1Q8XA

Nmr structure of human cofilin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
166
structure length
166
Chain Sequence
MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of human cofilin: rationalizing actin binding and pH sensitivity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Cofilin, non-muscle isoform
total genus 27
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2003-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1q8xA00
2FF3A 1VKKA 4PKHB 5KYNA 1RGIG 4KEEA 1NPHA 2LXXA 2MV2A 3L50A 3EFOB 1PD1A 4PKIG 5DD2A 1CNUA 3EGXA 1AK6A 3FG6A 1SVYA 3A5NS 3Q2BA 5FAFA 3EH1A 1J72A 1WNJA 1YVNG 4BEX1 2FH2A 3A5LS 3EFOA 1SVRA 2VILA 1PCXA 1Q8GA 5KYWA 1AHQA 5FAEA 5KYWB 2MOTA 2W0IA 3TU5B 5HVKD 2QTVA 1T44G 1HQZ1 3FG7A 5KYUA 2I2QA 2NUPB 2NUPA 2LJ8A 1T3YA 3FFKA 1MDUA 4PKGG 1NMDG 4S10C 1V6FA 1PD0A 1F7SA 3FFNA 3EG9A 2L72A 2XFAA 3EGDB 1Q8XA 5HVKB 1EQYS 1CFYA 3EGXB 5KYYB 1D4XG 1KCQA 4JD2H 1TVJA 2FH3A 2MP4A 1M2VB 2NUTA 1P8XA 2HD7A 1P8ZG 2KVKA 1COFA 1UDMA 1X67A 1NLVG 4KEFA 1QPVA 1WM4A 2NUTB 3EH2A 1C0GS 2LLFA 2D8BA 1M2VA 5L6WC 1M2OA 4LIZA 5KYXB 3A5MS 4CBUG 3A5OS 2FF6G 1C0FS 5KYXA 5IVUA 2FGHA 1AK7A 1YAGG 2FH4A 3DAWB 3CJBG 2FH1A 1T2LA 4CBXG 4Z94G 1NM1G 1SVQA 1DEJS 5KYYA 1TMWA 4KEDA 5A1MA 1ESVS 1JHWA 1H1VG 5KYUB 2XF1A 3EG9B 1VFQA 1WFSA 2VACA 3EGDA 1D0NA 2VIKA 1M4JA 4CBWG 1T3XA 3CJCG 3CIPG 3CI5G
chains in the Genus database with same CATH superfamily
2FF3A 1VKKA 4PKHB 5KYNA 1RGIG 4KEEA 1NPHA 2LXXA 2MV2A 3L50A 3EFOB 1PD1A 4PKIG 5DD2A 1CNUA 3EGXA 1AK6A 3FG6A 1SVYA 3A5NS 3Q2BA 5FAFA 3EH1A 1J72A 1WNJA 1YVNG 4BEX1 2FH2A 3A5LS 3EFOA 1SVRA 2VILA 1PCXA 1Q8GA 5KYWA 1AHQA 5FAEA 5KYWB 2MOTA 2W0IA 3TU5B 5HVKD 2QTVA 1T44G 1HQZ1 3FG7A 5KYUA 2I2QA 2NUPB 2NUPA 2LJ8A 1T3YA 3FFKA 1MDUA 4PKGG 1NMDG 4S10C 1V6FA 1PD0A 1F7SA 3FFNA 3EG9A 2L72A 2XFAA 3EGDB 1Q8XA 5HVKB 1EQYS 1CFYA 3EGXB 5KYYB 1D4XG 1KCQA 4JD2H 1TVJA 2FH3A 2MP4A 1M2VB 2NUTA 1P8XA 2HD7A 1P8ZG 2KVKA 1COFA 1UDMA 1X67A 1NLVG 4KEFA 1QPVA 1WM4A 2NUTB 3EH2A 1C0GS 2LLFA 2D8BA 1M2VA 5L6WC 1M2OA 4LIZA 5KYXB 3A5MS 4CBUG 3A5OS 2FF6G 1C0FS 5KYXA 5IVUA 2FGHA 1AK7A 1YAGG 2FH4A 3DAWB 3CJBG 2FH1A 3DA7A 1T2LA 4CBXG 4Z94G 1NM1G 1SVQA 1DEJS 5KYYA 1TMWA 4KEDA 5A1MA 1ESVS 1JHWA 1H1VG 5KYUB 2XF1A 3EG9B 1VFQA 1WFSA 2VACA 3EGDA 1D0NA 2VIKA 1M4JA 4CBWG 1T3XA 3CJCG 3CIPG 3CI5G
chains in the Genus database with same CATH topology
2FF3A 1VKKA 4PKHB 5KYNA 1RGIG 4KEEA 1NPHA 2LXXA 2MV2A 3L50A 3EFOB 1PD1A 4PKIG 5DD2A 1CNUA 3EGXA 1AK6A 3FG6A 1SVYA 3A5NS 3Q2BA 5FAFA 3EH1A 1J72A 1WNJA 1YVNG 4BEX1 2FH2A 3A5LS 3EFOA 1SVRA 2VILA 1PCXA 1Q8GA 5KYWA 1AHQA 5FAEA 5KYWB 2MOTA 2W0IA 3TU5B 5HVKD 2QTVA 1T44G 1HQZ1 3FG7A 5KYUA 2I2QA 2NUPB 2NUPA 2LJ8A 1T3YA 3FFKA 1MDUA 4PKGG 1NMDG 4S10C 1V6FA 1PD0A 1F7SA 3FFNA 3EG9A 2L72A 2XFAA 3EGDB 1Q8XA 5HVKB 1EQYS 1CFYA 3EGXB 5KYYB 1D4XG 1KCQA 4JD2H 1TVJA 2FH3A 2MP4A 1M2VB 2NUTA 1P8XA 2HD7A 1P8ZG 2KVKA 1COFA 1UDMA 1X67A 1NLVG 4KEFA 1QPVA 1WM4A 2NUTB 3EH2A 1C0GS 2LLFA 2D8BA 1M2VA 5L6WC 1M2OA 4LIZA 5KYXB 3A5MS 4CBUG 3A5OS 2FF6G 1C0FS 5KYXA 5IVUA 2FGHA 1AK7A 1YAGG 2FH4A 3DAWB 3CJBG 2FH1A 3DA7A 1T2LA 4CBXG 4Z94G 1NM1G 1SVQA 1DEJS 5KYYA 1TMWA 4KEDA 5A1MA 1ESVS 1JHWA 1H1VG 5KYUB 2XF1A 3EG9B 1VFQA 1WFSA 2VACA 3EGDA 1D0NA 2VIKA 1M4JA 4CBWG 1T3XA 3CJCG 3CIPG 3CI5G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FF3 A;  1VKK A;  4PKH B;  5KYN A;  1RGI G;  4KEE A;  1NPH A;  2LXX A;  2MV2 A;  3L50 A;  3EFO B;  1PD1 A;  4PKI G;  5DD2 A;  1CNU A;  3EGX A;  1AK6 A;  3FG6 A;  1SVY A;  3A5N S;  3Q2B A;  5FAF A;  3EH1 A;  1J72 A;  1WNJ A;  1YVN G;  4BEX 1;  2FH2 A;  3A5L S;  3EFO A;  1SVR A;  2VIL A;  1PCX A;  1Q8G A;  5KYW A;  1AHQ A;  5FAE A;  5KYW B;  2MOT A;  2W0I A;  3TU5 B;  5HVK D;  2QTV A;  1T44 G;  1HQZ 1;  3FG7 A;  5KYU A;  2I2Q A;  2NUP B;  2NUP A;  2LJ8 A;  1T3Y A;  3FFK A;  1MDU A;  4PKG G;  1NMD G;  4S10 C;  1V6F A;  1PD0 A;  1F7S A;  3FFN A;  3EG9 A;  2L72 A;  2XFA A;  3EGD B;  1Q8X A;  5HVK B;  1EQY S;  1CFY A;  3EGX B;  5KYY B;  1D4X G;  1KCQ A;  4JD2 H;  1TVJ A;  2FH3 A;  2MP4 A;  1M2V B;  2NUT A;  1P8X A;  2HD7 A;  1P8Z G;  2KVK A;  1COF A;  1UDM A;  1X67 A;  1NLV G;  4KEF A;  1QPV A;  1WM4 A;  2NUT B;  3EH2 A;  1C0G S;  2LLF A;  2D8B A;  1M2V A;  5L6W C;  1M2O A;  4LIZ A;  5KYX B;  3A5M S;  4CBU G;  3A5O S;  2FF6 G;  1C0F S;  5KYX A;  5IVU A;  2FGH A;  1AK7 A;  1YAG G;  2FH4 A;  3DAW B;  3CJB G;  2FH1 A;  1T2L A;  4CBX G;  4Z94 G;  1NM1 G;  1SVQ A;  1DEJ S;  5KYY A;  1TMW A;  4KED A;  5A1M A;  1ESV S;  1JHW A;  1H1V G;  5KYU B;  2XF1 A;  3EG9 B;  1VFQ A;  1WFS A;  2VAC A;  3EGD A;  1D0N A;  2VIK A;  1M4J A;  4CBW G;  1T3X A;  3CJC G;  3CIP G;  3CI5 G; 
#chains in the Genus database with same CATH topology
 2FF3 A;  1VKK A;  4PKH B;  5KYN A;  1RGI G;  4KEE A;  1NPH A;  2LXX A;  2MV2 A;  3L50 A;  3EFO B;  1PD1 A;  4PKI G;  5DD2 A;  1CNU A;  3EGX A;  1AK6 A;  3FG6 A;  1SVY A;  3A5N S;  3Q2B A;  5FAF A;  3EH1 A;  1J72 A;  1WNJ A;  1YVN G;  4BEX 1;  2FH2 A;  3A5L S;  3EFO A;  1SVR A;  2VIL A;  1PCX A;  1Q8G A;  5KYW A;  1AHQ A;  5FAE A;  5KYW B;  2MOT A;  2W0I A;  3TU5 B;  5HVK D;  2QTV A;  1T44 G;  1HQZ 1;  3FG7 A;  5KYU A;  2I2Q A;  2NUP B;  2NUP A;  2LJ8 A;  1T3Y A;  3FFK A;  1MDU A;  4PKG G;  1NMD G;  4S10 C;  1V6F A;  1PD0 A;  1F7S A;  3FFN A;  3EG9 A;  2L72 A;  2XFA A;  3EGD B;  1Q8X A;  5HVK B;  1EQY S;  1CFY A;  3EGX B;  5KYY B;  1D4X G;  1KCQ A;  4JD2 H;  1TVJ A;  2FH3 A;  2MP4 A;  1M2V B;  2NUT A;  1P8X A;  2HD7 A;  1P8Z G;  2KVK A;  1COF A;  1UDM A;  1X67 A;  1NLV G;  4KEF A;  1QPV A;  1WM4 A;  2NUT B;  3EH2 A;  1C0G S;  2LLF A;  2D8B A;  1M2V A;  5L6W C;  1M2O A;  4LIZ A;  5KYX B;  3A5M S;  4CBU G;  3A5O S;  2FF6 G;  1C0F S;  5KYX A;  5IVU A;  2FGH A;  1AK7 A;  1YAG G;  2FH4 A;  3DAW B;  3CJB G;  2FH1 A;  3DA7 A;  1T2L A;  4CBX G;  4Z94 G;  1NM1 G;  1SVQ A;  1DEJ S;  5KYY A;  1TMW A;  4KED A;  5A1M A;  1ESV S;  1JHW A;  1H1V G;  5KYU B;  2XF1 A;  3EG9 B;  1VFQ A;  1WFS A;  2VAC A;  3EGD A;  1D0N A;  2VIK A;  1M4J A;  4CBW G;  1T3X A;  3CJC G;  3CIP G;  3CI5 G; 
#chains in the Genus database with same CATH homology
 2FF3 A;  1VKK A;  4PKH B;  5KYN A;  1RGI G;  4KEE A;  1NPH A;  2LXX A;  2MV2 A;  3L50 A;  3EFO B;  1PD1 A;  4PKI G;  5DD2 A;  1CNU A;  3EGX A;  1AK6 A;  3FG6 A;  1SVY A;  3A5N S;  3Q2B A;  5FAF A;  3EH1 A;  1J72 A;  1WNJ A;  1YVN G;  4BEX 1;  2FH2 A;  3A5L S;  3EFO A;  1SVR A;  2VIL A;  1PCX A;  1Q8G A;  5KYW A;  1AHQ A;  5FAE A;  5KYW B;  2MOT A;  2W0I A;  3TU5 B;  5HVK D;  2QTV A;  1T44 G;  1HQZ 1;  3FG7 A;  5KYU A;  2I2Q A;  2NUP B;  2NUP A;  2LJ8 A;  1T3Y A;  3FFK A;  1MDU A;  4PKG G;  1NMD G;  4S10 C;  1V6F A;  1PD0 A;  1F7S A;  3FFN A;  3EG9 A;  2L72 A;  2XFA A;  3EGD B;  1Q8X A;  5HVK B;  1EQY S;  1CFY A;  3EGX B;  5KYY B;  1D4X G;  1KCQ A;  4JD2 H;  1TVJ A;  2FH3 A;  2MP4 A;  1M2V B;  2NUT A;  1P8X A;  2HD7 A;  1P8Z G;  2KVK A;  1COF A;  1UDM A;  1X67 A;  1NLV G;  4KEF A;  1QPV A;  1WM4 A;  2NUT B;  3EH2 A;  1C0G S;  2LLF A;  2D8B A;  1M2V A;  5L6W C;  1M2O A;  4LIZ A;  5KYX B;  3A5M S;  4CBU G;  3A5O S;  2FF6 G;  1C0F S;  5KYX A;  5IVU A;  2FGH A;  1AK7 A;  1YAG G;  2FH4 A;  3DAW B;  3CJB G;  2FH1 A;  3DA7 A;  1T2L A;  4CBX G;  4Z94 G;  1NM1 G;  1SVQ A;  1DEJ S;  5KYY A;  1TMW A;  4KED A;  5A1M A;  1ESV S;  1JHW A;  1H1V G;  5KYU B;  2XF1 A;  3EG9 B;  1VFQ A;  1WFS A;  2VAC A;  3EGD A;  1D0N A;  2VIK A;  1M4J A;  4CBW G;  1T3X A;  3CJC G;  3CIP G;  3CI5 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...