1Q82Q

Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
total genus 49
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1q82Q03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1q82Q01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1q82Q02
2QA4P 1VQ6P 1VQMP 3CC7P 3CXCO 3G4SP 1VQPP 3CC4P 1QVFO 1VQNP 1M90Q 3CCJP 1N8RQ 1VQOP 3CCSP 1Q82Q 3CCLP 1VQ9P 2OTJP 1YHQP 1JJ2O 3G6EP 3CCRP 2QEXP 1VQ7P 1VQKP 2OTLP 1KD1Q 1VQ4P 3CCEP 1S72P 1Q86Q 3CCVP 1K8AQ 3OW2O 1YI2P 1K9MQ 1K73Q 1VQ8P 3G71P 3CPWO 3CCUP 3CMEP 1KC8Q 3CC2P 3CCQP 1YIJP 1QVGO 3CCMP 1KQSO 1W2BO 1NJIQ 1VQ5P 1VQLP 1YJWP 1YITP 3CD6P 1Q81Q 3I55P 1YJNP 1Q7YQ 1YJ9P 3CMAP 3I56P 1M1KQ
chains in the Genus database with same CATH superfamily
3DS0A 1BE3J 4YXWH 1BGYJ 1KILD 1G2CB 2YKOA 1BE3D 1BGYD 3O6QB 3P7KA 4UHPB 2ERHA 1KQLA 2KS1A 1OR5A 1E5WA 3Q3DA 1FDMA 3GG2A 1LTJB 2BHVA 1KN7A 4DT0A 3EQ2A 1QVGO 1MUUA 3N4XA 2P9XA 1YJ9P 1RE4A 1GU5A 1X0TA 2YO2A 4R4MA 3UIAA 1Q82Q 1GXGA 2I1JA 2OTJP 2M8RA 1L4AD 1ZOYC 4H2XC 3CXHH 1RH5B 4KJMA 1NVOA 3OW2O 3H1KE 1UIXA 4QMAA 3WUUA 1QLED 1GPJA 1SQVG 4BWNA 1PGOA 2FVAA 1KYOD 5B5EE 2HR3A 2LXBA 2FY8A 4GR6A 2OQQA 1VF5C 3HTKA 1SQPK 1NAYA 2IBZI 2Z5HA 3L71J 1NAFA 2YXQB 2KB7P 3CPWO 1RF0A 2B89A 2HODB 4Z1MH 5AW2B 1SQQJ 3B5NB 2XDJA 3EJEA 1LTGC 2CPBA 2M8PA 1EDLA 2M5AA 1SQVD 2AXTH 5AVUB 2FAEA 1Q86Q 2GZEA 2GA1A 2A06G 3SSUA 2CWOA 1L2PA 4N78E 5AW9B 1YBKA 2ONTA 2JYLA 3CCMP 1LGHB 2FXPA 3KZIE 1RF0C 1RF1A 3FX0A 3P8CD 1QVFO 4L76A 4WY4A 4KT0J 1SQPG 4K3AA 3TSIA 1VHNA 2XZRA 2ZT9B 1M1JB 3H1JE 4N3YB 2AFEA 1QX8A 4UB8E 3F5HA 1OW7A 2A06D 1W2BO 1IK7A 3B71A 4COCA 1VQLP 5AW7B 1W5CE 1HWTC 2E76C 3G28A 2XNXA 1SQPJ 4WY4C 2HLOA 3H1LG 1IK9A 2GZGA 4RJTA 4LLHA 1P84E 2WWWA 1NOHA 1U7JA 5I4TG 2D2CC 3OA7A 3T97A 3H25A 4W80A 1K30A 1IFJA 2N1TD 3H1LJ 1J1DC 1J1EC 2PAJA 1S9KE 1EDKA 2ZAEB 2KSEA 1SQBG 1VF5B 3RL0C 1KILE 1BE3E 2GDYA 1NU1D 1BGYE 3SFDC 2WSCJ 3E2DA 2MF4A 2Q3IA 3HE5A 2HFED 2J59M 5AVQB 1NTMG 5JPAA 3EFGA 4U0BA 3L74G 5B66H 1SQBJ 1SQBD 3HTKB 3L72G 5KAFE 2K37A 2Z46A 4XFJA 2C9NY 1M7LA 1ZRTD 2RMZA 5BU8B 4H44C 1VQOP 2G3AA 5HGMA 1PV3A 2W27A 4U0FA 1W2EA 2K5XA 1NTMJ 4PH1A 3USSA 5KAIE 1NTMD 3V4WA 2R44A 1MKMA 2FADA 2O01N 1KYOE 3MD0A 1KB9I 2WTYA 5KKZC 3TDKA 2RN0A 1KC8Q 2KUBA 3L74D 1NTZK 4H2YC 1IMPA 3L72J 1EMVA 1KZUB 1X3OA 1KFNA 2JO0A 3RK2C 3L72D 3K5BA 3DS5A 2JKVA 2W90A 1A02F 1NHLA 4CA3A 1BSHA 2E76B 1SFCA 5L8RJ 4GOEA 3C8VA 4WY4B 1SQVE 2PGDA 1K05A 2W6JH 3DS4A 3B5ND 1Q81Q 2OYOA 1FJKA 3WUTA 2VLQA 3R4YA 5HVCA 3FWLA 4WYMA 3G26A 1N86A 3L73G 2D2CB 2Y9ZA 3CXHD 1QGKB 3P8CE 2FBWC 4OWFA 2WITA 4COPA 2WQYC 2NRGA 2ZXXA 2JBGA 2CGQA 1J1DB 1J1EB 1IO4A 5AVXB 4GT1A 3RL0B 2Y0EA 1BDDA 2LPKA 1R5SA 2K0YA 2FYNC 3H6PA 2A06E 3II6A 3L73J 1EZVG 2XV6A 1DEEG 3L73D 1N2DC 2E42A 3GHGA 3T97B 1OW6A 1NTZJ 3GLMA 1JY3O 2YIUC 3I55P 2PEQA 1ZLLA 2MR8A 1SQPE 1XTGB 3AEEC 2MY5A 3W67A 2QM8A 2E43A 3H4EA 1EOQA 2M3BA 3HE5B 4Y99C 1S72P 4RESB 4H44B 2L91A 3VMZA 5BVZA 3ITKA 1EZVD 3R2PA 4I6MC 4A7PA 2X2BA 5KKZB 2V4HA 4JQ0D 3H1LE 3RK3C 1XTCC 2O1JA 1X79B 1NU1E 2YNYA 3RK2B 5KJ7A 3MUDC 2M8NA 1GK4A 2A45H 2R3CA 3Q5RA 3KXDA 1VF5D 5APTA 3EFFK 3G0VA 2FACA 1X9VA 3VMXA 2H7HA 5AW3B 1EDJA 3U1CA 5K5GB 2WSFH 3F89A 2KSJA 1SQBE 3WUVA 2QNWA 2N6YA 1ZRTE 1AA0A 3PH0A 3VP8A 1IMQA 3BCCG 3RBXA 3NXSA 3V2NA 3HD7A 1U7MA 1M1KQ 3M06A 1SFCB 2Z45A 1NTME 5HGNA 3AE7C 3CX5H 1N7SA 4GIFA 1MZ8A 3L70G 2M0BA 3L74E 4PWVB 2KGAA 1S1CX 2FYNB 4GR2A 3D71A 3L72E 2BCCG 2K0DX 3BCCJ 1FDOA 2ROQA 1R5LA 2N9BA 3G9RA 2LIWA 3BCCD 3HD7C 1P84I 3L36A 2FYUD 2YIUB 3L70J 3CCRP 4U0CA 1NKNA 3L70D 3ZDMA 3TGUG 2H8PD 5AW8B 4WVZA 2BUOA 1VKUA 3TF5A 2BCCJ 4JF7A 2KODA 2Y9YA 4Y99B 5CCGA 1CZQA 2BCCD 3V2RA 1HBWA 2LKIA 3CXHE 5DJUB 2LL8A 2Z5IA 5BS1A 1Q2NA 3GKLC 2D2CD 3P32A 3RK3B 3TGUD 2JEEA 5HV8A 1FE6A 2P2UA 2KR5A 5CCGC 1VQNP 3L73E 3RL0D 2JGPA 3E1RA 3RG6C 2KLUA 2W6AA 3L35A 3E7KA 4IFMA 2AXTE 2C9LY 1NJIQ 1HH0A 5BU5A 1Y8AA 1YJNP 5C39A 4HB1A 1KYOI 4IL6X 1GDTA 3NFQA 4IFFA 1EZVE 2W83C 1PP9G 1VQ9P 3DS3A 2SPZA 2Y0DA 2I8DA 4H44D 1JOCA 4OVNF 3C1LA 4YTPC 4IFDK 2GZIA 4B86A 2BQ1E 1T3JA 2Q5UA 2O01H 1QRJA 4IOIH 1OWAA 1G1JA 4JPZB 2OARA 1OFCX 2JP3A 1QL2A 1L0IA 1VQ7P 3HD7B 1LTSC 4PV1C 1PP9D 2LMLA 1OW8A 3RK2D 1YTZI 4H13C 1JTHA 3Q5PA 3M0DA 2HG5D 3RG2A 3B5IA 1AJYA 4XRQA 3AEFC 2QJYC 2Q3EA 3PJSK 2ZT9C 1M1JC 1SQVK 2B88A 1JY2O 1BAJA 3TNUB 2A45G 2E5TA 1NYHA 1OMIA 3Q2YA 3M0DC 2WPQA 4EDFA 3LRYA 1X8YA 3A0BH 3G1GA 4U0AA 1OVUA 3D70A 5APQA 3NY7B 3CCVP 2G8YA 1IC2A 5APUA 3BCCE 2Z44A 3CI9A 2FYUE 5AVRB 2NPSA 1EIAA 1YITP 1RO0A 1ZNVA 1HY8A 2M3EA 3OAKA 3L70E 1RE4C 2KK7A 5B66E 1FDIA 1KD1Q 1L0ND 3V2PA 2BCCE 3BRTB 4ZMDA 2VLNA 1FZGA 5AW1B 4XA4A 1LWUA 3CC2P 4OGQD 1VQ5P 2OTKE 2V7QH 2VLOA 5EFWB 1SQVJ 2KORA 1ZMBA 3H32A 3CX5D 4GDOA 2K93A 1JMMA 2K94A 3TGUE 2R5DA 2EG5A 3FGAD 1EQ7A 1Z56A 3PHLA 2FFDA 3RK3D 3H0DA 1T2KC 2PFXA 2EHSA 1Y47A 1NU1K 4PV1B 4BXLA 1DD3A 1LWUC 1T3UA 2IPPA 4H13B 2HYNA 2PEMA 5EW5E 3CCLP 4RKUJ 2IYOA 2QJYB 2MVVA 1H0TB 1EC5A 1KB9H 2N9YB 3AE8C 1S5LH 2FFDC 4UB6H 3L4FA 3WU2H 5AVWB 1SQBK 3AE4C 4XFZA 1RF1C 2KOOA 1EXIA 1JTHB 1YHQP 5CMZA 1DD4A 2L0QA 1NTMK 5AVVB 3VMAA 1BXIA 3SWYA 2XNDH 1SP4A 1NU1G 2K0XA 3MGEA 2YMYA 2N5HA 2AXCA 3EWKA 3A0HH 1ZN5A 2I1KA 1DIPA 2KS1B 2QA4P 1VQMP 1PP9E 3D6ZA 2N5IA 2VLPA 2Z4EA 1FZEA 2FXMA 3G29A 1CI6A 4I1LA 3CXHI 1K8AQ 3HD7D 3DTJA 2YXRB 1YTZT 3M9QA 5CJ4A 1NU1J 1UIIA 3BRVB 1A43A 1BSNA 2RKLA 5F2KA 3HRNA 1NH4A 5AW4B 3CC4P 1FZBA 2VRSA 2WSEH 2WVRA 2K1AA 2B87A 1A8OA 1ACPA 3B4QA 1SVFA 1AUMA 3AE1C 2H88C 2B9BA 2L4BA 1JB0J 5KLIB 1LWUB 3P05A 3CWBG 3HZQA 5TISH 4U3FG 3H32B 2M5AB 3L74J 1EZVI 2AEFA 2IYPA 1OX3A 4HJGH 3G1IA 1L0NE 3CC7P 2FFDB 2PENA 2ZVOB 1S3JA 3LIDA 1T6AA 4IPYA 1RO2A 1JY2P 1U57A 5AW5B 2QM7A 3CWBJ 1KILA 1MV8A 2E5YA 1RF1B 2K88A 5AW6B 3VP9A 3CWBD 2KGDA 5KLVK 3CX5E 4U3FD 4LGDE 1YJWP 1ZMEC 3V2QA 3LW5H 3A2AA 1GW3A 3RK3E 2LOLA 1KTMA 1EXJA 2XZ0D 3MP7B 1KILC 5APSA 1PZQA 1L4AA 1IFPA 1SFCC 1H88A 2QJKB 2KWLA 2WPTA 2WZ7A 4BRYA 2PEKA 2XKMA 2KXPB 4NPEA 1HQBA 1DV5A 2L5GB 1VDFA 1Z6MA 4EI2A 1IFIA 1PIXA 2KG9A 4XFYA 1GMJA 3JCUH 1JO5A 2IZ0A 5KLVG 2ZT9D 1FR2A 3IAOA 2GUSA 3M0AA 1YYCA 2FYZA 1CI6B 4JBZA 2PRRA 5E79H 1FU1A 4NEOA 2LXCB 1GXHA 3CE7A 3VMYA 3D6YA 2KOQA 5KLVJ 3VTPC 5KLVD 2QVAA 2ZYDA 3EJDA 3GHGC 1SQXD 5GTHH 4EYYQ 1Q90D 3MZWB 4ZNCA 3LMOA 4O9BA 3EJBA 2B87B 4QNBA 3G4SP 4PD4H 1BDCA 4ASVA 3AE5C 2FYUK 2FVEA 2KOSA 1PFIA 2LIUA 3IN6A 2E75B 3S4RA 1KB9D 5KTBA 2KOPA 3NTEA 3JC22 2FHSC 2GDWA 2KZJA 1HF9A 3I56P 1SS1A 1KLPA 4DCKA 1LTIC 1HGZA 2P10A 3GJNA 1RQVA 3PRJA 3QWOC 1R8EA 3C9IA 2QIWA 2H89C 2N98A 1L0LG 5KJ7C 1JEKA 2JJLA 3W68A 3SFEC 3AE6C 1KILB 5APXA 2FYUG 1JUNA 5AW0B 1VQPP 1PPJG 4TLFA 4I2LC 4RO0A 2R3SA 3G21A 3M1MA 3H1HG 1M74A 5HGLA 1JMBA 1OVRA 2QG4A 2YKPA 2FVFA 2N1TA 1HVVA 4QKOA 2E74C 2AVAA 4HYTB 1FOSF 1L0LD 2O1KA 2FYUJ 3CWBE 2YO3A 1L4AB 3GZMA 1OVVA 2IDBA 2C0WA 1PPJD 1K04A 3OJAB 4U3FE 2LR2A 1HGVA 3IR9A 4BRYB 1N7SC 1E6JP 3HUSA 4M0IA 2MR7A 2CPSA 3H1HD 1G2CA 2E76D 4HKZH 3A0BE 1FC2C 2XZ1C 4NPFX 4WY4D 1KQFB 1DX7A 2JDIH 1ZW0A 4XFXA 1LTJA 3CXCO 3GHGB 1AVOA 1JM0A 3A5TA 4GKGA 1JJ2O 1CSBA 1VPCA 3TGUJ 3HUSC 1PGPA 2ZXEB 2KGCA 1KQGB 2JYGA 2KLVA 3N7NA 2ZFCA 2QJPC 2J58A 4K35A 1AQTA 2ZVNB 5AVTB 3HYBA 2KG6A 3U43A 2JU2A 4AYCA 2J5UA 1NWQA 2A45I 2NZ2A 1T8KA 2N6ZA 5APWA 1NTKG 1RY3A 5APYA 1H89A 5KLVE 3O8ZA 4U0EA 1VQKP 1SQXE 1USDA 5DJTB 3PLNA 1K9MQ 2KG8A 2LF4A 1YIJP 3NMDA 5CCHA 3FXDA 3CMAP 2GM4A 3ABVC 3E1IA 2E74B 1KB9E 1NTKD 3CCJP 3CX5I 1QEXA 1S5LE 4UB6E 3MGNA 1PP9J 3WU2E 1L0NK 1G1IA 3AEAC 4H2WC 1JCCA 3LIEA 1N7SB 2R32A 4NPDA 1BCCG 1LTBC 4D6TG 1JY3P 2KYVA 1AF8A 2CK3H 5CCHC 3AEBC 2WSSH 1IZNB 1ZV8A 2DGYA 2VSQA 1HUCA 5F2OA 1T8ZA 2KZIA 3A0HE 5CZDB 2E1MA 4GODA 4MN4C 1LP1A 2H43A 1AQ5A 1BCCJ 2WPRA 4D6TJ 1AFOA 3G3ZA 3HUSB 1A02J 2KGEA 1VQ6P 1BCCD 4PD4D 4D6TD 1ZR2A 1SFCD 1S2EA 4EOTA 3H47A 4EIJA 1L0NG 1AV1A 1L0LE 2QJPB 1RNIA 1WMKA 2IFNA 4AUWA 2WPSA 1PPJE 1PL5A 3BASA 3MTUE 1GW4A 3H1HE 1SLQA 2WSFJ 1L0NJ 1YQ4C 3A7OA 3SWFA 3L71G 3VOPA 1GL2A 2WT7A 4L75A 3Q20A 1SQQG 1RE3A 3S9OA 3TK1A 3AE9C 5APVA 4H0LC 1IFNA 5TISE 2NPSC 4PJ0H 4AQRD 3IF4A 3H1IG 2RH0A 2OTLP 3M91A 3L71D 1AYIA 1GL2C 1QL1A 5KLIC 4L74A 1SQQD 1JY2N 1RE3C 4ZKPA 2JU1A 3CCSP 2GUVA 2PEOA 5H2FH 2MJZA 3H1IJ 3KYQA 3I5CA 3H1ID 2MD9A 1Y9BA 2C0XA 2KOGA 4ASWA 1HJ0A 1NKZB 5KJ7D 2L22A 5BS2A 1EDIA 2AEMA 1HTLC 1PEQA 2M5RA 1FS0E 4C7NA 2P7JA 2Q9IA 3BVHA 1NTKE 1JNMA 3Q5SA 3KQGA 5KP6B 5GTIH 3CD6P 1MZ9A 2ZYGA 4BPHA 1AVYA 2OYIA 2JQ4A 4IL6H 2GYKA 3JCUE 5HGOA 4I7ZC 2XU6A 3L75G 2YMKA 2E74D 2IBZG 2JO1A 1RQUA 1LP1B 1SQPD 1OIPA 2QJKC 3GMAA 1M56D 5E79E 1URQA 4MRTC 4TT3H 2HPCA 4R0MA 7CEIA 3SWKA 1N7SD 1Q7YQ 2L9FA 2OYIC 1LTAC 3L75J 2M8LA 3L75D 4DOJA 4H0LB 2IBZD 2NPSB 1H8AA 5GTHE 3H1LD 3FWNA 4JYCA 1YI2P 2DNWA 5CBOA 3V4QA 1BCCE 4PD4E 4D6TE 2P58A 1NO4A 2O01J 1URQC 1CW5A 1GL2B 2WT7B 1M6EX 4W7YA 3AE3C 4R4LA 2FXOA 4GOFA 2L6EA 2BEZF 5B5EH 2DW3A 5CCGD 2JWAA 2CNRA 1RHZB 1JCDA 3AEGC 2AFDA 1PEMA 2FKWB 3GF7A 2JR8A 2KP8A 2E75C 2ZYAA 3PP5A 4WBAA 2MVUA 1OZHA 1FJPA 2FQ0A 3FXEA 4U3FJ 2N50A 4WWIA 4BPFA 3P8MC 1SQXK 2POHA 1LJ2A 2EFJA 3PTZA 3WMM0 1KFMA 5AVZB 3L71E 3KZIH 2KIKA 3M9BA 2MKVA 2Q7CA 2QEXP 2FQ2A 1SQQE 4I7ZB 5DCKA 1PEOA 2P1JA 2KW2A 3CL3D 3B8EB 3GZLA 4Y28J 4PV1D 2KNCA 4L73A 1WRGA 3H1IE 4HH2A 2QRXA 4LC1A 1D1DA 2JWDA 3L37A 4UB8H 2PEIA 3DS2A 2KI7B 4C7NB 4H13D 3CLQA 2PY8A 5AVSB 2XXMA 3V6IA 3TYYA 5CCHD 2OYIB 3B4SA 1NTZG 3M9HA 3MIWA 2V7QJ 1SQXG 1D7MA 2AF8A 2K9JA 1L4AC 4JYBA 4C46A 1PGQA 4N6JA 2GZFA 4F37A 2W6BA 1P84H 4PXHB 2O3JA 1URQB 1OXZA 2HPCB 2Y0CA 2UWJE 2EIAA 2PP6A 1FZAA 1K73Q 1N7LA 1SQXJ 3CCQP 1NTZD 3VN0A 1ZP0C 3VYIA 1L0LK 1GD2E 5KP7B 3AEDC 1F80D 3KDPB 2GZJA 4OGQC 1LNQA 3MUDA 2LKMA 2IFMA 5M1BA 1TU3F 1LT9A 1KMIZ 1GTWA 1LTTC 2PNGA 2W8ZA 3RL0g 2GDXA 1M8OB 1X22A 3L75E 3IFMA 5KP8B 2IBZE 1MFTA 2R5BA 1HJBA 4U0DA 1FOSE 1E0HA 1J2JB 1M57D 1GU4A 1LT1A 4OH8B 5KAFH 5EJDA 2NO8A 4H0LD 2NPSD 1N73A 3KHUA 3CMEP 1LT9C 1KQSO 3S1KA 3RGUA 1VL2A 4BPGA 5KAIH 3A3YB 4KHXA 1KYOH 1S4XA 1GL2D 3MHVA 5TJHA 2IZ1A 2CQ8A 1T2KD 1L0HA 2QE7H 2OYHA 1VQ4P 4XE5B 4DZOA 3QH9A 1KV4A 2OGUA 3KPEA 1FZCA 1JY3N 1N73C 3CCUP 1L0LJ 3H1KG 1GZLA 3HE4A 2WPVB 3RBZA 2LTEA 1DH3A 1PGJA 5F2NA 2YKQA 2XT1A 2WMMA 2ITAA 2WSEJ 3GW6A 3H1HJ 1IFDA 2OYHC 2KNCB 1VQ8P 3WBHA 3G71P 4HKGA 3AECC 2PEJA 3TNUA 3O6QA 1FZCC 1IFMA 3H1KJ 3DPHA 2N1TC 2ZJSE 3H1KD 1UNKA 2XV5A 2P67A 2K2QA 4IZ6A 1NTKK 2JB0A 5CBNA 1MFZA 2K9JB 1NGMB 4OGQB 1ZXGA 4XROA 1FZFA 4WB4A 2FQ1A 2AEJA 4PD4I 1LTJC 3G6EP 2QSIA 4PJ0E 2JAZA 3H1JG 1IJDB 1S5LX 4M3LA 2CG5B 3LW5J 4CPGA 2BASA 3GF3A 4N78D 1LT9B 2HODA 1M90Q 1N8RQ 2Q6QA 4C7RA 3B5NA 1IUQA 2K92A 1URQD 3VRLC 1NTZE 3AE2C 4DG9A 5AVYB 1UJZA 3H1JJ 5H2FE 1CEIA 4YPCA 3H1JD 1KORA 1YQ3C 1NTKJ 1NQ4A 1GK6A 1N73B 2WSCH 1DEBA 1ZR4A 2IX7C 3U1AA 3B5NC 4PH0A 1DNYA 2E75D 4ZKUA 1E79H 4YXDC 2K9YA 4DJGA 1M1JA 3BATA 2OYHB 2Q1KA 1H0TA 1BE3G 2EHTA 1BGYG 1P84D 1FZCB 3V5BA 3NTNA 1M6NA 3DS1A 1PEUA 2N1TB 3JSVC 1WT6A 4U7JA 5CHXA 3HE4B 5GTIE 2BEQD 3CCEP 1FAVA 3U59A 4IL6E 5CJ0A 2K3RA 4W7ZA 3Q1MA 1FBMA 1SQQK 1S9KD 1USEA
chains in the Genus database with same CATH topology
3DS0A 1ZMBA 2OARA 3CC4P 5HGOA 1VQPP 1QVFO 4U0DA 1VQOP 5HGMA 4U0FA 3G21A 2EG5A 3M1MA 1M74A 1EOQA 3H4EA 4PH1A 4U0EA 5HGLA 4XFYA 3G6EP 2QEXP 3CCRP 1VQ7P 4U0CA 1VQKP 5DCKA 1S72P 1A8OA 1PEOA 1K9MQ 3Q20A 2BUOA 3H0DA 2BHVA 3CMEP 1KC8Q 1AUMA 2LF4A 1YIJP 1QVGO 1KQSO 1W2BO 3B5IA 4COCA 1VQLP 2KODA 4XRQA 2P9XA 1Q7YQ 1YJ9P 3CMAP 2JO0A 3G28A 1D1DA 1M90Q 3CCJP 2PEIA 3DS2A 1N8RQ 2PEMA 3DS5A 2M8LA 2PY8A 1Q82Q 2XXMA 3CCLP 1IUQA 1BAJA 2OTJP 3P05A 5BS1A 3VRLC 3HZQA 2OTLP 1E6JP 1VQ4P 4M0IA 2M8NA 3OW2O 1YI2P 3CCUP 3G0VA 3DS4A 1Q81Q 5I4TG 3CCSP 3G1IA 2PEOA 3LRYA 4QNBA 4XFXA 1M6EX 2XT1A 4XFZA 5F2NA 2PENA 3G4SP 3CXCO 3CC7P 1VQNP 1K30A 4IPYA 1RO2A 2L6EA 4GR6A 2DGYA 4WYMA 3G26A 3RG6C 5F2OA 1YHQP 1JJ2O 2EIAA 3G1GA 4U0AA 3CCVP 4PH0A 2E1MA 1K73Q 1VQ8P 3WBHA 3G71P 3NTEA 3CPWO 2PEJA 2Z44A 3MGEA 4COPA 3CCQP 1NJIQ 1EIAA 3DPHA 1YJWP 1YITP 3E2DA 1YJNP 1RO0A 2JYGA 3I56P 1PEMA 1M1KQ 2M8PA 2QA4P 1VQ6P 1VQMP 2Z45A 5HGNA 1M6NA 3DS1A 1PEUA 3H47A 1VQ9P 3DS3A 5BS2A 5JPAA 1KD1Q 3G29A 3HYBA 3CCEP 1PEQA 1Q86Q 2XV6A 1K8AQ 3DTJA 4U0BA 4GR2A 2CWOA 2BQ1E 2ONTA 3CC2P 1A43A 2JYLA 3CCMP 1RNIA 1VQ5P 4XROA 5F2KA 3CD6P 3I55P 1QRJA 2PEQA 2EFJA 2PEKA 2Z46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QA4 P;  1VQ6 P;  1VQM P;  3CC7 P;  3CXC O;  3G4S P;  1VQP P;  3CC4 P;  1QVF O;  1VQN P;  1M90 Q;  3CCJ P;  1N8R Q;  1VQO P;  3CCS P;  1Q82 Q;  3CCL P;  1VQ9 P;  2OTJ P;  1YHQ P;  1JJ2 O;  3G6E P;  3CCR P;  2QEX P;  1VQ7 P;  1VQK P;  2OTL P;  1KD1 Q;  1VQ4 P;  3CCE P;  1S72 P;  1Q86 Q;  3CCV P;  1K8A Q;  3OW2 O;  1YI2 P;  1K9M Q;  1K73 Q;  1VQ8 P;  3G71 P;  3CPW O;  3CCU P;  3CME P;  1KC8 Q;  3CC2 P;  3CCQ P;  1YIJ P;  1QVG O;  3CCM P;  1KQS O;  1W2B O;  1NJI Q;  1VQ5 P;  1VQL P;  1YJW P;  1YIT P;  3CD6 P;  1Q81 Q;  3I55 P;  1YJN P;  1Q7Y Q;  1YJ9 P;  3CMA P;  3I56 P;  1M1K Q; 
#chains in the Genus database with same CATH topology
 3DS0 A;  1BE3 J;  4YXW H;  1BGY J;  1KIL D;  1G2C B;  2YKO A;  1BE3 D;  1BGY D;  3O6Q B;  3P7K A;  4UHP B;  2ERH A;  1KQL A;  2KS1 A;  1OR5 A;  1E5W A;  3Q3D A;  1FDM A;  3GG2 A;  1LTJ B;  2BHV A;  1KN7 A;  4DT0 A;  3EQ2 A;  1QVG O;  1MUU A;  3N4X A;  2P9X A;  1YJ9 P;  1RE4 A;  1GU5 A;  1X0T A;  2YO2 A;  4R4M A;  3UIA A;  1Q82 Q;  1GXG A;  2I1J A;  2OTJ P;  2M8R A;  1L4A D;  1ZOY C;  4H2X C;  3CXH H;  1RH5 B;  4KJM A;  1NVO A;  3OW2 O;  3H1K E;  1UIX A;  4QMA A;  3WUU A;  1QLE D;  1GPJ A;  1SQV G;  4BWN A;  1PGO A;  2FVA A;  1KYO D;  5B5E E;  2HR3 A;  2LXB A;  2FY8 A;  4GR6 A;  2OQQ A;  1VF5 C;  3HTK A;  1SQP K;  1NAY A;  2IBZ I;  2Z5H A;  3L71 J;  1NAF A;  2YXQ B;  2KB7 P;  3CPW O;  1RF0 A;  2B89 A;  2HOD B;  4Z1M H;  5AW2 B;  1SQQ J;  3B5N B;  2XDJ A;  3EJE A;  1LTG C;  2CPB A;  2M8P A;  1EDL A;  2M5A A;  1SQV D;  2AXT H;  5AVU B;  2FAE A;  1Q86 Q;  2GZE A;  2GA1 A;  2A06 G;  3SSU A;  2CWO A;  1L2P A;  4N78 E;  5AW9 B;  1YBK A;  2ONT A;  2JYL A;  3CCM P;  1LGH B;  2FXP A;  3KZI E;  1RF0 C;  1RF1 A;  3FX0 A;  3P8C D;  1QVF O;  4L76 A;  4WY4 A;  4KT0 J;  1SQP G;  4K3A A;  3TSI A;  1VHN A;  2XZR A;  2ZT9 B;  1M1J B;  3H1J E;  4N3Y B;  2AFE A;  1QX8 A;  4UB8 E;  3F5H A;  1OW7 A;  2A06 D;  1W2B O;  1IK7 A;  3B71 A;  4COC A;  1VQL P;  5AW7 B;  1W5C E;  1HWT C;  2E76 C;  3G28 A;  2XNX A;  1SQP J;  4WY4 C;  2HLO A;  3H1L G;  1IK9 A;  2GZG A;  4RJT A;  4LLH A;  1P84 E;  2WWW A;  1NOH A;  1U7J A;  5I4T G;  2D2C C;  3OA7 A;  3T97 A;  3H25 A;  4W80 A;  1K30 A;  1IFJ A;  2N1T D;  3H1L J;  1J1D C;  1J1E C;  2PAJ A;  1S9K E;  1EDK A;  2ZAE B;  2KSE A;  1SQB G;  1VF5 B;  3RL0 C;  1KIL E;  1BE3 E;  2GDY A;  1NU1 D;  1BGY E;  3SFD C;  2WSC J;  3E2D A;  2MF4 A;  2Q3I A;  3HE5 A;  2HFE D;  2J59 M;  5AVQ B;  1NTM G;  5JPA A;  3EFG A;  4U0B A;  3L74 G;  5B66 H;  1SQB J;  1SQB D;  3HTK B;  3L72 G;  5KAF E;  2K37 A;  2Z46 A;  4XFJ A;  2C9N Y;  1M7L A;  1ZRT D;  2RMZ A;  5BU8 B;  4H44 C;  1VQO P;  2G3A A;  5HGM A;  1PV3 A;  2W27 A;  4U0F A;  1W2E A;  2K5X A;  1NTM J;  4PH1 A;  3USS A;  5KAI E;  1NTM D;  3V4W A;  2R44 A;  1MKM A;  2FAD A;  2O01 N;  1KYO E;  3MD0 A;  1KB9 I;  2WTY A;  5KKZ C;  3TDK A;  2RN0 A;  1KC8 Q;  2KUB A;  3L74 D;  1NTZ K;  4H2Y C;  1IMP A;  3L72 J;  1EMV A;  1KZU B;  1X3O A;  1KFN A;  2JO0 A;  3RK2 C;  3L72 D;  3K5B A;  3DS5 A;  2JKV A;  2W90 A;  1A02 F;  1NHL A;  4CA3 A;  1BSH A;  2E76 B;  1SFC A;  5L8R J;  4GOE A;  3C8V A;  4WY4 B;  1SQV E;  2PGD A;  1K05 A;  2W6J H;  3DS4 A;  3B5N D;  1Q81 Q;  2OYO A;  1FJK A;  3WUT A;  2VLQ A;  3R4Y A;  5HVC A;  3FWL A;  4WYM A;  3G26 A;  1N86 A;  3L73 G;  2D2C B;  2Y9Z A;  3CXH D;  1QGK B;  3P8C E;  2FBW C;  4OWF A;  2WIT A;  4COP A;  2WQY C;  2NRG A;  2ZXX A;  2JBG A;  2CGQ A;  1J1D B;  1J1E B;  1IO4 A;  5AVX B;  4GT1 A;  3RL0 B;  2Y0E A;  1BDD A;  2LPK A;  1R5S A;  2K0Y A;  2FYN C;  3H6P A;  2A06 E;  3II6 A;  3L73 J;  1EZV G;  2XV6 A;  1DEE G;  3L73 D;  1N2D C;  2E42 A;  3GHG A;  3T97 B;  1OW6 A;  1NTZ J;  3GLM A;  1JY3 O;  2YIU C;  3I55 P;  2PEQ A;  1ZLL A;  2MR8 A;  1SQP E;  1XTG B;  3AEE C;  2MY5 A;  3W67 A;  2QM8 A;  2E43 A;  3H4E A;  1EOQ A;  2M3B A;  3HE5 B;  4Y99 C;  1S72 P;  4RES B;  4H44 B;  2L91 A;  3VMZ A;  5BVZ A;  3ITK A;  1EZV D;  3R2P A;  4I6M C;  4A7P A;  2X2B A;  5KKZ B;  2V4H A;  4JQ0 D;  3H1L E;  3RK3 C;  1XTC C;  2O1J A;  1X79 B;  1NU1 E;  2YNY A;  3RK2 B;  5KJ7 A;  3MUD C;  2M8N A;  1GK4 A;  2A45 H;  2R3C A;  3Q5R A;  3KXD A;  1VF5 D;  5APT A;  3EFF K;  3G0V A;  2FAC A;  1X9V A;  3VMX A;  2H7H A;  5AW3 B;  1EDJ A;  3U1C A;  5K5G B;  2WSF H;  3F89 A;  2KSJ A;  1SQB E;  3WUV A;  2QNW A;  2N6Y A;  1ZRT E;  1AA0 A;  3PH0 A;  3VP8 A;  1IMQ A;  3BCC G;  3RBX A;  3NXS A;  3V2N A;  3HD7 A;  1U7M A;  1M1K Q;  3M06 A;  1SFC B;  2Z45 A;  1NTM E;  5HGN A;  3AE7 C;  3CX5 H;  1N7S A;  4GIF A;  1MZ8 A;  3L70 G;  2M0B A;  3L74 E;  4PWV B;  2KGA A;  1S1C X;  2FYN B;  4GR2 A;  3D71 A;  3L72 E;  2BCC G;  2K0D X;  3BCC J;  1FDO A;  2ROQ A;  1R5L A;  2N9B A;  3G9R A;  2LIW A;  3BCC D;  3HD7 C;  1P84 I;  3L36 A;  2FYU D;  2YIU B;  3L70 J;  3CCR P;  4U0C A;  1NKN A;  3L70 D;  3ZDM A;  3TGU G;  2H8P D;  5AW8 B;  4WVZ A;  2BUO A;  1VKU A;  3TF5 A;  2BCC J;  4JF7 A;  2KOD A;  2Y9Y A;  4Y99 B;  5CCG A;  1CZQ A;  2BCC D;  3V2R A;  1HBW A;  2LKI A;  3CXH E;  5DJU B;  2LL8 A;  2Z5I A;  5BS1 A;  1Q2N A;  3GKL C;  2D2C D;  3P32 A;  3RK3 B;  3TGU D;  2JEE A;  5HV8 A;  1FE6 A;  2P2U A;  2KR5 A;  5CCG C;  1VQN P;  3L73 E;  3RL0 D;  2JGP A;  3E1R A;  3RG6 C;  2KLU A;  2W6A A;  3L35 A;  3E7K A;  4IFM A;  2AXT E;  2C9L Y;  1NJI Q;  1HH0 A;  5BU5 A;  1Y8A A;  1YJN P;  5C39 A;  4HB1 A;  1KYO I;  4IL6 X;  1GDT A;  3NFQ A;  4IFF A;  1EZV E;  2W83 C;  1PP9 G;  1VQ9 P;  3DS3 A;  2SPZ A;  2Y0D A;  2I8D A;  4H44 D;  1JOC A;  4OVN F;  3C1L A;  4YTP C;  4IFD K;  2GZI A;  4B86 A;  2BQ1 E;  1T3J A;  2Q5U A;  2O01 H;  1QRJ A;  4IOI H;  1OWA A;  1G1J A;  4JPZ B;  2OAR A;  1OFC X;  2JP3 A;  1QL2 A;  1L0I A;  1VQ7 P;  3HD7 B;  1LTS C;  4PV1 C;  1PP9 D;  2LML A;  1OW8 A;  3RK2 D;  1YTZ I;  4H13 C;  1JTH A;  3Q5P A;  3M0D A;  2HG5 D;  3RG2 A;  3B5I A;  1AJY A;  4XRQ A;  3AEF C;  2QJY C;  2Q3E A;  3PJS K;  2ZT9 C;  1M1J C;  1SQV K;  2B88 A;  1JY2 O;  1BAJ A;  3TNU B;  2A45 G;  2E5T A;  1NYH A;  1OMI A;  3Q2Y A;  3M0D C;  2WPQ A;  4EDF A;  3LRY A;  1X8Y A;  3A0B H;  3G1G A;  4U0A A;  1OVU A;  3D70 A;  5APQ A;  3NY7 B;  3CCV P;  2G8Y A;  1IC2 A;  5APU A;  3BCC E;  2Z44 A;  3CI9 A;  2FYU E;  5AVR B;  2NPS A;  1EIA A;  1YIT P;  1RO0 A;  1ZNV A;  1HY8 A;  2M3E A;  3OAK A;  3L70 E;  1RE4 C;  2KK7 A;  5B66 E;  1FDI A;  1KD1 Q;  1L0N D;  3V2P A;  2BCC E;  3BRT B;  4ZMD A;  2VLN A;  1FZG A;  5AW1 B;  4XA4 A;  1LWU A;  3CC2 P;  4OGQ D;  1VQ5 P;  2OTK E;  2V7Q H;  2VLO A;  5EFW B;  1SQV J;  2KOR A;  1ZMB A;  3H32 A;  3CX5 D;  4GDO A;  2K93 A;  1JMM A;  2K94 A;  3TGU E;  2R5D A;  2EG5 A;  3FGA D;  1EQ7 A;  1Z56 A;  3PHL A;  2FFD A;  3RK3 D;  3H0D A;  1T2K C;  2PFX A;  2EHS A;  1Y47 A;  1NU1 K;  4PV1 B;  4BXL A;  1DD3 A;  1LWU C;  1T3U A;  2IPP A;  4H13 B;  2HYN A;  2PEM A;  5EW5 E;  3CCL P;  4RKU J;  2IYO A;  2QJY B;  2MVV A;  1H0T B;  1EC5 A;  1KB9 H;  2N9Y B;  3AE8 C;  1S5L H;  2FFD C;  4UB6 H;  3L4F A;  3WU2 H;  5AVW B;  1SQB K;  3AE4 C;  4XFZ A;  1RF1 C;  2KOO A;  1EXI A;  1JTH B;  1YHQ P;  5CMZ A;  1DD4 A;  2L0Q A;  1NTM K;  5AVV B;  3VMA A;  1BXI A;  3SWY A;  2XND H;  1SP4 A;  1NU1 G;  2K0X A;  3MGE A;  2YMY A;  2N5H A;  2AXC A;  3EWK A;  3A0H H;  1ZN5 A;  2I1K A;  1DIP A;  2KS1 B;  2QA4 P;  1VQM P;  1PP9 E;  3D6Z A;  2N5I A;  2VLP A;  2Z4E A;  1FZE A;  2FXM A;  3G29 A;  1CI6 A;  4I1L A;  3CXH I;  1K8A Q;  3HD7 D;  3DTJ A;  2YXR B;  1YTZ T;  3M9Q A;  5CJ4 A;  1NU1 J;  1UII A;  3BRV B;  1A43 A;  1BSN A;  2RKL A;  5F2K A;  3HRN A;  1NH4 A;  5AW4 B;  3CC4 P;  1FZB A;  2VRS A;  2WSE H;  2WVR A;  2K1A A;  2B87 A;  1A8O A;  1ACP A;  3B4Q A;  1SVF A;  1AUM A;  3AE1 C;  2H88 C;  2B9B A;  2L4B A;  1JB0 J;  5KLI B;  1LWU B;  3P05 A;  3CWB G;  3HZQ A;  5TIS H;  4U3F G;  3H32 B;  2M5A B;  3L74 J;  1EZV I;  2AEF A;  2IYP A;  1OX3 A;  4HJG H;  3G1I A;  1L0N E;  3CC7 P;  2FFD B;  2PEN A;  2ZVO B;  1S3J A;  3LID A;  1T6A A;  4IPY A;  1RO2 A;  1JY2 P;  1U57 A;  5AW5 B;  2QM7 A;  3CWB J;  1KIL A;  1MV8 A;  2E5Y A;  1RF1 B;  2K88 A;  5AW6 B;  3VP9 A;  3CWB D;  2KGD A;  5KLV K;  3CX5 E;  4U3F D;  4LGD E;  1YJW P;  1ZME C;  3V2Q A;  3LW5 H;  3A2A A;  1GW3 A;  3RK3 E;  2LOL A;  1KTM A;  1EXJ A;  2XZ0 D;  3MP7 B;  1KIL C;  5APS A;  1PZQ A;  1L4A A;  1IFP A;  1SFC C;  1H88 A;  2QJK B;  2KWL A;  2WPT A;  2WZ7 A;  4BRY A;  2PEK A;  2XKM A;  2KXP B;  4NPE A;  1HQB A;  1DV5 A;  2L5G B;  1VDF A;  1Z6M A;  4EI2 A;  1IFI A;  1PIX A;  2KG9 A;  4XFY A;  1GMJ A;  3JCU H;  1JO5 A;  2IZ0 A;  5KLV G;  2ZT9 D;  1FR2 A;  3IAO A;  2GUS A;  3M0A A;  1YYC A;  2FYZ A;  1CI6 B;  4JBZ A;  2PRR A;  5E79 H;  1FU1 A;  4NEO A;  2LXC B;  1GXH A;  3CE7 A;  3VMY A;  3D6Y A;  2KOQ A;  5KLV J;  3VTP C;  5KLV D;  2QVA A;  2ZYD A;  3EJD A;  3GHG C;  1SQX D;  5GTH H;  4EYY Q;  1Q90 D;  3MZW B;  4ZNC A;  3LMO A;  4O9B A;  3EJB A;  2B87 B;  4QNB A;  3G4S P;  4PD4 H;  1BDC A;  4ASV A;  3AE5 C;  2FYU K;  2FVE A;  2KOS A;  1PFI A;  2LIU A;  3IN6 A;  2E75 B;  3S4R A;  1KB9 D;  5KTB A;  2KOP A;  3NTE A;  3JC2 2;  2FHS C;  2GDW A;  2KZJ A;  1HF9 A;  3I56 P;  1SS1 A;  1KLP A;  4DCK A;  1LTI C;  1HGZ A;  2P10 A;  3GJN A;  1RQV A;  3PRJ A;  3QWO C;  1R8E A;  3C9I A;  2QIW A;  2H89 C;  2N98 A;  1L0L G;  5KJ7 C;  1JEK A;  2JJL A;  3W68 A;  3SFE C;  3AE6 C;  1KIL B;  5APX A;  2FYU G;  1JUN A;  5AW0 B;  1VQP P;  1PPJ G;  4TLF A;  4I2L C;  4RO0 A;  2R3S A;  3G21 A;  3M1M A;  3H1H G;  1M74 A;  5HGL A;  1JMB A;  1OVR A;  2QG4 A;  2YKP A;  2FVF A;  2N1T A;  1HVV A;  4QKO A;  2E74 C;  2AVA A;  4HYT B;  1FOS F;  1L0L D;  2O1K A;  2FYU J;  3CWB E;  2YO3 A;  1L4A B;  3GZM A;  1OVV A;  2IDB A;  2C0W A;  1PPJ D;  1K04 A;  3OJA B;  4U3F E;  2LR2 A;  1HGV A;  3IR9 A;  4BRY B;  1N7S C;  1E6J P;  3HUS A;  4M0I A;  2MR7 A;  2CPS A;  3H1H D;  1G2C A;  2E76 D;  4HKZ H;  3A0B E;  1FC2 C;  2XZ1 C;  4NPF X;  4WY4 D;  1KQF B;  1DX7 A;  2JDI H;  1ZW0 A;  4XFX A;  1LTJ A;  3CXC O;  3GHG B;  1AVO A;  1JM0 A;  3A5T A;  4GKG A;  1JJ2 O;  1CSB A;  1VPC A;  3TGU J;  3HUS C;  1PGP A;  2ZXE B;  2KGC A;  1KQG B;  2JYG A;  2KLV A;  3N7N A;  2ZFC A;  2QJP C;  2J58 A;  4K35 A;  1AQT A;  2ZVN B;  5AVT B;  3HYB A;  2KG6 A;  3U43 A;  2JU2 A;  4AYC A;  2J5U A;  1NWQ A;  2A45 I;  2NZ2 A;  1T8K A;  2N6Z A;  5APW A;  1NTK G;  1RY3 A;  5APY A;  1H89 A;  5KLV E;  3O8Z A;  4U0E A;  1VQK P;  1SQX E;  1USD A;  5DJT B;  3PLN A;  1K9M Q;  2KG8 A;  2LF4 A;  1YIJ P;  3NMD A;  5CCH A;  3FXD A;  3CMA P;  2GM4 A;  3ABV C;  3E1I A;  2E74 B;  1KB9 E;  1NTK D;  3CCJ P;  3CX5 I;  1QEX A;  1S5L E;  4UB6 E;  3MGN A;  1PP9 J;  3WU2 E;  1L0N K;  1G1I A;  3AEA C;  4H2W C;  1JCC A;  3LIE A;  1N7S B;  2R32 A;  4NPD A;  1BCC G;  1LTB C;  4D6T G;  1JY3 P;  2KYV A;  1AF8 A;  2CK3 H;  5CCH C;  3AEB C;  2WSS H;  1IZN B;  1ZV8 A;  2DGY A;  2VSQ A;  1HUC A;  5F2O A;  1T8Z A;  2KZI A;  3A0H E;  5CZD B;  2E1M A;  4GOD A;  4MN4 C;  1LP1 A;  2H43 A;  1AQ5 A;  1BCC J;  2WPR A;  4D6T J;  1AFO A;  3G3Z A;  3HUS B;  1A02 J;  2KGE A;  1VQ6 P;  1BCC D;  4PD4 D;  4D6T D;  1ZR2 A;  1SFC D;  1S2E A;  4EOT A;  3H47 A;  4EIJ A;  1L0N G;  1AV1 A;  1L0L E;  2QJP B;  1RNI A;  1WMK A;  2IFN A;  4AUW A;  2WPS A;  1PPJ E;  1PL5 A;  3BAS A;  3MTU E;  1GW4 A;  3H1H E;  1SLQ A;  2WSF J;  1L0N J;  1YQ4 C;  3A7O A;  3SWF A;  3L71 G;  3VOP A;  1GL2 A;  2WT7 A;  4L75 A;  3Q20 A;  1SQQ G;  1RE3 A;  3S9O A;  3TK1 A;  3AE9 C;  5APV A;  4H0L C;  1IFN A;  5TIS E;  2NPS C;  4PJ0 H;  4AQR D;  3IF4 A;  3H1I G;  2RH0 A;  2OTL P;  3M91 A;  3L71 D;  1AYI A;  1GL2 C;  1QL1 A;  5KLI C;  4L74 A;  1SQQ D;  1JY2 N;  1RE3 C;  4ZKP A;  2JU1 A;  3CCS P;  2GUV A;  2PEO A;  5H2F H;  2MJZ A;  3H1I J;  3KYQ A;  3I5C A;  3H1I D;  2MD9 A;  1Y9B A;  2C0X A;  2KOG A;  4ASW A;  1HJ0 A;  1NKZ B;  5KJ7 D;  2L22 A;  5BS2 A;  1EDI A;  2AEM A;  1HTL C;  1PEQ A;  2M5R A;  1FS0 E;  4C7N A;  2P7J A;  2Q9I A;  3BVH A;  1NTK E;  1JNM A;  3Q5S A;  3KQG A;  5KP6 B;  5GTI H;  3CD6 P;  1MZ9 A;  2ZYG A;  4BPH A;  1AVY A;  2OYI A;  2JQ4 A;  4IL6 H;  2GYK A;  3JCU E;  5HGO A;  4I7Z C;  2XU6 A;  3L75 G;  2YMK A;  2E74 D;  2IBZ G;  2JO1 A;  1RQU A;  1LP1 B;  1SQP D;  1OIP A;  2QJK C;  3GMA A;  1M56 D;  5E79 E;  1URQ A;  4MRT C;  4TT3 H;  2HPC A;  4R0M A;  7CEI A;  3SWK A;  1N7S D;  1Q7Y Q;  2L9F A;  2OYI C;  1LTA C;  3L75 J;  2M8L A;  3L75 D;  4DOJ A;  4H0L B;  2IBZ D;  2NPS B;  1H8A A;  5GTH E;  3H1L D;  3FWN A;  4JYC A;  1YI2 P;  2DNW A;  5CBO A;  3V4Q A;  1BCC E;  4PD4 E;  4D6T E;  2P58 A;  1NO4 A;  2O01 J;  1URQ C;  1CW5 A;  1GL2 B;  2WT7 B;  1M6E X;  4W7Y A;  3AE3 C;  4R4L A;  2FXO A;  4GOF A;  2L6E A;  2BEZ F;  5B5E H;  2DW3 A;  5CCG D;  2JWA A;  2CNR A;  1RHZ B;  1JCD A;  3AEG C;  2AFD A;  1PEM A;  2FKW B;  3GF7 A;  2JR8 A;  2KP8 A;  2E75 C;  2ZYA A;  3PP5 A;  4WBA A;  2MVU A;  1OZH A;  1FJP A;  2FQ0 A;  3FXE A;  4U3F J;  2N50 A;  4WWI A;  4BPF A;  3P8M C;  1SQX K;  2POH A;  1LJ2 A;  2EFJ A;  3PTZ A;  3WMM 0;  1KFM A;  5AVZ B;  3L71 E;  3KZI H;  2KIK A;  3M9B A;  2MKV A;  2Q7C A;  2QEX P;  2FQ2 A;  1SQQ E;  4I7Z B;  5DCK A;  1PEO A;  2P1J A;  2KW2 A;  3CL3 D;  3B8E B;  3GZL A;  4Y28 J;  4PV1 D;  2KNC A;  4L73 A;  1WRG A;  3H1I E;  4HH2 A;  2QRX A;  4LC1 A;  1D1D A;  2JWD A;  3L37 A;  4UB8 H;  2PEI A;  3DS2 A;  2KI7 B;  4C7N B;  4H13 D;  3CLQ A;  2PY8 A;  5AVS B;  2XXM A;  3V6I A;  3TYY A;  5CCH D;  2OYI B;  3B4S A;  1NTZ G;  3M9H A;  3MIW A;  2V7Q J;  1SQX G;  1D7M A;  2AF8 A;  2K9J A;  1L4A C;  4JYB A;  4C46 A;  1PGQ A;  4N6J A;  2GZF A;  4F37 A;  2W6B A;  1P84 H;  4PXH B;  2O3J A;  1URQ B;  1OXZ A;  2HPC B;  2Y0C A;  2UWJ E;  2EIA A;  2PP6 A;  1FZA A;  1K73 Q;  1N7L A;  1SQX J;  3CCQ P;  1NTZ D;  3VN0 A;  1ZP0 C;  3VYI A;  1L0L K;  1GD2 E;  5KP7 B;  3AED C;  1F80 D;  3KDP B;  2GZJ A;  4OGQ C;  1LNQ A;  3MUD A;  2LKM A;  2IFM A;  5M1B A;  1TU3 F;  1LT9 A;  1KMI Z;  1GTW A;  1LTT C;  2PNG A;  2W8Z A;  3RL0 g;  2GDX A;  1M8O B;  1X22 A;  3L75 E;  3IFM A;  5KP8 B;  2IBZ E;  1MFT A;  2R5B A;  1HJB A;  4U0D A;  1FOS E;  1E0H A;  1J2J B;  1M57 D;  1GU4 A;  1LT1 A;  4OH8 B;  5KAF H;  5EJD A;  2NO8 A;  4H0L D;  2NPS D;  1N73 A;  3KHU A;  3CME P;  1LT9 C;  1KQS O;  3S1K A;  3RGU A;  1VL2 A;  4BPG A;  5KAI H;  3A3Y B;  4KHX A;  1KYO H;  1S4X A;  1GL2 D;  3MHV A;  5TJH A;  2IZ1 A;  2CQ8 A;  1T2K D;  1L0H A;  2QE7 H;  2OYH A;  1VQ4 P;  4XE5 B;  4DZO A;  3QH9 A;  1KV4 A;  2OGU A;  3KPE A;  1FZC A;  1JY3 N;  1N73 C;  3CCU P;  1L0L J;  3H1K G;  1GZL A;  3HE4 A;  2WPV B;  3RBZ A;  2LTE A;  1DH3 A;  1PGJ A;  5F2N A;  2YKQ A;  2XT1 A;  2WMM A;  2ITA A;  2WSE J;  3GW6 A;  3H1H J;  1IFD A;  2OYH C;  2KNC B;  1VQ8 P;  3WBH A;  3G71 P;  4HKG A;  3AEC C;  2PEJ A;  3TNU A;  3O6Q A;  1FZC C;  1IFM A;  3H1K J;  3DPH A;  2N1T C;  2ZJS E;  3H1K D;  1UNK A;  2XV5 A;  2P67 A;  2K2Q A;  4IZ6 A;  1NTK K;  2JB0 A;  5CBN A;  1MFZ A;  2K9J B;  1NGM B;  4OGQ B;  1ZXG A;  4XRO A;  1FZF A;  4WB4 A;  2FQ1 A;  2AEJ A;  4PD4 I;  1LTJ C;  3G6E P;  2QSI A;  4PJ0 E;  2JAZ A;  3H1J G;  1IJD B;  1S5L X;  4M3L A;  2CG5 B;  3LW5 J;  4CPG A;  2BAS A;  3GF3 A;  4N78 D;  1LT9 B;  2HOD A;  1M90 Q;  1N8R Q;  2Q6Q A;  4C7R A;  3B5N A;  1IUQ A;  2K92 A;  1URQ D;  3VRL C;  1NTZ E;  3AE2 C;  4DG9 A;  5AVY B;  1UJZ A;  3H1J J;  5H2F E;  1CEI A;  4YPC A;  3H1J D;  1KOR A;  1YQ3 C;  1NTK J;  1NQ4 A;  1GK6 A;  1N73 B;  2WSC H;  1DEB A;  1ZR4 A;  2IX7 C;  3U1A A;  3B5N C;  4PH0 A;  1DNY A;  2E75 D;  4ZKU A;  1E79 H;  4YXD C;  2K9Y A;  4DJG A;  1M1J A;  3BAT A;  2OYH B;  2Q1K A;  1H0T A;  1BE3 G;  2EHT A;  1BGY G;  1P84 D;  1FZC B;  3V5B A;  3NTN A;  1M6N A;  3DS1 A;  1PEU A;  2N1T B;  3JSV C;  1WT6 A;  4U7J A;  5CHX A;  3HE4 B;  5GTI E;  2BEQ D;  3CCE P;  1FAV A;  3U59 A;  4IL6 E;  5CJ0 A;  2K3R A;  4W7Z A;  3Q1M A;  1FBM A;  1SQQ K;  1S9K D;  1USE A; 
#chains in the Genus database with same CATH homology
 3DS0 A;  1ZMB A;  2OAR A;  3CC4 P;  5HGO A;  1VQP P;  1QVF O;  4U0D A;  1VQO P;  5HGM A;  4U0F A;  3G21 A;  2EG5 A;  3M1M A;  1M74 A;  1EOQ A;  3H4E A;  4PH1 A;  4U0E A;  5HGL A;  4XFY A;  3G6E P;  2QEX P;  3CCR P;  1VQ7 P;  4U0C A;  1VQK P;  5DCK A;  1S72 P;  1A8O A;  1PEO A;  1K9M Q;  3Q20 A;  2BUO A;  3H0D A;  2BHV A;  3CME P;  1KC8 Q;  1AUM A;  2LF4 A;  1YIJ P;  1QVG O;  1KQS O;  1W2B O;  3B5I A;  4COC A;  1VQL P;  2KOD A;  4XRQ A;  2P9X A;  1Q7Y Q;  1YJ9 P;  3CMA P;  2JO0 A;  3G28 A;  1D1D A;  1M90 Q;  3CCJ P;  2PEI A;  3DS2 A;  1N8R Q;  2PEM A;  3DS5 A;  2M8L A;  2PY8 A;  1Q82 Q;  2XXM A;  3CCL P;  1IUQ A;  1BAJ A;  2OTJ P;  3P05 A;  5BS1 A;  3VRL C;  3HZQ A;  2OTL P;  1E6J P;  1VQ4 P;  4M0I A;  2M8N A;  3OW2 O;  1YI2 P;  3CCU P;  3G0V A;  3DS4 A;  1Q81 Q;  5I4T G;  3CCS P;  3G1I A;  2PEO A;  3LRY A;  4QNB A;  4XFX A;  1M6E X;  2XT1 A;  4XFZ A;  5F2N A;  2PEN A;  3G4S P;  3CXC O;  3CC7 P;  1VQN P;  1K30 A;  4IPY A;  1RO2 A;  2L6E A;  4GR6 A;  2DGY A;  4WYM A;  3G26 A;  3RG6 C;  5F2O A;  1YHQ P;  1JJ2 O;  2EIA A;  3G1G A;  4U0A A;  3CCV P;  4PH0 A;  2E1M A;  1K73 Q;  1VQ8 P;  3WBH A;  3G71 P;  3NTE A;  3CPW O;  2PEJ A;  2Z44 A;  3MGE A;  4COP A;  3CCQ P;  1NJI Q;  1EIA A;  3DPH A;  1YJW P;  1YIT P;  3E2D A;  1YJN P;  1RO0 A;  2JYG A;  3I56 P;  1PEM A;  1M1K Q;  2M8P A;  2QA4 P;  1VQ6 P;  1VQM P;  2Z45 A;  5HGN A;  1M6N A;  3DS1 A;  1PEU A;  3H47 A;  1VQ9 P;  3DS3 A;  5BS2 A;  5JPA A;  1KD1 Q;  3G29 A;  3HYB A;  3CCE P;  1PEQ A;  1Q86 Q;  2XV6 A;  1K8A Q;  3DTJ A;  4U0B A;  4GR2 A;  2CWO A;  2BQ1 E;  2ONT A;  3CC2 P;  1A43 A;  2JYL A;  3CCM P;  1RNI A;  1VQ5 P;  4XRO A;  5F2K A;  3CD6 P;  3I55 P;  1QRJ A;  2PEQ A;  2EFJ A;  2PEK A;  2Z46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...