1Q86R

Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2003-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1q86R00
1VQLQ 1M1KR 1K8AR 1YHQQ 1VQ4Q 3CCEQ 1VQ9Q 1VQ7Q 3OW2P 3CMAQ 3I55Q 3CMEQ 1VQPQ 1YITQ 3CCUQ 2QA4Q 3CXCP 1W2BP 3CD6Q 1Q81R 3CCLQ 1VQ6Q 2OTJQ 3CCJQ 1YJWQ 1QVGP 3CCSQ 3CC7Q 3G4SQ 3CCRQ 1Q7YR 1QVFP 3CCVQ 1KQSP 1YI2Q 1N8RR 1VQ8Q 2OTLQ 1Q82R 3CC4Q 3G71Q 3I56Q 1VQMQ 1VQKQ 1YJNQ 3G6EQ 1M90R 1VQNQ 1YJ9Q 1YIJQ 3CCMQ 3CCQQ 2QEXQ 1KD1R 1VQOQ 1JJ2P 1KC8R 1S72Q 1NJIR 1Q86R 1K73R 1K9MR 3CC2Q 3CPWP 1VQ5Q
chains in the Genus database with same CATH superfamily
2LQNA 1B34B 1V29B 2WSCE 2CZ6B 1UTIA 1X2KA 1ZA1B 2KNBB 1VQPA 3CD6Q 2JTMA 1B07A 3OYKA 4KUIA 3INZA 4HVWA 3QJ6A 3HP9A 4ELZC 3P8HA 2K7AA 1QWFA 2F2VA 2XKOC 1WZOA 3DLMA 2KRNA 2YUQA 3V8KA 2I2LA 2AHJB 4KBMB 1JJ2A 5GANg 1XOVA 3OS5A 2O9VA 2LCCA 2KE9A 4OF1A 3FLGA 3LWIA 2D1XA 3UF4A 2KT8A 2O2OA 1AVZC 3CXCA 1M3AA 3ULRB 3CCVT 1VQOA 4XTXA 2DA9A 2DFUA 3A8HB 3L2WA 3PT9A 4HCKA 3AT1B 3CPFA 4B9XA 3M0RA 5KYUB 4XU1A 2QQ9A 1AOJA 1JQQA 1SSHA 3DLLA 4E7LA 3M54A 1NYGA 4C8QC 3EG1A 2W0ZA 4FT2A 3I56T 2JZ2A 1BKBA 2DXTA 5GAN3 4JUVA 4C8QB 1MUZA 1AWOA 1YP5A 1WLPB 2OAUA 4DBQA 3M57A 2QA4A 3CCLQ 1CKBA 2OAWA 1PKTA 4C8QE 1QVGP 1WYXA 3ASKA 3X25B 2D6FA 2IPOB 2R5MA 3EFRA 1H3HA 1RI9A 2P4TA 4JLGA 5GMKe 4LXCA 4AT1B 3CCJT 3CCMA 2KYBA 2FPFA 1B34A 3LW5E 2RK2A 2BZ8A 1N8RU 1M2OA 2PNIA 4M77D 2CZ0B 2YT6A 4C92F 4CI0C 2E3HA 3MP6A 4RTUA 4JJNK 3LWHA 3H41A 3QSUA 4R0KA 1AD5A 2L5QA 3VRZA 1T3LA 3PE0A 2KBTA 1U8RA 3RBBB 4KH0B 1K8AU 1NJIR 3MJXA 3OYAA 5J26A 1KK7A 5IAYA 2DL7A 1Y0MA 5IN1A 2NUTA 2BZYA 4RUGA 1VQPQ 3TREA 1N27A 4PJOG 3NGPA 3TVTA 1Q81C 2LQWA 2BE9B 1GCQA 8AT1B 5GAMh 3M4YA 2ZPIB 4MZTA 5EG2A 4ATOA 1BI1A 1R77A 1KQ2A 5HKCA 4ME7A 3SB2A 3VS1A 3OW2P 3H0IA 2RNAA 5KYUA 2VVKA 1YITA 1WQ7A 1ZBJA 1KJWA 1PC0A 3HPWA 5D7UA 1EX4A 2COYA 1ZX6A 4TVRA 1Q82C 1PCXA 1K73U 3X28B 1VQOQ 2CZ1B 2L8DA 4IIOA 4J6WA 1YI2T 2COWA 4C8QA 2CZ7B 4IUTA 2DL8A 1KG1A 1ZSZB 4RMOA 2YUNA 1LVKA 2LT4A 2OI3A 2RF0A 1OPLA 3C4SA 3DKMA 3MKDA 1NYFA 3DB3A 5CKBA 3PTAA 1D09B 1Z9QA 1BCMA 2LCSA 1IRXA 1PWTA 2JMAA 3E19A 5HK3A 1YIJQ 4M75F 1IGQA 3QDRB 5ECAA 5J39A 4ZTFA 3M4GA 3NPFA 3CQTA 1K0XA 2QK0A 2K3BA 1PNJA 2V8IA 2DXCA 2ZAEA 5LJ5g 2QA4Q 2F1LA 2RHZA 3OS1A 4JDSA 3I55T 3CCUT 2RB6A 1OX8A 2M0OA 4IIMA 2OTLA 1Q86U 2EYQA 2EVRA 3CCMQ 3META 1H8KA 4OMPA 5CO7A 2D0NA 2LJ0A 3F70A 1KQSA 1I5LA 4JZ4A 4EMKA 2CP2A 1M1GA 3SFMA 2F69A 2HBPA 3PVLA 3TEEA 1U1SA 1ZQ1A 1Y71A 2DXUA 4A53A 5I11A 2E10A 5CKDA 1N6AA 1MGQA 1FMKA 3OYYA 3L2ZA 1E6GA 3QPHA 1IGUA 2Z0WA 8ATCB 2VXEA 1LCKA 1MV3A 1VQKT 3RKWA 4CC3A 1SRLA 5LJ3g 2KXDA 2J6KA 4E7KA 3L2RA 3JB9D 2HQEA 3OB9A 3QJYA 3M56A 3JCMX 1ACMB 1NBEB 2CDTA 2QASA 2J7IA 4D8KA 2OTJT 1VQNA 1QCNA 3I35A 1U06A 4JRPA 2HQHA 3EG0A 2L2PA 2XDPA 1IHWA 2LVMA 3HTRA 1G2BA 1GBRA 5GMKl 3H6ZA 3X26B 1YITQ 4QQDA 4AG2C 1OPKA 2G6FX 1HD3A 5FLXE 2V8KA 1UHCA 2H3EB 6AT1B 1QVFS 2A3LA 4DEXA 2HBWA 1U5SA 2VXFA 3CC7T 4JLIA 2QDLA 3OYMA 4XTWA 3H8ZA 1UGPB 2CGHA 2AKLA 3ZL7C 3EHQA 4QQ6A 3CXCP 3C95A 1UGRB 3FRNA 2MIOA 1YJWA 4DBHA 5CK9A 4M78C 4PJOB 5GMKm 4MMLA 2Y4XA 2YRVA 2F2XA 3M0PA 3G6ET 4PJOE 3LH0A 1R8OB 4J9EA 5FWBA 1M4ZA 2RA2A 3OYHA 1QQJA 3VYGA 1XQHA 4FU6A 2HMAA 4EMHA 3JCMh 1PRMC 2OTLQ 2E70A 2RPNA 4C0DC 4OB2B 3QUIA 3O5ZA 1M90C 2QEXA 1M9SA 1AHJB 2D8HA 4C0DB 1P92A 2O31A 4C5HA 1T3SA 5LJ3j 2DEQA 3FJPA 5GAOm 1YBYA 2XIDA 2HKNA 3OYCA 3G4SA 4J83A 5GAMf 3J80E 2DPPB 2ZCFB 3SD4A 1LOJA 2FYKA 3TSWA 3E9FA 2CP5A 3MEUA 2DZ9A 1X2QA 1D1BA 2CUBA 1WJQA 3G71T 1YJ9T 2C0IA 3PMIA 1K9MC 1I0CA 2E41A 3E9GA 1VQLA 2WSEE 3OBYA 1Q7YU 1VQ7A 2CT3A 1ZSGA 3SWNB 1VQ5T 2HNIA 4PFOA 3BFMA 3CCET 4DOWA 2GQIA 1VQ4T 3CMET 3UA7A 1SHGA 1VQNQ 2A37A 9ATCB 1U3OA 2DE0X 2ATCB 3M0SA 1AWWA 2KROA 1X43A 3Q1JA 3RDVA 5DLQE 2XK0A 4C0ZA 3CBMA 2J05A 1QKWA 2MWPA 4M7DD 2AT1B 1QKXA 2EKHA 3EFOA 2EQMA 4JJDA 2F5TX 4C5EA 3GOXA 2MMPA 1AZEA 4J8OA 3RMSA 3JB9J 4KGZB 1VQMA 3CCRT 4M78A 4C8QG 4BI4A 1RLPC 4OGCA 3VU3C 1IB8A 1UJYA 2ZZDA 3EG9B 1S72T 2ZPGB 4A4GA 2VB6A 1ZHIA 1XJWB 3VS2A 4RTWA 2ZPBB 1YJWQ 4FYVB 1N9RA 3CCSA 3JCMe 1RUWA 5IXBA 4LD9K 3CBPA 3GIBA 4C92C 2K5FA 5DLOA 2R5AA 4C92B 1M3CA 3VJPA 3A8OB 4HKEA 4X1VA 4XTUA 2K57A 2VGMA 1Q81R 4C92E 1W2BS 4ANJA 4J9HA 4PKCC 2RQRA 2VWFA 4OMOA 3H0FA 3VUBA 3EGXA 2FZGB 3LGLA 2DTIA 2QEXQ 2HQXA 1NZ9A 1W4SA 1PM3A 4P5NA 2YUOA 4FCYA 1GL5A 1MV0B 4C0FA 5GANh 3JB9F 1JBMA 2L0AA 2HEQA 1QLYA 2YLBA 2ZPHB 5A0LA 1RL2A 4CC7A 3OYGA 2DETA 1WDXA 3A5ZB 3G4SQ 3CCLA 5GAOq 2XG8D 2DVEA 1BIBA 1KQ1A 3OSSC 4X9DA 2MCNA 1UECA 2KQWA 4OMNA 1Q82R 2RN8A 1FMVA 2XI9A 2VKNA 4J7IA 4DBRA 4O6JA 1VQLQ 4MZMA 1HK9A 2MWOA 5KYNA 1VQ7Q 4AFSC 2MK5A 4M78F 3JCMJ 1QP3A 3EH1A 2CT4A 3JCMV 3L42A 1OOTA 1Y57A 2FL7A 1JXOA 1UFFA 4BDZA 1MNDA 5GMKh 3GPLA 2X4YA 2CYZB 1NM7A 3EG9A 4M75C 2PUOB 1K8AC 1BCOA 1TXQA 3DB4A 4F7UE 3UATA 4M75B 4J9FA 4JS4A 2EJ9A 2HL5C 1VQMQ 2V1RA 4M75E 1YCSB 2GFAA 4CRIA 2RI2A 2W10A 3MHXA 4C92A 3CC4T 4CC2A 4GLMA 1YHQA 2PZ1A 1UGQB 2KRMA 2NUTB 3BW1A 1GCQC 2DM1A 2CSIA 3CCSQ 3CD6T 2CREA 4RCBA 5L23A 4XTZA 2O4XB 1NEBA 2M1HA 1BI3A 1PKSA 2HSEB 4IUPA 1GRIA 2IIMA 3CC2A 1K73C 3OYEA 4KT0E 5GANe 2KK4A 4KUDK 3M9QA 1BB9A 4LN2A 4XU2A 1UEBA 2QG9B 2EKOA 2JT4A 4C8QD 4B9WA 3ME9A 2DIGA 4X9CA 3IQLA 4LDWA 5KE2A 3OYLA 1YIJA 4ESRA 2A36A 1WHLA 2NLUA 1OZ3A 3OY9A 1D1AA 2XD0A 3S6WA 1M2VB 1MMDA 1QCOA 1M1KC 3NFCA 4OP0A 2JVVA 2L89A 1CSKA 1I8FA 1PSFA 3CCJQ 2DK3A 1EZZB 3GBQA 1I5OB 2CH4W 2L3PA 4BE2A 2EBPA 3L2QA 2LNVA 4F7UA 3JCMW 5J3BA 4Z8AA 3WVDB 1Q86C 2DJZA 4FIBA 3URGA 3BY7A 3H0HA 1VQ9A 2XU8A 1UB4A 2E64A 4M75A 3EGDB 4PFZA 1A0NB 1H641 1Y7XA 3NHNA 2KVQG 5GAOp 4RTTA 2PTKA 1SPKA 3FIFA 2FZCB 4M7AD 1AZGB 4V2SA 1M1FA 1HSQA 4EMKC 1QVFA 2E65A 3P8BB 2EYWA 2YWWA 4XU0A 1FWZA 2HAXA 4IUVA 5LJ5h 4EMKB 2KY9A 4JRIA 2FZKB 1WXUA 2RD1A 2EJGA 2V26A 4OGEA 1LPLA 1W1FA 3TQ7P 4M78G 1M90R 2YUPA 1UGSB 2O4XA 1EIFA 2LT1A 4E7IA 1G3TA 4BI3A 3TCJA 1YHQQ 1M3BA 3OYIA 1H3ZA 2HD0A 3RKXA 4PNOA 1VQPT 2KI7A 2LJ3A 5C0MA 2KDSA 1WJSA 1YI2Q 4EIKA 2OJ2A 2ABLA 3QZ5B 4F04B 1N9SA 3CCQA 2RJCA 1RABB 1BBZA 4L59A 3VS7A 2ENMA 1M2VA 3M0TA 1TH7A 2HSPA 5LJ3h 4ZTJA 1K9MR 3CC2Q 4RTVA 3OYJA 2AK5A 5GANf 1AT1B 3L2VA 3PVQA 5GJWB 3HHTB 1OU8A 1TOVA 4F7UF 3RNJA 1OU9A 2PVGB 5GAOr 3I5SA 2HDAA 1M1KU 2A0FB 2DYIA 2QQBA 2SRCA 2JM8A 1VQOT 1PHTA 4BB7A 3PIOA 2DTHA 1BU1A 3I55Q 3RERA 3EGDA 4DBFA 2K3XA 4K11A 1YWPA 2E4HA 4XTYA 3QWYA 1YJNA 3I5RA 1UUEA 4N0AC 2RJEA 3M0QA 5FROA 4II1A 1XNIA 1PD1A 1GXIE 2EFIA 4FSXA 1VQ9Q 5D6WA 2CP6A 1UDLA 5DY9A 5LJ5e 1YNZA 3A8LB 2G3RA 4ZGJB 1VQ6A 2VASA 2DF6A 1QWEA 4XU3A 3HKSA 4KGVB 4HT8A 2KSSA 4A54A 4HCCA 5KH6A 2LP5A 1AWXA 2XICA 3A1PA 3CCMT 4HCZA 1QW1A 5CAIA 3KBGA 4PJLA 2Y4YA 3HFOA 2GGRA 1PRLC 1WGSA 4BE0A 2RQVA 1M8VA 4OMMA 1Q7YC 2QGGA 1AEYA 5FWCA 2MPXC 3QHSA 2O88A 2V8JA 4VUBA 4C92G 5KYWB 3MP1A 3QDFA 5LJ3e 2Y90A 4E7ZA 1N5ZA 4PK4A 3VS4A 1WJRA 3VUZA 3SEMA 2A08A 1KIKA 2FVUA 2DL4A 3VYHB 1G3YA 4ORZA 3M53A 3CCQQ 1W2BA 4J9DA 3OS2A 1JJ2P 1KD1C 5A0DA 2O01E 2DMOA 2K79A 1VA7A 3BDLA 2LC4A 5HY6A 4PJOD 2KXCA 4N4HA 3GNGA 4LDXA 3EFOB 5GAN7 2YXYA 2FHDA 3HSBA 1YITT 1N8RR 2EQJA 3VS6A 3MCAB 3NTKA 4PJJA 4BE1A 2EYXA 2K9GA 3T9NA 1M8MA 2GF7A 5C6SA 3M58A 1VYTA 2WACA 4M78B 2P0KA 3EAEA 4N0AA 4E6RA 2M9UA 1K8AR 1V76A 5D6XA 2SEMA 1BI2A 4M77F 2K5LA 2DNUA 4M78E 2RJDA 3OYNA 2COZA 1Q95G 2ZGWA 3OBWA 4ZN1A 4CC4B 2M0YA 4M7AF 5GAMj 1YJNQ 4F7UG 5A2QE 5FU7C 4FSSA 2JTFA 2E5KA 3LYIA 4Y28E 3FC3A 2DRMA 4J9CA 2RMOA 2QGFB 5FU7B 1ZUUA 4NS5A 3PIPA 4M75G 3SDZA 3P8DA 2PU9B 1VQ6Q 1XTDA 2DXBA 3MPUB 2JXBA 1HJDA 4MZPA 1VQ8A 2BZXA 4EMGA 3VS5A 4QQGA 4E2FB 5KYWA 3EGXB 2OTLT 1G3WA 2C0TA 1K73R 2JW4A 2PUKB 1VQ5Q 3S3MA 3QIIA 3JAME 1PD0A 1QMCA 2CUDA 2MI6A 1VQ4Q 5GAN8 2FO0A 3R6OA 1QVPA 2WSFE 1QVFP 1O75A 3CMAT 2C06A 4FYYB 2X3WD 3ZEHA 2HCKA 3EGUA 1DJ7B 4HVUA 1M1KR 4N4IA 3CPWS 1M5Q1 2CKKA 2EJFA 3MEAA 1OI1A 4E7SA 2KAFA 1RACB 2RHUA 2QTVA 4JJBA 2LQ8A 1G8XA 4XQ3A 4LNPA 1ABQA 1FX7A 1KD1U 4Z02A 1NLOC 3OSVA 2V1QA 1OZ2A 4E7HA 3VRYA 2RQTA 5M9OA 4UC4A 1WHGA 1VQNT 1Q86R 4GLKA 5IXFA 1D0YA 2YHTA 4FT4A 2RI5A 5CIUA 5EC7A 5KCOA 2AZSA 3EFSA 4J7FA 4M7DC 3V8JA 3EHRA 1SSFA 3HFNA 3THKA 4LE9A 2VGNA 2L3RA 4KRTA 3CCVA 1RAGB 3EG3A 4C5GA 4DOVA 4LUEA 1X75C 2KT1A 1I07A 2ESWA 3OYFA 3I9QA 2QQRA 1VYVA 4A63B 2QQSA 3QG1A 1JU5C 1FXXA 4FL6A 2GTJA 3O8VA 2YRCA 4JJCA 1NJIU 2LX9A 1YJWT 3I56A 4RTZA 4ELYC 4ZN3A 3JCMc 1IREB 2HL3A 5GAMd 2M16A 2CH4A 4OMLA 2VYTA 1NPRA 5CQYA 3OQ5A 3G1JA 4PFPA 3C12A 2DYBA 2RQWA 1WXBA 4L5GA 3CCJA 1KQSP 1G83A 1NE8A 1VQ8Q 2BKDN 4J6XA 1K76A 2F2WA 3LGFA 1RADB 2QEXT 1M27C 4NL3A 3FEOA 2M51A 1J3TA 2GNCA 1ZUKA 4WF2A 1K4US 2NWMA 5KYYB 4IURA 1D3BA 4AG1C 4OVAA 4PL6A 2DERA 3G4ST 2MAMA 3NTIA 2EGCA 1K0SA 2EPDA 1KC8C 3UT1A 4F7UB 4J9IA 2DRKA 3JB9I 2YDLA 5L8RE 5GAN4 2FPDA 4LD6A 3MO8A 1VQLT 1IZ6A 5CCAA 1VQ7T 1NEGA 2LTOA 1QVGS 5CKHA 4M7DA 3N5BB 1G3SA 5FU6C 3J81E 4KULA 2X4XA 5FU6B 1B7TA 2AZVA 3HL8A 5IHNA 2B8AA 2I0NA 2DIQA 2VUBA 1W2BP 2IVWA 1VUBA 1OEBA 1TUCA 1OULA 2RM4A 3UDCA 2JJ9A 3QWXX 3CCVQ 2DVJA 4ZGDB 3JCMf 1H92A 1VIEA 4HCBA 1YI2A 4JZ3A 1D1CA 1GFCA 4A4EA 2LJ1A 1VQMT 1WQWA 3H9NA 4IKFA 3E2UA 3RKYA 5DM7R 2R57A 1I1JA 1TWBA 1PSEA 4R55A 1RLQC 3M0UA 2KEAA 1K1ZA 2DILA 2LMJA 4QVZA 2BE7D 1Q7YR 3I56Q 4FYXB 3CCST 1W6XA 3S3NA 3MEVA 5CQXA 4AFZC 3G7ZA 2RJFA 3NTHA 3QYGB 1SKUB 4JRQA 2B86A 2CP3A 3JCMQ 3OW2S 4Z89A 4QVCA 3OA6A 3I55A 3CCUA 1MNEA 1E6HA 3RR6A 5KYYA 1WNLA 2D9TA 1TS9A 2C0OA 2X4WA 2JS2A 4D8DA 4RCCA 2LCLA 4FYWB 4WTOB 1KD1R 1SHFA 3JV3A 2PVDB 3HRSA 5AT1B 1S1NA 5HK0A 3KXTA 4M7DF 3C94A 1B3QA 2FEIA 4WCIA 4XTVA 3V7SA 4RTXA 2QAZA 3QO3A 1V1CA 1LJOA 2CP7A 2DKGA 3ER0A 1T0HA 5AYFA 3JB9G 1KC8U 2ED0A 1JB0E 1VQKA 3CCLT 4KGXB 2DAQA 4HA8A 3WXMB 3PGGA 2K4YA 2KGTA 5I2MA 3JSCA 2NUPB 2PQWA 4BY6C 1ZBXA 2XDDA 3ZBDA 5IHKA 4J5YA 3FDRA 3UPUA 2OTJA 2KYMA 2E1HA 4BY6B 3QBYA 3LH5A 2ZPEB 4M77C 2EQIA 1KHCA 2ECZA 5GAN2 4M77B 4M7AC 2RO0A 5CKFA 4PLLA 3TSZA 3JCMd 2AKKA 1FMWA 2XMFA 1HYOA 4M77E 4M7AB 5GANj 3TU4K 1ABOA 4EPCA 2DBMA 2FG0A 4LUDA 1NG2A 1C6VX 2A28A 3CC7A 4R56A 1MMAA 4M7AE 4Y91A 4LDVA 2E6NA 2EQUA 2JOYA 1FYNA 4M4ZA 4AFUC 1UHFA 2EGEA 1JEGA 2DL5A 2DTOA 4NOYA 2E6ZA 4RG2A 2GQVA 2RI3A 4KH1B 3KUFA 4YTLA 5IHIA 4DA4A 2L3SA 2LNHB 2CS7A 3GNFB 1VIFA 4LDUA 4ZNXA 1YHQT 4QT7A 2PVOB 7AT1B 3ZFJA 3RMQA 1WX6A 2QTXA 2X3XD 1ZSZC 3G6EA 2GFUA 2E12A 5GMKi 4QW2A 1BYMA 4OB3B 5I21A 5GMKj 2R58A 2RK1A 2DJQA 3JRZA 1SF9A 1QCFA 2CSQA 3CCUQ 2P0QA 3CC2T 1TUDA 4O5VA 2JTEA 1LNXA 1QP2A 1R0CB 1M30A 3X24B 3VS3A 3CBOA 1IXDA 3M59A 2JM9A 1JJ2S 1WA7A 2J6FA 3JCMP 2JNGA 1C0MA 1BI0A 2NUPA 2DLPA 2DO3A 2AIRB 3UA6A 4MMKA 1YIJT 1U1TA 1X6BA 3PNWC 2ROLA 5GAN5 2DD5A 3CXCS 2QQAA 3CPWA 5GAMg 1MHNA 1ZA2B 2QA4T 1VQKQ 1X27A 3G71A 4FW1A 4M77A 1YJ9A 1RAAB 4NL2A 3CEYA 5I22A 4A4KA 4OB1B 1IO6A 4PLIA 1OQKA 1EFNA 2MOXA 1VQ5A 4M7AA 3CCEA 4AFQC 4E47A 1VQ4A 1F1BB 2FPEA 3CMAA 4N4GA 3CMEA 2EQKA 4XK8E 2OTJQ 5GAMe 4M7DG 4A4FA 1VQ9T 5FW9A 2VC8A 4PJMA 1PG5B 1Z9ZA 3RIRA 2RQUA 1UGVA 2JS0A 1JRIA 2KRSA 3HRUA 3VV0A 1Q81U 1WHMA 4XAXB 3GP8A 1WPYA 2FB7A 1YCYA 2ROTA 2IG0A 1YFNA 2NUZA 4BD3A 5FRMA 4HXJA 2X35A 1D0XA 4C8QF 3CC7Q 4F16A 2DX1A 3CCRA 4LDYA 5GAN6 4JRKA 1D0ZA 3QXEB 3WVEB 5GANd 1TU0B 1IHVA 1S72A 1ZSZA 1WI7A 5I2SA 4F14A 2FRYA 3U23A 1G5VA 2DEUA 3MP8A 1Q82U 2EIFA 4M78D 1RAHB 3G6EQ 2P4RA 1KC8R 2EGAA 1MMGA 3VS0A 1OYXA 3QYHB 1O9SA 3EG2A 3LX7A 1UG1A 4F17A 3CCQT 4RTYA 1ZUYA 4PJOC 3FB9A 5LJ5j 3OMGA 2QDYB 4C0GA 3L1AA 1CKAA 2P0PA 3C0CA 4OMFB 5GAOl 5IH2A 1YN8A 1NJIC 2GTOA 1TSFA 4QKUA 1SRMA 5KYXB 1VOMA 3RESA 2X4JA 5LJ5f 4ZGEB 2DL3A 3PFSA 4GY5A 4Z88A 2YSQA 4MDXA 2H3JA 4IUUA 1Y96B 2K5IA 4A4HA 1TG0A 3G71Q 1YJ9Q 1QVGA 1YJNT 4BDYA 3VKIA 3HRTA 4PJNA 3CCEQ 3V7CA 2FRWA 1K9AA 3CMAQ 2OX7A 3CMEQ 4J9GA 1ARKA 2LZ6B 4C5IA 2EYYA 2H8HA 4IUQA 2KR3A 4BI8B 3AHUA 1WHJA 1VQ6T 3QKJA 1W70A 3R6NA 4MDWA 2RHYA 2XDBA 4FM4B 3SHWA 1NLPC 4J9BA 4X34A 3SWNC 1KSWA 2CP0A 3BE3A 1X69A 5LJ3f 2JUFA 2BIVA 3JCMb 3RUXA 3EH2A 4JPBW 2J6OA 4RKUE 1WHKA 1HXDA 2D0QB 4J6YA 2O9SA 1RAEB 4D6WA 3CCRQ 2F5KA 2X51A 1I81A 1KQSS 3D7SB 1SG5A 3CC4A 2JN0A 2RHIA 1D3BB 2ZPFB 3M5AA 1T0JA 1S72Q 3REBB 2J06A 4QVDA 1KHIA 4HVVA 1UE9A 1BIAA 4B6MA 1JXMA 1VYUA 1X6GA 2QYZA 2E3IA 2K6DA 3OMCA 2EYZA 3PMTA 1YWOA 1BK2A 3CD6A 1RAIB 4OMQA 2E5QA 4PJOA 2MF2A 4C92D 3JCMg 2EAYA 3OW2A 4M7DB 5KE3A 2QXFA 1GCPA 2K2MA 1Y07A 3BDUA 2M02A 3QZ9B 1OX9A 5KYXA 2QI2A 4M7DE 2EWNA 4GBQA 4DQ2A 1TTHB 1TUGB 3REAB 2LQKA 5FRNA 2LX7A 1I4K1 1WHHA 1Y96A 4Q5WA 3NMZC 3JB9H 1GFDA 2DZCA 2BTTA 5LL6S 5LJ5d 1C1AA 4BUGA 5CVIA 3M55A 1RI0A 1SEMA 1OV3A 5D6YA 5CKEA 1WXTA 5GAOn 2MYSA 4E7JA 2HZYA 3L2UA 1E7OA 2D8JA 2A7YA 1M90U 2DD4A 4HT9A 2HKQB 5HCKA 2JMCA 2K2VA 3MEWA 4M77G 1JO8A 1KFZA 4FW2A 4JS5A 1WFWA 3UWNA 2ED1A 3OYBA 1R0BG 2LDMA 2YLCA 1ZLMA 1X01A 4OB0B 2P84A 3CPWP 1WIEA 4EDUA 4M7AG 2YRDA 3SWNA 3GLXA 2X9HA 2LRQA 2RH2A 4AMCA 3A8GB 1RAFB 1AWJA 3OS0A 5LJ3d 2EW3A 3A8MB 1NPPA 1K9MU 3OYDA 2DBKA 3KFVA 1MMNA 1VQ8T 2KMTA 1GBQA 5CR2A 4PJOF 1X6OA 4M75D 2L3QA 3J7AF 5KCHA 5GJVB 4RG8A 2BUDA 2XHCA 1UJ0A 3LLRA 3S3OA 3V8LA 2GCXA 3GF5A 2GBQA 4BACA 4DEYA 2K3YA 2RHXA 3X20B 1N8RC 3CC4Q 2NYSA 2VV5A 5A0GA 3E1SA 3FJ5A 5IT9E 3V7RA 4Y92A 4L6V5 3A98A
chains in the Genus database with same CATH topology
1VQLQ 1M1KR 1K8AR 1YHQQ 1VQ4Q 3CCEQ 1VQ9Q 1VQ7Q 3OW2P 3CMAQ 3I55Q 3CMEQ 1VQPQ 1YITQ 3CCUQ 2QA4Q 3CXCP 1W2BP 3CD6Q 1Q81R 3CCLQ 1VQ6Q 2OTJQ 3CCJQ 1YJWQ 1QVGP 3CCSQ 3CC7Q 3G4SQ 3CCRQ 1Q7YR 1QVFP 3CCVQ 1KQSP 1YI2Q 1N8RR 1VQ8Q 2OTLQ 1Q82R 3CC4Q 3G71Q 3I56Q 1VQMQ 1VQKQ 1YJNQ 3G6EQ 1M90R 1VQNQ 1YJ9Q 1YIJQ 3CCMQ 3CCQQ 2QEXQ 1KD1R 1VQOQ 1JJ2P 1KC8R 1S72Q 1NJIR 1Q86R 1K73R 1K9MR 3CC2Q 3CPWP 1VQ5Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQL Q;  1M1K R;  1K8A R;  1YHQ Q;  1VQ4 Q;  3CCE Q;  1VQ9 Q;  1VQ7 Q;  3OW2 P;  3CMA Q;  3I55 Q;  3CME Q;  1VQP Q;  1YIT Q;  3CCU Q;  2QA4 Q;  3CXC P;  1W2B P;  3CD6 Q;  1Q81 R;  3CCL Q;  1VQ6 Q;  2OTJ Q;  3CCJ Q;  1YJW Q;  1QVG P;  3CCS Q;  3CC7 Q;  3G4S Q;  3CCR Q;  1Q7Y R;  1QVF P;  3CCV Q;  1KQS P;  1YI2 Q;  1N8R R;  1VQ8 Q;  2OTL Q;  1Q82 R;  3CC4 Q;  3G71 Q;  3I56 Q;  1VQM Q;  1VQK Q;  1YJN Q;  3G6E Q;  1M90 R;  1VQN Q;  1YJ9 Q;  1YIJ Q;  3CCM Q;  3CCQ Q;  2QEX Q;  1KD1 R;  1VQO Q;  1JJ2 P;  1KC8 R;  1S72 Q;  1NJI R;  1Q86 R;  1K73 R;  1K9M R;  3CC2 Q;  3CPW P;  1VQ5 Q; 
#chains in the Genus database with same CATH topology
 2LQN A;  1B34 B;  1V29 B;  2WSC E;  2CZ6 B;  1UTI A;  1X2K A;  1ZA1 B;  2KNB B;  1VQP A;  3CD6 Q;  2JTM A;  1B07 A;  3OYK A;  4KUI A;  3INZ A;  4HVW A;  3QJ6 A;  3HP9 A;  4ELZ C;  3P8H A;  2K7A A;  1QWF A;  2F2V A;  2XKO C;  1WZO A;  3DLM A;  2KRN A;  2YUQ A;  3V8K A;  2I2L A;  2AHJ B;  4KBM B;  1JJ2 A;  5GAN g;  1XOV A;  3OS5 A;  2O9V A;  2LCC A;  2KE9 A;  4OF1 A;  3FLG A;  3LWI A;  2D1X A;  3UF4 A;  2KT8 A;  2O2O A;  1AVZ C;  3CXC A;  1M3A A;  3ULR B;  3CCV T;  1VQO A;  4XTX A;  2DA9 A;  2DFU A;  3A8H B;  3L2W A;  3PT9 A;  4HCK A;  3AT1 B;  3CPF A;  4B9X A;  3M0R A;  5KYU B;  4XU1 A;  2QQ9 A;  1AOJ A;  1JQQ A;  1SSH A;  3DLL A;  4E7L A;  3M54 A;  1NYG A;  4C8Q C;  3EG1 A;  2W0Z A;  4FT2 A;  3I56 T;  2JZ2 A;  1BKB A;  2DXT A;  5GAN 3;  4JUV A;  4C8Q B;  1MUZ A;  1AWO A;  1YP5 A;  1WLP B;  2OAU A;  4DBQ A;  3M57 A;  2QA4 A;  3CCL Q;  1CKB A;  2OAW A;  1PKT A;  4C8Q E;  1QVG P;  1WYX A;  3ASK A;  3X25 B;  2D6F A;  2IPO B;  2R5M A;  3EFR A;  1H3H A;  1RI9 A;  2P4T A;  4JLG A;  5GMK e;  4LXC A;  4AT1 B;  3CCJ T;  3CCM A;  2KYB A;  2FPF A;  1B34 A;  3LW5 E;  2RK2 A;  2BZ8 A;  1N8R U;  1M2O A;  2PNI A;  4M77 D;  2CZ0 B;  2YT6 A;  4C92 F;  4CI0 C;  2E3H A;  3MP6 A;  4RTU A;  4JJN K;  3LWH A;  3H41 A;  3QSU A;  4R0K A;  1AD5 A;  2L5Q A;  3VRZ A;  1T3L A;  3PE0 A;  2KBT A;  1U8R A;  3RBB B;  4KH0 B;  1K8A U;  1NJI R;  3MJX A;  3OYA A;  5J26 A;  1KK7 A;  5IAY A;  2DL7 A;  1Y0M A;  5IN1 A;  2NUT A;  2BZY A;  4RUG A;  1VQP Q;  3TRE A;  1N27 A;  4PJO G;  3NGP A;  3TVT A;  1Q81 C;  2LQW A;  2BE9 B;  1GCQ A;  8AT1 B;  5GAM h;  3M4Y A;  2ZPI B;  4MZT A;  5EG2 A;  4ATO A;  1BI1 A;  1R77 A;  1KQ2 A;  5HKC A;  4ME7 A;  3SB2 A;  3VS1 A;  3OW2 P;  3H0I A;  2RNA A;  5KYU A;  2VVK A;  1YIT A;  1WQ7 A;  1ZBJ A;  1KJW A;  1PC0 A;  3HPW A;  5D7U A;  1EX4 A;  2COY A;  1ZX6 A;  4TVR A;  1Q82 C;  1PCX A;  1K73 U;  3X28 B;  1VQO Q;  2CZ1 B;  2L8D A;  4IIO A;  4J6W A;  1YI2 T;  2COW A;  4C8Q A;  2CZ7 B;  4IUT A;  2DL8 A;  1KG1 A;  1ZSZ B;  4RMO A;  2YUN A;  1LVK A;  2LT4 A;  2OI3 A;  2RF0 A;  1OPL A;  3C4S A;  3DKM A;  3MKD A;  1NYF A;  3DB3 A;  5CKB A;  3PTA A;  1D09 B;  1Z9Q A;  1BCM A;  2LCS A;  1IRX A;  1PWT A;  2JMA A;  3E19 A;  5HK3 A;  1YIJ Q;  4M75 F;  1IGQ A;  3QDR B;  5ECA A;  5J39 A;  4ZTF A;  3M4G A;  3NPF A;  3CQT A;  1K0X A;  2QK0 A;  2K3B A;  1PNJ A;  2V8I A;  2DXC A;  2ZAE A;  5LJ5 g;  2QA4 Q;  2F1L A;  2RHZ A;  3OS1 A;  4JDS A;  3I55 T;  3CCU T;  2RB6 A;  1OX8 A;  2M0O A;  4IIM A;  2OTL A;  1Q86 U;  2EYQ A;  2EVR A;  3CCM Q;  3MET A;  1H8K A;  4OMP A;  5CO7 A;  2D0N A;  2LJ0 A;  3F70 A;  1KQS A;  1I5L A;  4JZ4 A;  4EMK A;  2CP2 A;  1M1G A;  3SFM A;  2F69 A;  2HBP A;  3PVL A;  3TEE A;  1U1S A;  1ZQ1 A;  1Y71 A;  2DXU A;  4A53 A;  5I11 A;  2E10 A;  5CKD A;  1N6A A;  1MGQ A;  1FMK A;  3OYY A;  3L2Z A;  1E6G A;  3QPH A;  1IGU A;  2Z0W A;  8ATC B;  2VXE A;  1LCK A;  1MV3 A;  1VQK T;  3RKW A;  4CC3 A;  1SRL A;  5LJ3 g;  2KXD A;  2J6K A;  4E7K A;  3L2R A;  3JB9 D;  2HQE A;  3OB9 A;  3QJY A;  3M56 A;  3JCM X;  1ACM B;  1NBE B;  2CDT A;  2QAS A;  2J7I A;  4D8K A;  2OTJ T;  1VQN A;  1QCN A;  3I35 A;  1U06 A;  4JRP A;  2HQH A;  3EG0 A;  2L2P A;  2XDP A;  1IHW A;  2LVM A;  3HTR A;  1G2B A;  1GBR A;  5GMK l;  3H6Z A;  3X26 B;  1YIT Q;  4QQD A;  4AG2 C;  1OPK A;  2G6F X;  1HD3 A;  5FLX E;  2V8K A;  1UHC A;  2H3E B;  6AT1 B;  1QVF S;  2A3L A;  4DEX A;  2HBW A;  1U5S A;  2VXF A;  3CC7 T;  4JLI A;  2QDL A;  3OYM A;  4XTW A;  3H8Z A;  1UGP B;  2CGH A;  2AKL A;  3ZL7 C;  3EHQ A;  4QQ6 A;  3CXC P;  3C95 A;  1UGR B;  3FRN A;  2MIO A;  1YJW A;  4DBH A;  5CK9 A;  4M78 C;  4PJO B;  5GMK m;  4MML A;  2Y4X A;  2YRV A;  2F2X A;  3M0P A;  3G6E T;  4PJO E;  3LH0 A;  1R8O B;  4J9E A;  5FWB A;  1M4Z A;  2RA2 A;  3OYH A;  1QQJ A;  3VYG A;  1XQH A;  4FU6 A;  2HMA A;  4EMH A;  3JCM h;  1PRM C;  2OTL Q;  2E70 A;  2RPN A;  4C0D C;  4OB2 B;  3QUI A;  3O5Z A;  1M90 C;  2QEX A;  1M9S A;  1AHJ B;  2D8H A;  4C0D B;  1P92 A;  2O31 A;  4C5H A;  1T3S A;  5LJ3 j;  2DEQ A;  3FJP A;  5GAO m;  1YBY A;  2XID A;  2HKN A;  3OYC A;  3G4S A;  4J83 A;  5GAM f;  3J80 E;  2DPP B;  2ZCF B;  3SD4 A;  1LOJ A;  2FYK A;  3TSW A;  3E9F A;  2CP5 A;  3MEU A;  2DZ9 A;  1X2Q A;  1D1B A;  2CUB A;  1WJQ A;  3G71 T;  1YJ9 T;  2C0I A;  3PMI A;  1K9M C;  1I0C A;  2E41 A;  3E9G A;  1VQL A;  2WSE E;  3OBY A;  1Q7Y U;  1VQ7 A;  2CT3 A;  1ZSG A;  3SWN B;  1VQ5 T;  2HNI A;  4PFO A;  3BFM A;  3CCE T;  4DOW A;  2GQI A;  1VQ4 T;  3CME T;  3UA7 A;  1SHG A;  1VQN Q;  2A37 A;  9ATC B;  1U3O A;  2DE0 X;  2ATC B;  3M0S A;  1AWW A;  2KRO A;  1X43 A;  3Q1J A;  3RDV A;  5DLQ E;  2XK0 A;  4C0Z A;  3CBM A;  2J05 A;  1QKW A;  2MWP A;  4M7D D;  2AT1 B;  1QKX A;  2EKH A;  3EFO A;  2EQM A;  4JJD A;  2F5T X;  4C5E A;  3GOX A;  2MMP A;  1AZE A;  4J8O A;  3RMS A;  3JB9 J;  4KGZ B;  1VQM A;  3CCR T;  4M78 A;  4C8Q G;  4BI4 A;  1RLP C;  4OGC A;  3VU3 C;  1IB8 A;  1UJY A;  2ZZD A;  3EG9 B;  1S72 T;  2ZPG B;  4A4G A;  2VB6 A;  1ZHI A;  1XJW B;  3VS2 A;  4RTW A;  2ZPB B;  1YJW Q;  4FYV B;  1N9R A;  3CCS A;  3JCM e;  1RUW A;  5IXB A;  4LD9 K;  3CBP A;  3GIB A;  4C92 C;  2K5F A;  5DLO A;  2R5A A;  4C92 B;  1M3C A;  3VJP A;  3A8O B;  4HKE A;  4X1V A;  4XTU A;  2K57 A;  2VGM A;  1Q81 R;  4C92 E;  1W2B S;  4ANJ A;  4J9H A;  4PKC C;  2RQR A;  2VWF A;  4OMO A;  3H0F A;  3VUB A;  3EGX A;  2FZG B;  3LGL A;  2DTI A;  2QEX Q;  2HQX A;  1NZ9 A;  1W4S A;  1PM3 A;  4P5N A;  2YUO A;  4FCY A;  1GL5 A;  1MV0 B;  4C0F A;  5GAN h;  3JB9 F;  1JBM A;  2L0A A;  2HEQ A;  1QLY A;  2YLB A;  2ZPH B;  5A0L A;  1RL2 A;  4CC7 A;  3OYG A;  2DET A;  1WDX A;  3A5Z B;  3G4S Q;  3CCL A;  5GAO q;  2XG8 D;  2DVE A;  1BIB A;  1KQ1 A;  3OSS C;  4X9D A;  2MCN A;  1UEC A;  2KQW A;  4OMN A;  1Q82 R;  2RN8 A;  1FMV A;  2XI9 A;  2VKN A;  4J7I A;  4DBR A;  4O6J A;  1VQL Q;  4MZM A;  1HK9 A;  2MWO A;  5KYN A;  1VQ7 Q;  4AFS C;  2MK5 A;  4M78 F;  3JCM J;  1QP3 A;  3EH1 A;  2CT4 A;  3JCM V;  3L42 A;  1OOT A;  1Y57 A;  2FL7 A;  1JXO A;  1UFF A;  4BDZ A;  1MND A;  5GMK h;  3GPL A;  2X4Y A;  2CYZ B;  1NM7 A;  3EG9 A;  4M75 C;  2PUO B;  1K8A C;  1BCO A;  1TXQ A;  3DB4 A;  4F7U E;  3UAT A;  4M75 B;  4J9F A;  4JS4 A;  2EJ9 A;  2HL5 C;  1VQM Q;  2V1R A;  4M75 E;  1YCS B;  2GFA A;  4CRI A;  2RI2 A;  2W10 A;  3MHX A;  4C92 A;  3CC4 T;  4CC2 A;  4GLM A;  1YHQ A;  2PZ1 A;  1UGQ B;  2KRM A;  2NUT B;  3BW1 A;  1GCQ C;  2DM1 A;  2CSI A;  3CCS Q;  3CD6 T;  2CRE A;  4RCB A;  5L23 A;  4XTZ A;  2O4X B;  1NEB A;  2M1H A;  1BI3 A;  1PKS A;  2HSE B;  4IUP A;  1GRI A;  2IIM A;  3CC2 A;  1K73 C;  3OYE A;  4KT0 E;  5GAN e;  2KK4 A;  4KUD K;  3M9Q A;  1BB9 A;  4LN2 A;  4XU2 A;  1UEB A;  2QG9 B;  2EKO A;  2JT4 A;  4C8Q D;  4B9W A;  3ME9 A;  2DIG A;  4X9C A;  3IQL A;  4LDW A;  5KE2 A;  3OYL A;  1YIJ A;  4ESR A;  2A36 A;  1WHL A;  2NLU A;  1OZ3 A;  3OY9 A;  1D1A A;  2XD0 A;  3S6W A;  1M2V B;  1MMD A;  1QCO A;  1M1K C;  3NFC A;  4OP0 A;  2JVV A;  2L89 A;  1CSK A;  1I8F A;  1PSF A;  3CCJ Q;  2DK3 A;  1EZZ B;  3GBQ A;  1I5O B;  2CH4 W;  2L3P A;  4BE2 A;  2EBP A;  3L2Q A;  2LNV A;  4F7U A;  3JCM W;  5J3B A;  4Z8A A;  3WVD B;  1Q86 C;  2DJZ A;  4FIB A;  3URG A;  3BY7 A;  3H0H A;  1VQ9 A;  2XU8 A;  1UB4 A;  2E64 A;  4M75 A;  3EGD B;  4PFZ A;  1A0N B;  1H64 1;  1Y7X A;  3NHN A;  2KVQ G;  5GAO p;  4RTT A;  2PTK A;  1SPK A;  3FIF A;  2FZC B;  4M7A D;  1AZG B;  4V2S A;  1M1F A;  1HSQ A;  4EMK C;  1QVF A;  2E65 A;  3P8B B;  2EYW A;  2YWW A;  4XU0 A;  1FWZ A;  2HAX A;  4IUV A;  5LJ5 h;  4EMK B;  2KY9 A;  4JRI A;  2FZK B;  1WXU A;  2RD1 A;  2EJG A;  2V26 A;  4OGE A;  1LPL A;  1W1F A;  3TQ7 P;  4M78 G;  1M90 R;  2YUP A;  1UGS B;  2O4X A;  1EIF A;  2LT1 A;  4E7I A;  1G3T A;  4BI3 A;  3TCJ A;  1YHQ Q;  1M3B A;  3OYI A;  1H3Z A;  2HD0 A;  3RKX A;  4PNO A;  1VQP T;  2KI7 A;  2LJ3 A;  5C0M A;  2KDS A;  1WJS A;  1YI2 Q;  4EIK A;  2OJ2 A;  2ABL A;  3QZ5 B;  4F04 B;  1N9S A;  3CCQ A;  2RJC A;  1RAB B;  1BBZ A;  4L59 A;  3VS7 A;  2ENM A;  1M2V A;  3M0T A;  1TH7 A;  2HSP A;  5LJ3 h;  4ZTJ A;  1K9M R;  3CC2 Q;  4RTV A;  3OYJ A;  2AK5 A;  5GAN f;  1AT1 B;  3L2V A;  3PVQ A;  5GJW B;  3HHT B;  1OU8 A;  1TOV A;  4F7U F;  3RNJ A;  1OU9 A;  2PVG B;  5GAO r;  3I5S A;  2HDA A;  1M1K U;  2A0F B;  2DYI A;  2QQB A;  2SRC A;  2JM8 A;  1VQO T;  1PHT A;  4BB7 A;  3PIO A;  2DTH A;  1BU1 A;  3I55 Q;  3RER A;  3EGD A;  4DBF A;  2K3X A;  4K11 A;  1YWP A;  2E4H A;  4XTY A;  3QWY A;  1YJN A;  3I5R A;  1UUE A;  4N0A C;  2RJE A;  3M0Q A;  5FRO A;  4II1 A;  1XNI A;  1PD1 A;  1GXI E;  2EFI A;  4FSX A;  1VQ9 Q;  5D6W A;  2CP6 A;  1UDL A;  5DY9 A;  5LJ5 e;  1YNZ A;  3A8L B;  2G3R A;  4ZGJ B;  1VQ6 A;  2VAS A;  2DF6 A;  1QWE A;  4XU3 A;  3HKS A;  4KGV B;  4HT8 A;  2KSS A;  4A54 A;  4HCC A;  5KH6 A;  2LP5 A;  1AWX A;  2XIC A;  3A1P A;  3CCM T;  4HCZ A;  1QW1 A;  5CAI A;  3KBG A;  4PJL A;  2Y4Y A;  3HFO A;  2GGR A;  1PRL C;  1WGS A;  4BE0 A;  2RQV A;  1M8V A;  4OMM A;  1Q7Y C;  2QGG A;  1AEY A;  5FWC A;  2MPX C;  3QHS A;  2O88 A;  2V8J A;  4VUB A;  4C92 G;  5KYW B;  3MP1 A;  3QDF A;  5LJ3 e;  2Y90 A;  4E7Z A;  1N5Z A;  4PK4 A;  3VS4 A;  1WJR A;  3VUZ A;  3SEM A;  2A08 A;  1KIK A;  2FVU A;  2DL4 A;  3VYH B;  1G3Y A;  4ORZ A;  3M53 A;  3CCQ Q;  1W2B A;  4J9D A;  3OS2 A;  1JJ2 P;  1KD1 C;  5A0D A;  2O01 E;  2DMO A;  2K79 A;  1VA7 A;  3BDL A;  2LC4 A;  5HY6 A;  4PJO D;  2KXC A;  4N4H A;  3GNG A;  4LDX A;  3EFO B;  5GAN 7;  2YXY A;  2FHD A;  3HSB A;  1YIT T;  1N8R R;  2EQJ A;  3VS6 A;  3MCA B;  3NTK A;  4PJJ A;  4BE1 A;  2EYX A;  2K9G A;  3T9N A;  1M8M A;  2GF7 A;  5C6S A;  3M58 A;  1VYT A;  2WAC A;  4M78 B;  2P0K A;  3EAE A;  4N0A A;  4E6R A;  2M9U A;  1K8A R;  1V76 A;  5D6X A;  2SEM A;  1BI2 A;  4M77 F;  2K5L A;  2DNU A;  4M78 E;  2RJD A;  3OYN A;  2COZ A;  1Q95 G;  2ZGW A;  3OBW A;  4ZN1 A;  4CC4 B;  2M0Y A;  4M7A F;  5GAM j;  1YJN Q;  4F7U G;  5A2Q E;  5FU7 C;  4FSS A;  2JTF A;  2E5K A;  3LYI A;  4Y28 E;  3FC3 A;  2DRM A;  4J9C A;  2RMO A;  2QGF B;  5FU7 B;  1ZUU A;  4NS5 A;  3PIP A;  4M75 G;  3SDZ A;  3P8D A;  2PU9 B;  1VQ6 Q;  1XTD A;  2DXB A;  3MPU B;  2JXB A;  1HJD A;  4MZP A;  1VQ8 A;  2BZX A;  4EMG A;  3VS5 A;  4QQG A;  4E2F B;  5KYW A;  3EGX B;  2OTL T;  1G3W A;  2C0T A;  1K73 R;  2JW4 A;  2PUK B;  1VQ5 Q;  3S3M A;  3QII A;  3JAM E;  1PD0 A;  1QMC A;  2CUD A;  2MI6 A;  1VQ4 Q;  5GAN 8;  2FO0 A;  3R6O A;  1QVP A;  2WSF E;  1QVF P;  1O75 A;  3CMA T;  2C06 A;  4FYY B;  2X3W D;  3ZEH A;  2HCK A;  3EGU A;  1DJ7 B;  4HVU A;  1M1K R;  4N4I A;  3CPW S;  1M5Q 1;  2CKK A;  2EJF A;  3MEA A;  1OI1 A;  4E7S A;  2KAF A;  1RAC B;  2RHU A;  2QTV A;  4JJB A;  2LQ8 A;  1G8X A;  4XQ3 A;  4LNP A;  1ABQ A;  1FX7 A;  1KD1 U;  4Z02 A;  1NLO C;  3OSV A;  2V1Q A;  1OZ2 A;  4E7H A;  3VRY A;  2RQT A;  5M9O A;  4UC4 A;  1WHG A;  1VQN T;  1Q86 R;  4GLK A;  5IXF A;  1D0Y A;  2YHT A;  4FT4 A;  2RI5 A;  5CIU A;  5EC7 A;  5KCO A;  2AZS A;  3EFS A;  4J7F A;  4M7D C;  3V8J A;  3EHR A;  1SSF A;  3HFN A;  3THK A;  4LE9 A;  2VGN A;  2L3R A;  4KRT A;  3CCV A;  1RAG B;  3EG3 A;  4C5G A;  4DOV A;  4LUE A;  1X75 C;  2KT1 A;  1I07 A;  2ESW A;  3OYF A;  3I9Q A;  2QQR A;  1VYV A;  4A63 B;  2QQS A;  3QG1 A;  1JU5 C;  1FXX A;  4FL6 A;  2GTJ A;  3O8V A;  2YRC A;  4JJC A;  1NJI U;  2LX9 A;  1YJW T;  3I56 A;  4RTZ A;  4ELY C;  4ZN3 A;  3JCM c;  1IRE B;  2HL3 A;  5GAM d;  2M16 A;  2CH4 A;  4OML A;  2VYT A;  1NPR A;  5CQY A;  3OQ5 A;  3G1J A;  4PFP A;  3C12 A;  2DYB A;  2RQW A;  1WXB A;  4L5G A;  3CCJ A;  1KQS P;  1G83 A;  1NE8 A;  1VQ8 Q;  2BKD N;  4J6X A;  1K76 A;  2F2W A;  3LGF A;  1RAD B;  2QEX T;  1M27 C;  4NL3 A;  3FEO A;  2M51 A;  1J3T A;  2GNC A;  1ZUK A;  4WF2 A;  1K4U S;  2NWM A;  5KYY B;  4IUR A;  1D3B A;  4AG1 C;  4OVA A;  4PL6 A;  2DER A;  3G4S T;  2MAM A;  3NTI A;  2EGC A;  1K0S A;  2EPD A;  1KC8 C;  3UT1 A;  4F7U B;  4J9I A;  2DRK A;  3JB9 I;  2YDL A;  5L8R E;  5GAN 4;  2FPD A;  4LD6 A;  3MO8 A;  1VQL T;  1IZ6 A;  5CCA A;  1VQ7 T;  1NEG A;  2LTO A;  1QVG S;  5CKH A;  4M7D A;  3N5B B;  1G3S A;  5FU6 C;  3J81 E;  4KUL A;  2X4X A;  5FU6 B;  1B7T A;  2AZV A;  3HL8 A;  5IHN A;  2B8A A;  2I0N A;  2DIQ A;  2VUB A;  1W2B P;  2IVW A;  1VUB A;  1OEB A;  1TUC A;  1OUL A;  2RM4 A;  3UDC A;  2JJ9 A;  3QWX X;  3CCV Q;  2DVJ A;  4ZGD B;  3JCM f;  1H92 A;  1VIE A;  4HCB A;  1YI2 A;  4JZ3 A;  1D1C A;  1GFC A;  4A4E A;  2LJ1 A;  1VQM T;  1WQW A;  3H9N A;  4IKF A;  3E2U A;  3RKY A;  5DM7 R;  2R57 A;  1I1J A;  1TWB A;  1PSE A;  4R55 A;  1RLQ C;  3M0U A;  2KEA A;  1K1Z A;  2DIL A;  2LMJ A;  4QVZ A;  2BE7 D;  1Q7Y R;  3I56 Q;  4FYX B;  3CCS T;  1W6X A;  3S3N A;  3MEV A;  5CQX A;  4AFZ C;  3G7Z A;  2RJF A;  3NTH A;  3QYG B;  1SKU B;  4JRQ A;  2B86 A;  2CP3 A;  3JCM Q;  3OW2 S;  4Z89 A;  4QVC A;  3OA6 A;  3I55 A;  3CCU A;  1MNE A;  1E6H A;  3RR6 A;  5KYY A;  1WNL A;  2D9T A;  1TS9 A;  2C0O A;  2X4W A;  2JS2 A;  4D8D A;  4RCC A;  2LCL A;  4FYW B;  4WTO B;  1KD1 R;  1SHF A;  3JV3 A;  2PVD B;  3HRS A;  5AT1 B;  1S1N A;  5HK0 A;  3KXT A;  4M7D F;  3C94 A;  1B3Q A;  2FEI A;  4WCI A;  4XTV A;  3V7S A;  4RTX A;  2QAZ A;  3QO3 A;  1V1C A;  1LJO A;  2CP7 A;  2DKG A;  3ER0 A;  1T0H A;  5AYF A;  3JB9 G;  1KC8 U;  2ED0 A;  1JB0 E;  1VQK A;  3CCL T;  4KGX B;  2DAQ A;  4HA8 A;  3WXM B;  3PGG A;  2K4Y A;  2KGT A;  5I2M A;  3JSC A;  2NUP B;  2PQW A;  4BY6 C;  1ZBX A;  2XDD A;  3ZBD A;  5IHK A;  4J5Y A;  3FDR A;  3UPU A;  2OTJ A;  2KYM A;  2E1H A;  4BY6 B;  3QBY A;  3LH5 A;  2ZPE B;  4M77 C;  2EQI A;  1KHC A;  2ECZ A;  5GAN 2;  4M77 B;  4M7A C;  2RO0 A;  5CKF A;  4PLL A;  3TSZ A;  3JCM d;  2AKK A;  1FMW A;  2XMF A;  1HYO A;  4M77 E;  4M7A B;  5GAN j;  3TU4 K;  1ABO A;  4EPC A;  2DBM A;  2FG0 A;  4LUD A;  1NG2 A;  1C6V X;  2A28 A;  3CC7 A;  4R56 A;  1MMA A;  4M7A E;  4Y91 A;  4LDV A;  2E6N A;  2EQU A;  2JOY A;  1FYN A;  4M4Z A;  4AFU C;  1UHF A;  2EGE A;  1JEG A;  2DL5 A;  2DTO A;  4NOY A;  2E6Z A;  4RG2 A;  2GQV A;  2RI3 A;  4KH1 B;  3KUF A;  4YTL A;  5IHI A;  4DA4 A;  2L3S A;  2LNH B;  2CS7 A;  3GNF B;  1VIF A;  4LDU A;  4ZNX A;  1YHQ T;  4QT7 A;  2PVO B;  7AT1 B;  3ZFJ A;  3RMQ A;  1WX6 A;  2QTX A;  2X3X D;  1ZSZ C;  3G6E A;  2GFU A;  2E12 A;  5GMK i;  4QW2 A;  1BYM A;  4OB3 B;  5I21 A;  5GMK j;  2R58 A;  2RK1 A;  2DJQ A;  3JRZ A;  1SF9 A;  1QCF A;  2CSQ A;  3CCU Q;  2P0Q A;  3CC2 T;  1TUD A;  4O5V A;  2JTE A;  1LNX A;  1QP2 A;  1R0C B;  1M30 A;  3X24 B;  3VS3 A;  3CBO A;  1IXD A;  3M59 A;  2JM9 A;  1JJ2 S;  1WA7 A;  2J6F A;  3JCM P;  2JNG A;  1C0M A;  1BI0 A;  2NUP A;  2DLP A;  2DO3 A;  2AIR B;  3UA6 A;  4MMK A;  1YIJ T;  1U1T A;  1X6B A;  3PNW C;  2ROL A;  5GAN 5;  2DD5 A;  3CXC S;  2QQA A;  3CPW A;  5GAM g;  1MHN A;  1ZA2 B;  2QA4 T;  1VQK Q;  1X27 A;  3G71 A;  4FW1 A;  4M77 A;  1YJ9 A;  1RAA B;  4NL2 A;  3CEY A;  5I22 A;  4A4K A;  4OB1 B;  1IO6 A;  4PLI A;  1OQK A;  1EFN A;  2MOX A;  1VQ5 A;  4M7A A;  3CCE A;  4AFQ C;  4E47 A;  1VQ4 A;  1F1B B;  2FPE A;  3CMA A;  4N4G A;  3CME A;  2EQK A;  4XK8 E;  2OTJ Q;  5GAM e;  4M7D G;  4A4F A;  1VQ9 T;  5FW9 A;  2VC8 A;  4PJM A;  1PG5 B;  1Z9Z A;  3RIR A;  2RQU A;  1UGV A;  2JS0 A;  1JRI A;  2KRS A;  3HRU A;  3VV0 A;  1Q81 U;  1WHM A;  4XAX B;  3GP8 A;  1WPY A;  2FB7 A;  1YCY A;  2ROT A;  2IG0 A;  1YFN A;  2NUZ A;  4BD3 A;  5FRM A;  4HXJ A;  2X35 A;  1D0X A;  4C8Q F;  3CC7 Q;  4F16 A;  2DX1 A;  3CCR A;  4LDY A;  5GAN 6;  4JRK A;  1D0Z A;  3QXE B;  3WVE B;  5GAN d;  1TU0 B;  1IHV A;  1S72 A;  1ZSZ A;  1WI7 A;  5I2S A;  4F14 A;  2FRY A;  3U23 A;  1G5V A;  2DEU A;  3MP8 A;  1Q82 U;  2EIF A;  4M78 D;  1RAH B;  3G6E Q;  2P4R A;  1KC8 R;  2EGA A;  1MMG A;  3VS0 A;  1OYX A;  3QYH B;  1O9S A;  3EG2 A;  3LX7 A;  1UG1 A;  4F17 A;  3CCQ T;  4RTY A;  1ZUY A;  4PJO C;  3FB9 A;  5LJ5 j;  3OMG A;  2QDY B;  4C0G A;  3L1A A;  1CKA A;  2P0P A;  3C0C A;  4OMF B;  5GAO l;  5IH2 A;  1YN8 A;  1NJI C;  2GTO A;  1TSF A;  4QKU A;  1SRM A;  5KYX B;  1VOM A;  3RES A;  2X4J A;  5LJ5 f;  4ZGE B;  2DL3 A;  3PFS A;  4GY5 A;  4Z88 A;  2YSQ A;  4MDX A;  2H3J A;  4IUU A;  1Y96 B;  2K5I A;  4A4H A;  1TG0 A;  3G71 Q;  1YJ9 Q;  1QVG A;  1YJN T;  4BDY A;  3VKI A;  3HRT A;  4PJN A;  3CCE Q;  3V7C A;  2FRW A;  1K9A A;  3CMA Q;  2OX7 A;  3CME Q;  4J9G A;  1ARK A;  2LZ6 B;  4C5I A;  2EYY A;  2H8H A;  4IUQ A;  2KR3 A;  4BI8 B;  3AHU A;  1WHJ A;  1VQ6 T;  3QKJ A;  1W70 A;  3R6N A;  4MDW A;  2RHY A;  2XDB A;  4FM4 B;  3SHW A;  1NLP C;  4J9B A;  4X34 A;  3SWN C;  1KSW A;  2CP0 A;  3BE3 A;  1X69 A;  5LJ3 f;  2JUF A;  2BIV A;  3JCM b;  3RUX A;  3EH2 A;  4JPB W;  2J6O A;  4RKU E;  1WHK A;  1HXD A;  2D0Q B;  4J6Y A;  2O9S A;  1RAE B;  4D6W A;  3CCR Q;  2F5K A;  2X51 A;  1I81 A;  1KQS S;  3D7S B;  1SG5 A;  3CC4 A;  2JN0 A;  2RHI A;  1D3B B;  2ZPF B;  3M5A A;  1T0J A;  1S72 Q;  3REB B;  2J06 A;  4QVD A;  1KHI A;  4HVV A;  1UE9 A;  1BIA A;  4B6M A;  1JXM A;  1VYU A;  1X6G A;  2QYZ A;  2E3I A;  2K6D A;  3OMC A;  2EYZ A;  3PMT A;  1YWO A;  1BK2 A;  3CD6 A;  1RAI B;  4OMQ A;  2E5Q A;  4PJO A;  2MF2 A;  4C92 D;  3JCM g;  2EAY A;  3OW2 A;  4M7D B;  5KE3 A;  2QXF A;  1GCP A;  2K2M A;  1Y07 A;  3BDU A;  2M02 A;  3QZ9 B;  1OX9 A;  5KYX A;  2QI2 A;  4M7D E;  2EWN A;  4GBQ A;  4DQ2 A;  1TTH B;  1TUG B;  3REA B;  2LQK A;  5FRN A;  2LX7 A;  1I4K 1;  1WHH A;  1Y96 A;  4Q5W A;  3NMZ C;  3JB9 H;  1GFD A;  2DZC A;  2BTT A;  5LL6 S;  5LJ5 d;  1C1A A;  4BUG A;  5CVI A;  3M55 A;  1RI0 A;  1SEM A;  1OV3 A;  5D6Y A;  5CKE A;  1WXT A;  5GAO n;  2MYS A;  4E7J A;  2HZY A;  3L2U A;  1E7O A;  2D8J A;  2A7Y A;  1M90 U;  2DD4 A;  4HT9 A;  2HKQ B;  5HCK A;  2JMC A;  2K2V A;  3MEW A;  4M77 G;  1JO8 A;  1KFZ A;  4FW2 A;  4JS5 A;  1WFW A;  3UWN A;  2ED1 A;  3OYB A;  1R0B G;  2LDM A;  2YLC A;  1ZLM A;  1X01 A;  4OB0 B;  2P84 A;  3CPW P;  1WIE A;  4EDU A;  4M7A G;  2YRD A;  3SWN A;  3GLX A;  2X9H A;  2LRQ A;  2RH2 A;  4AMC A;  3A8G B;  1RAF B;  1AWJ A;  3OS0 A;  5LJ3 d;  2EW3 A;  3A8M B;  1NPP A;  1K9M U;  3OYD A;  2DBK A;  3KFV A;  1MMN A;  1VQ8 T;  2KMT A;  1GBQ A;  5CR2 A;  4PJO F;  1X6O A;  4M75 D;  2L3Q A;  3J7A F;  5KCH A;  5GJV B;  4RG8 A;  2BUD A;  2XHC A;  1UJ0 A;  3LLR A;  3S3O A;  3V8L A;  2GCX A;  3GF5 A;  2GBQ A;  4BAC A;  4DEY A;  2K3Y A;  2RHX A;  3X20 B;  1N8R C;  3CC4 Q;  2NYS A;  2VV5 A;  5A0G A;  3E1S A;  3FJ5 A;  5IT9 E;  3V7R A;  4Y92 A;  4L6V 5;  3A98 A; 
#chains in the Genus database with same CATH homology
 1VQL Q;  1M1K R;  1K8A R;  1YHQ Q;  1VQ4 Q;  3CCE Q;  1VQ9 Q;  1VQ7 Q;  3OW2 P;  3CMA Q;  3I55 Q;  3CME Q;  1VQP Q;  1YIT Q;  3CCU Q;  2QA4 Q;  3CXC P;  1W2B P;  3CD6 Q;  1Q81 R;  3CCL Q;  1VQ6 Q;  2OTJ Q;  3CCJ Q;  1YJW Q;  1QVG P;  3CCS Q;  3CC7 Q;  3G4S Q;  3CCR Q;  1Q7Y R;  1QVF P;  3CCV Q;  1KQS P;  1YI2 Q;  1N8R R;  1VQ8 Q;  2OTL Q;  1Q82 R;  3CC4 Q;  3G71 Q;  3I56 Q;  1VQM Q;  1VQK Q;  1YJN Q;  3G6E Q;  1M90 R;  1VQN Q;  1YJ9 Q;  1YIJ Q;  3CCM Q;  3CCQ Q;  2QEX Q;  1KD1 R;  1VQO Q;  1JJ2 P;  1KC8 R;  1S72 Q;  1NJI R;  1Q86 R;  1K73 R;  1K9M R;  3CC2 Q;  3CPW P;  1VQ5 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...