1Q86R

Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2003-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1q86R00
3I55Q 2QEXQ 3CCQQ 1N8RR 1S72Q 1M1KR 3CD6Q 3G6EQ 3CCEQ 1K9MR 1Q81R 3CCVQ 1VQ5Q 1K8AR 1VQOQ 1VQ4Q 1KD1R 1VQPQ 1NJIR 1K73R 3CCMQ 3CCRQ 1KQSP 1VQ7Q 1YJ9Q 1M90R 1Q82R 1QVFP 1YJNQ 1VQ9Q 3CCUQ 3CC4Q 1Q86R 2QA4Q 1YITQ 1VQKQ 3G4SQ 3I56Q 3CCJQ 1Q7YR 1QVGP 3G71Q 3CPWP 1YI2Q 1JJ2P 3CCSQ 1YJWQ 2OTJQ 3CXCP 1VQMQ 1YIJQ 3OW2P 2OTLQ 1KC8R 1W2BP 3CC2Q 3CMAQ 1VQLQ 3CC7Q 3CCLQ 1VQ6Q 1VQNQ 1VQ8Q 1YHQQ 3CMEQ
chains in the Genus database with same CATH superfamily
2VUBA 2XG8D 1OOTA 4J6XA 4M77B 4BI8B 2CGHA 5IHKA 3OYCA 2AT1B 1M3AA 2YRCA 4X1VA 1X27A 2HQHA 3RKXA 5CQYA 2FPFA 4M7DF 2PU9B 1D1CA 1UGVA 1ZSZA 2CP3A 2QTVA 4D8KA 1Q7YC 2XHCA 4BUGA 3QWXX 4TVRA 1M90U 2DJZA 3JB9H 2DZ9A 4C92F 3M4GA 1BB9A 1PM3A 3NHNA 4N4HA 2MWPA 2EYQA 1Q81U 4KGVB 2JW4A 3N5BB 2YHTA 4QQGA 3OSVA 1M2OA 1R0BG 5KYYA 2RK2A 7AT1B 2L3QA 1BKBA 1UEBA 5GAOm 2K3XA 3OYEA 1NEGA 1IGUA 1VQ4T 1Q86C 2F69A 3OYYA 5IXBA 1WNLA 5LL6S 1MMNA 5FU7B 2PVDB 5CKBA 3MEUA 3CCSQ 4PJLA 2FRYA 1KC8R 2MYSA 5LJ3h 2M1HA 2VXEA 5EG2A 2C0TA 2A36A 1YHQQ 1PWTA 4LDUA 1UG1A 2JNGA 5FRNA 1RLQC 1X43A 4GY5A 2L0AA 4Z02A 4AMCA 5IN1A 2ED1A 5GAMg 1YJWT 2V1QA 4Z89A 3EH1A 1M3CA 2ABLA 3PMIA 9ATCB 2KK4A 1TXQA 2LJ3A 2YRVA 3OYKA 2KAFA 3OS1A 3A1PA 3EG9B 4AFZC 4M75B 1VYTA 1WHLA 2LX9A 3FEOA 3CD6T 4J9FA 5I11A 2DPPB 3OS5A 3CCQA 2EYYA 2I2LA 2W10A 2GBQA 2I0NA 3CPWP 2COWA 2KDSA 2MK5A 4F7UF 1G5VA 2PUOB 4JJCA 4JRIA 1YJ9A 2VKNA 4J5YA 5GAOn 2OI3A 3VRZA 4OB3B 3HRSA 4D6WA 4LUDA 3CCQQ 3CD6Q 2CP0A 3MEVA 2XDBA 4M7AB 2XU8A 2V8KA 1M1KU 4RG2A 4E7LA 3EGUA 1TG0A 1YITQ 5IT9E 1TUCA 2JMCA 2HKNA 2AHJB 4DQ2A 1WXBA 3OW2P 2CH4W 4BI4A 2KT8A 2QEXQ 2EQIA 1BCOA 4ZNXA 3VUZA 2RHIA 3FJPA 5C0MA 1XTDA 3UATA 3FLGA 4ZGJB 3QG1A 2OAWA 1YJNA 5GMKh 3H8ZA 1R0CB 1UGRB 3OB9A 3OYJA 2HL5C 3QJYA 2LCCA 3EGDA 1RAHB 5GJVB 1N9SA 3JCMX 4KBMB 1NLPC 1SPKA 2EQUA 2X4JA 1A0NB 4XK8E 3CCRT 1GCQC 2LZ6B 4R55A 1OX9A 4C92G 1VIFA 4EMKA 4FYWB 4PJOC 3HSBA 4J6WA 4C92A 4IIOA 2X3XD 2AZSA 1AWXA 1GBRA 1I07A 1WHJA 2DJQA 1MUZA 2FEIA 2RHUA 1K9MR 5KYUA 4JJNK 1W4SA 1H641 5HKCA 1SKUB 2MCNA 1OV3A 1QVFP 2K3YA 2DYBA 3CCUQ 3VS6A 3BW1A 2FZCB 2R57A 4IUPA 5CIUA 2EYWA 3G71Q 4ELYC 1CKBA 3OA6A 1W2BA 2D0NA 1RI9A 1M30A 4FW1A 1WPYA 1IREB 3KFVA 2L5QA 1PSFA 4C5IA 4QQ6A 3QSUA 2CZ0B 5CVIA 3I9QA 2CZ1B 3NMZC 3VS0A 2PZ1A 3F70A 1X75C 4MZTA 3I5SA 3HRUA 5CR2A 2OJ2A 5GMKj 3MP8A 1NJIC 2BE9B 3QZ5B 1V76A 3ZBDA 4J9DA 3EG3A 1B34B 4FT4A 3OYBA 3CMAA 4J9BA 1ZBXA 2DXBA 5I2MA 3CC4T 3FC3A 1K0SA 4F7UG 1ZLMA 5ECAA 1OPKA 2PUKB 1KK7A 1X2QA 1JU5C 2RQWA 2EGCA 1ABOA 4DOVA 4CC4B 1VQ6A 1RAAB 1NM7A 4KRTA 4OB1B 1AWOA 2EKOA 1ZSGA 4V2SA 1Z9QA 2CREA 1VQKQ 2YLBA 4XTZA 1RI0A 4RTWA 3CCEA 2EJFA 2EKHA 1BCMA 2CSQA 2QGGA 1NBEB 2NLUA 1FX7A 4DBHA 2EVRA 2A0FB 3TREA 1SF9A 1ZUYA 1KG1A 2VYTA 4ZGEB 1WI7A 1M90R 1TUGB 1LVKA 3QO3A 4F04B 5I22A 4A4KA 2DZCA 2JUFA 1KC8C 1ACMB 3RMQA 1BI3A 1T0HA 1M2VA 2L2PA 5KE3A 1PKTA 4M7DG 3CCUA 1QVFS 3J81E 3PVQA 5CCAA 3C95A 3LGFA 1VQ4Q 5J3BA 1JXOA 4RUGA 1U1TA 3ZFJA 2X9HA 2O9VA 2DYIA 3HTRA 1QKWA 4ORZA 4PFOA 4C8QD 1MV3A 3CXCP 5KYUB 1OI1A 3V8LA 1VQMT 4LXCA 1KQ2A 1U5SA 3G1JA 1VQ4A 4JRPA 4M7AF 2HMAA 3I55Q 3PT9A 1ZUUA 1KC8U 2P4TA 5CKDA 5FLXE 2GGRA 1I0CA 2KMTA 4PFZA 3VS3A 4XU0A 5L8RE 1N27A 2HDAA 4E7IA 1PG5B 4C92C 4M7AD 3G6EA 5KYYB 1TS9A 1UTIA 2K6DA 1MMGA 2CP2A 4E2FB 4JJDA 3EHRA 2E6ZA 5IHNA 4JZ4A 1VQ8T 3MKDA 1Y7XA 4C0ZA 2O4XA 2LCSA 3G6EQ 1GRIA 2KEAA 2X3WD 2NUPB 2VXFA 2XMFA 2DERA 2VB6A 3LX7A 1MGQA 1FWZA 3OYGA 3G4SA 4LDYA 3CMAT 1UDLA 2AZVA 3QZ9B 5D6WA 2LX7A 1VQ6Q 1VQLT 2L3PA 1Q7YU 3LLRA 3QHSA 2PVOB 3UWNA 3CCEQ 2VASA 4Q5WA 1YBYA 5HY6A 3AT1B 5GAN3 1D0ZA 4M4ZA 1YWOA 3EFRA 1K9MC 1MNEA 4EIKA 2QEXA 3OSSC 1NJIU 2KYMA 1G2BA 1Q7YR 2LVMA 1PRMC 1QP3A 2RB6A 2LQKA 1AVZC 4C0DC 1M1FA 1OZ2A 2FG0A 3SWNB 1O9SA 3MO8A 2ESWA 2BTTA 4PJNA 4J83A 1KQ1A 4JS5A 1MMAA 3M0RA 2CUDA 2DLPA 2E3IA 1YITT 3CC4Q 2LQNA 2K5IA 2DFUA 2COYA 3E1SA 4OGEA 4AG2C 2CKKA 2OAUA 3DLMA 1WYXA 1HK9A 3LH5A 3RKWA 2GCXA 1U1SA 3G7ZA 2JT4A 4J9HA 3V7SA 4HCKA 4ATOA 1BK2A 3I35A 3HPWA 4MMKA 3BDLA 3PGGA 1KIKA 4HVVA 3DLLA 4MDXA 3PNWC 2BUDA 1U06A 1VQLA 4J7IA 2RHZA 2D1XA 1VQNT 1M1KC 4PK4A 4ZTJA 4ELZC 1G3WA 2K4YA 2RJFA 4DBRA 3M59A 2OTLA 1F1BB 3WXMB 2QDLA 3V8JA 1P92A 1H92A 5IH2A 3A8OB 2DTIA 3RDVA 2DILA 2QXFA 3I56A 3CBOA 3ZEHA 3I5RA 1D3BA 4KT0E 1ZUKA 2OTLQ 1QVPA 3C0CA 4BDYA 5GAMj 4M78D 5CKEA 4AT1B 1JBMA 4MZPA 3VS2A 2C0OA 4CC2A 3CMEQ 2VGNA 4M7AG 2FHDA 2RK1A 4J9IA 2RI3A 1WX6A 4M78E 4PJOG 1YN8A 1Q81C 4J9EA 1HXDA 2DK3A 8AT1B 5KYNA 2EJGA 2C06A 5A0LA 1M9SA 1N5ZA 2KRSA 3OMGA 1UUEA 3CMAQ 2RD1A 4JRKA 1PCXA 3EG1A 2K3BA 3ASKA 4M7DB 2GF7A 5CKFA 1BBZA 4E7HA 1YJWA 1OX8A 1Q95G 2KVQG 1WHMA 1UECA 2YUOA 3VRYA 2LC4A 1I4K1 1GXIE 3CPWS 3GPLA 2K79A 4M77E 1AOJA 2SRCA 1MNDA 1W1FA 1NLOC 1JO8A 3X25B 1PKSA 3QIIA 5LJ5d 4FIBA 1GL5A 1QKXA 2RM4A 2D9TA 1UB4A 2H3JA 2D8HA 3NGPA 1KFZA 2ZPGB 5GAMf 1YIJT 1PHTA 4C0FA 2M9UA 4RTVA 3CCLT 1S72A 2LQWA 2XD0A 1RLPC 2EGEA 2EYXA 2DF6A 4M75E 2HNIA 5GAN5 2J6OA 5FW9A 1LPLA 2QI2A 1VQ7T 1VQNA 2EQJA 2QAZA 2QDYB 1TU0B 2L8DA 1PNJA 2D8JA 4B6MA 3UA6A 2MPXC 1KD1C 1AWJA 2E1HA 1G3TA 3HL8A 3REBB 1RAIB 1EX4A 2CZ6B 4N0AC 3M54A 2RO0A 2DEQA 3M53A 3REAB 3JCMQ 1M8MA 1VQNQ 2LCLA 2O88A 2JM8A 4L59A 2LDMA 5CQXA 4NL2A 5KYWA 1SHFA 2Y4YA 3TEEA 2KYBA 1G83A 4FSSA 3QYHB 1M1GA 1JXMA 3H9NA 2ZPFB 2J6KA 1YITA 1Q86R 5GANf 3JB9I 4EMKC 3VS7A 5CKHA 1QLYA 1V1CA 3CC2Q 4C8QC 3CCRA 2BZ8A 1J3TA 2QK0A 3E9GA 4PL6A 1S72T 4HA8A 3CBPA 3RUXA 2V8IA 3KUFA 4IKFA 4AFUC 5FWBA 1EZZB 1K8AC 1H8KA 1CKAA 2E5QA 2FYKA 2VGMA 1VA7A 1YJWQ 3C94A 3A8HB 4JLGA 3OY9A 3PTAA 3E2UA 3V7CA 5A2QE 5IXFA 2DX1A 3LGLA 4M78B 1EFNA 1OZ3A 2AKKA 2DXCA 3QKJA 2LT4A 3NTKA 2DMOA 3ME9A 2YDLA 3C12A 3FJ5A 4M77C 4RTTA 2RJDA 2JMAA 4X9DA 1B34A 4E7JA 1SHGA 1G8XA 2BZYA 4BD3A 4HCZA 3CCST 2HCKA 5GANd 1GCPA 2FPDA 3OYHA 3A5ZB 4M7AE 2HD0A 1BIBA 3MEAA 4EDUA 2O2OA 2KBTA 2QQSA 2ZAEA 1NEBA 4M7AC 2MIOA 3UA7A 3JRZA 1JQQA 5A0DA 1QCFA 4EMGA 2ZPHB 4QKUA 3G4ST 3ULRB 4BY6C 1YIJA 1VQLQ 4PJOE 5M9OA 2DXUA 2LT1A 5KYXB 2DNUA 5LJ5j 2J06A 1IXDA 4A4EA 1C0MA 1D0YA 4BE0A 2VWFA 5GAMh 3J80E 4HCCA 4MZMA 1FMVA 4FYVB 1X2KA 1VQ9A 4Z88A 2E70A 4O6JA 3VYHB 1UE9A 2AIRB 1UJYA 5DLOA 4M75A 1TUDA 4XTYA 1DJ7B 2V26A 1U3OA 2MMPA 2JTEA 1GFCA 3EFOB 3JCMh 2CUBA 1RAEB 3CCRQ 4J9GA 2RQUA 4N4GA 3VKIA 3V7RA 1M5Q1 4N4IA 3M5AA 1MV0B 1Y96B 3CEYA 2M0OA 3SB2A 3OW2A 3P8DA 3X26B 1M27C 1OQKA 2DKGA 2RHYA 3S3MA 4XTWA 3A8LB 2CP6A 2E64A 1I81A 4M75C 4KH0B 3H0IA 1VQ5Q 2E6NA 4RG8A 1RABB 3CCMT 1W2BS 2HAXA 1TOVA 3E19A 3CCLA 3EAEA 2XI9A 4LD9K 2EYZA 1JRIA 4IUUA 1I1JA 3NTIA 1VQMA 3VS1A 2M51A 1SRLA 3LYIA 5LJ5f 1NYFA 2E10A 4GBQA 4PLIA 2JOYA 1YHQT 3ZL7C 1IZ6A 3BY7A 4KGXB 4EPCA 1OU8A 4ZN3A 1GCQA 4WTOB 2O31A 4C0GA 1BYMA 4EMHA 4J9CA 1YI2A 3UT1A 3OYNA 4M78A 1PRLC 2QA4T 1UFFA 2JXBA 3C4SA 1PC0A 1T3LA 2IG0A 2KY9A 4P5NA 2OTLT 2P0KA 4Y28E 5EC7A 3L2RA 1VQ6T 2DL8A 1RUWA 2EGAA 2X4XA 1S72Q 1ABQA 1JJ2A 1WJSA 3MCAB 5FU7C 3PE0A 5CAIA 3RBBB 2E4HA 4MMLA 4XQ3A 1NYGA 1KHIA 1ZHIA 2V1RA 4C92B 4FYYB 1YCYA 4X34A 4PJOF 3G71T 2M16A 2RA2A 1AZEA 3CC4A 1K0XA 3SDZA 2C0IA 1VYVA 3S3OA 2DVJA 4E7ZA 3EGXB 2RJEA 2JZ2A 2A28A 2DE0X 3J7AF 2F2VA 4M77D 1BU1A 3OYDA 1I8FA 2DBMA 2B8AA 3TSZA 2D6FA 5CO7A 1VOMA 2COZA 3MHXA 2ROTA 3RERA 4ZGDB 2CDTA 4A4HA 1D1AA 3BE3A 2FVUA 3JCMJ 4AG1C 2QEXT 1WJRA 2FZGB 1WHGA 3INZA 3M9QA 4C8QA 2NYSA 3RIRA 4PJMA 1NJIR 5LJ3j 1D1BA 2P84A 2DVEA 1YJNT 4PNOA 5FWCA 4Y92A 3G4SQ 3M0PA 2JVVA 2LJ1A 3GNGA 2HSPA 2HSEB 3QPHA 4RTXA 3PVLA 2MOXA 1M1KR 1WXUA 3CMEA 3OYFA 5DM7R 1KQSS 2F5KA 1K8AR 2BE7D 1TTHB 1Y96A 1XNIA 2CT3A 5KE2A 2KROA 1IHWA 4A4FA 3OYIA 1VQ9T 3WVDB 3M57A 1U8RA 4FU6A 3MJXA 4OB0B 3QBYA 2E12A 3MP6A 4F7UE 2YWWA 5GAN2 4R56A 5GMKl 4C5GA 1X6OA 1WA7A 5LJ5h 2LNVA 2YUNA 2KE9A 2XDPA 3M56A 3TVTA 2MWOA 1NE8A 3VV0A 4K11A 5J26A 4AFSC 3M4YA 2A37A 3HFNA 1YWPA 3CPWA 2RJCA 1OPLA 4M75G 1QW1A 3CCVQ 4M7DA 3OS0A 2XDDA 4QQDA 1E6GA 3PFSA 4M75F 2JTFA 2W0ZA 4BE1A 1K9AA 4XTUA 3E9FA 3V8KA 2EPDA 2DIGA 3CCVA 2NUPA 4OMNA 2ECZA 3OBYA 2M02A 1D09B 3UF4A 3R6NA 2KI7A 4JDSA 2DO3A 3EH2A 4BB7A 1LOJA 2OX7A 3QYGB 1PD1A 5IHIA 3SEMA 3I56Q 1WHKA 4C8QF 4M77F 2IIMA 3SWNC 2VVKA 4DA4A 3OYLA 2DAQA 4M77G 3Q1JA 2XIDA 3VU3C 3WVEB 2LMJA 5A0GA 3L2QA 4FW2A 4PJOA 4JJBA 5GANe 2H8HA 1KD1R 1K73R 4M77A 5D6YA 2DTOA 4PJOD 5AYFA 2EW3A 2QG9B 4L5GA 4C92E 2IVWA 2MI6A 3X28B 4M78G 3L2VA 2BZXA 2FRWA 1YFNA 1KD1U 3H0HA 4GLMA 2GTOA 2LP5A 2EIFA 4M78F 2FO0A 4M7DE 5IAYA 2ATCB 1ZA1B 3D7SB 2CYZB 2D0QB 5I2SA 4C5EA 4J8OA 5GAOp 3OS2A 1Q82C 1SEMA 2QTXA 2HQEA 1VQ5A 1KQSA 3CXCS 4FYXB 2ROLA 3CCLQ 3QXEB 8ATCB 1K73C 2YSQA 1RADB 1PD0A 3LW5E 1K4US 2WSFE 4E7SA 4NL3A 3KBGA 2KNBB 5GMKm 1N9RA 3JCMP 2L89A 4BE2A 1V29B 2JS2A 2QYZA 4KGZB 4XTVA 2OTJA 5GANg 2X51A 2DEUA 4YTLA 1OULA 4BACA 3EFOA 2BIVA 1WDXA 2ZPEB 4OMPA 3CCVT 1KQSP 1UHFA 3VS5A 2MF2A 3IQLA 2LNHB 1K9MU 3GP8A 2EQKA 5KCOA 5J39A 1HJDA 3ER0A 2RQVA 4QVCA 4KH1B 2YUPA 1RL2A 1NG2A 1WZOA 3RR6A 4M7DC 2K5FA 1C1AA 2LTOA 3TCJA 3AHUA 3LWHA 2EQMA 3PMTA 4CC7A 1VYUA 1VIEA 1WIEA 3A98A 2DM1A 2XK0A 2EBPA 2ZZDA 2EFIA 3META 1VQ7A 3SHWA 4PFPA 1IO6A 2RMOA 5GANj 2JS0A 4NS5A 4RMOA 2DRMA 4LUEA 1UGPB 2NUZA 2DL5A 4ZN1A 1W70A 3QDFA 2WSCE 2A08A 2ZCFB 2ZPIB 3OMCA 4LE9A 3PIPA 2J7IA 3GBQA 5HK3A 2AK5A 4M7AA 1D3BB 2QGFB 2QQBA 4M7DD 2CS7A 4DBFA 4XU1A 4HT9A 2DXTA 3QDRB 4NOYA 4BI3A 3CMET 4C8QG 5CK9A 1IB8A 1QVGS 1KSWA 2RH2A 5LJ3g 1BI0A 3OW2S 5GAOr 3LH0A 5LJ5e 3L2ZA 4HCBA 3MPUB 1YJNQ 4PJOB 1QCOA 2LQ8A 1QVFA 3A8MB 1VQKT 5GMKe 2M0YA 2AKLA 4J7FA 1YCSB 3KXTA 2JM9A 2GTJA 2DD4A 3NTHA 5LJ3e 4IUTA 2RHXA 2PQWA 2P0QA 3M0TA 2K9GA 3CXCA 1R8OB 2LJ0A 4DBQA 3EHQA 1K1ZA 1KJWA 1BIAA 4GLKA 4XTXA 3OBWA 1JJ2P 1YI2Q 2A3LA 4C0DB 4HXJA 4RTYA 4OF1A 1EIFA 1YIJQ 4ZTFA 3MP1A 1I5OB 3S6WA 1UGSB 4JLIA 1XQHA 2P0PA 3CC7A 3L1AA 1AD5A 3FIFA 4A63B 2GQIA 1ZBJA 1X69A 4WF2A 1TH7A 2A7YA 3FB9A 2E5KA 2CZ7B 4RCCA 1VQ9Q 4RCBA 3CCUT 1QP2A 2L3SA 1Y57A 4OMLA 1Q82U 5GAN8 4JZ3A 1XOVA 2WACA 5I21A 3CC7Q 4N0AA 1AWWA 3EGDB 2R5MA 3EG2A 1YNZA 2DL7A 2K2MA 4F7UA 2JJ9A 1VQ5T 2O01E 3FDRA 4HKEA 1CSKA 1NPRA 1Q82R 3CPFA 4ANJA 5D7UA 5KH6A 2ZGWA 2V8JA 4AFQC 1ZSZB 2XICA 4FL6A 1WLPB 2O9SA 2PNIA 3GNFB 1B7TA 1AT1B 3FRNA 4OB2B 4E6RA 2CH4A 2RPNA 1HYOA 2NUTB 1VQOQ 1VQPQ 4MDWA 2QQ9A 3S3NA 1GFDA 1I5LA 2G6FX 2FB7A 2CP5A 2GNCA 3TU4K 1WXTA 1ZX6A 4FCYA 4IURA 3H0FA 3M55A 2F2WA 1X01A 2OTJT 2FL7A 2O4XB 1WFWA 1D0XA 3GF5A 2KRNA 2FPEA 2HEQA 3X24B 2QQAA 1VQOA 3JB9D 3UDCA 4A53A 1QMCA 4C8QE 4QVZA 2RF0A 3M0UA 4RTZA 1VQPT 2DTHA 2R5AA 3H41A 4LN2A 2XKOC 5HK0A 1C6VX 2B86A 4PLLA 3OYAA 2HBPA 1SG5A 3U23A 1T0JA 5C6SA 4XU2A 1T3SA 3OQ5A 1NZ9A 1OEBA 3L2WA 1VQ8Q 4OMOA 1QCNA 4FM4B 3NPFA 1HD3A 4C92D 1IHVA 4A4GA 1WGSA 3DB4A 1LJOA 3O8VA 5FU6C 4F14A 1FXXA 1VQ8A 2HQXA 2X4YA 3SWNA 3CCJQ 4M75D 1LNXA 1WJQA 3HP9A 2QQRA 3LWIA 5GAN6 2Y90A 4XU3A 2K7AA 2KQWA 4M78C 5LJ5g 3GIBA 3CCJA 2KRMA 4OMQA 2J05A 4L6V5 3CCJT 3JCMf 3SD4A 2Y4XA 4KUIA 4HT8A 1M3BA 4X9CA 1K8AU 1SSFA 3I55A 3I55T 1G3YA 4JS4A 5LJ3f 1UHCA 3TSWA 2K5LA 2E3HA 2QASA 2P4RA 1QQJA 3DKMA 2DBKA 4HVUA 3JB9J 4FT2A 1AHJB 1GBQA 1B3QA 2R58A 1JJ2S 1RAGB 4JPBW 4F7UB 4FSXA 4BY6B 3CD6A 1SSHA 1E7OA 4CI0C 3JB9F 3HKSA 1Q81R 1G3SA 1H3HA 4IUVA 3URGA 3PIOA 3EG0A 4HVWA 1S1NA 1VQPA 2HZYA 3A8GB 3QUIA 2X35A 4D8DA 1UGQB 1IRXA 3JCMc 4R0KA 4DOWA 3CCMA 4JUVA 1H3ZA 2ED0A 3P8BB 5GAOq 2RQTA 1RAFB 2PTKA 3VJPA 5DLQE 2DA9A 3RKYA 1LCKA 1XJWB 1Z9ZA 2YRDA 3SFMA 5GAMe 2NUTA 4E7KA 2YT6A 2FZKB 3I56T 3JV3A 1VQMQ 2BKDN 2SEMA 1OYXA 3RMSA 5LJ3d 1X6BA 3MEWA 1JB0E 1QWFA 2H3EB 3THKA 1AZGB 3CCQT 4PKCC 3VYGA 5L23A 5GMKi 3CCSA 4LDXA 4OMMA 3X20B 3JCMe 2GFUA 4CRIA 1Y0MA 3QJ6A 2E65A 3GOXA 4KUDK 3H6ZA 3DB3A 2DIQA 1BI1A 3O5ZA 4IUQA 2KXDA 1K73U 2EWNA 5KCHA 2WSEE 4CC3A 1WHHA 2RQRA 2F5TX 5FU6B 6AT1B 4RTUA 4LDVA 1IGQA 3G71A 2F2XA 2JTMA 4UC4A 1Y71A 1QVGP 1RACB 4Z8AA 1YHQA 3EGXA 1B07A 4OGCA 5FRMA 5FROA 2DL3A 2F1LA 4QVDA 4ME7A 2IPOB 4QW2A 1ZQ1A 1K76A 1YJ9Q 4B9WA 2EAYA 2K57A 3OYMA 2KGTA 1FMKA 1YI2T 5GAOl 1FMWA 2E41A 3L42A 2GFAA 2DETA 4OP0A 4F16A 1Q86U 4EMKB 3JCMb 3M0QA 3CC7T 3BDUA 1NPPA 4C8QB 1ARKA 3NFCA 1E6HA 1PSEA 1YJ9T 5HCKA 4ESRA 4WCIA 1FYNA 2PVGB 2HKQB 4O5VA 1Y07A 3M58A 1TSFA 4JRQA 2KXCA 3R6OA 4J6YA 1JEGA 4LNPA 3L2UA 3EFSA 4PJJA 1M90C 4OMFB 2DRKA 1KHCA 1M8VA 5GJWB 4LDWA 3CCMQ 4LD6A 3JB9G 1QVGA 2ENMA 3UPUA 1VQKA 1W6XA 1O75A 1WQ7A 2VC8A 1AEYA 2K2VA 1M2VB 1UJ0A 2OTJQ 3HHTB 3CC2T 3HFOA 3JCMV 2HL3A 4RKUE 2RN8A 3VUBA 2QA4A 4B9XA 5AT1B 1YP5A 4IIMA 4VUBA 3CCET 2LRQA 1BI2A 4F17A 4A54A 4DEYA 1M4ZA 2X4WA 4QT7A 2VV5A 1N8RC 5DY9A 3RESA 4C5HA 5GAN4 3JCMd 4BDZA 2YUQA 3RNJA 2Z0WA 2QA4Q 4E47A 3EG9A 1MHNA 4Y91A 2EJ9A 2KR3A 1W2BP 3JSCA 2J6FA 1HSQA 3G6ET 1SRMA 2CP7A 3TQ7P 2DD5A 3HRTA 3CBMA 1VQOT 1VQ7Q 2RI2A 5GAMd 1MMDA 1ZSZC 3JCMg 3QWYA 3JAME 1VUBA 2YLCA 1N6AA 5KYXA 3P8HA 1QWEA 3GLXA 1X6GA 1OU9A 2YXYA 2NWMA 2RNAA 4DEXA 2MAMA 5GAN7 3M0SA 2CT4A 1TWBA 1N8RR 4II1A 1WQWA 3CQTA 2RI5A 4OVAA 1ZA2B 2HBWA 3VS4A 5KYWB 2ZPBB 3BFMA 3T9NA 2KSSA 2JN0A 2GQVA 4KULA 3JCMW 4XAXB 1R77A 2CSIA 2L3RA 2DL4A 1N8RU 3CC2A 2KT1A 5D6XA 2G3RA 5GANh
chains in the Genus database with same CATH topology
3I55Q 2QEXQ 3CCQQ 1N8RR 1S72Q 1M1KR 3CD6Q 3G6EQ 3CCEQ 1K9MR 1Q81R 3CCVQ 1VQ5Q 1K8AR 1VQOQ 1VQ4Q 1KD1R 1VQPQ 1NJIR 1K73R 3CCMQ 3CCRQ 1KQSP 1VQ7Q 1YJ9Q 1M90R 1Q82R 1QVFP 1YJNQ 1VQ9Q 3CCUQ 3CC4Q 1Q86R 2QA4Q 1YITQ 1VQKQ 3G4SQ 3I56Q 3CCJQ 1Q7YR 1QVGP 3G71Q 3CPWP 1YI2Q 1JJ2P 3CCSQ 1YJWQ 2OTJQ 3CXCP 1VQMQ 1YIJQ 3OW2P 2OTLQ 1KC8R 1W2BP 3CC2Q 3CMAQ 1VQLQ 3CC7Q 3CCLQ 1VQ6Q 1VQNQ 1VQ8Q 1YHQQ 3CMEQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I55 Q;  2QEX Q;  3CCQ Q;  1N8R R;  1S72 Q;  1M1K R;  3CD6 Q;  3G6E Q;  3CCE Q;  1K9M R;  1Q81 R;  3CCV Q;  1VQ5 Q;  1K8A R;  1VQO Q;  1VQ4 Q;  1KD1 R;  1VQP Q;  1NJI R;  1K73 R;  3CCM Q;  3CCR Q;  1KQS P;  1VQ7 Q;  1YJ9 Q;  1M90 R;  1Q82 R;  1QVF P;  1YJN Q;  1VQ9 Q;  3CCU Q;  3CC4 Q;  1Q86 R;  2QA4 Q;  1YIT Q;  1VQK Q;  3G4S Q;  3I56 Q;  3CCJ Q;  1Q7Y R;  1QVG P;  3G71 Q;  3CPW P;  1YI2 Q;  1JJ2 P;  3CCS Q;  1YJW Q;  2OTJ Q;  3CXC P;  1VQM Q;  1YIJ Q;  3OW2 P;  2OTL Q;  1KC8 R;  1W2B P;  3CC2 Q;  3CMA Q;  1VQL Q;  3CC7 Q;  3CCL Q;  1VQ6 Q;  1VQN Q;  1VQ8 Q;  1YHQ Q;  3CME Q; 
#chains in the Genus database with same CATH topology
 2VUB A;  2XG8 D;  1OOT A;  4J6X A;  4M77 B;  4BI8 B;  2CGH A;  5IHK A;  3OYC A;  2AT1 B;  1M3A A;  2YRC A;  4X1V A;  1X27 A;  2HQH A;  3RKX A;  5CQY A;  2FPF A;  4M7D F;  2PU9 B;  1D1C A;  1UGV A;  1ZSZ A;  2CP3 A;  2QTV A;  4D8K A;  1Q7Y C;  2XHC A;  4BUG A;  3QWX X;  4TVR A;  1M90 U;  2DJZ A;  3JB9 H;  2DZ9 A;  4C92 F;  3M4G A;  1BB9 A;  1PM3 A;  3NHN A;  4N4H A;  2MWP A;  2EYQ A;  1Q81 U;  4KGV B;  2JW4 A;  3N5B B;  2YHT A;  4QQG A;  3OSV A;  1M2O A;  1R0B G;  5KYY A;  2RK2 A;  7AT1 B;  2L3Q A;  1BKB A;  1UEB A;  5GAO m;  2K3X A;  3OYE A;  1NEG A;  1IGU A;  1VQ4 T;  1Q86 C;  2F69 A;  3OYY A;  5IXB A;  1WNL A;  5LL6 S;  1MMN A;  5FU7 B;  2PVD B;  5CKB A;  3MEU A;  3CCS Q;  4PJL A;  2FRY A;  1KC8 R;  2MYS A;  5LJ3 h;  2M1H A;  2VXE A;  5EG2 A;  2C0T A;  2A36 A;  1YHQ Q;  1PWT A;  4LDU A;  1UG1 A;  2JNG A;  5FRN A;  1RLQ C;  1X43 A;  4GY5 A;  2L0A A;  4Z02 A;  4AMC A;  5IN1 A;  2ED1 A;  5GAM g;  1YJW T;  2V1Q A;  4Z89 A;  3EH1 A;  1M3C A;  2ABL A;  3PMI A;  9ATC B;  2KK4 A;  1TXQ A;  2LJ3 A;  2YRV A;  3OYK A;  2KAF A;  3OS1 A;  3A1P A;  3EG9 B;  4AFZ C;  4M75 B;  1VYT A;  1WHL A;  2LX9 A;  3FEO A;  3CD6 T;  4J9F A;  5I11 A;  2DPP B;  3OS5 A;  3CCQ A;  2EYY A;  2I2L A;  2W10 A;  2GBQ A;  2I0N A;  3CPW P;  2COW A;  2KDS A;  2MK5 A;  4F7U F;  1G5V A;  2PUO B;  4JJC A;  4JRI A;  1YJ9 A;  2VKN A;  4J5Y A;  5GAO n;  2OI3 A;  3VRZ A;  4OB3 B;  3HRS A;  4D6W A;  4LUD A;  3CCQ Q;  3CD6 Q;  2CP0 A;  3MEV A;  2XDB A;  4M7A B;  2XU8 A;  2V8K A;  1M1K U;  4RG2 A;  4E7L A;  3EGU A;  1TG0 A;  1YIT Q;  5IT9 E;  1TUC A;  2JMC A;  2HKN A;  2AHJ B;  4DQ2 A;  1WXB A;  3OW2 P;  2CH4 W;  4BI4 A;  2KT8 A;  2QEX Q;  2EQI A;  1BCO A;  4ZNX A;  3VUZ A;  2RHI A;  3FJP A;  5C0M A;  1XTD A;  3UAT A;  3FLG A;  4ZGJ B;  3QG1 A;  2OAW A;  1YJN A;  5GMK h;  3H8Z A;  1R0C B;  1UGR B;  3OB9 A;  3OYJ A;  2HL5 C;  3QJY A;  2LCC A;  3EGD A;  1RAH B;  5GJV B;  1N9S A;  3JCM X;  4KBM B;  1NLP C;  1SPK A;  2EQU A;  2X4J A;  1A0N B;  4XK8 E;  3CCR T;  1GCQ C;  2LZ6 B;  4R55 A;  1OX9 A;  4C92 G;  1VIF A;  4EMK A;  4FYW B;  4PJO C;  3HSB A;  4J6W A;  4C92 A;  4IIO A;  2X3X D;  2AZS A;  1AWX A;  1GBR A;  1I07 A;  1WHJ A;  2DJQ A;  1MUZ A;  2FEI A;  2RHU A;  1K9M R;  5KYU A;  4JJN K;  1W4S A;  1H64 1;  5HKC A;  1SKU B;  2MCN A;  1OV3 A;  1QVF P;  2K3Y A;  2DYB A;  3CCU Q;  3VS6 A;  3BW1 A;  2FZC B;  2R57 A;  4IUP A;  5CIU A;  2EYW A;  3G71 Q;  4ELY C;  1CKB A;  3OA6 A;  1W2B A;  2D0N A;  1RI9 A;  1M30 A;  4FW1 A;  1WPY A;  1IRE B;  3KFV A;  2L5Q A;  1PSF A;  4C5I A;  4QQ6 A;  3QSU A;  2CZ0 B;  5CVI A;  3I9Q A;  2CZ1 B;  3NMZ C;  3VS0 A;  2PZ1 A;  3F70 A;  1X75 C;  4MZT A;  3I5S A;  3HRU A;  5CR2 A;  2OJ2 A;  5GMK j;  3MP8 A;  1NJI C;  2BE9 B;  3QZ5 B;  1V76 A;  3ZBD A;  4J9D A;  3EG3 A;  1B34 B;  4FT4 A;  3OYB A;  3CMA A;  4J9B A;  1ZBX A;  2DXB A;  5I2M A;  3CC4 T;  3FC3 A;  1K0S A;  4F7U G;  1ZLM A;  5ECA A;  1OPK A;  2PUK B;  1KK7 A;  1X2Q A;  1JU5 C;  2RQW A;  2EGC A;  1ABO A;  4DOV A;  4CC4 B;  1VQ6 A;  1RAA B;  1NM7 A;  4KRT A;  4OB1 B;  1AWO A;  2EKO A;  1ZSG A;  4V2S A;  1Z9Q A;  2CRE A;  1VQK Q;  2YLB A;  4XTZ A;  1RI0 A;  4RTW A;  3CCE A;  2EJF A;  2EKH A;  1BCM A;  2CSQ A;  2QGG A;  1NBE B;  2NLU A;  1FX7 A;  4DBH A;  2EVR A;  2A0F B;  3TRE A;  1SF9 A;  1ZUY A;  1KG1 A;  2VYT A;  4ZGE B;  1WI7 A;  1M90 R;  1TUG B;  1LVK A;  3QO3 A;  4F04 B;  5I22 A;  4A4K A;  2DZC A;  2JUF A;  1KC8 C;  1ACM B;  3RMQ A;  1BI3 A;  1T0H A;  1M2V A;  2L2P A;  5KE3 A;  1PKT A;  4M7D G;  3CCU A;  1QVF S;  3J81 E;  3PVQ A;  5CCA A;  3C95 A;  3LGF A;  1VQ4 Q;  5J3B A;  1JXO A;  4RUG A;  1U1T A;  3ZFJ A;  2X9H A;  2O9V A;  2DYI A;  3HTR A;  1QKW A;  4ORZ A;  4PFO A;  4C8Q D;  1MV3 A;  3CXC P;  5KYU B;  1OI1 A;  3V8L A;  1VQM T;  4LXC A;  1KQ2 A;  1U5S A;  3G1J A;  1VQ4 A;  4JRP A;  4M7A F;  2HMA A;  3I55 Q;  3PT9 A;  1ZUU A;  1KC8 U;  2P4T A;  5CKD A;  5FLX E;  2GGR A;  1I0C A;  2KMT A;  4PFZ A;  3VS3 A;  4XU0 A;  5L8R E;  1N27 A;  2HDA A;  4E7I A;  1PG5 B;  4C92 C;  4M7A D;  3G6E A;  5KYY B;  1TS9 A;  1UTI A;  2K6D A;  1MMG A;  2CP2 A;  4E2F B;  4JJD A;  3EHR A;  2E6Z A;  5IHN A;  4JZ4 A;  1VQ8 T;  3MKD A;  1Y7X A;  4C0Z A;  2O4X A;  2LCS A;  3G6E Q;  1GRI A;  2KEA A;  2X3W D;  2NUP B;  2VXF A;  2XMF A;  2DER A;  2VB6 A;  3LX7 A;  1MGQ A;  1FWZ A;  3OYG A;  3G4S A;  4LDY A;  3CMA T;  1UDL A;  2AZV A;  3QZ9 B;  5D6W A;  2LX7 A;  1VQ6 Q;  1VQL T;  2L3P A;  1Q7Y U;  3LLR A;  3QHS A;  2PVO B;  3UWN A;  3CCE Q;  2VAS A;  4Q5W A;  1YBY A;  5HY6 A;  3AT1 B;  5GAN 3;  1D0Z A;  4M4Z A;  1YWO A;  3EFR A;  1K9M C;  1MNE A;  4EIK A;  2QEX A;  3OSS C;  1NJI U;  2KYM A;  1G2B A;  1Q7Y R;  2LVM A;  1PRM C;  1QP3 A;  2RB6 A;  2LQK A;  1AVZ C;  4C0D C;  1M1F A;  1OZ2 A;  2FG0 A;  3SWN B;  1O9S A;  3MO8 A;  2ESW A;  2BTT A;  4PJN A;  4J83 A;  1KQ1 A;  4JS5 A;  1MMA A;  3M0R A;  2CUD A;  2DLP A;  2E3I A;  1YIT T;  3CC4 Q;  2LQN A;  2K5I A;  2DFU A;  2COY A;  3E1S A;  4OGE A;  4AG2 C;  2CKK A;  2OAU A;  3DLM A;  1WYX A;  1HK9 A;  3LH5 A;  3RKW A;  2GCX A;  1U1S A;  3G7Z A;  2JT4 A;  4J9H A;  3V7S A;  4HCK A;  4ATO A;  1BK2 A;  3I35 A;  3HPW A;  4MMK A;  3BDL A;  3PGG A;  1KIK A;  4HVV A;  3DLL A;  4MDX A;  3PNW C;  2BUD A;  1U06 A;  1VQL A;  4J7I A;  2RHZ A;  2D1X A;  1VQN T;  1M1K C;  4PK4 A;  4ZTJ A;  4ELZ C;  1G3W A;  2K4Y A;  2RJF A;  4DBR A;  3M59 A;  2OTL A;  1F1B B;  3WXM B;  2QDL A;  3V8J A;  1P92 A;  1H92 A;  5IH2 A;  3A8O B;  2DTI A;  3RDV A;  2DIL A;  2QXF A;  3I56 A;  3CBO A;  3ZEH A;  3I5R A;  1D3B A;  4KT0 E;  1ZUK A;  2OTL Q;  1QVP A;  3C0C A;  4BDY A;  5GAM j;  4M78 D;  5CKE A;  4AT1 B;  1JBM A;  4MZP A;  3VS2 A;  2C0O A;  4CC2 A;  3CME Q;  2VGN A;  4M7A G;  2FHD A;  2RK1 A;  4J9I A;  2RI3 A;  1WX6 A;  4M78 E;  4PJO G;  1YN8 A;  1Q81 C;  4J9E A;  1HXD A;  2DK3 A;  8AT1 B;  5KYN A;  2EJG A;  2C06 A;  5A0L A;  1M9S A;  1N5Z A;  2KRS A;  3OMG A;  1UUE A;  3CMA Q;  2RD1 A;  4JRK A;  1PCX A;  3EG1 A;  2K3B A;  3ASK A;  4M7D B;  2GF7 A;  5CKF A;  1BBZ A;  4E7H A;  1YJW A;  1OX8 A;  1Q95 G;  2KVQ G;  1WHM A;  1UEC A;  2YUO A;  3VRY A;  2LC4 A;  1I4K 1;  1GXI E;  3CPW S;  3GPL A;  2K79 A;  4M77 E;  1AOJ A;  2SRC A;  1MND A;  1W1F A;  1NLO C;  1JO8 A;  3X25 B;  1PKS A;  3QII A;  5LJ5 d;  4FIB A;  1GL5 A;  1QKX A;  2RM4 A;  2D9T A;  1UB4 A;  2H3J A;  2D8H A;  3NGP A;  1KFZ A;  2ZPG B;  5GAM f;  1YIJ T;  1PHT A;  4C0F A;  2M9U A;  4RTV A;  3CCL T;  1S72 A;  2LQW A;  2XD0 A;  1RLP C;  2EGE A;  2EYX A;  2DF6 A;  4M75 E;  2HNI A;  5GAN 5;  2J6O A;  5FW9 A;  1LPL A;  2QI2 A;  1VQ7 T;  1VQN A;  2EQJ A;  2QAZ A;  2QDY B;  1TU0 B;  2L8D A;  1PNJ A;  2D8J A;  4B6M A;  3UA6 A;  2MPX C;  1KD1 C;  1AWJ A;  2E1H A;  1G3T A;  3HL8 A;  3REB B;  1RAI B;  1EX4 A;  2CZ6 B;  4N0A C;  3M54 A;  2RO0 A;  2DEQ A;  3M53 A;  3REA B;  3JCM Q;  1M8M A;  1VQN Q;  2LCL A;  2O88 A;  2JM8 A;  4L59 A;  2LDM A;  5CQX A;  4NL2 A;  5KYW A;  1SHF A;  2Y4Y A;  3TEE A;  2KYB A;  1G83 A;  4FSS A;  3QYH B;  1M1G A;  1JXM A;  3H9N A;  2ZPF B;  2J6K A;  1YIT A;  1Q86 R;  5GAN f;  3JB9 I;  4EMK C;  3VS7 A;  5CKH A;  1QLY A;  1V1C A;  3CC2 Q;  4C8Q C;  3CCR A;  2BZ8 A;  1J3T A;  2QK0 A;  3E9G A;  4PL6 A;  1S72 T;  4HA8 A;  3CBP A;  3RUX A;  2V8I A;  3KUF A;  4IKF A;  4AFU C;  5FWB A;  1EZZ B;  1K8A C;  1H8K A;  1CKA A;  2E5Q A;  2FYK A;  2VGM A;  1VA7 A;  1YJW Q;  3C94 A;  3A8H B;  4JLG A;  3OY9 A;  3PTA A;  3E2U A;  3V7C A;  5A2Q E;  5IXF A;  2DX1 A;  3LGL A;  4M78 B;  1EFN A;  1OZ3 A;  2AKK A;  2DXC A;  3QKJ A;  2LT4 A;  3NTK A;  2DMO A;  3ME9 A;  2YDL A;  3C12 A;  3FJ5 A;  4M77 C;  4RTT A;  2RJD A;  2JMA A;  4X9D A;  1B34 A;  4E7J A;  1SHG A;  1G8X A;  2BZY A;  4BD3 A;  4HCZ A;  3CCS T;  2HCK A;  5GAN d;  1GCP A;  2FPD A;  3OYH A;  3A5Z B;  4M7A E;  2HD0 A;  1BIB A;  3MEA A;  4EDU A;  2O2O A;  2KBT A;  2QQS A;  2ZAE A;  1NEB A;  4M7A C;  2MIO A;  3UA7 A;  3JRZ A;  1JQQ A;  5A0D A;  1QCF A;  4EMG A;  2ZPH B;  4QKU A;  3G4S T;  3ULR B;  4BY6 C;  1YIJ A;  1VQL Q;  4PJO E;  5M9O A;  2DXU A;  2LT1 A;  5KYX B;  2DNU A;  5LJ5 j;  2J06 A;  1IXD A;  4A4E A;  1C0M A;  1D0Y A;  4BE0 A;  2VWF A;  5GAM h;  3J80 E;  4HCC A;  4MZM A;  1FMV A;  4FYV B;  1X2K A;  1VQ9 A;  4Z88 A;  2E70 A;  4O6J A;  3VYH B;  1UE9 A;  2AIR B;  1UJY A;  5DLO A;  4M75 A;  1TUD A;  4XTY A;  1DJ7 B;  2V26 A;  1U3O A;  2MMP A;  2JTE A;  1GFC A;  3EFO B;  3JCM h;  2CUB A;  1RAE B;  3CCR Q;  4J9G A;  2RQU A;  4N4G A;  3VKI A;  3V7R A;  1M5Q 1;  4N4I A;  3M5A A;  1MV0 B;  1Y96 B;  3CEY A;  2M0O A;  3SB2 A;  3OW2 A;  3P8D A;  3X26 B;  1M27 C;  1OQK A;  2DKG A;  2RHY A;  3S3M A;  4XTW A;  3A8L B;  2CP6 A;  2E64 A;  1I81 A;  4M75 C;  4KH0 B;  3H0I A;  1VQ5 Q;  2E6N A;  4RG8 A;  1RAB B;  3CCM T;  1W2B S;  2HAX A;  1TOV A;  3E19 A;  3CCL A;  3EAE A;  2XI9 A;  4LD9 K;  2EYZ A;  1JRI A;  4IUU A;  1I1J A;  3NTI A;  1VQM A;  3VS1 A;  2M51 A;  1SRL A;  3LYI A;  5LJ5 f;  1NYF A;  2E10 A;  4GBQ A;  4PLI A;  2JOY A;  1YHQ T;  3ZL7 C;  1IZ6 A;  3BY7 A;  4KGX B;  4EPC A;  1OU8 A;  4ZN3 A;  1GCQ A;  4WTO B;  2O31 A;  4C0G A;  1BYM A;  4EMH A;  4J9C A;  1YI2 A;  3UT1 A;  3OYN A;  4M78 A;  1PRL C;  2QA4 T;  1UFF A;  2JXB A;  3C4S A;  1PC0 A;  1T3L A;  2IG0 A;  2KY9 A;  4P5N A;  2OTL T;  2P0K A;  4Y28 E;  5EC7 A;  3L2R A;  1VQ6 T;  2DL8 A;  1RUW A;  2EGA A;  2X4X A;  1S72 Q;  1ABQ A;  1JJ2 A;  1WJS A;  3MCA B;  5FU7 C;  3PE0 A;  5CAI A;  3RBB B;  2E4H A;  4MML A;  4XQ3 A;  1NYG A;  1KHI A;  1ZHI A;  2V1R A;  4C92 B;  4FYY B;  1YCY A;  4X34 A;  4PJO F;  3G71 T;  2M16 A;  2RA2 A;  1AZE A;  3CC4 A;  1K0X A;  3SDZ A;  2C0I A;  1VYV A;  3S3O A;  2DVJ A;  4E7Z A;  3EGX B;  2RJE A;  2JZ2 A;  2A28 A;  2DE0 X;  3J7A F;  2F2V A;  4M77 D;  1BU1 A;  3OYD A;  1I8F A;  2DBM A;  2B8A A;  3TSZ A;  2D6F A;  5CO7 A;  1VOM A;  2COZ A;  3MHX A;  2ROT A;  3RER A;  4ZGD B;  2CDT A;  4A4H A;  1D1A A;  3BE3 A;  2FVU A;  3JCM J;  4AG1 C;  2QEX T;  1WJR A;  2FZG B;  1WHG A;  3INZ A;  3M9Q A;  4C8Q A;  2NYS A;  3RIR A;  4PJM A;  1NJI R;  5LJ3 j;  1D1B A;  2P84 A;  2DVE A;  1YJN T;  4PNO A;  5FWC A;  4Y92 A;  3G4S Q;  3M0P A;  2JVV A;  2LJ1 A;  3GNG A;  2HSP A;  2HSE B;  3QPH A;  4RTX A;  3PVL A;  2MOX A;  1M1K R;  1WXU A;  3CME A;  3OYF A;  5DM7 R;  1KQS S;  2F5K A;  1K8A R;  2BE7 D;  1TTH B;  1Y96 A;  1XNI A;  2CT3 A;  5KE2 A;  2KRO A;  1IHW A;  4A4F A;  3OYI A;  1VQ9 T;  3WVD B;  3M57 A;  1U8R A;  4FU6 A;  3MJX A;  4OB0 B;  3QBY A;  2E12 A;  3MP6 A;  4F7U E;  2YWW A;  5GAN 2;  4R56 A;  5GMK l;  4C5G A;  1X6O A;  1WA7 A;  5LJ5 h;  2LNV A;  2YUN A;  2KE9 A;  2XDP A;  3M56 A;  3TVT A;  2MWO A;  1NE8 A;  3VV0 A;  4K11 A;  5J26 A;  4AFS C;  3M4Y A;  2A37 A;  3HFN A;  1YWP A;  3CPW A;  2RJC A;  1OPL A;  4M75 G;  1QW1 A;  3CCV Q;  4M7D A;  3OS0 A;  2XDD A;  4QQD A;  1E6G A;  3PFS A;  4M75 F;  2JTF A;  2W0Z A;  4BE1 A;  1K9A A;  4XTU A;  3E9F A;  3V8K A;  2EPD A;  2DIG A;  3CCV A;  2NUP A;  4OMN A;  2ECZ A;  3OBY A;  2M02 A;  1D09 B;  3UF4 A;  3R6N A;  2KI7 A;  4JDS A;  2DO3 A;  3EH2 A;  4BB7 A;  1LOJ A;  2OX7 A;  3QYG B;  1PD1 A;  5IHI A;  3SEM A;  3I56 Q;  1WHK A;  4C8Q F;  4M77 F;  2IIM A;  3SWN C;  2VVK A;  4DA4 A;  3OYL A;  2DAQ A;  4M77 G;  3Q1J A;  2XID A;  3VU3 C;  3WVE B;  2LMJ A;  5A0G A;  3L2Q A;  4FW2 A;  4PJO A;  4JJB A;  5GAN e;  2H8H A;  1KD1 R;  1K73 R;  4M77 A;  5D6Y A;  2DTO A;  4PJO D;  5AYF A;  2EW3 A;  2QG9 B;  4L5G A;  4C92 E;  2IVW A;  2MI6 A;  3X28 B;  4M78 G;  3L2V A;  2BZX A;  2FRW A;  1YFN A;  1KD1 U;  3H0H A;  4GLM A;  2GTO A;  2LP5 A;  2EIF A;  4M78 F;  2FO0 A;  4M7D E;  5IAY A;  2ATC B;  1ZA1 B;  3D7S B;  2CYZ B;  2D0Q B;  5I2S A;  4C5E A;  4J8O A;  5GAO p;  3OS2 A;  1Q82 C;  1SEM A;  2QTX A;  2HQE A;  1VQ5 A;  1KQS A;  3CXC S;  4FYX B;  2ROL A;  3CCL Q;  3QXE B;  8ATC B;  1K73 C;  2YSQ A;  1RAD B;  1PD0 A;  3LW5 E;  1K4U S;  2WSF E;  4E7S A;  4NL3 A;  3KBG A;  2KNB B;  5GMK m;  1N9R A;  3JCM P;  2L89 A;  4BE2 A;  1V29 B;  2JS2 A;  2QYZ A;  4KGZ B;  4XTV A;  2OTJ A;  5GAN g;  2X51 A;  2DEU A;  4YTL A;  1OUL A;  4BAC A;  3EFO A;  2BIV A;  1WDX A;  2ZPE B;  4OMP A;  3CCV T;  1KQS P;  1UHF A;  3VS5 A;  2MF2 A;  3IQL A;  2LNH B;  1K9M U;  3GP8 A;  2EQK A;  5KCO A;  5J39 A;  1HJD A;  3ER0 A;  2RQV A;  4QVC A;  4KH1 B;  2YUP A;  1RL2 A;  1NG2 A;  1WZO A;  3RR6 A;  4M7D C;  2K5F A;  1C1A A;  2LTO A;  3TCJ A;  3AHU A;  3LWH A;  2EQM A;  3PMT A;  4CC7 A;  1VYU A;  1VIE A;  1WIE A;  3A98 A;  2DM1 A;  2XK0 A;  2EBP A;  2ZZD A;  2EFI A;  3MET A;  1VQ7 A;  3SHW A;  4PFP A;  1IO6 A;  2RMO A;  5GAN j;  2JS0 A;  4NS5 A;  4RMO A;  2DRM A;  4LUE A;  1UGP B;  2NUZ A;  2DL5 A;  4ZN1 A;  1W70 A;  3QDF A;  2WSC E;  2A08 A;  2ZCF B;  2ZPI B;  3OMC A;  4LE9 A;  3PIP A;  2J7I A;  3GBQ A;  5HK3 A;  2AK5 A;  4M7A A;  1D3B B;  2QGF B;  2QQB A;  4M7D D;  2CS7 A;  4DBF A;  4XU1 A;  4HT9 A;  2DXT A;  3QDR B;  4NOY A;  4BI3 A;  3CME T;  4C8Q G;  5CK9 A;  1IB8 A;  1QVG S;  1KSW A;  2RH2 A;  5LJ3 g;  1BI0 A;  3OW2 S;  5GAO r;  3LH0 A;  5LJ5 e;  3L2Z A;  4HCB A;  3MPU B;  1YJN Q;  4PJO B;  1QCO A;  2LQ8 A;  1QVF A;  3A8M B;  1VQK T;  5GMK e;  2M0Y A;  2AKL A;  4J7F A;  1YCS B;  3KXT A;  2JM9 A;  2GTJ A;  2DD4 A;  3NTH A;  5LJ3 e;  4IUT A;  2RHX A;  2PQW A;  2P0Q A;  3M0T A;  2K9G A;  3CXC A;  1R8O B;  2LJ0 A;  4DBQ A;  3EHQ A;  1K1Z A;  1KJW A;  1BIA A;  4GLK A;  4XTX A;  3OBW A;  1JJ2 P;  1YI2 Q;  2A3L A;  4C0D B;  4HXJ A;  4RTY A;  4OF1 A;  1EIF A;  1YIJ Q;  4ZTF A;  3MP1 A;  1I5O B;  3S6W A;  1UGS B;  4JLI A;  1XQH A;  2P0P A;  3CC7 A;  3L1A A;  1AD5 A;  3FIF A;  4A63 B;  2GQI A;  1ZBJ A;  1X69 A;  4WF2 A;  1TH7 A;  2A7Y A;  3FB9 A;  2E5K A;  2CZ7 B;  4RCC A;  1VQ9 Q;  4RCB A;  3CCU T;  1QP2 A;  2L3S A;  1Y57 A;  4OML A;  1Q82 U;  5GAN 8;  4JZ3 A;  1XOV A;  2WAC A;  5I21 A;  3CC7 Q;  4N0A A;  1AWW A;  3EGD B;  2R5M A;  3EG2 A;  1YNZ A;  2DL7 A;  2K2M A;  4F7U A;  2JJ9 A;  1VQ5 T;  2O01 E;  3FDR A;  4HKE A;  1CSK A;  1NPR A;  1Q82 R;  3CPF A;  4ANJ A;  5D7U A;  5KH6 A;  2ZGW A;  2V8J A;  4AFQ C;  1ZSZ B;  2XIC A;  4FL6 A;  1WLP B;  2O9S A;  2PNI A;  3GNF B;  1B7T A;  1AT1 B;  3FRN A;  4OB2 B;  4E6R A;  2CH4 A;  2RPN A;  1HYO A;  2NUT B;  1VQO Q;  1VQP Q;  4MDW A;  2QQ9 A;  3S3N A;  1GFD A;  1I5L A;  2G6F X;  2FB7 A;  2CP5 A;  2GNC A;  3TU4 K;  1WXT A;  1ZX6 A;  4FCY A;  4IUR A;  3H0F A;  3M55 A;  2F2W A;  1X01 A;  2OTJ T;  2FL7 A;  2O4X B;  1WFW A;  1D0X A;  3GF5 A;  2KRN A;  2FPE A;  2HEQ A;  3X24 B;  2QQA A;  1VQO A;  3JB9 D;  3UDC A;  4A53 A;  1QMC A;  4C8Q E;  4QVZ A;  2RF0 A;  3M0U A;  4RTZ A;  1VQP T;  2DTH A;  2R5A A;  3H41 A;  4LN2 A;  2XKO C;  5HK0 A;  1C6V X;  2B86 A;  4PLL A;  3OYA A;  2HBP A;  1SG5 A;  3U23 A;  1T0J A;  5C6S A;  4XU2 A;  1T3S A;  3OQ5 A;  1NZ9 A;  1OEB A;  3L2W A;  1VQ8 Q;  4OMO A;  1QCN A;  4FM4 B;  3NPF A;  1HD3 A;  4C92 D;  1IHV A;  4A4G A;  1WGS A;  3DB4 A;  1LJO A;  3O8V A;  5FU6 C;  4F14 A;  1FXX A;  1VQ8 A;  2HQX A;  2X4Y A;  3SWN A;  3CCJ Q;  4M75 D;  1LNX A;  1WJQ A;  3HP9 A;  2QQR A;  3LWI A;  5GAN 6;  2Y90 A;  4XU3 A;  2K7A A;  2KQW A;  4M78 C;  5LJ5 g;  3GIB A;  3CCJ A;  2KRM A;  4OMQ A;  2J05 A;  4L6V 5;  3CCJ T;  3JCM f;  3SD4 A;  2Y4X A;  4KUI A;  4HT8 A;  1M3B A;  4X9C A;  1K8A U;  1SSF A;  3I55 A;  3I55 T;  1G3Y A;  4JS4 A;  5LJ3 f;  1UHC A;  3TSW A;  2K5L A;  2E3H A;  2QAS A;  2P4R A;  1QQJ A;  3DKM A;  2DBK A;  4HVU A;  3JB9 J;  4FT2 A;  1AHJ B;  1GBQ A;  1B3Q A;  2R58 A;  1JJ2 S;  1RAG B;  4JPB W;  4F7U B;  4FSX A;  4BY6 B;  3CD6 A;  1SSH A;  1E7O A;  4CI0 C;  3JB9 F;  3HKS A;  1Q81 R;  1G3S A;  1H3H A;  4IUV A;  3URG A;  3PIO A;  3EG0 A;  4HVW A;  1S1N A;  1VQP A;  2HZY A;  3A8G B;  3QUI A;  2X35 A;  4D8D A;  1UGQ B;  1IRX A;  3JCM c;  4R0K A;  4DOW A;  3CCM A;  4JUV A;  1H3Z A;  2ED0 A;  3P8B B;  5GAO q;  2RQT A;  1RAF B;  2PTK A;  3VJP A;  5DLQ E;  2DA9 A;  3RKY A;  1LCK A;  1XJW B;  1Z9Z A;  2YRD A;  3SFM A;  5GAM e;  2NUT A;  4E7K A;  2YT6 A;  2FZK B;  3I56 T;  3JV3 A;  1VQM Q;  2BKD N;  2SEM A;  1OYX A;  3RMS A;  5LJ3 d;  1X6B A;  3MEW A;  1JB0 E;  1QWF A;  2H3E B;  3THK A;  1AZG B;  3CCQ T;  4PKC C;  3VYG A;  5L23 A;  5GMK i;  3CCS A;  4LDX A;  4OMM A;  3X20 B;  3JCM e;  2GFU A;  4CRI A;  1Y0M A;  3QJ6 A;  2E65 A;  3GOX A;  4KUD K;  3H6Z A;  3DB3 A;  2DIQ A;  1BI1 A;  3O5Z A;  4IUQ A;  2KXD A;  1K73 U;  2EWN A;  5KCH A;  2WSE E;  4CC3 A;  1WHH A;  2RQR A;  2F5T X;  5FU6 B;  6AT1 B;  4RTU A;  4LDV A;  1IGQ A;  3G71 A;  2F2X A;  2JTM A;  4UC4 A;  1Y71 A;  1QVG P;  1RAC B;  4Z8A A;  1YHQ A;  3EGX A;  1B07 A;  4OGC A;  5FRM A;  5FRO A;  2DL3 A;  2F1L A;  4QVD A;  4ME7 A;  2IPO B;  4QW2 A;  1ZQ1 A;  1K76 A;  1YJ9 Q;  4B9W A;  2EAY A;  2K57 A;  3OYM A;  2KGT A;  1FMK A;  1YI2 T;  5GAO l;  1FMW A;  2E41 A;  3L42 A;  2GFA A;  2DET A;  4OP0 A;  4F16 A;  1Q86 U;  4EMK B;  3JCM b;  3M0Q A;  3CC7 T;  3BDU A;  1NPP A;  4C8Q B;  1ARK A;  3NFC A;  1E6H A;  1PSE A;  1YJ9 T;  5HCK A;  4ESR A;  4WCI A;  1FYN A;  2PVG B;  2HKQ B;  4O5V A;  1Y07 A;  3M58 A;  1TSF A;  4JRQ A;  2KXC A;  3R6O A;  4J6Y A;  1JEG A;  4LNP A;  3L2U A;  3EFS A;  4PJJ A;  1M90 C;  4OMF B;  2DRK A;  1KHC A;  1M8V A;  5GJW B;  4LDW A;  3CCM Q;  4LD6 A;  3JB9 G;  1QVG A;  2ENM A;  3UPU A;  1VQK A;  1W6X A;  1O75 A;  1WQ7 A;  2VC8 A;  1AEY A;  2K2V A;  1M2V B;  1UJ0 A;  2OTJ Q;  3HHT B;  3CC2 T;  3HFO A;  3JCM V;  2HL3 A;  4RKU E;  2RN8 A;  3VUB A;  2QA4 A;  4B9X A;  5AT1 B;  1YP5 A;  4IIM A;  4VUB A;  3CCE T;  2LRQ A;  1BI2 A;  4F17 A;  4A54 A;  4DEY A;  1M4Z A;  2X4W A;  4QT7 A;  2VV5 A;  1N8R C;  5DY9 A;  3RES A;  4C5H A;  5GAN 4;  3JCM d;  4BDZ A;  2YUQ A;  3RNJ A;  2Z0W A;  2QA4 Q;  4E47 A;  3EG9 A;  1MHN A;  4Y91 A;  2EJ9 A;  2KR3 A;  1W2B P;  3JSC A;  2J6F A;  1HSQ A;  3G6E T;  1SRM A;  2CP7 A;  3TQ7 P;  2DD5 A;  3HRT A;  3CBM A;  1VQO T;  1VQ7 Q;  2RI2 A;  5GAM d;  1MMD A;  1ZSZ C;  3JCM g;  3QWY A;  3JAM E;  1VUB A;  2YLC A;  1N6A A;  5KYX A;  3P8H A;  1QWE A;  3GLX A;  1X6G A;  1OU9 A;  2YXY A;  2NWM A;  2RNA A;  4DEX A;  2MAM A;  5GAN 7;  3M0S A;  2CT4 A;  1TWB A;  1N8R R;  4II1 A;  1WQW A;  3CQT A;  2RI5 A;  4OVA A;  1ZA2 B;  2HBW A;  3VS4 A;  5KYW B;  2ZPB B;  3BFM A;  3T9N A;  2KSS A;  2JN0 A;  2GQV A;  4KUL A;  3JCM W;  4XAX B;  1R77 A;  2CSI A;  2L3R A;  2DL4 A;  1N8R U;  3CC2 A;  2KT1 A;  5D6X A;  2G3R A;  5GAN h; 
#chains in the Genus database with same CATH homology
 3I55 Q;  2QEX Q;  3CCQ Q;  1N8R R;  1S72 Q;  1M1K R;  3CD6 Q;  3G6E Q;  3CCE Q;  1K9M R;  1Q81 R;  3CCV Q;  1VQ5 Q;  1K8A R;  1VQO Q;  1VQ4 Q;  1KD1 R;  1VQP Q;  1NJI R;  1K73 R;  3CCM Q;  3CCR Q;  1KQS P;  1VQ7 Q;  1YJ9 Q;  1M90 R;  1Q82 R;  1QVF P;  1YJN Q;  1VQ9 Q;  3CCU Q;  3CC4 Q;  1Q86 R;  2QA4 Q;  1YIT Q;  1VQK Q;  3G4S Q;  3I56 Q;  3CCJ Q;  1Q7Y R;  1QVG P;  3G71 Q;  3CPW P;  1YI2 Q;  1JJ2 P;  3CCS Q;  1YJW Q;  2OTJ Q;  3CXC P;  1VQM Q;  1YIJ Q;  3OW2 P;  2OTL Q;  1KC8 R;  1W2B P;  3CC2 Q;  3CMA Q;  1VQL Q;  3CC7 Q;  3CCL Q;  1VQ6 Q;  1VQN Q;  1VQ8 Q;  1YHQ Q;  3CME Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...