1Q86R

Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2003-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1q86R00
2QA4Q 1VQMQ 1YITQ 1Q7YR 1YJWQ 1YIJQ 1YJ9Q 3CCMQ 1K73R 1K9MR 1VQ4Q 3CC2Q 1QVFP 1N8RR 3I56Q 1K8AR 1Q81R 1M1KR 1VQ6Q 1VQNQ 1VQPQ 1VQKQ 1S72Q 3CCEQ 1YJNQ 1YI2Q 1KD1R 1YHQQ 3CPWP 3CC7Q 3I55Q 2OTLQ 3CCUQ 1W2BP 1KC8R 1VQ8Q 1KQSP 3CCLQ 3CMAQ 2QEXQ 3CMEQ 3CCJQ 3CCQQ 3CXCP 1VQOQ 1VQ9Q 3G6EQ 1NJIR 3G4SQ 1VQ5Q 3CD6Q 1VQLQ 3G71Q 3CC4Q 3CCVQ 1Q86R 3CCSQ 1QVGP 1JJ2P 3CCRQ 2OTJQ 1M90R 1VQ7Q 3OW2P 1Q82R
chains in the Genus database with same CATH superfamily
4J83A 4ME7A 2RQVA 4M7AE 3OSSC 1NJIC 3CMET 3L2QA 3RERA 4FW2A 3OYBA 2K2VA 3QZ9B 2ROLA 4M75F 3PVQA 1K0SA 2IG0A 1OX9A 4KH0B 2MF2A 3OB9A 2HSPA 1YJ9A 3I56T 4DBFA 2DL3A 1GFDA 1W2BA 1YN8A 4C8QC 4LUDA 1AZEA 3OYGA 2OTLT 1H92A 1RAGB 2ECZA 4DEYA 5LJ5d 4C0DC 4B9WA 1I07A 3T9NA 4M7AC 3ER0A 3TU4K 3EFOB 4FU6A 2EQUA 3ULRB 1YCSB 5D6WA 3DB3A 1VQOQ 1QWFA 1LOJA 4UC4A 4BY6C 3L42A 4J6YA 2CGHA 3CC4Q 1R8OB 2JN0A 3BDLA 1VQNA 2QTXA 2Y4YA 2FG0A 4C92D 2HZYA 2XKOC 1MMNA 1ARKA 3TEEA 2O31A 2X9HA 2EAYA 3FC3A 1LCKA 2KRSA 2K3XA 3EHQA 3OW2S 2DBKA 4EIKA 1VQ8Q 2XDDA 3G4SA 5ECAA 1M27C 2KXDA 3TCJA 4V2SA 1UTIA 3Q1JA 2M9UA 3CD6Q 4L6V5 4C8QA 3AT1B 1ZA2B 1JU5C 1WHHA 1NPPA 2RJDA 2RQTA 3TSWA 4M75B 2F2VA 2V26A 3CC7A 3QJYA 4KGZB 4M7AA 2FVUA 3JB9D 5CKFA 2ED1A 1K76A 1WI7A 2XD0A 2BZYA 2LQNA 2EQMA 2BZXA 4CC2A 2PVGB 2DD4A 4FCYA 2EKHA 1IZ6A 2DIGA 2R5AA 4IKFA 3JCMd 2QQAA 1RLQC 5GAMg 5HY6A 2QASA 2XICA 2NUZA 5GANd 1KQSS 2QQRA 2GFUA 2EYZA 4XAXB 5GAMh 2RHUA 5GJWB 2XU8A 1XQHA 3CXCP 1AWOA 1WFWA 1Y7XA 3JB9H 2EWNA 1ZHIA 4NL2A 5KYUB 3NTKA 1CKBA 1BYMA 3MKDA 5CVIA 1TG0A 1Q82R 2OAUA 2LJ0A 4M78G 2X4WA 4FYWB 3DLMA 2SEMA 3JRZA 4RG8A 1X43A 3KUFA 5A0GA 4XU2A 2MWOA 3LH5A 1ZSGA 4E47A 4R0KA 5A0LA 4JLGA 1GRIA 1X27A 1VQ9Q 2J7IA 2PTKA 2EKOA 1Y0MA 2RHIA 4LUEA 2EQIA 3UDCA 4BD3A 4M7DC 2I0NA 5D6XA 3ZFJA 3X25B 2RK2A 4FYVB 1YJNA 2IVWA 5LJ3g 4C5GA 3QBYA 4II1A 2Y4XA 4JPBW 3CPWP 5FROA 3RDVA 5LJ3h 1W2BP 4XQ3A 3VS3A 3GBQA 3EFRA 2R58A 4M78F 4HXJA 4DBHA 2X3XD 3GOXA 5C6SA 1WJRA 4HA8A 5GAN2 2FEIA 2MWPA 2VC8A 1UB4A 2JTMA 2K7AA 4RTWA 4PJOG 2GQIA 2RMOA 5GAMe 2O2OA 1VQMQ 2K57A 1BI0A 1YITQ 1QQJA 2D8JA 2GF7A 1M4ZA 4HCZA 3DB4A 4IUTA 4MDXA 5J26A 3M0SA 2DTOA 2KYMA 3QSUA 1JO8A 4M7DA 3EGDA 4HT9A 3M0RA 2LTOA 2XDBA 1NE8A 2C0TA 1NEBA 1NPRA 1VQ6T 2YUQA 3V7RA 1M2VB 1VQKA 4O5VA 3GF5A 2X4JA 1VYUA 4PL6A 1AD5A 1G3TA 2CYZB 1S1NA 1IXDA 1M2OA 1BCMA 2RQWA 5DM7R 2HSEB 4PJOF 2DTIA 1V1CA 1HK9A 5GAN4 5CKEA 4J9IA 3PIOA 1GL5A 1QP3A 4BDYA 1U3OA 2RQRA 1VQ4A 5LJ3e 2ZPHB 4LDVA 4M78B 1ZA1B 3MHXA 1I5OB 1WPYA 1VQPQ 1NEGA 2LJ1A 3CCJA 1M90C 1HSQA 5IN1A 4C8QD 2RH2A 1M90U 4JLIA 2DYBA 2LRQA 1FX7A 2FB7A 4M7AD 1JEGA 1VOMA 2JM8A 1D3BA 1JB0E 2E5KA 2RHYA 2ABLA 3NGPA 1WGSA 1QW1A 2DILA 1KG1A 1PC0A 1K9AA 2NYSA 2K3YA 4KT0E 3E9GA 5GMKh 1M1KC 1M1FA 2AZSA 2K5FA 2X3WD 3M56A 3CC2A 2R57A 1GBRA 2ZPEB 4RKUE 1M1KU 4GBQA 2JS0A 3PMTA 4M75E 4PJOB 2KYBA 2BUDA 1YI2T 5IHIA 1C0MA 5I21A 2QA4Q 3CCUT 2JMCA 2V1RA 3CCLT 4BACA 4DOVA 5GMKm 2KAFA 4OMOA 3NMZC 2H3EB 1W4SA 4B6MA 1KHCA 3G71A 3HSBA 1ZUYA 1G8XA 3A1PA 4Z02A 2C06A 1X01A 4C5HA 2KVQG 3JB9J 3M57A 2L0AA 4XTYA 1NLOC 2VUBA 4GLMA 1UGQB 2C0OA 2ZPGB 2CT3A 2PVDB 2KT8A 3TVTA 3DKMA 2O01E 1AEYA 4M75C 1ZLMA 2EGAA 4IUVA 1N9RA 3CCVT 4J9DA 4N0AC 4DBQA 3J80E 5EC7A 2JZ2A 2P4TA 4MDWA 2DVJA 1WNLA 2DL4A 4LE9A 4JZ4A 2KK4A 3CCRQ 3JB9I 3UATA 1S72T 4GLKA 5LJ5j 3RNJA 4PKCC 3RESA 1VUBA 3VS0A 4R55A 2KR3A 3GNGA 1UHCA 4J7IA 1YHQQ 3CPFA 1VQOA 3QDRB 1MHNA 2ROTA 5GAN6 3CC4A 1RADB 2L3SA 1TSFA 1QCOA 4PJNA 2AKKA 2L3RA 4ZN1A 1YIJT 4BI3A 1R0BG 2CP2A 4M75A 2QQSA 2EVRA 5A0DA 2F5TX 3M4GA 2EIFA 3QWYA 1M3CA 5GAMf 1VQ8A 3QXEB 1C1AA 4N0AA 3LH0A 1D0XA 1ZBJA 2KQWA 4ZN3A 4M7DD 4ANJA 5I22A 3EG1A 1M8VA 2COWA 2X35A 2YRVA 7AT1B 1MMDA 5L8RE 3TREA 3L2UA 2KY9A 2KXCA 2GNCA 1E6HA 4L59A 2A0FB 4PK4A 3X24B 3G6ET 3M4YA 2CSIA 2EJ9A 4ATOA 5KYXB 3CMAQ 5KE2A 2HQEA 5GAN8 3R6OA 3O5ZA 4J6WA 3ZBDA 5KYUA 5I2MA 1J3TA 2CP6A 4M4ZA 4AFUC 3SWNB 1WIEA 1P92A 1QKWA 1WQ7A 2LC4A 4HCBA 2VYTA 4MZMA 2X4XA 1G3SA 2RI2A 2KSSA 4EPCA 1I8FA 3OS5A 5FU6B 4WF2A 5LJ3f 2HKNA 2M0YA 1SHFA 1Y71A 2MYSA 5EG2A 2O88A 1BCOA 2DRKA 4OMLA 2QEXQ 2L3PA 4LD6A 3PNWC 4RMOA 2D9TA 2LP5A 1WA7A 2J06A 2K6DA 3ASKA 2RI5A 2LQKA 1UUEA 1D0ZA 1M3AA 3S3MA 4M78E 4KGXB 5GMKi 4A63B 2CP3A 4RTZA 2DXTA 3C95A 2DXUA 2RJCA 3I55Q 3JCMP 2FRYA 4OB0B 4Z8AA 3FIFA 1FMWA 2Y90A 3C12A 4F7UG 4QQGA 1Q7YU 4PFPA 3F70A 1SRLA 3JCMV 1AWXA 2FRWA 2VB6A 2QYZA 4M77F 1KIKA 3SFMA 1UECA 1JQQA 2K4YA 4M78C 3EG2A 4OGEA 2NUPB 5HK0A 1WLPB 4BDZA 1MMAA 3OBYA 2OTJT 2CUBA 5I2SA 2DBMA 3RIRA 1UEBA 3OSVA 1YITA 3VS6A 3PVLA 1M2VA 3LGFA 1YJWA 4HT8A 4PJOE 2M16A 4O6JA 1PG5B 3MEUA 2L8DA 2KI7A 2RJFA 1VQ6Q 4F7UF 2YLCA 2K9GA 5I11A 1PRLC 3A8MB 3M53A 1I4K1 2V1QA 2PZ1A 3UPUA 2HCKA 4B9XA 1GCQC 3PGGA 3CCQQ 3J7AF 3OYJA 1KFZA 3CCMA 1M90R 2GFAA 4M78A 1JRIA 2M1HA 2DRMA 2M02A 4PJOC 1LVKA 2HQXA 1M8MA 3CXCA 4ZTFA 1T0HA 2PQWA 4J9EA 4ZGEB 1QWEA 3CBPA 1I0CA 2QK0A 4M77B 2EPDA 3HFNA 3CCSA 3L2VA 4M75D 1YJ9T 1O75A 4FT2A 4AFZC 2QG9B 2V8KA 1JJ2P 3CXCS 3H0HA 2XDPA 1M1KR 3JCMQ 3C94A 1GCQA 1SPKA 2V8JA 3NFCA 4X9DA 4DA4A 2COYA 3RR6A 3L1AA 4F7UB 4KRTA 1VQLQ 1VQNT 1XNIA 4PJOA 3LLRA 3CPWA 2YUOA 1X6OA 4LDXA 2ZPFB 2E4HA 1KD1U 2V8IA 2W0ZA 2DEQA 1X6BA 1RAEB 2VXEA 1YI2Q 1JBMA 1G3WA 3CCUQ 3G4ST 3M0UA 5LJ5e 1PHTA 2RK1A 3L2ZA 2MCNA 1M5Q1 3CPWS 1BIBA 2YXYA 2MI6A 5GAN7 3HRSA 1W2BS 2QA4A 3A5ZB 2LNHB 1PD0A 3QHSA 4AG2C 3UA6A 3CC7T 3A98A 3H0FA 2VKNA 2KGTA 1UGVA 3VRZA 2CSQA 2H3JA 4JS4A 3HHTB 3EG3A 4GY5A 3GIBA 1D09B 1RAFB 3HFOA 3RUXA 1KQ2A 2DZ9A 4KH1B 4EMHA 1QP2A 2D8HA 1OU9A 2HBWA 5CQXA 2E1HA 1I81A 5GAOp 2P0KA 1KC8U 3A8OB 3I35A 1UGPB 4RG2A 2XG8D 2BE7D 3GPLA 3CCRA 2KMTA 4C92F 2DETA 2FPEA 4E2FB 5CR2A 1OX8A 2VWFA 3SWNC 1BI3A 2K79A 2NUTB 1YHQA 3V8LA 1YIJQ 5FU6C 3V7SA 3MEWA 1FWZA 2HQHA 3EHRA 3JCMe 2ZGWA 2JTEA 4A4EA 1UHFA 4Q5WA 5GMKj 5GANe 1VQ5Q 4FT4A 2DD5A 2ATCB 3ZL7C 1YJNT 8AT1B 1G3YA 2HDAA 1OEBA 2DE0X 2D0NA 1H641 1UGSB 5KYXA 3M9QA 2QDLA 3MP1A 3FDRA 5DLQE 3SWNA 4M78D 2DVEA 3VUBA 4A4KA 2QI2A 1K8AU 2CZ1B 1WHKA 2BTTA 4OMFB 1RL2A 1JXMA 2DL5A 5CKBA 5IH2A 4C92B 3BW1A 2RHZA 5DY9A 4YTLA 3CBOA 2DXBA 3CMAA 1LJOA 1MGQA 3A8GB 2HL5C 1IB8A 1Q86U 1AT1B 2O9SA 4FYYB 2LMJA 1M30A 1HJDA 4EDUA 2QQBA 2QTVA 4IIOA 2A7YA 1VQKT 2COZA 1Q7YR 4XK8E 2OX7A 4E7HA 2QEXA 4Z88A 3SHWA 4M77E 4LDUA 5GAMd 2O9VA 4PJOD 4AG1C 5GMKl 1TH7A 2D6FA 2BKDN 2DM1A 3ME9A 5FWBA 3E1SA 4PJMA 5GAOn 4JRQA 1VQ4T 1Q81U 1BI1A 2X51A 3I55A 1SEMA 2NUPA 2J05A 2QQ9A 2X4YA 1BI2A 3VS5A 5D7UA 5KYNA 1VYTA 4LXCA 2HKQB 2P0QA 3CCJT 2JT4A 2SRCA 5GAN3 4ESRA 3M54A 1MV0B 2DNUA 1B07A 1QVPA 3SEMA 4F7UE 2KEAA 4EMKB 3THKA 1GBQA 3JV3A 3TQ7P 3HKSA 5CKHA 3VV0A 2EBPA 4QQ6A 2YRDA 2LCLA 1D0YA 3RMSA 3EFSA 4AFSC 4BE2A 1TUGB 4P5NA 2YUNA 4RCBA 1OZ2A 1X2KA 4CC7A 4IIMA 1UJ0A 4OVAA 5LJ3d 1NG2A 5AYFA 2DKGA 2E3IA 4X9CA 4E7IA 2ENMA 4C0ZA 1VQ7A 4ORZA 5GAOl 1D1AA 3CC2T 3DLLA 1K9MU 2KT1A 3OMGA 4HCKA 1TWBA 1WX6A 1XOVA 4IUQA 1AWJA 2FO0A 3CCQA 3G71T 3OBWA 4A54A 1WXUA 2G3RA 5FU7B 2DAQA 4LD9K 1YNZA 2LCSA 3EAEA 1U5SA 2WSEE 1Z9ZA 4FL6A 1RI9A 3CCEA 1E6GA 2RA2A 4QQDA 1UGRB 4A4GA 2L2PA 1KD1R 2E5QA 2XMFA 1IO6A 4J6XA 2JNGA 3VU3C 1NZ9A 4MZPA 1OZ3A 1WDXA 2K2MA 3CMEQ 4F7UA 3CEYA 2DERA 2DLPA 3FRNA 1QCNA 3LGLA 1N8RU 2DZCA 1C6VX 2A08A 3RKYA 5GAN5 3QPHA 2OI3A 3I56Q 2RF0A 1VQOT 1UG1A 2OTLQ 4NOYA 3MP8A 2JTFA 4OF1A 3CC4T 1VQLA 3EFOA 1T0JA 1YWPA 2LT1A 2YT6A 1FMVA 3G4SQ 1IHWA 2DJQA 5CCAA 3QUIA 4XTVA 2HAXA 2QAZA 3M59A 4MZTA 2LX7A 2LX9A 1VQ8T 2IPOB 5IHNA 5HK3A 1M3BA 2AZVA 2ED0A 3BFMA 1JXOA 3OA6A 2D0QB 1KC8R 3H6ZA 4HKEA 2KROA 1OI1A 4J9GA 4LNPA 3V8KA 3H41A 3VS7A 2CH4W 4X34A 1EFNA 3P8BB 4RTUA 2JXBA 2KRNA 2DXCA 1EX4A 1ZX6A 1BIAA 2LVMA 1WHMA 4C92E 2JS2A 3G1JA 4J8OA 3VYHB 4BI8B 1RAHB 2PUKB 2EQJA 2JMAA 3VS1A 3CD6A 2HNIA 1SF9A 4RCCA 2VXFA 3S6WA 2A3LA 3QDFA 1Y96B 1PSEA 2QXFA 2D1XA 3MP6A 1NYGA 4F04B 2NUTA 4JDSA 2FL7A 1WHGA 4JJNK 1ZUUA 4HVWA 5CK9A 4XTXA 1M1GA 3PTAA 3RKWA 2E70A 1JJ2A 4PFOA 2GQVA 3P8HA 3MEVA 1K73C 3MEAA 2JW4A 4PJLA 3I9QA 4OB3B 2LDMA 1RACB 5FLXE 2P0PA 1K73U 3A8LB 3BY7A 3LW5E 4CI0C 2MPXC 1AHJB 4LN2A 1U06A 3IQLA 4J9BA 1G2BA 1K8AR 1JJ2S 1N5ZA 1IHVA 2RD1A 4M7DF 1YJNQ 1M9SA 3LYIA 1VQ5A 2F1LA 4M77G 3VRYA 1BU1A 2RB6A 1V76A 5KYWB 1W6XA 3P8DA 3EG9B 1FXXA 1Q86R 4JUVA 2HMAA 1RABB 2P84A 2EGCA 3CQTA 2RPNA 1UDLA 2F2WA 2EYYA 2YHTA 2FPFA 3O8VA 4X1VA 1KJWA 2MAMA 1OV3A 1BBZA 4F14A 1SSHA 2JOYA 2DYIA 4OB1B 2DX1A 1VQ9A 3CBMA 1B7TA 2AT1B 1A0NB 1Q7YC 2AIRB 4E7JA 1YITT 3SDZA 1YJWT 2EYQA 1K4US 2PUOB 2DFUA 4HCCA 3KXTA 1N6AA 1R0CB 4N4IA 2XI9A 1WJQA 1OPLA 1YCYA 1HYOA 2LT4A 4KGVB 1VIEA 1KSWA 3UA7A 1MV3A 2NLUA 2G6FX 2YSQA 4DBRA 3QZ5B 4M7DB 4C0FA 3CCMT 1VQMA 4BUGA 2PVOB 2K5IA 4JRKA 1Z9QA 2E6NA 1QVFP 3M0PA 1SHGA 1VQ4Q 2EJGA 1EIFA 2HD0A 4IUPA 5GAMj 2LQWA 3M0TA 4BI4A 3VS4A 2F69A 3OS0A 5CO7A 1QLYA 1V29B 3CCST 3JCMW 1WHJA 3CCJQ 1IGUA 1PCXA 2K5LA 5FU7C 1W70A 5LJ5g 1Y57A 1PD1A 1XTDA 3FJPA 5LJ5h 1K9MR 4LDWA 4D8DA 1D1CA 2NWMA 2RQUA 5M9OA 1D1BA 4ELYC 1H3HA 4NS5A 2EFIA 1VQPA 3PMIA 2E3HA 3MPUB 2LCCA 1T3LA 4RTTA 4XU0A 1RAAB 5LJ3j 2VGNA 2E64A 2WSCE 4QKUA 4J9HA 2LZ6B 1HXDA 4EMGA 1ZSZB 3OYHA 2QA4T 5CAIA 3OYAA 2MMPA 1KD1C 4ZTJA 4PNOA 1YWOA 2VVKA 3UWNA 5IXBA 5HKCA 2CUDA 4BB7A 3PT9A 1OULA 3RKXA 4BE0A 1N8RR 5CKDA 3VKIA 1OU8A 5CQYA 3WXMB 4LDYA 2VV5A 4K11A 3E9FA 2J6FA 4FSXA 1NJIU 2CP7A 3CCLQ 2W10A 2E41A 5J39A 3JCMg 1VYVA 4WCIA 5GANg 4OGCA 3JCMh 2XIDA 4C5EA 2RNAA 5GANh 3QIIA 2CP5A 4C92G 3WVEB 1ABOA 1WXTA 4E7ZA 2RI3A 3CMEA 1ZUKA 1Y07A 2B8AA 5FWCA 3OW2A 4BE1A 2FZGB 5GAOr 1MNDA 1E7OA 3CCRT 3E2UA 4E7LA 3CCVQ 1NBEB 3LWIA 2F2XA 1RUWA 1UJYA 3I56A 1YHQT 1KC8C 1WHLA 2OTLA 1HD3A 2EQKA 2E12A 1S72Q 3OS2A 1YFNA 1TTHB 2LNVA 5C0MA 1ACMB 2JVVA 3I5RA 3JB9G 1X75C 5KYYB 3GNFB 3OQ5A 2FZCB 2OJ2A 4ELZC 1R77A 1QVGP 3FEOA 3A8HB 4IUUA 2DK3A 1RLPC 2MK5A 1KQSA 4MMLA 5FRNA 3EH2A 3MJXA 1GCPA 4C0GA 1Y96A 3JSCA 3H9NA 2CZ0B 2M0OA 4A53A 4NL3A 4E6RA 2ZCFB 4AFQC 2H8HA 2CKKA 3WVDB 1K73R 3JB9F 4J9CA 1LNXA 3META 3CMAT 1UFFA 1LPLA 1O9SA 3BDUA 3OYDA 2FYKA 1IREB 2PNIA 5FW9A 2HBPA 4XTUA 1KHIA 4PFZA 3G6EQ 4M7DE 1K8AC 3R6NA 2ZPIB 1I1JA 1WZOA 2DO3A 3TSZA 3URGA 1G83A 1U8RA 2EYXA 3OYMA 4KUIA 1GXIE 2WSFE 3QWXX 5KCOA 4ZNXA 3JCMJ 2CH4A 1RAIB 4PJJA 2QEXT 1BK2A 3OYLA 4CC4B 1Q86C 1H8KA 2ZPBB 4OMNA 5GAOq 1SG5A 5KYWA 1NYFA 5L23A 3EG9A 3OYCA 2J6KA 5IAYA 2FZKB 3I55T 3GP8A 1PSFA 2GTJA 2B86A 4HVVA 3G7ZA 1MNEA 2RJEA 6AT1B 1UE9A 1Q81C 4QVCA 3HPWA 2BIVA 2GTOA 2YRCA 4E7KA 1OYXA 3OW2P 5IHKA 4OB2B 1KK7A 1X2QA 1YJWQ 2CT4A 4C5IA 9ATCB 4JRIA 4FW1A 3X26B 2DMOA 3S3OA 2KBTA 4KBMB 2E10A 4M77C 1VQ7T 3D7SB 1FYNA 5LJ5f 1K0XA 2OTJQ 3KBGA 1U1TA 1CSKA 1SSFA 3CCMQ 1K1ZA 1MUZA 3BE3A 2LJ3A 4JJBA 3JCMb 2DJZA 4PLLA 3CCQT 3H8ZA 1YP5A 2EW3A 2KNBB 1K9MC 4CC3A 2EYWA 5KH6A 3VUZA 2CDTA 2E6ZA 3OYEA 2BZ8A 1ZSZC 2KDSA 4C8QG 3CCSQ 1PWTA 1KQSP 3CCET 1VQ6A 1WJSA 1N9SA 3U23A 4FSSA 4M7AG 2GCXA 2AKLA 2JM9A 1B34B 3N5BB 1U1SA 1AVZC 4M77A 4AMCA 4XU3A 4Z89A 3EGXB 5LL6S 2LQ8A 4JRPA 3FJ5A 3RMQA 2RN8A 1QMCA 1B3QA 2C0IA 2I2LA 2YWWA 2O4XB 1PKTA 4RUGA 1YJ9Q 3UF4A 5A2QE 4A4HA 5GJVB 3V8JA 3E19A 3PIPA 4C8QF 2YDLA 1VQLT 3C4SA 1BB9A 1PRMC 1ZSZA 2DEUA 4HVUA 1NJIR 1N8RC 3FLGA 4M7AF 2EJFA 4FYXB 3JCMf 4KULA 1TS9A 3EH1A 1RI0A 2DL8A 3AHUA 2FPDA 5GANf 4JZ3A 2GGRA 1WQWA 2EGEA 1VQNQ 4D6WA 3NHNA 4RTVA 2XK0A 2A28A 4OMQA 3L2WA 3JCMX 1SRMA 2DTHA 2IIMA 3SD4A 1ZBXA 4F16A 4CRIA 3OY9A 2CP0A 4F17A 2JJ9A 3QJ6A 2OAWA 3HRUA 2E65A 3H0IA 1YI2A 3CCUA 3CCLA 4Y91A 3OYYA 3CC7Q 3M55A 4Y28E 5IT9E 3CD6T 1TUDA 2KE9A 4R56A 1QVFA 4TVRA 1AWWA 2CZ7B 2F5KA 2PU9B 1XJWB 3NTIA 3NPFA 4C8QB 2DA9A 1AOJA 3ZEHA 4AT1B 5HCKA 3JCMc 4C0DB 5GMKe 3M58A 4XU1A 4M7AB 4J7FA 5GAOm 1QVFS 2Z0WA 2WACA 1YBYA 1ZQ1A 5KYYA 3CCVA 2QGFB 1W1FA 4BY6B 2QDYB 4OMMA 4M7DG 2JUFA 2J6OA 1MMGA 3INZA 3C0CA 5J3BA 4JS5A 1OQKA 4OP0A 1S72A 1SKUB 3QKJA 1Q95G 2AHJB 3GLXA 1QKXA 2KRMA 1G5VA 1CKAA 2AK5A 1VQ5T 3V7CA 4C92C 4VUBA 4QVZA 3HTRA 4Y92A 3X28B 2K3BA 4FIBA 3SB2A 1BKBA 4PLIA 3J81E 1IGQA 1X69A 1YIJA 1IRXA 3EGUA 5IXFA 2L3QA 8ATCB 4A4FA 2RO0A 5KCHA 4XTZA 1T3SA 2YLBA 3QYGB 1VQ9T 2MOXA 2A36A 1Q82C 1AZGB 4IURA 3PE0A 1TXQA 1Q82U 5FRMA 5KE3A 4ZGDB 2ZAEA 2ZZDA 3PFSA 4WTOB 5DLOA 2VASA 5CIUA 5GANj 3JAME 4C92A 4J9FA 4M77D 1TU0B 3S3NA 3REAB 3OMCA 2QGGA 3G6EA 2DF6A 3OYFA 2DPPB 1OOTA 1VIFA 1H3ZA 1VQMT 2RHXA 4E7SA 2ESWA 4EMKC 1X6GA 1EZZB 2L89A 1Q81R 1PNJA 1VQKQ 2L5QA 2HL3A 4QVDA 1FMKA 4RTYA 4L5GA 3RBBB 4FM4B 2CREA 4JJDA 4QW2A 1N27A 4ZGJB 4DOWA 2R5MA 3MO8A 3EGDB 3UT1A 4QT7A 4D8KA 4KUDK 5AT1B 3X20B 3EG0A 4RTXA 3VJPA 1NLPC 2RM4A 3NTHA 3QG1A 1QVGA 3VS2A 3HP9A 4DEXA 1I5LA 3M5AA 1KQ1A 4J5YA 4EMKA 3QO3A 1TOVA 2DL7A 2P4RA 3FB9A 1NM7A 1PM3A 2CZ6B 1VQPT 1VQ7Q 3KFVA 3MCAB 2MIOA 1PKSA 4XTWA 1QVGS 2CS7A 4OMPA 3M0QA 2BE9B 5D6YA 2M51A 3REBB 1WYXA 3OYIA 1OPKA 3QYHB 2OTJA 1WXBA 1TUCA 3LX7A 3OYKA 2HEQA 1GFCA 3L2RA 4M75G 2XHCA 3CC2Q 1F1BB 2GBQA 3HL8A 4N4GA 1D3BB 1QCFA 3CCEQ 1B34A 1VA7A 1DJ7B 2DIQA 2VGMA 3VYGA 3EGXA 3HRTA 2FHDA 2A37A 3I5SA 4MMKA 3G71Q 3OYNA 4C8QE 1ABQA 3LWHA 4N4HA 4JJCA 2O4XA 2YUPA 3OS1A 4DQ2A
chains in the Genus database with same CATH topology
2QA4Q 1VQMQ 1YITQ 1Q7YR 1YJWQ 1YIJQ 1YJ9Q 3CCMQ 1K73R 1K9MR 1VQ4Q 3CC2Q 1QVFP 1N8RR 3I56Q 1K8AR 1Q81R 1M1KR 1VQ6Q 1VQNQ 1VQPQ 1VQKQ 1S72Q 3CCEQ 1YJNQ 1YI2Q 1KD1R 1YHQQ 3CPWP 3CC7Q 3I55Q 2OTLQ 3CCUQ 1W2BP 1KC8R 1VQ8Q 1KQSP 3CCLQ 3CMAQ 2QEXQ 3CMEQ 3CCJQ 3CCQQ 3CXCP 1VQOQ 1VQ9Q 3G6EQ 1NJIR 3G4SQ 1VQ5Q 3CD6Q 1VQLQ 3G71Q 3CC4Q 3CCVQ 1Q86R 3CCSQ 1QVGP 1JJ2P 3CCRQ 2OTJQ 1M90R 1VQ7Q 3OW2P 1Q82R
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QA4 Q;  1VQM Q;  1YIT Q;  1Q7Y R;  1YJW Q;  1YIJ Q;  1YJ9 Q;  3CCM Q;  1K73 R;  1K9M R;  1VQ4 Q;  3CC2 Q;  1QVF P;  1N8R R;  3I56 Q;  1K8A R;  1Q81 R;  1M1K R;  1VQ6 Q;  1VQN Q;  1VQP Q;  1VQK Q;  1S72 Q;  3CCE Q;  1YJN Q;  1YI2 Q;  1KD1 R;  1YHQ Q;  3CPW P;  3CC7 Q;  3I55 Q;  2OTL Q;  3CCU Q;  1W2B P;  1KC8 R;  1VQ8 Q;  1KQS P;  3CCL Q;  3CMA Q;  2QEX Q;  3CME Q;  3CCJ Q;  3CCQ Q;  3CXC P;  1VQO Q;  1VQ9 Q;  3G6E Q;  1NJI R;  3G4S Q;  1VQ5 Q;  3CD6 Q;  1VQL Q;  3G71 Q;  3CC4 Q;  3CCV Q;  1Q86 R;  3CCS Q;  1QVG P;  1JJ2 P;  3CCR Q;  2OTJ Q;  1M90 R;  1VQ7 Q;  3OW2 P;  1Q82 R; 
#chains in the Genus database with same CATH topology
 4J83 A;  4ME7 A;  2RQV A;  4M7A E;  3OSS C;  1NJI C;  3CME T;  3L2Q A;  3RER A;  4FW2 A;  3OYB A;  2K2V A;  3QZ9 B;  2ROL A;  4M75 F;  3PVQ A;  1K0S A;  2IG0 A;  1OX9 A;  4KH0 B;  2MF2 A;  3OB9 A;  2HSP A;  1YJ9 A;  3I56 T;  4DBF A;  2DL3 A;  1GFD A;  1W2B A;  1YN8 A;  4C8Q C;  4LUD A;  1AZE A;  3OYG A;  2OTL T;  1H92 A;  1RAG B;  2ECZ A;  4DEY A;  5LJ5 d;  4C0D C;  4B9W A;  1I07 A;  3T9N A;  4M7A C;  3ER0 A;  3TU4 K;  3EFO B;  4FU6 A;  2EQU A;  3ULR B;  1YCS B;  5D6W A;  3DB3 A;  1VQO Q;  1QWF A;  1LOJ A;  4UC4 A;  4BY6 C;  3L42 A;  4J6Y A;  2CGH A;  3CC4 Q;  1R8O B;  2JN0 A;  3BDL A;  1VQN A;  2QTX A;  2Y4Y A;  2FG0 A;  4C92 D;  2HZY A;  2XKO C;  1MMN A;  1ARK A;  3TEE A;  2O31 A;  2X9H A;  2EAY A;  3FC3 A;  1LCK A;  2KRS A;  2K3X A;  3EHQ A;  3OW2 S;  2DBK A;  4EIK A;  1VQ8 Q;  2XDD A;  3G4S A;  5ECA A;  1M27 C;  2KXD A;  3TCJ A;  4V2S A;  1UTI A;  3Q1J A;  2M9U A;  3CD6 Q;  4L6V 5;  4C8Q A;  3AT1 B;  1ZA2 B;  1JU5 C;  1WHH A;  1NPP A;  2RJD A;  2RQT A;  3TSW A;  4M75 B;  2F2V A;  2V26 A;  3CC7 A;  3QJY A;  4KGZ B;  4M7A A;  2FVU A;  3JB9 D;  5CKF A;  2ED1 A;  1K76 A;  1WI7 A;  2XD0 A;  2BZY A;  2LQN A;  2EQM A;  2BZX A;  4CC2 A;  2PVG B;  2DD4 A;  4FCY A;  2EKH A;  1IZ6 A;  2DIG A;  2R5A A;  4IKF A;  3JCM d;  2QQA A;  1RLQ C;  5GAM g;  5HY6 A;  2QAS A;  2XIC A;  2NUZ A;  5GAN d;  1KQS S;  2QQR A;  2GFU A;  2EYZ A;  4XAX B;  5GAM h;  2RHU A;  5GJW B;  2XU8 A;  1XQH A;  3CXC P;  1AWO A;  1WFW A;  1Y7X A;  3JB9 H;  2EWN A;  1ZHI A;  4NL2 A;  5KYU B;  3NTK A;  1CKB A;  1BYM A;  3MKD A;  5CVI A;  1TG0 A;  1Q82 R;  2OAU A;  2LJ0 A;  4M78 G;  2X4W A;  4FYW B;  3DLM A;  2SEM A;  3JRZ A;  4RG8 A;  1X43 A;  3KUF A;  5A0G A;  4XU2 A;  2MWO A;  3LH5 A;  1ZSG A;  4E47 A;  4R0K A;  5A0L A;  4JLG A;  1GRI A;  1X27 A;  1VQ9 Q;  2J7I A;  2PTK A;  2EKO A;  1Y0M A;  2RHI A;  4LUE A;  2EQI A;  3UDC A;  4BD3 A;  4M7D C;  2I0N A;  5D6X A;  3ZFJ A;  3X25 B;  2RK2 A;  4FYV B;  1YJN A;  2IVW A;  5LJ3 g;  4C5G A;  3QBY A;  4II1 A;  2Y4X A;  4JPB W;  3CPW P;  5FRO A;  3RDV A;  5LJ3 h;  1W2B P;  4XQ3 A;  3VS3 A;  3GBQ A;  3EFR A;  2R58 A;  4M78 F;  4HXJ A;  4DBH A;  2X3X D;  3GOX A;  5C6S A;  1WJR A;  4HA8 A;  5GAN 2;  2FEI A;  2MWP A;  2VC8 A;  1UB4 A;  2JTM A;  2K7A A;  4RTW A;  4PJO G;  2GQI A;  2RMO A;  5GAM e;  2O2O A;  1VQM Q;  2K57 A;  1BI0 A;  1YIT Q;  1QQJ A;  2D8J A;  2GF7 A;  1M4Z A;  4HCZ A;  3DB4 A;  4IUT A;  4MDX A;  5J26 A;  3M0S A;  2DTO A;  2KYM A;  3QSU A;  1JO8 A;  4M7D A;  3EGD A;  4HT9 A;  3M0R A;  2LTO A;  2XDB A;  1NE8 A;  2C0T A;  1NEB A;  1NPR A;  1VQ6 T;  2YUQ A;  3V7R A;  1M2V B;  1VQK A;  4O5V A;  3GF5 A;  2X4J A;  1VYU A;  4PL6 A;  1AD5 A;  1G3T A;  2CYZ B;  1S1N A;  1IXD A;  1M2O A;  1BCM A;  2RQW A;  5DM7 R;  2HSE B;  4PJO F;  2DTI A;  1V1C A;  1HK9 A;  5GAN 4;  5CKE A;  4J9I A;  3PIO A;  1GL5 A;  1QP3 A;  4BDY A;  1U3O A;  2RQR A;  1VQ4 A;  5LJ3 e;  2ZPH B;  4LDV A;  4M78 B;  1ZA1 B;  3MHX A;  1I5O B;  1WPY A;  1VQP Q;  1NEG A;  2LJ1 A;  3CCJ A;  1M90 C;  1HSQ A;  5IN1 A;  4C8Q D;  2RH2 A;  1M90 U;  4JLI A;  2DYB A;  2LRQ A;  1FX7 A;  2FB7 A;  4M7A D;  1JEG A;  1VOM A;  2JM8 A;  1D3B A;  1JB0 E;  2E5K A;  2RHY A;  2ABL A;  3NGP A;  1WGS A;  1QW1 A;  2DIL A;  1KG1 A;  1PC0 A;  1K9A A;  2NYS A;  2K3Y A;  4KT0 E;  3E9G A;  5GMK h;  1M1K C;  1M1F A;  2AZS A;  2K5F A;  2X3W D;  3M56 A;  3CC2 A;  2R57 A;  1GBR A;  2ZPE B;  4RKU E;  1M1K U;  4GBQ A;  2JS0 A;  3PMT A;  4M75 E;  4PJO B;  2KYB A;  2BUD A;  1YI2 T;  5IHI A;  1C0M A;  5I21 A;  2QA4 Q;  3CCU T;  2JMC A;  2V1R A;  3CCL T;  4BAC A;  4DOV A;  5GMK m;  2KAF A;  4OMO A;  3NMZ C;  2H3E B;  1W4S A;  4B6M A;  1KHC A;  3G71 A;  3HSB A;  1ZUY A;  1G8X A;  3A1P A;  4Z02 A;  2C06 A;  1X01 A;  4C5H A;  2KVQ G;  3JB9 J;  3M57 A;  2L0A A;  4XTY A;  1NLO C;  2VUB A;  4GLM A;  1UGQ B;  2C0O A;  2ZPG B;  2CT3 A;  2PVD B;  2KT8 A;  3TVT A;  3DKM A;  2O01 E;  1AEY A;  4M75 C;  1ZLM A;  2EGA A;  4IUV A;  1N9R A;  3CCV T;  4J9D A;  4N0A C;  4DBQ A;  3J80 E;  5EC7 A;  2JZ2 A;  2P4T A;  4MDW A;  2DVJ A;  1WNL A;  2DL4 A;  4LE9 A;  4JZ4 A;  2KK4 A;  3CCR Q;  3JB9 I;  3UAT A;  1S72 T;  4GLK A;  5LJ5 j;  3RNJ A;  4PKC C;  3RES A;  1VUB A;  3VS0 A;  4R55 A;  2KR3 A;  3GNG A;  1UHC A;  4J7I A;  1YHQ Q;  3CPF A;  1VQO A;  3QDR B;  1MHN A;  2ROT A;  5GAN 6;  3CC4 A;  1RAD B;  2L3S A;  1TSF A;  1QCO A;  4PJN A;  2AKK A;  2L3R A;  4ZN1 A;  1YIJ T;  4BI3 A;  1R0B G;  2CP2 A;  4M75 A;  2QQS A;  2EVR A;  5A0D A;  2F5T X;  3M4G A;  2EIF A;  3QWY A;  1M3C A;  5GAM f;  1VQ8 A;  3QXE B;  1C1A A;  4N0A A;  3LH0 A;  1D0X A;  1ZBJ A;  2KQW A;  4ZN3 A;  4M7D D;  4ANJ A;  5I22 A;  3EG1 A;  1M8V A;  2COW A;  2X35 A;  2YRV A;  7AT1 B;  1MMD A;  5L8R E;  3TRE A;  3L2U A;  2KY9 A;  2KXC A;  2GNC A;  1E6H A;  4L59 A;  2A0F B;  4PK4 A;  3X24 B;  3G6E T;  3M4Y A;  2CSI A;  2EJ9 A;  4ATO A;  5KYX B;  3CMA Q;  5KE2 A;  2HQE A;  5GAN 8;  3R6O A;  3O5Z A;  4J6W A;  3ZBD A;  5KYU A;  5I2M A;  1J3T A;  2CP6 A;  4M4Z A;  4AFU C;  3SWN B;  1WIE A;  1P92 A;  1QKW A;  1WQ7 A;  2LC4 A;  4HCB A;  2VYT A;  4MZM A;  2X4X A;  1G3S A;  2RI2 A;  2KSS A;  4EPC A;  1I8F A;  3OS5 A;  5FU6 B;  4WF2 A;  5LJ3 f;  2HKN A;  2M0Y A;  1SHF A;  1Y71 A;  2MYS A;  5EG2 A;  2O88 A;  1BCO A;  2DRK A;  4OML A;  2QEX Q;  2L3P A;  4LD6 A;  3PNW C;  4RMO A;  2D9T A;  2LP5 A;  1WA7 A;  2J06 A;  2K6D A;  3ASK A;  2RI5 A;  2LQK A;  1UUE A;  1D0Z A;  1M3A A;  3S3M A;  4M78 E;  4KGX B;  5GMK i;  4A63 B;  2CP3 A;  4RTZ A;  2DXT A;  3C95 A;  2DXU A;  2RJC A;  3I55 Q;  3JCM P;  2FRY A;  4OB0 B;  4Z8A A;  3FIF A;  1FMW A;  2Y90 A;  3C12 A;  4F7U G;  4QQG A;  1Q7Y U;  4PFP A;  3F70 A;  1SRL A;  3JCM V;  1AWX A;  2FRW A;  2VB6 A;  2QYZ A;  4M77 F;  1KIK A;  3SFM A;  1UEC A;  1JQQ A;  2K4Y A;  4M78 C;  3EG2 A;  4OGE A;  2NUP B;  5HK0 A;  1WLP B;  4BDZ A;  1MMA A;  3OBY A;  2OTJ T;  2CUB A;  5I2S A;  2DBM A;  3RIR A;  1UEB A;  3OSV A;  1YIT A;  3VS6 A;  3PVL A;  1M2V A;  3LGF A;  1YJW A;  4HT8 A;  4PJO E;  2M16 A;  4O6J A;  1PG5 B;  3MEU A;  2L8D A;  2KI7 A;  2RJF A;  1VQ6 Q;  4F7U F;  2YLC A;  2K9G A;  5I11 A;  1PRL C;  3A8M B;  3M53 A;  1I4K 1;  2V1Q A;  2PZ1 A;  3UPU A;  2HCK A;  4B9X A;  1GCQ C;  3PGG A;  3CCQ Q;  3J7A F;  3OYJ A;  1KFZ A;  3CCM A;  1M90 R;  2GFA A;  4M78 A;  1JRI A;  2M1H A;  2DRM A;  2M02 A;  4PJO C;  1LVK A;  2HQX A;  1M8M A;  3CXC A;  4ZTF A;  1T0H A;  2PQW A;  4J9E A;  4ZGE B;  1QWE A;  3CBP A;  1I0C A;  2QK0 A;  4M77 B;  2EPD A;  3HFN A;  3CCS A;  3L2V A;  4M75 D;  1YJ9 T;  1O75 A;  4FT2 A;  4AFZ C;  2QG9 B;  2V8K A;  1JJ2 P;  3CXC S;  3H0H A;  2XDP A;  1M1K R;  3JCM Q;  3C94 A;  1GCQ A;  1SPK A;  2V8J A;  3NFC A;  4X9D A;  4DA4 A;  2COY A;  3RR6 A;  3L1A A;  4F7U B;  4KRT A;  1VQL Q;  1VQN T;  1XNI A;  4PJO A;  3LLR A;  3CPW A;  2YUO A;  1X6O A;  4LDX A;  2ZPF B;  2E4H A;  1KD1 U;  2V8I A;  2W0Z A;  2DEQ A;  1X6B A;  1RAE B;  2VXE A;  1YI2 Q;  1JBM A;  1G3W A;  3CCU Q;  3G4S T;  3M0U A;  5LJ5 e;  1PHT A;  2RK1 A;  3L2Z A;  2MCN A;  1M5Q 1;  3CPW S;  1BIB A;  2YXY A;  2MI6 A;  5GAN 7;  3HRS A;  1W2B S;  2QA4 A;  3A5Z B;  2LNH B;  1PD0 A;  3QHS A;  4AG2 C;  3UA6 A;  3CC7 T;  3A98 A;  3H0F A;  2VKN A;  2KGT A;  1UGV A;  3VRZ A;  2CSQ A;  2H3J A;  4JS4 A;  3HHT B;  3EG3 A;  4GY5 A;  3GIB A;  1D09 B;  1RAF B;  3HFO A;  3RUX A;  1KQ2 A;  2DZ9 A;  4KH1 B;  4EMH A;  1QP2 A;  2D8H A;  1OU9 A;  2HBW A;  5CQX A;  2E1H A;  1I81 A;  5GAO p;  2P0K A;  1KC8 U;  3A8O B;  3I35 A;  1UGP B;  4RG2 A;  2XG8 D;  2BE7 D;  3GPL A;  3CCR A;  2KMT A;  4C92 F;  2DET A;  2FPE A;  4E2F B;  5CR2 A;  1OX8 A;  2VWF A;  3SWN C;  1BI3 A;  2K79 A;  2NUT B;  1YHQ A;  3V8L A;  1YIJ Q;  5FU6 C;  3V7S A;  3MEW A;  1FWZ A;  2HQH A;  3EHR A;  3JCM e;  2ZGW A;  2JTE A;  4A4E A;  1UHF A;  4Q5W A;  5GMK j;  5GAN e;  1VQ5 Q;  4FT4 A;  2DD5 A;  2ATC B;  3ZL7 C;  1YJN T;  8AT1 B;  1G3Y A;  2HDA A;  1OEB A;  2DE0 X;  2D0N A;  1H64 1;  1UGS B;  5KYX A;  3M9Q A;  2QDL A;  3MP1 A;  3FDR A;  5DLQ E;  3SWN A;  4M78 D;  2DVE A;  3VUB A;  4A4K A;  2QI2 A;  1K8A U;  2CZ1 B;  1WHK A;  2BTT A;  4OMF B;  1RL2 A;  1JXM A;  2DL5 A;  5CKB A;  5IH2 A;  4C92 B;  3BW1 A;  2RHZ A;  5DY9 A;  4YTL A;  3CBO A;  2DXB A;  3CMA A;  1LJO A;  1MGQ A;  3A8G B;  2HL5 C;  1IB8 A;  1Q86 U;  1AT1 B;  2O9S A;  4FYY B;  2LMJ A;  1M30 A;  1HJD A;  4EDU A;  2QQB A;  2QTV A;  4IIO A;  2A7Y A;  1VQK T;  2COZ A;  1Q7Y R;  4XK8 E;  2OX7 A;  4E7H A;  2QEX A;  4Z88 A;  3SHW A;  4M77 E;  4LDU A;  5GAM d;  2O9V A;  4PJO D;  4AG1 C;  5GMK l;  1TH7 A;  2D6F A;  2BKD N;  2DM1 A;  3ME9 A;  5FWB A;  3E1S A;  4PJM A;  5GAO n;  4JRQ A;  1VQ4 T;  1Q81 U;  1BI1 A;  2X51 A;  3I55 A;  1SEM A;  2NUP A;  2J05 A;  2QQ9 A;  2X4Y A;  1BI2 A;  3VS5 A;  5D7U A;  5KYN A;  1VYT A;  4LXC A;  2HKQ B;  2P0Q A;  3CCJ T;  2JT4 A;  2SRC A;  5GAN 3;  4ESR A;  3M54 A;  1MV0 B;  2DNU A;  1B07 A;  1QVP A;  3SEM A;  4F7U E;  2KEA A;  4EMK B;  3THK A;  1GBQ A;  3JV3 A;  3TQ7 P;  3HKS A;  5CKH A;  3VV0 A;  2EBP A;  4QQ6 A;  2YRD A;  2LCL A;  1D0Y A;  3RMS A;  3EFS A;  4AFS C;  4BE2 A;  1TUG B;  4P5N A;  2YUN A;  4RCB A;  1OZ2 A;  1X2K A;  4CC7 A;  4IIM A;  1UJ0 A;  4OVA A;  5LJ3 d;  1NG2 A;  5AYF A;  2DKG A;  2E3I A;  4X9C A;  4E7I A;  2ENM A;  4C0Z A;  1VQ7 A;  4ORZ A;  5GAO l;  1D1A A;  3CC2 T;  3DLL A;  1K9M U;  2KT1 A;  3OMG A;  4HCK A;  1TWB A;  1WX6 A;  1XOV A;  4IUQ A;  1AWJ A;  2FO0 A;  3CCQ A;  3G71 T;  3OBW A;  4A54 A;  1WXU A;  2G3R A;  5FU7 B;  2DAQ A;  4LD9 K;  1YNZ A;  2LCS A;  3EAE A;  1U5S A;  2WSE E;  1Z9Z A;  4FL6 A;  1RI9 A;  3CCE A;  1E6G A;  2RA2 A;  4QQD A;  1UGR B;  4A4G A;  2L2P A;  1KD1 R;  2E5Q A;  2XMF A;  1IO6 A;  4J6X A;  2JNG A;  3VU3 C;  1NZ9 A;  4MZP A;  1OZ3 A;  1WDX A;  2K2M A;  3CME Q;  4F7U A;  3CEY A;  2DER A;  2DLP A;  3FRN A;  1QCN A;  3LGL A;  1N8R U;  2DZC A;  1C6V X;  2A08 A;  3RKY A;  5GAN 5;  3QPH A;  2OI3 A;  3I56 Q;  2RF0 A;  1VQO T;  1UG1 A;  2OTL Q;  4NOY A;  3MP8 A;  2JTF A;  4OF1 A;  3CC4 T;  1VQL A;  3EFO A;  1T0J A;  1YWP A;  2LT1 A;  2YT6 A;  1FMV A;  3G4S Q;  1IHW A;  2DJQ A;  5CCA A;  3QUI A;  4XTV A;  2HAX A;  2QAZ A;  3M59 A;  4MZT A;  2LX7 A;  2LX9 A;  1VQ8 T;  2IPO B;  5IHN A;  5HK3 A;  1M3B A;  2AZV A;  2ED0 A;  3BFM A;  1JXO A;  3OA6 A;  2D0Q B;  1KC8 R;  3H6Z A;  4HKE A;  2KRO A;  1OI1 A;  4J9G A;  4LNP A;  3V8K A;  3H41 A;  3VS7 A;  2CH4 W;  4X34 A;  1EFN A;  3P8B B;  4RTU A;  2JXB A;  2KRN A;  2DXC A;  1EX4 A;  1ZX6 A;  1BIA A;  2LVM A;  1WHM A;  4C92 E;  2JS2 A;  3G1J A;  4J8O A;  3VYH B;  4BI8 B;  1RAH B;  2PUK B;  2EQJ A;  2JMA A;  3VS1 A;  3CD6 A;  2HNI A;  1SF9 A;  4RCC A;  2VXF A;  3S6W A;  2A3L A;  3QDF A;  1Y96 B;  1PSE A;  2QXF A;  2D1X A;  3MP6 A;  1NYG A;  4F04 B;  2NUT A;  4JDS A;  2FL7 A;  1WHG A;  4JJN K;  1ZUU A;  4HVW A;  5CK9 A;  4XTX A;  1M1G A;  3PTA A;  3RKW A;  2E70 A;  1JJ2 A;  4PFO A;  2GQV A;  3P8H A;  3MEV A;  1K73 C;  3MEA A;  2JW4 A;  4PJL A;  3I9Q A;  4OB3 B;  2LDM A;  1RAC B;  5FLX E;  2P0P A;  1K73 U;  3A8L B;  3BY7 A;  3LW5 E;  4CI0 C;  2MPX C;  1AHJ B;  4LN2 A;  1U06 A;  3IQL A;  4J9B A;  1G2B A;  1K8A R;  1JJ2 S;  1N5Z A;  1IHV A;  2RD1 A;  4M7D F;  1YJN Q;  1M9S A;  3LYI A;  1VQ5 A;  2F1L A;  4M77 G;  3VRY A;  1BU1 A;  2RB6 A;  1V76 A;  5KYW B;  1W6X A;  3P8D A;  3EG9 B;  1FXX A;  1Q86 R;  4JUV A;  2HMA A;  1RAB B;  2P84 A;  2EGC A;  3CQT A;  2RPN A;  1UDL A;  2F2W A;  2EYY A;  2YHT A;  2FPF A;  3O8V A;  4X1V A;  1KJW A;  2MAM A;  1OV3 A;  1BBZ A;  4F14 A;  1SSH A;  2JOY A;  2DYI A;  4OB1 B;  2DX1 A;  1VQ9 A;  3CBM A;  1B7T A;  2AT1 B;  1A0N B;  1Q7Y C;  2AIR B;  4E7J A;  1YIT T;  3SDZ A;  1YJW T;  2EYQ A;  1K4U S;  2PUO B;  2DFU A;  4HCC A;  3KXT A;  1N6A A;  1R0C B;  4N4I A;  2XI9 A;  1WJQ A;  1OPL A;  1YCY A;  1HYO A;  2LT4 A;  4KGV B;  1VIE A;  1KSW A;  3UA7 A;  1MV3 A;  2NLU A;  2G6F X;  2YSQ A;  4DBR A;  3QZ5 B;  4M7D B;  4C0F A;  3CCM T;  1VQM A;  4BUG A;  2PVO B;  2K5I A;  4JRK A;  1Z9Q A;  2E6N A;  1QVF P;  3M0P A;  1SHG A;  1VQ4 Q;  2EJG A;  1EIF A;  2HD0 A;  4IUP A;  5GAM j;  2LQW A;  3M0T A;  4BI4 A;  3VS4 A;  2F69 A;  3OS0 A;  5CO7 A;  1QLY A;  1V29 B;  3CCS T;  3JCM W;  1WHJ A;  3CCJ Q;  1IGU A;  1PCX A;  2K5L A;  5FU7 C;  1W70 A;  5LJ5 g;  1Y57 A;  1PD1 A;  1XTD A;  3FJP A;  5LJ5 h;  1K9M R;  4LDW A;  4D8D A;  1D1C A;  2NWM A;  2RQU A;  5M9O A;  1D1B A;  4ELY C;  1H3H A;  4NS5 A;  2EFI A;  1VQP A;  3PMI A;  2E3H A;  3MPU B;  2LCC A;  1T3L A;  4RTT A;  4XU0 A;  1RAA B;  5LJ3 j;  2VGN A;  2E64 A;  2WSC E;  4QKU A;  4J9H A;  2LZ6 B;  1HXD A;  4EMG A;  1ZSZ B;  3OYH A;  2QA4 T;  5CAI A;  3OYA A;  2MMP A;  1KD1 C;  4ZTJ A;  4PNO A;  1YWO A;  2VVK A;  3UWN A;  5IXB A;  5HKC A;  2CUD A;  4BB7 A;  3PT9 A;  1OUL A;  3RKX A;  4BE0 A;  1N8R R;  5CKD A;  3VKI A;  1OU8 A;  5CQY A;  3WXM B;  4LDY A;  2VV5 A;  4K11 A;  3E9F A;  2J6F A;  4FSX A;  1NJI U;  2CP7 A;  3CCL Q;  2W10 A;  2E41 A;  5J39 A;  3JCM g;  1VYV A;  4WCI A;  5GAN g;  4OGC A;  3JCM h;  2XID A;  4C5E A;  2RNA A;  5GAN h;  3QII A;  2CP5 A;  4C92 G;  3WVE B;  1ABO A;  1WXT A;  4E7Z A;  2RI3 A;  3CME A;  1ZUK A;  1Y07 A;  2B8A A;  5FWC A;  3OW2 A;  4BE1 A;  2FZG B;  5GAO r;  1MND A;  1E7O A;  3CCR T;  3E2U A;  4E7L A;  3CCV Q;  1NBE B;  3LWI A;  2F2X A;  1RUW A;  1UJY A;  3I56 A;  1YHQ T;  1KC8 C;  1WHL A;  2OTL A;  1HD3 A;  2EQK A;  2E12 A;  1S72 Q;  3OS2 A;  1YFN A;  1TTH B;  2LNV A;  5C0M A;  1ACM B;  2JVV A;  3I5R A;  3JB9 G;  1X75 C;  5KYY B;  3GNF B;  3OQ5 A;  2FZC B;  2OJ2 A;  4ELZ C;  1R77 A;  1QVG P;  3FEO A;  3A8H B;  4IUU A;  2DK3 A;  1RLP C;  2MK5 A;  1KQS A;  4MML A;  5FRN A;  3EH2 A;  3MJX A;  1GCP A;  4C0G A;  1Y96 A;  3JSC A;  3H9N A;  2CZ0 B;  2M0O A;  4A53 A;  4NL3 A;  4E6R A;  2ZCF B;  4AFQ C;  2H8H A;  2CKK A;  3WVD B;  1K73 R;  3JB9 F;  4J9C A;  1LNX A;  3MET A;  3CMA T;  1UFF A;  1LPL A;  1O9S A;  3BDU A;  3OYD A;  2FYK A;  1IRE B;  2PNI A;  5FW9 A;  2HBP A;  4XTU A;  1KHI A;  4PFZ A;  3G6E Q;  4M7D E;  1K8A C;  3R6N A;  2ZPI B;  1I1J A;  1WZO A;  2DO3 A;  3TSZ A;  3URG A;  1G83 A;  1U8R A;  2EYX A;  3OYM A;  4KUI A;  1GXI E;  2WSF E;  3QWX X;  5KCO A;  4ZNX A;  3JCM J;  2CH4 A;  1RAI B;  4PJJ A;  2QEX T;  1BK2 A;  3OYL A;  4CC4 B;  1Q86 C;  1H8K A;  2ZPB B;  4OMN A;  5GAO q;  1SG5 A;  5KYW A;  1NYF A;  5L23 A;  3EG9 A;  3OYC A;  2J6K A;  5IAY A;  2FZK B;  3I55 T;  3GP8 A;  1PSF A;  2GTJ A;  2B86 A;  4HVV A;  3G7Z A;  1MNE A;  2RJE A;  6AT1 B;  1UE9 A;  1Q81 C;  4QVC A;  3HPW A;  2BIV A;  2GTO A;  2YRC A;  4E7K A;  1OYX A;  3OW2 P;  5IHK A;  4OB2 B;  1KK7 A;  1X2Q A;  1YJW Q;  2CT4 A;  4C5I A;  9ATC B;  4JRI A;  4FW1 A;  3X26 B;  2DMO A;  3S3O A;  2KBT A;  4KBM B;  2E10 A;  4M77 C;  1VQ7 T;  3D7S B;  1FYN A;  5LJ5 f;  1K0X A;  2OTJ Q;  3KBG A;  1U1T A;  1CSK A;  1SSF A;  3CCM Q;  1K1Z A;  1MUZ A;  3BE3 A;  2LJ3 A;  4JJB A;  3JCM b;  2DJZ A;  4PLL A;  3CCQ T;  3H8Z A;  1YP5 A;  2EW3 A;  2KNB B;  1K9M C;  4CC3 A;  2EYW A;  5KH6 A;  3VUZ A;  2CDT A;  2E6Z A;  3OYE A;  2BZ8 A;  1ZSZ C;  2KDS A;  4C8Q G;  3CCS Q;  1PWT A;  1KQS P;  3CCE T;  1VQ6 A;  1WJS A;  1N9S A;  3U23 A;  4FSS A;  4M7A G;  2GCX A;  2AKL A;  2JM9 A;  1B34 B;  3N5B B;  1U1S A;  1AVZ C;  4M77 A;  4AMC A;  4XU3 A;  4Z89 A;  3EGX B;  5LL6 S;  2LQ8 A;  4JRP A;  3FJ5 A;  3RMQ A;  2RN8 A;  1QMC A;  1B3Q A;  2C0I A;  2I2L A;  2YWW A;  2O4X B;  1PKT A;  4RUG A;  1YJ9 Q;  3UF4 A;  5A2Q E;  4A4H A;  5GJV B;  3V8J A;  3E19 A;  3PIP A;  4C8Q F;  2YDL A;  1VQL T;  3C4S A;  1BB9 A;  1PRM C;  1ZSZ A;  2DEU A;  4HVU A;  1NJI R;  1N8R C;  3FLG A;  4M7A F;  2EJF A;  4FYX B;  3JCM f;  4KUL A;  1TS9 A;  3EH1 A;  1RI0 A;  2DL8 A;  3AHU A;  2FPD A;  5GAN f;  4JZ3 A;  2GGR A;  1WQW A;  2EGE A;  1VQN Q;  4D6W A;  3NHN A;  4RTV A;  2XK0 A;  2A28 A;  4OMQ A;  3L2W A;  3JCM X;  1SRM A;  2DTH A;  2IIM A;  3SD4 A;  1ZBX A;  4F16 A;  4CRI A;  3OY9 A;  2CP0 A;  4F17 A;  2JJ9 A;  3QJ6 A;  2OAW A;  3HRU A;  2E65 A;  3H0I A;  1YI2 A;  3CCU A;  3CCL A;  4Y91 A;  3OYY A;  3CC7 Q;  3M55 A;  4Y28 E;  5IT9 E;  3CD6 T;  1TUD A;  2KE9 A;  4R56 A;  1QVF A;  4TVR A;  1AWW A;  2CZ7 B;  2F5K A;  2PU9 B;  1XJW B;  3NTI A;  3NPF A;  4C8Q B;  2DA9 A;  1AOJ A;  3ZEH A;  4AT1 B;  5HCK A;  3JCM c;  4C0D B;  5GMK e;  3M58 A;  4XU1 A;  4M7A B;  4J7F A;  5GAO m;  1QVF S;  2Z0W A;  2WAC A;  1YBY A;  1ZQ1 A;  5KYY A;  3CCV A;  2QGF B;  1W1F A;  4BY6 B;  2QDY B;  4OMM A;  4M7D G;  2JUF A;  2J6O A;  1MMG A;  3INZ A;  3C0C A;  5J3B A;  4JS5 A;  1OQK A;  4OP0 A;  1S72 A;  1SKU B;  3QKJ A;  1Q95 G;  2AHJ B;  3GLX A;  1QKX A;  2KRM A;  1G5V A;  1CKA A;  2AK5 A;  1VQ5 T;  3V7C A;  4C92 C;  4VUB A;  4QVZ A;  3HTR A;  4Y92 A;  3X28 B;  2K3B A;  4FIB A;  3SB2 A;  1BKB A;  4PLI A;  3J81 E;  1IGQ A;  1X69 A;  1YIJ A;  1IRX A;  3EGU A;  5IXF A;  2L3Q A;  8ATC B;  4A4F A;  2RO0 A;  5KCH A;  4XTZ A;  1T3S A;  2YLB A;  3QYG B;  1VQ9 T;  2MOX A;  2A36 A;  1Q82 C;  1AZG B;  4IUR A;  3PE0 A;  1TXQ A;  1Q82 U;  5FRM A;  5KE3 A;  4ZGD B;  2ZAE A;  2ZZD A;  3PFS A;  4WTO B;  5DLO A;  2VAS A;  5CIU A;  5GAN j;  3JAM E;  4C92 A;  4J9F A;  4M77 D;  1TU0 B;  3S3N A;  3REA B;  3OMC A;  2QGG A;  3G6E A;  2DF6 A;  3OYF A;  2DPP B;  1OOT A;  1VIF A;  1H3Z A;  1VQM T;  2RHX A;  4E7S A;  2ESW A;  4EMK C;  1X6G A;  1EZZ B;  2L89 A;  1Q81 R;  1PNJ A;  1VQK Q;  2L5Q A;  2HL3 A;  4QVD A;  1FMK A;  4RTY A;  4L5G A;  3RBB B;  4FM4 B;  2CRE A;  4JJD A;  4QW2 A;  1N27 A;  4ZGJ B;  4DOW A;  2R5M A;  3MO8 A;  3EGD B;  3UT1 A;  4QT7 A;  4D8K A;  4KUD K;  5AT1 B;  3X20 B;  3EG0 A;  4RTX A;  3VJP A;  1NLP C;  2RM4 A;  3NTH A;  3QG1 A;  1QVG A;  3VS2 A;  3HP9 A;  4DEX A;  1I5L A;  3M5A A;  1KQ1 A;  4J5Y A;  4EMK A;  3QO3 A;  1TOV A;  2DL7 A;  2P4R A;  3FB9 A;  1NM7 A;  1PM3 A;  2CZ6 B;  1VQP T;  1VQ7 Q;  3KFV A;  3MCA B;  2MIO A;  1PKS A;  4XTW A;  1QVG S;  2CS7 A;  4OMP A;  3M0Q A;  2BE9 B;  5D6Y A;  2M51 A;  3REB B;  1WYX A;  3OYI A;  1OPK A;  3QYH B;  2OTJ A;  1WXB A;  1TUC A;  3LX7 A;  3OYK A;  2HEQ A;  1GFC A;  3L2R A;  4M75 G;  2XHC A;  3CC2 Q;  1F1B B;  2GBQ A;  3HL8 A;  4N4G A;  1D3B B;  1QCF A;  3CCE Q;  1B34 A;  1VA7 A;  1DJ7 B;  2DIQ A;  2VGM A;  3VYG A;  3EGX A;  3HRT A;  2FHD A;  2A37 A;  3I5S A;  4MMK A;  3G71 Q;  3OYN A;  4C8Q E;  1ABQ A;  3LWH A;  4N4H A;  4JJC A;  2O4X A;  2YUP A;  3OS1 A;  4DQ2 A; 
#chains in the Genus database with same CATH homology
 2QA4 Q;  1VQM Q;  1YIT Q;  1Q7Y R;  1YJW Q;  1YIJ Q;  1YJ9 Q;  3CCM Q;  1K73 R;  1K9M R;  1VQ4 Q;  3CC2 Q;  1QVF P;  1N8R R;  3I56 Q;  1K8A R;  1Q81 R;  1M1K R;  1VQ6 Q;  1VQN Q;  1VQP Q;  1VQK Q;  1S72 Q;  3CCE Q;  1YJN Q;  1YI2 Q;  1KD1 R;  1YHQ Q;  3CPW P;  3CC7 Q;  3I55 Q;  2OTL Q;  3CCU Q;  1W2B P;  1KC8 R;  1VQ8 Q;  1KQS P;  3CCL Q;  3CMA Q;  2QEX Q;  3CME Q;  3CCJ Q;  3CCQ Q;  3CXC P;  1VQO Q;  1VQ9 Q;  3G6E Q;  1NJI R;  3G4S Q;  1VQ5 Q;  3CD6 Q;  1VQL Q;  3G71 Q;  3CC4 Q;  3CCV Q;  1Q86 R;  3CCS Q;  1QVG P;  1JJ2 P;  3CCR Q;  2OTJ Q;  1M90 R;  1VQ7 Q;  3OW2 P;  1Q82 R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...