1Q86R

Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2003-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1q86R00
3CCSQ 3CMAQ 3CPWP 1YI2Q 1M90R 2OTJQ 3CCVQ 1YJ9Q 1W2BP 1YJWQ 1VQOQ 1K73R 1JJ2P 1VQ8Q 2OTLQ 1N8RR 3CCUQ 3CCEQ 2QEXQ 3CC7Q 1Q7YR 3CD6Q 1KD1R 1VQPQ 3CC4Q 1QVGP 1VQKQ 3CCLQ 3G71Q 1VQ4Q 1YIJQ 1KC8R 1VQMQ 1VQNQ 3OW2P 1K9MR 3I56Q 1VQ5Q 3G6EQ 1M1KR 2QA4Q 3G4SQ 1KQSP 3CXCP 1K8AR 1VQ7Q 1YJNQ 1VQ6Q 3CCJQ 1VQ9Q 1YITQ 1NJIR 1Q86R 3CC2Q 1VQLQ 3CMEQ 3I55Q 3CCMQ 1Q81R 3CCRQ 1QVFP 1S72Q 3CCQQ 1Q82R 1YHQQ
chains in the Genus database with same CATH superfamily
2M1HA 2CREA 1ZA1B 5FU6B 4XTWA 5LJ3e 2KT8A 1ZUKA 2CH4A 4CC4B 3CD6T 1GCPA 2DRMA 4E2FB 2A7YA 3L2VA 2D6FA 3M0QA 1K9MU 4F17A 1AZGB 3NTIA 4YTLA 3JCMc 1KFZA 1VQLT 1BKBA 3I35A 4XU0A 4FSXA 2YRCA 2HEQA 3CCVQ 2E5KA 2KXCA 4PJOF 5IHNA 3G71Q 5GAMg 4GLKA 1D09B 2QA4A 2ROLA 4OMNA 4P5NA 1D3BA 2QTVA 2RB6A 4LDUA 1SHFA 1AOJA 3J80E 2H3EB 2OTLQ 3NPFA 1B7TA 4HCCA 2L3RA 3G1JA 3CCUT 1OU9A 4M78G 5CAIA 2HMAA 3MP1A 4C0FA 1U06A 3CXCP 1OZ2A 1SG5A 1Q82C 3LH5A 2B86A 2HSPA 3UF4A 4XU2A 4JRQA 2DXTA 2NUTA 4PJJA 5LJ5f 3I5RA 1NPRA 2LRQA 4A53A 1UGSB 3CCLA 2GNCA 1RAAB 4C8QF 1Y0MA 3I56Q 1RI9A 1WFWA 3OS0A 5FWCA 1D1BA 4BE0A 1CKAA 1JJ2A 2WACA 1WJRA 1WYXA 4J83A 3M0SA 3CQTA 2DIQA 3PMTA 2YT6A 2BTTA 3CMAQ 2V1QA 5A2QE 2KAFA 4JUVA 4HKEA 2JOYA 3S3NA 2FYKA 1N6AA 1WJSA 1SKUB 3G6EA 4IIMA 3X20B 4M75F 3PVLA 1PKTA 4DA4A 4J6XA 2NUPA 1M3AA 2CUBA 3VJPA 4QVZA 2QQAA 5GAMf 3WVEB 2EW3A 3CC2T 3VRZA 1YJWQ 4BACA 2FPFA 3EHRA 5LJ5h 1UGQB 3CC4T 1VQMA 2DTHA 3HFOA 1FMKA 4ATOA 3KFVA 2BE9B 4M7AC 1XOVA 1ZBXA 1E7OA 1YWOA 3EFRA 3MHXA 3CMET 2PNIA 2ZAEA 4JPBW 1AT1B 2RMOA 1S72T 4LDXA 4RCBA 2OTJT 2CGHA 5GJWB 4E7LA 1DJ7B 1LVKA 4PKCC 4HVVA 3MEWA 1VQ5A 4LE9A 3PE0A 4AMCA 3JB9J 4FL6A 2X4XA 4HVUA 1G3YA 2Y90A 3VS0A 5KYUB 2DJZA 2QQ9A 4RTZA 5GAMh 3FEOA 3JCMJ 1YJ9T 2DMOA 2F1LA 4QQDA 3MCAB 4M7AD 4XU3A 3S3OA 2M16A 2RHYA 3S6WA 3QZ9B 2FO0A 1BB9A 4M7DE 4IUTA 1M90C 1WXBA 1OOTA 4JLGA 4M7AA 1M2VB 3OMCA 2EGEA 3Q1JA 5GANf 2ENMA 1NM7A 4EMKC 4V2SA 2YDLA 1PRLC 3OW2S 2OAUA 2LZ6B 3H0IA 2E3IA 5FLXE 1Z9ZA 4KRTA 3A8OB 2M02A 1LCKA 2KXDA 5IXBA 1BYMA 3OYLA 1W2BA 1R0CB 4KH1B 2RH2A 4A4FA 4C92E 4E7KA 4HXJA 3PVQA 4PLIA 5CKEA 4JS5A 2AHJB 3P8DA 5A0GA 1T0JA 2VKNA 2E70A 1Q7YR 2CP6A 3MP6A 1Y96B 2RN8A 2BZYA 2GQVA 1NLOC 3G4SA 1T3LA 1TXQA 2RQRA 1AWXA 5GAN2 3TSZA 2K5LA 3DLLA 4QQ6A 3CCUQ 1Q82U 4LDYA 3A1PA 5GAN4 4KGZB 4KGXB 4EMKA 1VUBA 5KYXA 5A0DA 4L6V5 2ZPHB 4J6WA 2CH4W 1Q81C 3EGDA 3SEMA 2V1RA 4LNPA 3UATA 3CCJT 2GFAA 2NUZA 1K0SA 2HCKA 1ZSZB 4BI4A 1BI0A 4M7AG 1H8KA 2FPEA 4OB3B 2E12A 3CC7A 5HY6A 1TUDA 8ATCB 2A08A 4C5HA 3OYBA 1SF9A 2ED0A 4NOYA 1N8RU 2XHCA 4E7IA 1M8MA 3M0RA 1G3WA 4FCYA 2O9SA 2O9VA 2BZXA 2NYSA 3KBGA 2E6ZA 3QUIA 2VC8A 2MPXC 2DD5A 3GIBA 3BE3A 4XQ3A 3THKA 2GTOA 2CZ1B 2SEMA 1KQ2A 4RTWA 5LJ5j 2EGCA 1UJ0A 2GF7A 1VQ4A 1VQPA 1VIFA 3JSCA 5KYNA 2F5KA 3QSUA 2RQWA 3WXMB 4BDYA 5GAOr 2EQKA 1WXTA 4M77C 4C0DB 4PJOD 1JRIA 5CIUA 4AFZC 5J39A 4E6RA 1R77A 4IUVA 2COZA 9ATCB 4M77E 4PJOA 3EG3A 1X2QA 1B07A 4QW2A 3CC4Q 3URGA 2LNHB 1C1AA 3BDUA 3LLRA 5L8RE 1QCOA 1W6XA 4XTXA 4DEYA 4BE1A 1T3SA 3PFSA 3ULRB 3CMEQ 3NTKA 1YHQA 7AT1B 1S72Q 3M0TA 5GAMj 5A0LA 2AKLA 2ATCB 3HL8A 2OTJQ 1K73R 2KR3A 1PKSA 1PCXA 8AT1B 1NJIC 3G71T 1GCQA 2DAQA 1X01A 3EGXB 2E64A 1KC8U 3RDVA 4II1A 2L3SA 1IGUA 2QGFB 4MMLA 1XTDA 3VUBA 4IIOA 4B6MA 4IURA 2RJFA 1YI2Q 3SWNB 1VQOQ 3OYEA 1M1KC 4C8QA 3QWXX 1M90U 2G6FX 2C0OA 5DLQE 1VQNT 3JCMd 4JDSA 2XKOC 3OYCA 4MZMA 2QA4T 1VQ6A 3E19A 1VQ9Q 2DL5A 3EAEA 4MMKA 3ZL7C 2HNIA 1Q81R 2EKHA 2HBPA 1G2BA 4M75D 2KYBA 3BDLA 4F7UB 2RK2A 3VS6A 2JM8A 1OEBA 4FSSA 4PJOG 1G5VA 1I0CA 1X75C 2K5IA 3OW2P 1Y71A 4M75A 3EGUA 3HRTA 3CBMA 4BDZA 3I56T 2PUOB 1WHJA 2QGGA 5HK0A 3RERA 2CP5A 3VUZA 3VS4A 5GANj 2JUFA 3IQLA 4BI3A 1LPLA 3CMAT 2P0PA 1VQKQ 2E65A 1E6HA 3MO8A 4FT2A 1FX7A 2EJGA 2V26A 1RAHB 1WNLA 4GY5A 3BW1A 1D1CA 3MPUB 3C12A 1WPYA 3CCQQ 2F2WA 5L23A 2VB6A 4QQGA 4M77G 1WXUA 1IRXA 3NTHA 2VGMA 3EG2A 3OS2A 1YJWT 1N9RA 2HKNA 5KCOA 3OYGA 2XICA 1GRIA 3CCJQ 3EH1A 4PJMA 1WLPB 3VYHB 3LW5E 1Q95G 2CS7A 4BY6B 3QJYA 4M7DF 5KH6A 2B8AA 3J81E 4J7IA 2FZKB 5AT1B 3H0FA 2DBMA 4C5IA 1VYTA 2J6KA 1QVPA 1TUGB 2OI3A 2X4YA 1YIJA 2LJ1A 2O4XA 4AT1B 5I21A 4QT7A 3O8VA 1VQMT 3JCMg 2ZPGB 1IO6A 1B34B 2DL8A 2LDMA 2RO0A 4JRIA 4LUEA 5CQXA 2LX9A 1NJIR 4JJBA 1JEGA 5GAN6 2JJ9A 3OYKA 2CP3A 3CPWS 2C06A 4ZTJA 4C92F 2L3QA 2QQRA 3EFOA 3VS7A 4Q5WA 4QVCA 3P8BB 4OB1B 4ORZA 2J6FA 1WHLA 2D0NA 1M1KR 4J9EA 4NL3A 1YJNA 1I8FA 2Z0WA 1UUEA 4LDWA 5M9OA 3LYIA 5GAN8 5I11A 5FRMA 3CCRA 3GP8A 1UE9A 1K4US 1RLQC 1R0BG 2KK4A 4BB7A 1M3CA 4A4HA 2HKQB 4EMGA 1MHNA 4IUPA 2WSFE 5GANd 2BKDN 4IUQA 1GXIE 4PJLA 3OMGA 2D1XA 2RM4A 3MJXA 1YITQ 1WIEA 3QHSA 4FIBA 4FYVB 2DE0X 3CCMQ 2RF0A 5DM7R 3M58A 1OX8A 3WVDB 3L2QA 1AD5A 3HFNA 1JBMA 2LQWA 3CCVA 1A0NB 1FMWA 2YHTA 1VQ8T 1SEMA 3OYYA 3E9FA 2QI2A 1KHCA 2JNGA 4UC4A 3M57A 3M55A 2DJQA 2YRVA 1YP5A 1QCNA 4JS4A 3S3MA 3JCMV 2LT4A 3CCSA 1GFDA 2LCCA 3JCMf 2XDBA 4WTOB 4ZGJB 4C0ZA 1NPPA 2ESWA 3SHWA 3LH0A 3ZFJA 1VQNQ 1BK2A 1EX4A 1Q86C 2X4JA 2QA4Q 1QLYA 2RD1A 3G4ST 1XQHA 1X2KA 1BIAA 2LX7A 2DM1A 1NYFA 1V1CA 2A0FB 2X35A 2WSEE 4M77F 2ECZA 1OQKA 4PLLA 1UHFA 1PD0A 3RKWA 1TS9A 1SSFA 5IN1A 1AHJB 4AFSC 1VYVA 5CQYA 4OB2B 3TEEA 1QP3A 2DL4A 2RQUA 2DYIA 4RG8A 1Q7YC 2HQEA 4X34A 3T9NA 5IHIA 4C5GA 2QTXA 3HHTB 3EG9A 2DXUA 3A8GB 2K3YA 2XDPA 5FU7C 4ZN1A 1UGRB 1MMNA 5GANg 3FJ5A 2OX7A 5GAOp 1RAFB 1Z9QA 1O75A 2M51A 4J8OA 2RHZA 5C6SA 3ASKA 2K79A 1W70A 1JB0E 4XTVA 2KI7A 2LC4A 2QDYB 1M5Q1 3OYMA 3A8LB 2K3BA 1K8AC 1ZUUA 5CO7A 1HJDA 2KSSA 3G6EQ 2F2VA 3PIPA 2JMCA 3NFCA 2FRWA 2K3XA 2YUQA 4FYWB 1PSFA 2ABLA 4ELYC 3QYHB 4M78B 1D0XA 2DD4A 2LTOA 3DB3A 2AIRB 1K0XA 2QK0A 5J3BA 2H3JA 2E10A 1VQMQ 4FYYB 3RIRA 5KYWB 2CZ6B 2ZCFB 3L2ZA 4OMQA 2EPDA 2E41A 2P4RA 2XMFA 2EKOA 2X51A 1WJQA 1MMDA 2H8HA 2KYMA 2KE9A 3CPWP 2PZ1A 2LJ0A 2QEXA 1YI2T 2KRNA 2L8DA 3RUXA 1VQOT 2HL5C 2CUDA 1UGVA 2VWFA 4M7DC 1VQ5Q 2DF6A 1WQWA 2EQJA 2DERA 3E2UA 4DOWA 4LN2A 4C5EA 4DBHA 4VUBA 4OGEA 1Q86R 1IXDA 1SRLA 1VQ9T 5LJ3d 2EYXA 2VVKA 3RKXA 2A3LA 1AEYA 2RQVA 3CD6A 4F7UE 2W10A 3O5ZA 3JB9F 4C92C 1D3BB 3LWIA 2KMTA 2C0IA 3VS3A 2MWPA 5EG2A 3VU3C 2XG8D 2YSQA 1QVFS 1VQLA 4CRIA 1K73C 1X69A 5D7UA 1JJ2S 2EQMA 1GFCA 1NBEB 4EDUA 4EMHA 3JB9I 2DX1A 2RHUA 5KYYA 1VQ8Q 3GBQA 3HTRA 2JZ2A 1BCOA 4JJNK 1UHCA 4M7DD 2RHXA 2PVOB 2O2OA 3MP8A 3NHNA 4OF1A 1VQKT 4CC3A 1N27A 2EAYA 4M7DA 2JM9A 4A4EA 4EIKA 3SFMA 2NUTB 5LJ5e 1C0MA 4JRKA 1KD1C 3QXEB 1IREB 2A37A 3CCUA 1PSEA 3CCQT 1I81A 3CCET 3VRYA 5GANh 1OX9A 4C92D 3G4SQ 1VQ7A 1K8AR 2DA9A 2EJFA 2MMPA 1IGQA 4HT9A 4BY6C 1QCFA 3JV3A 4XTZA 2HQXA 4C92A 2DTIA 1N9SA 4XU1A 3CPFA 4AFQC 3H9NA 3CXCA 2KBTA 2VXEA 2YRDA 2FPDA 3X24B 1M8VA 3JCMb 4NL2A 1Q7YU 1MUZA 2NUPB 2YUOA 1W4SA 1I07A 3E1SA 5I22A 5GAMe 2J05A 3X28B 2YXYA 6AT1B 1ZLMA 3NGPA 1RAIB 3TSWA 4ZGEB 5LJ3g 2MI6A 2CSIA 2ROTA 5IAYA 2BUDA 2RA2A 4E7JA 2X3XD 4WCIA 2V8KA 3RMQA 3JCMP 3CC7Q 4J6YA 1G3SA 2DZCA 4X9DA 1YIJT 3V7SA 1RADB 2FB7A 1IHVA 2P84A 2RPNA 2PUKB 4FM4B 3CC2A 2EYQA 1IB8A 4GBQA 4M7DG 4JJDA 1D1AA 3PTAA 2R58A 5FU6C 2PQWA 3H8ZA 2QDLA 1G83A 2ZZDA 5FRNA 3PMIA 4X9CA 4FW2A 1U3OA 2RQTA 4F7UG 1VQPQ 1TSFA 1TG0A 4LXCA 1X6GA 3MKDA 1KG1A 2DO3A 3F70A 3OBWA 2AZVA 1YJNT 2NWMA 1U1TA 2AT1B 1GBQA 2XD0A 3FB9A 2M0OA 1YITT 1W2BS 2JVVA 4C92G 3EG1A 3CCMT 1QKWA 4AG1C 1NZ9A 2VUBA 3OYJA 2KRSA 2RJEA 1C6VX 4HT8A 4EPCA 4PL6A 2MAMA 3M4GA 1UB4A 3FC3A 1P92A 1MV0B 2QQBA 2RNAA 4M77D 4Z89A 4J9CA 3OS1A 3ZEHA 4LD9K 3M56A 4M7AB 5GANe 3HPWA 2VXFA 2L3PA 1JO8A 4HCBA 4TVRA 3UA6A 2QQSA 4E7SA 4M77A 2Y4YA 4MZTA 1YJ9A 2JT4A 3EHQA 1XJWB 2E5QA 2JTMA 1ABOA 1KD1R 2JTEA 4J9HA 3KUFA 1KQSS 3UWNA 2J6OA 3TU4K 1RACB 2V8IA 5FWBA 4RTXA 5LJ3f 2EGAA 1M3BA 4B9WA 2YUNA 1M9SA 2G3RA 4D6WA 2I0NA 3L1AA 1WGSA 2O88A 3U23A 2CT3A 2GFUA 1Y57A 1V29B 1KQ1A 4FW1A 1MNDA 2MK5A 3QJ6A 3ZBDA 1K73U 4R0KA 5GAN7 4F14A 2HL3A 3OBYA 4X1VA 1TH7A 3PT9A 2P4TA 1VQ6Q 2HZYA 2KRMA 1K76A 3I55A 4OVAA 1H3ZA 3HSBA 1QW1A 1M1FA 1QVFP 3BFMA 1JJ2P 3AT1B 4EMKB 1JQQA 1KK7A 4KUDK 1NG2A 5KYXB 1UDLA 2LQKA 4FU6A 3EGDB 3GF5A 3CCLT 1WA7A 1X6BA 2YLCA 1PHTA 2E3HA 2DETA 3FLGA 4D8DA 4RG2A 3I5SA 2CYZB 2GGRA 2QYZA 2JW4A 1YBYA 2LCSA 2EQUA 5C0MA 4R56A 1Q81U 3CCEQ 2XK0A 2K7AA 4NS5A 1UECA 1YFNA 2DVEA 2KROA 3VV0A 2VYTA 4J9IA 1X43A 2MIOA 3EH2A 4Y92A 3R6NA 2RK1A 3CCJA 3G6ET 5I2SA 4AG2C 3V7CA 1WX6A 1FMVA 2L2PA 4BI8B 2EIFA 3SB2A 1GBRA 3M0PA 4M78E 2EFIA 2K5FA 1YCYA 2FHDA 1Y7XA 1M2OA 4F7UF 3OYAA 4N0AC 1LNXA 1I5OB 4OMMA 3JB9D 3D7SB 4ME7A 4MDWA 3GOXA 3HRSA 5CR2A 5CK9A 4PJOB 2CKKA 2EQIA 5CKBA 1FWZA 3AHUA 2DEQA 5I2MA 4OB0B 1YIJQ 3OY9A 1K9MR 1HK9A 1RAGB 2DL3A 2PU9B 1HSQA 1VQ5T 1VIEA 2A28A 3ME9A 3FIFA 1CKBA 3M53A 4OMLA 2FG0A 1NE8A 1WZOA 1OYXA 3QDFA 4E47A 4ZNXA 5GAOm 1WDXA 4O5VA 1UJYA 2OJ2A 4PFPA 2RI3A 1WHGA 5CKFA 4RTUA 5LL6S 1F1BB 1IHWA 1H641 2OAWA 3RNJA 1WHHA 1YCSB 4BUGA 3RR6A 2YUPA 1WHMA 2HBWA 4E7ZA 1YJNQ 2RJDA 5D6XA 4A54A 4F16A 2FRYA 3META 2COYA 1ACMB 1NJIU 4C8QB 1MMAA 3HKSA 1I4K1 3VYGA 1W2BP 5KE2A 3CEYA 5KYUA 5GMKm 2CP0A 3CBPA 3OA6A 2LJ3A 2EBPA 3G71A 2DIGA 3OQ5A 2C0TA 2XIDA 3P8HA 4RTYA 2QAZA 4LDVA 4KBMB 3M4YA 1M1KU 2Y4XA 2BZ8A 2EJ9A 3PIOA 3V8LA 1M2VA 2OTLA 1TWBA 2JS0A 4M75B 3JB9G 1VQNA 5GMKj 2J06A 2SRCA 1AWJA 3GPLA 1KQSP 1KHIA 1QQJA 4C0GA 2X9HA 3A8HB 1UEBA 5J26A 2D9TA 1ZSZC 2ZPIB 2EYZA 3HP9A 4Z02A 4RTVA 4WF2A 1WHKA 3CCSQ 1ZA2B 2DVJA 1QVGS 2KDSA 2ZGWA 1B3QA 2DILA 1KSWA 1YNZA 2DRKA 1U5SA 2D0QB 2EYWA 4QKUA 2DTOA 1O9SA 3NMZC 1D0YA 3I56A 1Y96A 3FRNA 2RHIA 4KGVB 5LJ3j 2X4WA 1VQ7T 4MDXA 3FDRA 2HSEB 4A4KA 2K57A 2E6NA 3M5AA 2DPPB 4Y28E 4J9FA 3UA7A 3J7AF 2F2XA 3OW2A 3TQ7P 3DLMA 3CMAA 2LCLA 1BBZA 3QYGB 2LQNA 4ELZC 5GAOn 3CCLQ 3CC7T 3JCMh 3GNFB 4XK8E 4C0DC 3DKMA 1QVFA 2YLBA 3M0UA 5GAOq 1RUWA 3RKYA 2JMAA 3VKIA 1N8RC 2IPOB 4J9BA 4N4IA 4CC7A 5KCHA 4ZN3A 2IVWA 1ZSZA 4KUIA 1YJWA 2FL7A 1SSHA 2O4XB 3V7RA 4FT4A 2I2LA 3PGGA 4KT0E 1VQ4T 1VQPT 3LX7A 5FROA 3LWHA 4GLMA 4JRPA 3EFOB 1M1GA 2ED1A 2A36A 4RMOA 3VS5A 1T0HA 1OZ3A 3C94A 1FYNA 1ZUYA 2COWA 4J5YA 2XI9A 2HDAA 3E9GA 3H41A 4F04B 3A8MB 4M7AE 4DQ2A 1PM3A 2DYBA 3QPHA 3SWNC 2W0ZA 1YHQT 1D0ZA 2ZPFB 3V8JA 5IXFA 4PJNA 2EYYA 2CT4A 3OB9A 1LJOA 1RL2A 2GCXA 1PWTA 3I9QA 4ANJA 2AZSA 2K6DA 1KC8C 1ZQ1A 2HD0A 2VGNA 3HRUA 4LD6A 2QEXQ 2MYSA 3OSSC 2K2VA 4HCKA 5EC7A 4QVDA 1AZEA 1MNEA 2NLUA 1PRMC 1K9AA 1U1SA 3H0HA 3TREA 2R57A 2MCNA 2XDDA 2CSQA 3EGXA 3JCMX 3L2RA 2GQIA 1SPKA 3JCMe 2F5TX 1VQ6T 5DY9A 2DEUA 4DEXA 4DBQA 1Q82R 4N4GA 1PD1A 1VQ8A 3GNGA 2E4HA 1BCMA 3X26B 3CD6Q 5GMKi 3SWNA 3REAB 4M78F 3LGFA 2DBKA 5HKCA 1ZHIA 3G7ZA 4ZGDB 3RESA 2MWOA 2CZ0B 2P0QA 2K2MA 2M0YA 3A98A 3M9QA 1VQLQ 2QASA 2XU8A 3I55T 3JCMW 4J9GA 2RI2A 5D6WA 1MMGA 1Q86U 2CP2A 2DXCA 2K4YA 2LMJA 3QWYA 2LP5A 2E1HA 1N8RR 2GTJA 1QKXA 3MEAA 4F7UA 2EWNA 5CVIA 4BD3A 1GL5A 2PTKA 1CSKA 3JRZA 1EZZB 2KNBB 4DBFA 3X25B 2DZ9A 4FYXB 2RJCA 2V8JA 4JJCA 2L5QA 1Y07A 4IUUA 4MZPA 2KVQG 1EFNA 1KQSA 1ZBJA 4RKUE 1HD3A 3N5BB 1MV3A 3EG9B 1U8RA 1QVGP 2AKKA 1YN8A 3EG0A 1AVZC 1XNIA 1VQ7Q 4JZ4A 2LNVA 1OU8A 4OGCA 4PJOC 1I5LA 1ARKA 3OYIA 2MF2A 1TOVA 2LT1A 1BU1A 2L0AA 1UGPB 3CBOA 2PVDB 2R5AA 4PJOE 3SDZA 3UDCA 1QWFA 1AWOA 3L42A 3QZ5B 1NEBA 4Y91A 1PG5B 1H92A 4HA8A 4M4ZA 4E7HA 2PVGB 5DLOA 1K8AU 4JLIA 3C0CA 5GAN3 2R5MA 3QDRB 4N4HA 1GCQC 4JZ3A 4J7FA 2QXFA 3CC4A 1HYOA 1VQ4Q 1KC8R 1OI1A 5HCKA 1SRMA 5FU7B 2CZ7B 1BIBA 4HVWA 3UPUA 5GAOl 2IIMA 1B34A 2FEIA 3CC2Q 2O31A 4K11A 4C8QC 3CMEA 5IHKA 1S72A 1TUCA 3M54A 1AWWA 3CCRT 2OTJA 1M90R 4L5GA 3C95A 4PFZA 4C8QE 1V76A 1ZSGA 2JTFA 1QP2A 4LUDA 5GJVB 2RI5A 3L2WA 1N5ZA 1RLPC 1LOJA 4KH0B 3SD4A 1JXMA 2WSCE 1I1JA 2M9UA 4CI0C 1VYUA 1PNJA 4OMPA 5GMKl 3MEVA 4BE2A 1BI1A 1RAEB 2D8JA 1YHQQ 1OPLA 4PFOA 5IH2A 1YI2A 4M75C 1VQOA 1PC0A 1K9MC 4ESRA 3CCVT 3VS2A 3A5ZB 4Z8AA 4OMFB 5CKDA 1WQ7A 2LVMA 5KE3A 4M75E 3QG1A 1KIKA 3CPWA 4C8QD 1VQ9A 5FW9A 1NEGA 2FVUA 3DB4A 5GAN5 5KYYB 3TVTA 3EFSA 4R55A 3RBBB 3BY7A 1YJ9Q 1EIFA 3CCST 2DLPA 2OTLT 1ZX6A 3ER0A 4HCZA 4J9DA 5CKHA 1UG1A 5AYFA 4DBRA 3QO3A 3CXCS 1K1ZA 3C4SA 2MOXA 2K9GA 2CP7A 3INZA 5D6YA 5GMKh 4OMOA 2KQWA 4M7DB 3OYDA 1IZ6A 2GBQA 2O01E 2ZPEB 3R6OA 3JAME 1FXXA 2JN0A 3OYHA 4XTUA 4IKFA 2DNUA 3TCJA 2KT1A 1JXOA 3LGLA 1VQKA 3OYFA 2ZPBB 4A4GA 4CC2A 3QIIA 2HAXA 2DKGA 2FZGB 3V8KA 1KD1U 4XTYA 1TU0B 3OS5A 5LJ5d 3OYNA 4C92B 2JS2A 3UT1A 1ABQA 3GLXA 2QG9B 1QMCA 1JU5C 5LJ3h 3I55Q 2KY9A 3CCQA 2DXBA 4DOVA 4M7AF 3CCEA 2D8HA 4D8KA 1M4ZA 1M27C 4XAXB 3PNWC 4Z88A 4L59A 5CCAA 2BE7D 1OPKA 1W1FA 1M30A 3MEUA 2KEAA 4M78C 1RI0A 3QBYA 4OP0A 5ECAA 4KULA 3RMSA 4PK4A 3H6ZA 1WI7A 1E6GA 4C8QG 1MGQA 2X3WD 2EVRA 5GAMd 5IT9E 1X6OA 2DL7A 1SHGA 1QVGA 2CDTA 3KXTA 4B9XA 1OULA 1R8OB 1KJWA 2BIVA 2VASA 1QWEA 2HQHA 1BI3A 2JXBA 2DK3A 1J3TA 3OSVA 3M59A 1VA7A 4RUGA 4M75G 3REBB 1RABB 3L2UA 4RCCA 1UFFA 4RTTA 1S1NA 2VV5A 4M78D 4AFUC 4ZTFA 2YWWA 1VOMA 5GMKe 1X27A 1TTHB 4PNOA 1H3HA 3VS1A 2KGTA 2F69A 1YWPA 2IG0A 2LQ8A 4M78A 3FJPA 1G3TA 2FZCB 1NLPC 3QKJA 1OV3A 2QEXT 2AK5A 1NYGA 4A63B 2L89A 1HXDA 5LJ5g 1UTIA 4O6JA 5KYWA 2J7IA 1G8XA 2P0KA 1YITA 3JCMQ 3CCMA 4M77B 1BI2A 3CCRQ 4N0AA 5HK3A 3JB9H 2DFUA
chains in the Genus database with same CATH topology
3CCSQ 3CMAQ 3CPWP 1YI2Q 1M90R 2OTJQ 3CCVQ 1YJ9Q 1W2BP 1YJWQ 1VQOQ 1K73R 1JJ2P 1VQ8Q 2OTLQ 1N8RR 3CCUQ 3CCEQ 2QEXQ 3CC7Q 1Q7YR 3CD6Q 1KD1R 1VQPQ 3CC4Q 1QVGP 1VQKQ 3CCLQ 3G71Q 1VQ4Q 1YIJQ 1KC8R 1VQMQ 1VQNQ 3OW2P 1K9MR 3I56Q 1VQ5Q 3G6EQ 1M1KR 2QA4Q 3G4SQ 1KQSP 3CXCP 1K8AR 1VQ7Q 1YJNQ 1VQ6Q 3CCJQ 1VQ9Q 1YITQ 1NJIR 1Q86R 3CC2Q 1VQLQ 3CMEQ 3I55Q 3CCMQ 1Q81R 3CCRQ 1QVFP 1S72Q 3CCQQ 1Q82R 1YHQQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCS Q;  3CMA Q;  3CPW P;  1YI2 Q;  1M90 R;  2OTJ Q;  3CCV Q;  1YJ9 Q;  1W2B P;  1YJW Q;  1VQO Q;  1K73 R;  1JJ2 P;  1VQ8 Q;  2OTL Q;  1N8R R;  3CCU Q;  3CCE Q;  2QEX Q;  3CC7 Q;  1Q7Y R;  3CD6 Q;  1KD1 R;  1VQP Q;  3CC4 Q;  1QVG P;  1VQK Q;  3CCL Q;  3G71 Q;  1VQ4 Q;  1YIJ Q;  1KC8 R;  1VQM Q;  1VQN Q;  3OW2 P;  1K9M R;  3I56 Q;  1VQ5 Q;  3G6E Q;  1M1K R;  2QA4 Q;  3G4S Q;  1KQS P;  3CXC P;  1K8A R;  1VQ7 Q;  1YJN Q;  1VQ6 Q;  3CCJ Q;  1VQ9 Q;  1YIT Q;  1NJI R;  1Q86 R;  3CC2 Q;  1VQL Q;  3CME Q;  3I55 Q;  3CCM Q;  1Q81 R;  3CCR Q;  1QVF P;  1S72 Q;  3CCQ Q;  1Q82 R;  1YHQ Q; 
#chains in the Genus database with same CATH topology
 2M1H A;  2CRE A;  1ZA1 B;  5FU6 B;  4XTW A;  5LJ3 e;  2KT8 A;  1ZUK A;  2CH4 A;  4CC4 B;  3CD6 T;  1GCP A;  2DRM A;  4E2F B;  2A7Y A;  3L2V A;  2D6F A;  3M0Q A;  1K9M U;  4F17 A;  1AZG B;  3NTI A;  4YTL A;  3JCM c;  1KFZ A;  1VQL T;  1BKB A;  3I35 A;  4XU0 A;  4FSX A;  2YRC A;  2HEQ A;  3CCV Q;  2E5K A;  2KXC A;  4PJO F;  5IHN A;  3G71 Q;  5GAM g;  4GLK A;  1D09 B;  2QA4 A;  2ROL A;  4OMN A;  4P5N A;  1D3B A;  2QTV A;  2RB6 A;  4LDU A;  1SHF A;  1AOJ A;  3J80 E;  2H3E B;  2OTL Q;  3NPF A;  1B7T A;  4HCC A;  2L3R A;  3G1J A;  3CCU T;  1OU9 A;  4M78 G;  5CAI A;  2HMA A;  3MP1 A;  4C0F A;  1U06 A;  3CXC P;  1OZ2 A;  1SG5 A;  1Q82 C;  3LH5 A;  2B86 A;  2HSP A;  3UF4 A;  4XU2 A;  4JRQ A;  2DXT A;  2NUT A;  4PJJ A;  5LJ5 f;  3I5R A;  1NPR A;  2LRQ A;  4A53 A;  1UGS B;  3CCL A;  2GNC A;  1RAA B;  4C8Q F;  1Y0M A;  3I56 Q;  1RI9 A;  1WFW A;  3OS0 A;  5FWC A;  1D1B A;  4BE0 A;  1CKA A;  1JJ2 A;  2WAC A;  1WJR A;  1WYX A;  4J83 A;  3M0S A;  3CQT A;  2DIQ A;  3PMT A;  2YT6 A;  2BTT A;  3CMA Q;  2V1Q A;  5A2Q E;  2KAF A;  4JUV A;  4HKE A;  2JOY A;  3S3N A;  2FYK A;  1N6A A;  1WJS A;  1SKU B;  3G6E A;  4IIM A;  3X20 B;  4M75 F;  3PVL A;  1PKT A;  4DA4 A;  4J6X A;  2NUP A;  1M3A A;  2CUB A;  3VJP A;  4QVZ A;  2QQA A;  5GAM f;  3WVE B;  2EW3 A;  3CC2 T;  3VRZ A;  1YJW Q;  4BAC A;  2FPF A;  3EHR A;  5LJ5 h;  1UGQ B;  3CC4 T;  1VQM A;  2DTH A;  3HFO A;  1FMK A;  4ATO A;  3KFV A;  2BE9 B;  4M7A C;  1XOV A;  1ZBX A;  1E7O A;  1YWO A;  3EFR A;  3MHX A;  3CME T;  2PNI A;  2ZAE A;  4JPB W;  1AT1 B;  2RMO A;  1S72 T;  4LDX A;  4RCB A;  2OTJ T;  2CGH A;  5GJW B;  4E7L A;  1DJ7 B;  1LVK A;  4PKC C;  4HVV A;  3MEW A;  1VQ5 A;  4LE9 A;  3PE0 A;  4AMC A;  3JB9 J;  4FL6 A;  2X4X A;  4HVU A;  1G3Y A;  2Y90 A;  3VS0 A;  5KYU B;  2DJZ A;  2QQ9 A;  4RTZ A;  5GAM h;  3FEO A;  3JCM J;  1YJ9 T;  2DMO A;  2F1L A;  4QQD A;  3MCA B;  4M7A D;  4XU3 A;  3S3O A;  2M16 A;  2RHY A;  3S6W A;  3QZ9 B;  2FO0 A;  1BB9 A;  4M7D E;  4IUT A;  1M90 C;  1WXB A;  1OOT A;  4JLG A;  4M7A A;  1M2V B;  3OMC A;  2EGE A;  3Q1J A;  5GAN f;  2ENM A;  1NM7 A;  4EMK C;  4V2S A;  2YDL A;  1PRL C;  3OW2 S;  2OAU A;  2LZ6 B;  3H0I A;  2E3I A;  5FLX E;  1Z9Z A;  4KRT A;  3A8O B;  2M02 A;  1LCK A;  2KXD A;  5IXB A;  1BYM A;  3OYL A;  1W2B A;  1R0C B;  4KH1 B;  2RH2 A;  4A4F A;  4C92 E;  4E7K A;  4HXJ A;  3PVQ A;  4PLI A;  5CKE A;  4JS5 A;  2AHJ B;  3P8D A;  5A0G A;  1T0J A;  2VKN A;  2E70 A;  1Q7Y R;  2CP6 A;  3MP6 A;  1Y96 B;  2RN8 A;  2BZY A;  2GQV A;  1NLO C;  3G4S A;  1T3L A;  1TXQ A;  2RQR A;  1AWX A;  5GAN 2;  3TSZ A;  2K5L A;  3DLL A;  4QQ6 A;  3CCU Q;  1Q82 U;  4LDY A;  3A1P A;  5GAN 4;  4KGZ B;  4KGX B;  4EMK A;  1VUB A;  5KYX A;  5A0D A;  4L6V 5;  2ZPH B;  4J6W A;  2CH4 W;  1Q81 C;  3EGD A;  3SEM A;  2V1R A;  4LNP A;  3UAT A;  3CCJ T;  2GFA A;  2NUZ A;  1K0S A;  2HCK A;  1ZSZ B;  4BI4 A;  1BI0 A;  4M7A G;  1H8K A;  2FPE A;  4OB3 B;  2E12 A;  3CC7 A;  5HY6 A;  1TUD A;  8ATC B;  2A08 A;  4C5H A;  3OYB A;  1SF9 A;  2ED0 A;  4NOY A;  1N8R U;  2XHC A;  4E7I A;  1M8M A;  3M0R A;  1G3W A;  4FCY A;  2O9S A;  2O9V A;  2BZX A;  2NYS A;  3KBG A;  2E6Z A;  3QUI A;  2VC8 A;  2MPX C;  2DD5 A;  3GIB A;  3BE3 A;  4XQ3 A;  3THK A;  2GTO A;  2CZ1 B;  2SEM A;  1KQ2 A;  4RTW A;  5LJ5 j;  2EGC A;  1UJ0 A;  2GF7 A;  1VQ4 A;  1VQP A;  1VIF A;  3JSC A;  5KYN A;  2F5K A;  3QSU A;  2RQW A;  3WXM B;  4BDY A;  5GAO r;  2EQK A;  1WXT A;  4M77 C;  4C0D B;  4PJO D;  1JRI A;  5CIU A;  4AFZ C;  5J39 A;  4E6R A;  1R77 A;  4IUV A;  2COZ A;  9ATC B;  4M77 E;  4PJO A;  3EG3 A;  1X2Q A;  1B07 A;  4QW2 A;  3CC4 Q;  3URG A;  2LNH B;  1C1A A;  3BDU A;  3LLR A;  5L8R E;  1QCO A;  1W6X A;  4XTX A;  4DEY A;  4BE1 A;  1T3S A;  3PFS A;  3ULR B;  3CME Q;  3NTK A;  1YHQ A;  7AT1 B;  1S72 Q;  3M0T A;  5GAM j;  5A0L A;  2AKL A;  2ATC B;  3HL8 A;  2OTJ Q;  1K73 R;  2KR3 A;  1PKS A;  1PCX A;  8AT1 B;  1NJI C;  3G71 T;  1GCQ A;  2DAQ A;  1X01 A;  3EGX B;  2E64 A;  1KC8 U;  3RDV A;  4II1 A;  2L3S A;  1IGU A;  2QGF B;  4MML A;  1XTD A;  3VUB A;  4IIO A;  4B6M A;  4IUR A;  2RJF A;  1YI2 Q;  3SWN B;  1VQO Q;  3OYE A;  1M1K C;  4C8Q A;  3QWX X;  1M90 U;  2G6F X;  2C0O A;  5DLQ E;  1VQN T;  3JCM d;  4JDS A;  2XKO C;  3OYC A;  4MZM A;  2QA4 T;  1VQ6 A;  3E19 A;  1VQ9 Q;  2DL5 A;  3EAE A;  4MMK A;  3ZL7 C;  2HNI A;  1Q81 R;  2EKH A;  2HBP A;  1G2B A;  4M75 D;  2KYB A;  3BDL A;  4F7U B;  2RK2 A;  3VS6 A;  2JM8 A;  1OEB A;  4FSS A;  4PJO G;  1G5V A;  1I0C A;  1X75 C;  2K5I A;  3OW2 P;  1Y71 A;  4M75 A;  3EGU A;  3HRT A;  3CBM A;  4BDZ A;  3I56 T;  2PUO B;  1WHJ A;  2QGG A;  5HK0 A;  3RER A;  2CP5 A;  3VUZ A;  3VS4 A;  5GAN j;  2JUF A;  3IQL A;  4BI3 A;  1LPL A;  3CMA T;  2P0P A;  1VQK Q;  2E65 A;  1E6H A;  3MO8 A;  4FT2 A;  1FX7 A;  2EJG A;  2V26 A;  1RAH B;  1WNL A;  4GY5 A;  3BW1 A;  1D1C A;  3MPU B;  3C12 A;  1WPY A;  3CCQ Q;  2F2W A;  5L23 A;  2VB6 A;  4QQG A;  4M77 G;  1WXU A;  1IRX A;  3NTH A;  2VGM A;  3EG2 A;  3OS2 A;  1YJW T;  1N9R A;  2HKN A;  5KCO A;  3OYG A;  2XIC A;  1GRI A;  3CCJ Q;  3EH1 A;  4PJM A;  1WLP B;  3VYH B;  3LW5 E;  1Q95 G;  2CS7 A;  4BY6 B;  3QJY A;  4M7D F;  5KH6 A;  2B8A A;  3J81 E;  4J7I A;  2FZK B;  5AT1 B;  3H0F A;  2DBM A;  4C5I A;  1VYT A;  2J6K A;  1QVP A;  1TUG B;  2OI3 A;  2X4Y A;  1YIJ A;  2LJ1 A;  2O4X A;  4AT1 B;  5I21 A;  4QT7 A;  3O8V A;  1VQM T;  3JCM g;  2ZPG B;  1IO6 A;  1B34 B;  2DL8 A;  2LDM A;  2RO0 A;  4JRI A;  4LUE A;  5CQX A;  2LX9 A;  1NJI R;  4JJB A;  1JEG A;  5GAN 6;  2JJ9 A;  3OYK A;  2CP3 A;  3CPW S;  2C06 A;  4ZTJ A;  4C92 F;  2L3Q A;  2QQR A;  3EFO A;  3VS7 A;  4Q5W A;  4QVC A;  3P8B B;  4OB1 B;  4ORZ A;  2J6F A;  1WHL A;  2D0N A;  1M1K R;  4J9E A;  4NL3 A;  1YJN A;  1I8F A;  2Z0W A;  1UUE A;  4LDW A;  5M9O A;  3LYI A;  5GAN 8;  5I11 A;  5FRM A;  3CCR A;  3GP8 A;  1UE9 A;  1K4U S;  1RLQ C;  1R0B G;  2KK4 A;  4BB7 A;  1M3C A;  4A4H A;  2HKQ B;  4EMG A;  1MHN A;  4IUP A;  2WSF E;  5GAN d;  2BKD N;  4IUQ A;  1GXI E;  4PJL A;  3OMG A;  2D1X A;  2RM4 A;  3MJX A;  1YIT Q;  1WIE A;  3QHS A;  4FIB A;  4FYV B;  2DE0 X;  3CCM Q;  2RF0 A;  5DM7 R;  3M58 A;  1OX8 A;  3WVD B;  3L2Q A;  1AD5 A;  3HFN A;  1JBM A;  2LQW A;  3CCV A;  1A0N B;  1FMW A;  2YHT A;  1VQ8 T;  1SEM A;  3OYY A;  3E9F A;  2QI2 A;  1KHC A;  2JNG A;  4UC4 A;  3M57 A;  3M55 A;  2DJQ A;  2YRV A;  1YP5 A;  1QCN A;  4JS4 A;  3S3M A;  3JCM V;  2LT4 A;  3CCS A;  1GFD A;  2LCC A;  3JCM f;  2XDB A;  4WTO B;  4ZGJ B;  4C0Z A;  1NPP A;  2ESW A;  3SHW A;  3LH0 A;  3ZFJ A;  1VQN Q;  1BK2 A;  1EX4 A;  1Q86 C;  2X4J A;  2QA4 Q;  1QLY A;  2RD1 A;  3G4S T;  1XQH A;  1X2K A;  1BIA A;  2LX7 A;  2DM1 A;  1NYF A;  1V1C A;  2A0F B;  2X35 A;  2WSE E;  4M77 F;  2ECZ A;  1OQK A;  4PLL A;  1UHF A;  1PD0 A;  3RKW A;  1TS9 A;  1SSF A;  5IN1 A;  1AHJ B;  4AFS C;  1VYV A;  5CQY A;  4OB2 B;  3TEE A;  1QP3 A;  2DL4 A;  2RQU A;  2DYI A;  4RG8 A;  1Q7Y C;  2HQE A;  4X34 A;  3T9N A;  5IHI A;  4C5G A;  2QTX A;  3HHT B;  3EG9 A;  2DXU A;  3A8G B;  2K3Y A;  2XDP A;  5FU7 C;  4ZN1 A;  1UGR B;  1MMN A;  5GAN g;  3FJ5 A;  2OX7 A;  5GAO p;  1RAF B;  1Z9Q A;  1O75 A;  2M51 A;  4J8O A;  2RHZ A;  5C6S A;  3ASK A;  2K79 A;  1W70 A;  1JB0 E;  4XTV A;  2KI7 A;  2LC4 A;  2QDY B;  1M5Q 1;  3OYM A;  3A8L B;  2K3B A;  1K8A C;  1ZUU A;  5CO7 A;  1HJD A;  2KSS A;  3G6E Q;  2F2V A;  3PIP A;  2JMC A;  3NFC A;  2FRW A;  2K3X A;  2YUQ A;  4FYW B;  1PSF A;  2ABL A;  4ELY C;  3QYH B;  4M78 B;  1D0X A;  2DD4 A;  2LTO A;  3DB3 A;  2AIR B;  1K0X A;  2QK0 A;  5J3B A;  2H3J A;  2E10 A;  1VQM Q;  4FYY B;  3RIR A;  5KYW B;  2CZ6 B;  2ZCF B;  3L2Z A;  4OMQ A;  2EPD A;  2E41 A;  2P4R A;  2XMF A;  2EKO A;  2X51 A;  1WJQ A;  1MMD A;  2H8H A;  2KYM A;  2KE9 A;  3CPW P;  2PZ1 A;  2LJ0 A;  2QEX A;  1YI2 T;  2KRN A;  2L8D A;  3RUX A;  1VQO T;  2HL5 C;  2CUD A;  1UGV A;  2VWF A;  4M7D C;  1VQ5 Q;  2DF6 A;  1WQW A;  2EQJ A;  2DER A;  3E2U A;  4DOW A;  4LN2 A;  4C5E A;  4DBH A;  4VUB A;  4OGE A;  1Q86 R;  1IXD A;  1SRL A;  1VQ9 T;  5LJ3 d;  2EYX A;  2VVK A;  3RKX A;  2A3L A;  1AEY A;  2RQV A;  3CD6 A;  4F7U E;  2W10 A;  3O5Z A;  3JB9 F;  4C92 C;  1D3B B;  3LWI A;  2KMT A;  2C0I A;  3VS3 A;  2MWP A;  5EG2 A;  3VU3 C;  2XG8 D;  2YSQ A;  1QVF S;  1VQL A;  4CRI A;  1K73 C;  1X69 A;  5D7U A;  1JJ2 S;  2EQM A;  1GFC A;  1NBE B;  4EDU A;  4EMH A;  3JB9 I;  2DX1 A;  2RHU A;  5KYY A;  1VQ8 Q;  3GBQ A;  3HTR A;  2JZ2 A;  1BCO A;  4JJN K;  1UHC A;  4M7D D;  2RHX A;  2PVO B;  2O2O A;  3MP8 A;  3NHN A;  4OF1 A;  1VQK T;  4CC3 A;  1N27 A;  2EAY A;  4M7D A;  2JM9 A;  4A4E A;  4EIK A;  3SFM A;  2NUT B;  5LJ5 e;  1C0M A;  4JRK A;  1KD1 C;  3QXE B;  1IRE B;  2A37 A;  3CCU A;  1PSE A;  3CCQ T;  1I81 A;  3CCE T;  3VRY A;  5GAN h;  1OX9 A;  4C92 D;  3G4S Q;  1VQ7 A;  1K8A R;  2DA9 A;  2EJF A;  2MMP A;  1IGQ A;  4HT9 A;  4BY6 C;  1QCF A;  3JV3 A;  4XTZ A;  2HQX A;  4C92 A;  2DTI A;  1N9S A;  4XU1 A;  3CPF A;  4AFQ C;  3H9N A;  3CXC A;  2KBT A;  2VXE A;  2YRD A;  2FPD A;  3X24 B;  1M8V A;  3JCM b;  4NL2 A;  1Q7Y U;  1MUZ A;  2NUP B;  2YUO A;  1W4S A;  1I07 A;  3E1S A;  5I22 A;  5GAM e;  2J05 A;  3X28 B;  2YXY A;  6AT1 B;  1ZLM A;  3NGP A;  1RAI B;  3TSW A;  4ZGE B;  5LJ3 g;  2MI6 A;  2CSI A;  2ROT A;  5IAY A;  2BUD A;  2RA2 A;  4E7J A;  2X3X D;  4WCI A;  2V8K A;  3RMQ A;  3JCM P;  3CC7 Q;  4J6Y A;  1G3S A;  2DZC A;  4X9D A;  1YIJ T;  3V7S A;  1RAD B;  2FB7 A;  1IHV A;  2P84 A;  2RPN A;  2PUK B;  4FM4 B;  3CC2 A;  2EYQ A;  1IB8 A;  4GBQ A;  4M7D G;  4JJD A;  1D1A A;  3PTA A;  2R58 A;  5FU6 C;  2PQW A;  3H8Z A;  2QDL A;  1G83 A;  2ZZD A;  5FRN A;  3PMI A;  4X9C A;  4FW2 A;  1U3O A;  2RQT A;  4F7U G;  1VQP Q;  1TSF A;  1TG0 A;  4LXC A;  1X6G A;  3MKD A;  1KG1 A;  2DO3 A;  3F70 A;  3OBW A;  2AZV A;  1YJN T;  2NWM A;  1U1T A;  2AT1 B;  1GBQ A;  2XD0 A;  3FB9 A;  2M0O A;  1YIT T;  1W2B S;  2JVV A;  4C92 G;  3EG1 A;  3CCM T;  1QKW A;  4AG1 C;  1NZ9 A;  2VUB A;  3OYJ A;  2KRS A;  2RJE A;  1C6V X;  4HT8 A;  4EPC A;  4PL6 A;  2MAM A;  3M4G A;  1UB4 A;  3FC3 A;  1P92 A;  1MV0 B;  2QQB A;  2RNA A;  4M77 D;  4Z89 A;  4J9C A;  3OS1 A;  3ZEH A;  4LD9 K;  3M56 A;  4M7A B;  5GAN e;  3HPW A;  2VXF A;  2L3P A;  1JO8 A;  4HCB A;  4TVR A;  3UA6 A;  2QQS A;  4E7S A;  4M77 A;  2Y4Y A;  4MZT A;  1YJ9 A;  2JT4 A;  3EHQ A;  1XJW B;  2E5Q A;  2JTM A;  1ABO A;  1KD1 R;  2JTE A;  4J9H A;  3KUF A;  1KQS S;  3UWN A;  2J6O A;  3TU4 K;  1RAC B;  2V8I A;  5FWB A;  4RTX A;  5LJ3 f;  2EGA A;  1M3B A;  4B9W A;  2YUN A;  1M9S A;  2G3R A;  4D6W A;  2I0N A;  3L1A A;  1WGS A;  2O88 A;  3U23 A;  2CT3 A;  2GFU A;  1Y57 A;  1V29 B;  1KQ1 A;  4FW1 A;  1MND A;  2MK5 A;  3QJ6 A;  3ZBD A;  1K73 U;  4R0K A;  5GAN 7;  4F14 A;  2HL3 A;  3OBY A;  4X1V A;  1TH7 A;  3PT9 A;  2P4T A;  1VQ6 Q;  2HZY A;  2KRM A;  1K76 A;  3I55 A;  4OVA A;  1H3Z A;  3HSB A;  1QW1 A;  1M1F A;  1QVF P;  3BFM A;  1JJ2 P;  3AT1 B;  4EMK B;  1JQQ A;  1KK7 A;  4KUD K;  1NG2 A;  5KYX B;  1UDL A;  2LQK A;  4FU6 A;  3EGD B;  3GF5 A;  3CCL T;  1WA7 A;  1X6B A;  2YLC A;  1PHT A;  2E3H A;  2DET A;  3FLG A;  4D8D A;  4RG2 A;  3I5S A;  2CYZ B;  2GGR A;  2QYZ A;  2JW4 A;  1YBY A;  2LCS A;  2EQU A;  5C0M A;  4R56 A;  1Q81 U;  3CCE Q;  2XK0 A;  2K7A A;  4NS5 A;  1UEC A;  1YFN A;  2DVE A;  2KRO A;  3VV0 A;  2VYT A;  4J9I A;  1X43 A;  2MIO A;  3EH2 A;  4Y92 A;  3R6N A;  2RK1 A;  3CCJ A;  3G6E T;  5I2S A;  4AG2 C;  3V7C A;  1WX6 A;  1FMV A;  2L2P A;  4BI8 B;  2EIF A;  3SB2 A;  1GBR A;  3M0P A;  4M78 E;  2EFI A;  2K5F A;  1YCY A;  2FHD A;  1Y7X A;  1M2O A;  4F7U F;  3OYA A;  4N0A C;  1LNX A;  1I5O B;  4OMM A;  3JB9 D;  3D7S B;  4ME7 A;  4MDW A;  3GOX A;  3HRS A;  5CR2 A;  5CK9 A;  4PJO B;  2CKK A;  2EQI A;  5CKB A;  1FWZ A;  3AHU A;  2DEQ A;  5I2M A;  4OB0 B;  1YIJ Q;  3OY9 A;  1K9M R;  1HK9 A;  1RAG B;  2DL3 A;  2PU9 B;  1HSQ A;  1VQ5 T;  1VIE A;  2A28 A;  3ME9 A;  3FIF A;  1CKB A;  3M53 A;  4OML A;  2FG0 A;  1NE8 A;  1WZO A;  1OYX A;  3QDF A;  4E47 A;  4ZNX A;  5GAO m;  1WDX A;  4O5V A;  1UJY A;  2OJ2 A;  4PFP A;  2RI3 A;  1WHG A;  5CKF A;  4RTU A;  5LL6 S;  1F1B B;  1IHW A;  1H64 1;  2OAW A;  3RNJ A;  1WHH A;  1YCS B;  4BUG A;  3RR6 A;  2YUP A;  1WHM A;  2HBW A;  4E7Z A;  1YJN Q;  2RJD A;  5D6X A;  4A54 A;  4F16 A;  2FRY A;  3MET A;  2COY A;  1ACM B;  1NJI U;  4C8Q B;  1MMA A;  3HKS A;  1I4K 1;  3VYG A;  1W2B P;  5KE2 A;  3CEY A;  5KYU A;  5GMK m;  2CP0 A;  3CBP A;  3OA6 A;  2LJ3 A;  2EBP A;  3G71 A;  2DIG A;  3OQ5 A;  2C0T A;  2XID A;  3P8H A;  4RTY A;  2QAZ A;  4LDV A;  4KBM B;  3M4Y A;  1M1K U;  2Y4X A;  2BZ8 A;  2EJ9 A;  3PIO A;  3V8L A;  1M2V A;  2OTL A;  1TWB A;  2JS0 A;  4M75 B;  3JB9 G;  1VQN A;  5GMK j;  2J06 A;  2SRC A;  1AWJ A;  3GPL A;  1KQS P;  1KHI A;  1QQJ A;  4C0G A;  2X9H A;  3A8H B;  1UEB A;  5J26 A;  2D9T A;  1ZSZ C;  2ZPI B;  2EYZ A;  3HP9 A;  4Z02 A;  4RTV A;  4WF2 A;  1WHK A;  3CCS Q;  1ZA2 B;  2DVJ A;  1QVG S;  2KDS A;  2ZGW A;  1B3Q A;  2DIL A;  1KSW A;  1YNZ A;  2DRK A;  1U5S A;  2D0Q B;  2EYW A;  4QKU A;  2DTO A;  1O9S A;  3NMZ C;  1D0Y A;  3I56 A;  1Y96 A;  3FRN A;  2RHI A;  4KGV B;  5LJ3 j;  2X4W A;  1VQ7 T;  4MDX A;  3FDR A;  2HSE B;  4A4K A;  2K57 A;  2E6N A;  3M5A A;  2DPP B;  4Y28 E;  4J9F A;  3UA7 A;  3J7A F;  2F2X A;  3OW2 A;  3TQ7 P;  3DLM A;  3CMA A;  2LCL A;  1BBZ A;  3QYG B;  2LQN A;  4ELZ C;  5GAO n;  3CCL Q;  3CC7 T;  3JCM h;  3GNF B;  4XK8 E;  4C0D C;  3DKM A;  1QVF A;  2YLB A;  3M0U A;  5GAO q;  1RUW A;  3RKY A;  2JMA A;  3VKI A;  1N8R C;  2IPO B;  4J9B A;  4N4I A;  4CC7 A;  5KCH A;  4ZN3 A;  2IVW A;  1ZSZ A;  4KUI A;  1YJW A;  2FL7 A;  1SSH A;  2O4X B;  3V7R A;  4FT4 A;  2I2L A;  3PGG A;  4KT0 E;  1VQ4 T;  1VQP T;  3LX7 A;  5FRO A;  3LWH A;  4GLM A;  4JRP A;  3EFO B;  1M1G A;  2ED1 A;  2A36 A;  4RMO A;  3VS5 A;  1T0H A;  1OZ3 A;  3C94 A;  1FYN A;  1ZUY A;  2COW A;  4J5Y A;  2XI9 A;  2HDA A;  3E9G A;  3H41 A;  4F04 B;  3A8M B;  4M7A E;  4DQ2 A;  1PM3 A;  2DYB A;  3QPH A;  3SWN C;  2W0Z A;  1YHQ T;  1D0Z A;  2ZPF B;  3V8J A;  5IXF A;  4PJN A;  2EYY A;  2CT4 A;  3OB9 A;  1LJO A;  1RL2 A;  2GCX A;  1PWT A;  3I9Q A;  4ANJ A;  2AZS A;  2K6D A;  1KC8 C;  1ZQ1 A;  2HD0 A;  2VGN A;  3HRU A;  4LD6 A;  2QEX Q;  2MYS A;  3OSS C;  2K2V A;  4HCK A;  5EC7 A;  4QVD A;  1AZE A;  1MNE A;  2NLU A;  1PRM C;  1K9A A;  1U1S A;  3H0H A;  3TRE A;  2R57 A;  2MCN A;  2XDD A;  2CSQ A;  3EGX A;  3JCM X;  3L2R A;  2GQI A;  1SPK A;  3JCM e;  2F5T X;  1VQ6 T;  5DY9 A;  2DEU A;  4DEX A;  4DBQ A;  1Q82 R;  4N4G A;  1PD1 A;  1VQ8 A;  3GNG A;  2E4H A;  1BCM A;  3X26 B;  3CD6 Q;  5GMK i;  3SWN A;  3REA B;  4M78 F;  3LGF A;  2DBK A;  5HKC A;  1ZHI A;  3G7Z A;  4ZGD B;  3RES A;  2MWO A;  2CZ0 B;  2P0Q A;  2K2M A;  2M0Y A;  3A98 A;  3M9Q A;  1VQL Q;  2QAS A;  2XU8 A;  3I55 T;  3JCM W;  4J9G A;  2RI2 A;  5D6W A;  1MMG A;  1Q86 U;  2CP2 A;  2DXC A;  2K4Y A;  2LMJ A;  3QWY A;  2LP5 A;  2E1H A;  1N8R R;  2GTJ A;  1QKX A;  3MEA A;  4F7U A;  2EWN A;  5CVI A;  4BD3 A;  1GL5 A;  2PTK A;  1CSK A;  3JRZ A;  1EZZ B;  2KNB B;  4DBF A;  3X25 B;  2DZ9 A;  4FYX B;  2RJC A;  2V8J A;  4JJC A;  2L5Q A;  1Y07 A;  4IUU A;  4MZP A;  2KVQ G;  1EFN A;  1KQS A;  1ZBJ A;  4RKU E;  1HD3 A;  3N5B B;  1MV3 A;  3EG9 B;  1U8R A;  1QVG P;  2AKK A;  1YN8 A;  3EG0 A;  1AVZ C;  1XNI A;  1VQ7 Q;  4JZ4 A;  2LNV A;  1OU8 A;  4OGC A;  4PJO C;  1I5L A;  1ARK A;  3OYI A;  2MF2 A;  1TOV A;  2LT1 A;  1BU1 A;  2L0A A;  1UGP B;  3CBO A;  2PVD B;  2R5A A;  4PJO E;  3SDZ A;  3UDC A;  1QWF A;  1AWO A;  3L42 A;  3QZ5 B;  1NEB A;  4Y91 A;  1PG5 B;  1H92 A;  4HA8 A;  4M4Z A;  4E7H A;  2PVG B;  5DLO A;  1K8A U;  4JLI A;  3C0C A;  5GAN 3;  2R5M A;  3QDR B;  4N4H A;  1GCQ C;  4JZ3 A;  4J7F A;  2QXF A;  3CC4 A;  1HYO A;  1VQ4 Q;  1KC8 R;  1OI1 A;  5HCK A;  1SRM A;  5FU7 B;  2CZ7 B;  1BIB A;  4HVW A;  3UPU A;  5GAO l;  2IIM A;  1B34 A;  2FEI A;  3CC2 Q;  2O31 A;  4K11 A;  4C8Q C;  3CME A;  5IHK A;  1S72 A;  1TUC A;  3M54 A;  1AWW A;  3CCR T;  2OTJ A;  1M90 R;  4L5G A;  3C95 A;  4PFZ A;  4C8Q E;  1V76 A;  1ZSG A;  2JTF A;  1QP2 A;  4LUD A;  5GJV B;  2RI5 A;  3L2W A;  1N5Z A;  1RLP C;  1LOJ A;  4KH0 B;  3SD4 A;  1JXM A;  2WSC E;  1I1J A;  2M9U A;  4CI0 C;  1VYU A;  1PNJ A;  4OMP A;  5GMK l;  3MEV A;  4BE2 A;  1BI1 A;  1RAE B;  2D8J A;  1YHQ Q;  1OPL A;  4PFO A;  5IH2 A;  1YI2 A;  4M75 C;  1VQO A;  1PC0 A;  1K9M C;  4ESR A;  3CCV T;  3VS2 A;  3A5Z B;  4Z8A A;  4OMF B;  5CKD A;  1WQ7 A;  2LVM A;  5KE3 A;  4M75 E;  3QG1 A;  1KIK A;  3CPW A;  4C8Q D;  1VQ9 A;  5FW9 A;  1NEG A;  2FVU A;  3DB4 A;  5GAN 5;  5KYY B;  3TVT A;  3EFS A;  4R55 A;  3RBB B;  3BY7 A;  1YJ9 Q;  1EIF A;  3CCS T;  2DLP A;  2OTL T;  1ZX6 A;  3ER0 A;  4HCZ A;  4J9D A;  5CKH A;  1UG1 A;  5AYF A;  4DBR A;  3QO3 A;  3CXC S;  1K1Z A;  3C4S A;  2MOX A;  2K9G A;  2CP7 A;  3INZ A;  5D6Y A;  5GMK h;  4OMO A;  2KQW A;  4M7D B;  3OYD A;  1IZ6 A;  2GBQ A;  2O01 E;  2ZPE B;  3R6O A;  3JAM E;  1FXX A;  2JN0 A;  3OYH A;  4XTU A;  4IKF A;  2DNU A;  3TCJ A;  2KT1 A;  1JXO A;  3LGL A;  1VQK A;  3OYF A;  2ZPB B;  4A4G A;  4CC2 A;  3QII A;  2HAX A;  2DKG A;  2FZG B;  3V8K A;  1KD1 U;  4XTY A;  1TU0 B;  3OS5 A;  5LJ5 d;  3OYN A;  4C92 B;  2JS2 A;  3UT1 A;  1ABQ A;  3GLX A;  2QG9 B;  1QMC A;  1JU5 C;  5LJ3 h;  3I55 Q;  2KY9 A;  3CCQ A;  2DXB A;  4DOV A;  4M7A F;  3CCE A;  2D8H A;  4D8K A;  1M4Z A;  1M27 C;  4XAX B;  3PNW C;  4Z88 A;  4L59 A;  5CCA A;  2BE7 D;  1OPK A;  1W1F A;  1M30 A;  3MEU A;  2KEA A;  4M78 C;  1RI0 A;  3QBY A;  4OP0 A;  5ECA A;  4KUL A;  3RMS A;  4PK4 A;  3H6Z A;  1WI7 A;  1E6G A;  4C8Q G;  1MGQ A;  2X3W D;  2EVR A;  5GAM d;  5IT9 E;  1X6O A;  2DL7 A;  1SHG A;  1QVG A;  2CDT A;  3KXT A;  4B9X A;  1OUL A;  1R8O B;  1KJW A;  2BIV A;  2VAS A;  1QWE A;  2HQH A;  1BI3 A;  2JXB A;  2DK3 A;  1J3T A;  3OSV A;  3M59 A;  1VA7 A;  4RUG A;  4M75 G;  3REB B;  1RAB B;  3L2U A;  4RCC A;  1UFF A;  4RTT A;  1S1N A;  2VV5 A;  4M78 D;  4AFU C;  4ZTF A;  2YWW A;  1VOM A;  5GMK e;  1X27 A;  1TTH B;  4PNO A;  1H3H A;  3VS1 A;  2KGT A;  2F69 A;  1YWP A;  2IG0 A;  2LQ8 A;  4M78 A;  3FJP A;  1G3T A;  2FZC B;  1NLP C;  3QKJ A;  1OV3 A;  2QEX T;  2AK5 A;  1NYG A;  4A63 B;  2L89 A;  1HXD A;  5LJ5 g;  1UTI A;  4O6J A;  5KYW A;  2J7I A;  1G8X A;  2P0K A;  1YIT A;  3JCM Q;  3CCM A;  4M77 B;  1BI2 A;  3CCR Q;  4N0A A;  5HK3 A;  3JB9 H;  2DFU A; 
#chains in the Genus database with same CATH homology
 3CCS Q;  3CMA Q;  3CPW P;  1YI2 Q;  1M90 R;  2OTJ Q;  3CCV Q;  1YJ9 Q;  1W2B P;  1YJW Q;  1VQO Q;  1K73 R;  1JJ2 P;  1VQ8 Q;  2OTL Q;  1N8R R;  3CCU Q;  3CCE Q;  2QEX Q;  3CC7 Q;  1Q7Y R;  3CD6 Q;  1KD1 R;  1VQP Q;  3CC4 Q;  1QVG P;  1VQK Q;  3CCL Q;  3G71 Q;  1VQ4 Q;  1YIJ Q;  1KC8 R;  1VQM Q;  1VQN Q;  3OW2 P;  1K9M R;  3I56 Q;  1VQ5 Q;  3G6E Q;  1M1K R;  2QA4 Q;  3G4S Q;  1KQS P;  3CXC P;  1K8A R;  1VQ7 Q;  1YJN Q;  1VQ6 Q;  3CCJ Q;  1VQ9 Q;  1YIT Q;  1NJI R;  1Q86 R;  3CC2 Q;  1VQL Q;  3CME Q;  3I55 Q;  3CCM Q;  1Q81 R;  3CCR Q;  1QVF P;  1S72 Q;  3CCQ Q;  1Q82 R;  1YHQ Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...