW1 B;  2ZT9 D;  2YO3 A;  2POH A;  3PTZ A;  1ZMB A;  2PEQ A;  3VP9 A;  4BXL A;  1HJB A;  1OFC X;  1CI6 B;  1Y8A A;  1NTM J;  3FWN A;  1L0I A;  2Y0E A;  2GZE A;  2Z45 A;  4WWI A;  3HRN A;  2XT1 A;  2LIU A;  2E75 B;  2IX7 C;  2HYN A;  3CWB G;  1QLE D;  1FE6 A;  2H7H A;  2KSJ A;  2Y0C A;  1RH5 B;  4U0F A;  4U0C A;  3RK2 D;  1SFC C;  4L76 A;  1M74 A;  1S9K D;  2E76 D;  1KFM A;  2DNW A;  1KB9 E;  3BRV B;  1E5W A;  1NTK K;  3E7K A;  1L4A C;  3CCR P;  1QRJ A;  1AQ5 A;  1GD2 E;  3RBZ A;  3EFF K;  2WT7 B;  2E42 A;  1ZP0 C;  1VQ6 P;  3AE6 C;  1KYO H;  1A8O A;  2AEF A;  1PEM A;  3L74 E;  2H43 A;  1NU1 D;  1HVV A;  1YJW P;  3FWL A;  1ACP A;  5I4T G;  1N7S D;  3P8C E;  2P67 A;  1A43 A;  1T3J A;  1KB9 D;  2MVV A;  3L73 G;  3AEC C;  1S5L X;  3L37 A;  5AVS B;  2IDB A;  2LPK A;  1LP1 B;  1EC5 A;  3L36 A;  2LML A;  2WZ7 A;  4COC A;  2RMZ A;  4YTP C;  2K2Q A;  1RQV A;  4Z1M H;  3M0A A;  3GW6 A;  5B66 E;  5GTH H;  3V4W A;  1W2E A;  5KLI C;  2V7Q H;  3A2A A;  3WU2 E;  2GA1 A;  1N7L A;  1A02 F;  3C8V A;  1HGV A;  2HPC B;  1HQB A;  3RL0 D;  1RE3 A;  1IFD A;  4OGQ D;  4RJT A;  2XV5 A;  3HTK B;  3G21 A;  1HH0 A;  2IZ0 A;  2PEK A;  3K5B A;  4PXH B;  3O8Z A;  1LTG C;  5CCG D;  1Q86 Q;  2M3B A;  3B5I A;  2Z44 A;  3M9B A;  1NVO A;  2KG8 A;  3CC7 P;  5APS A;  2FQ0 A;  1NAF A;  1VHN A;  2JP3 A;  1YI2 P;  1L0L K;  2GDW A;  3CI9 A;  2V4H A;  4AUW A;  1SQX G;  2QA4 P;  3CD6 P;  2J58 A;  2QJK B;  3A0B H;  1NU1 K;  3N7N A;  2E75 C;  4BRY A;  4CA3 A;  5BU5 A;  3CPW O;  1KQS O;  4R4M A;  1SQV K;  2JBG A;  2HPC A;  1KTM A;  1L0L G;  5B5E E;  3Q2Y A;  4C46 A;  1FZG A;  2Q6Q A;  3TGU G;  1EZV E;  1FZE A;  1DH3 A;  3WUV A;  2FQ1 A;  3VMZ A;  3CE7 A;  1AFO A;  3LW5 J;  2YMY A;  3ZDM A;  1SQP J;  4H13 D;  1M6E X;  4UHP B;  4L75 A;  4LC1 A;  2Q9I A;  3NTE A;  2M5R A;  4H44 B;  5GTI E;  2Z4E A;  1QX8 A;  4IL6 X;  2H89 C;  1MZ8 A;  2XZ1 C;  1YIJ P;  4JPZ B;  4XRQ A;  1DD3 A;  1E79 H;  3PHL A;  1U7M A;  1VQN P;  1KIL C;  4D6T E;  2C9N Y;  1R8E A;  3H1I J;  4WYM A;  5CZD B;  5GTH E;  2WMM A;  1NTM G;  2ZFC A;  4OH8 B;  1N86 A;  4DCK A;  5L8R J; 
#chains in the Genus database with same CATH homology
 2PEK A;  1QVG O;  2M8L A;  5HGN A;  1JJ2 O;  3DPH A;  3WBH A;  1Q86 Q;  1IUQ A;  3B5I A;  4U0F A;  2Z44 A;  1N8R Q;  2OTL P;  1K73 Q;  3H4E A;  3CCM P;  3DTJ A;  4U0C A;  5F2K A;  2ONT A;  5F2N A;  3I56 P;  3CC7 P;  1VQP P;  3M1M A;  5HGM A;  1M74 A;  3HZQ A;  1W2B O;  1K9M Q;  1QVF O;  5HGL A;  2EG5 A;  1VQ5 P;  1YI2 P;  3CCR P;  3LRY A;  1VQK P;  3CCJ P;  1QRJ A;  1RO2 A;  1YJ9 P;  2OTJ P;  2M8P A;  2XXM A;  3CXC O;  3DS0 A;  4XRO A;  2QA4 P;  3CD6 P;  2PY8 A;  3CC4 P;  1PEQ A;  1S72 P;  5BS1 A;  3CCS P;  1VQ6 P;  4U0B A;  3CME P;  1A8O A;  3G28 A;  2LF4 A;  3CPW O;  1KQS O;  4PH0 A;  1D1D A;  1PEM A;  2PEO A;  1K30 A;  3P05 A;  1KC8 Q;  1YJW P;  1M1K Q;  3G1G A;  2KOD A;  3H0D A;  3G0V A;  3CC2 P;  1Q82 Q;  5I4T G;  4IPY A;  1VQO P;  1A43 A;  3MGE A;  2PEN A;  3G6E P;  4U0E A;  1BAJ A;  4XFZ A;  4PH1 A;  3HYB A;  5JPA A;  2QEX P;  1PEO A;  2JYG A;  4U0A A;  2DGY A;  2Z46 A;  3DS2 A;  3CCQ P;  3G29 A;  3H47 A;  1VQL P;  4QNB A;  3CCU P;  3DS1 A;  1EOQ A;  4XFX A;  1VQM P;  1K8A Q;  3CCE P;  3G26 A;  4COC A;  5DCK A;  1NJI Q;  3I55 P;  1VQ8 P;  2BUO A;  3DS3 A;  1Q81 Q;  1VQ9 P;  1VQ7 P;  1PEU A;  1M6E X;  2JYL A;  2EIA A;  5F2O A;  4GR2 A;  2CWO A;  3RG6 C;  3NTE A;  3Q20 A;  3E2D A;  3VRL C;  3OW2 O;  4M0I A;  1ZMB A;  3G1I A;  3DS5 A;  2E1M A;  2PEQ A;  2XV6 A;  4XFY A;  1KD1 Q;  3CCL P;  2L6E A;  1YIJ P;  1VQ4 P;  1EIA A;  4XRQ A;  4U0D A;  3G4S P;  2EFJ A;  1M6N A;  2PEM A;  5HGO A;  2BQ1 E;  2OAR A;  1RO0 A;  1YHQ P;  1Q7Y Q;  1YJN P;  4GR6 A;  4COP A;  1VQN P;  1M90 Q;  1E6J P;  1RNI A;  3CMA P;  5BS2 A;  2BHV A;  2M8N A;  4WYM A;  2Z45 A;  2P9X A;  1AUM A;  2PEJ A;  2PEI A;  3G71 P;  3CCV P;  2XT1 A;  3G21 A;  1YIT P;  3DS4 A;  2JO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...