1Q90D

Structure of the cytochrome b6f (plastohydroquinone : plastocyanin oxidoreductase) from chlamydomonas reinhardtii
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
156
structure length
156
Chain Sequence
TKKPDLSDPVLKAKLAKGMGHNTYGEPAWPNDLLYMFPVVILGTFACVIGLSVLDPAAMGEPANPFATPLEILPEWYFYPVFQILRVVPNKLLGVLLMAAVPAGLITVPFIESINKFQNPYRRPIATILFLLGTLVAVWLGIGSTFPIDISLTLGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Atypical Haem in the Cytochrome B6F Complex
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Photosynthesis
molecule keywords Apocytochrome f
total genus 44
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2003-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 1q90D02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1q90D01
2YIUC 4H44B 2E75B 4Y28J 1S5LX 2FYNC 1JB0J 3C8VA 1Q90D 4PV1B 2WSCJ 4KT0J 2WPVB 2QJYC 2O01J 4OGQB 4I7ZB 1VF5B 4H0LB 2QJPC 5KKZC 2WSFJ 2ZT9B 2E74B 3LW5J 4RKUJ 1ZRTE 2QJKC 2WSEJ 2QSIA 2E76B 2K9YA 4IL6X 5L8RJ 5KLIC 4H13B 2QIWA 2D2CB
chains in the Genus database with same CATH superfamily
3H1JE 5FLXN 3CX5F 5CA1B 4XDKA 5LYJB 2HVJC 3F5TA 4E4EA 1KB9I 2HG5D 2JEEA 3ZHUA 4D6TH 1RSOA 3LSUA 4K8XA 4DV4O 2IH3C 4JAUA 1SQVK 2IU0A 3RK3D 2XNDG 2RCVA 3CCSP 1SQPG 1ZV8A 2WSSG 4JAVA 3TXSA 3CJHB 3LNNA 2PZSA 2YIBA 3RVZA 2P67A 1JY3O 1PPJE 1AA0A 3QG5A 1LT9C 2Y4TA 4PD4D 1Y74B 5H2FE 5D5PA 4UB8E 2B5UA 1ZW0A 2Q3IA 3MHHC 1EDJA 4HNAB 1G2CB 1KFMA 1M1KW 2AGAA 5KJ7D 2YI9A 4WVZA 2V4DA 2ZXWB 1NU1J 3O6QB 2YXYA 4JF7A 1HF9A 4LF5B 1ZTEA 1VQMV 3CWBJ 1K92A 2OTKE 2P5OA 2UXDO 4I6MC 3ZEDA 2YMYA 2X6BA 2ZFCA 3H1JJ 2E74D 4EYYQ 2OCCB 2QKSA 3EQ2A 4B7KA 4NPEA 1QLNA 5AW1B 2P90A 1X79B 2QM8A 4MVRA 4DV2B 4LF4O 1JTHB 4C7NB 4U3FE 5GTIH 4FK5C 3Q3DA 3N4XA 4PJ0E 1GRJA 4GX1A 5H5NA 2OCCC 3AE8C 1Q8IA 4ASVA 3B8EB 4MVUA 4TQFA 4R6ZA 2A7WA 3O8ZA 4AYCA 3CCEP 3DSQA 1GU4A 4B3TB 1VQ6V 2VWJA 4NXNB 4AI8A 2E5LO 3RL0C 2WQYC 2CGOA 4I9QA 3HE4B 2WSFH 4B3MB 3QO7A 1L0LK 2EINB 2FTKA 4JI5B 5TISH 4OWFA 4W7ZA 3FWNA 3P3NA 1IJDB 1NWQA 1L2PA 3E83A 3E8FA 1KQGB 3D71A 2OYHA 5B1AB 4H44D 1JPXA 2XT9A 2EINC 1Y76B 3AE2C 1YJNV 1HNZB 1IK9A 1WT6A 3A2AA 3WUTA 1LTJC 1JA8A 3H1LJ 2AEJA 2QWNB 3CCJV 1NU1D 2OIGA 1R3IC 4IHJA 4I5SA 2K9PA 2VQEO 2OTJV 1OVUA 2KUBA 4N6JA 1NZ6A 2UXNA 1Q7YQ 3GF3A 3DGEA 5AVZB 3JCZA 4KHPO 1QU7A 1PV0A 4ZOLB 2D2CD 3D3IA 5AVWB 1M5IA 4H44B 1FKAO 3GLMA 2F1MA 4XDLA 3DXRB 1YJWV 4JYAB 1FJKA 4X89A 3CSXA 3WB1A 1OX3A 1MG1A 4L74A 3L36A 2EIKC 1NTZJ 3CX5H 3OW2U 1M90W 2MJZA 3L70G 4O9BA 3UM7A 1FXHA 1QLED 2WLJA 3B8NA 1ZOYC 3CX5I 3OMNB 1Q3EA 1NTKH 3W7UA 1IBLB 3M0AA 4LFCO 2H88C 1XTCC 3L74E 3RT3C 3N2KA 1TVKB 3CCMV 1PPJD 1DX7A 1FDMA 3D36C 1S5LH 5BU5A 1VQOV 1FOSE 2X0LA 2ZNIA 2KB1A 4O4HB 3SJQC 4GKKB 1H2MA 1QL2A 2NNUA 4AQRD 2B9ZA 2XAFA 3D36A 4DV5O 2JKVA 5BVZA 2Z4EA 3OGCC 2ZINA 1AVYA 3CCRV 3L74D 1DLBA 3L72G 1NVPB 2YEVB 4IYHA 3CCLV 4YHHO 2E74C 2BTQA 2PGDA 1YHQV 2WTYA 3FB5C 1N7SB 3W67A 4PV1C 2Q68A 5L3BA 1GN2A 4LH6A 4O2AB 1NO4A 4JTDB 2OYIB 2KQXA 2O01J 1WJZA 2V7QG 5LXTB 5APWA 1AI5A 4LF9B 1TA8A 2IYOA 3EFGA 3CMEP 2Y48A 3MHVA 4DV4B 5LL6Y 2O1KA 3W7SA 5KMGB 2QWPB 3SFEC 3UQ8A 1XNQO 1Z2GA 2R72A 3U10A 2XAGA 3FB7C 2ZDIC 3CL3D 4CPGA 3CCQV 3I5CA 3LUTB 2GUZB 1AR5A 5KJ7A 5DM6V 1COWG 1L4AC 2HVKC 1I0HA 3I56P 2HG5C 4UXNA 4BXLA 4DV3O 3AG3B 1P84I 4JI8B 4CS4A 4HZ3A 2Q7EA 4J80A 1IK7A 1IBKO 4ZHQA 2NLJC 1L0NK 3BATA 1Q82Q 3D6YA 4KHPB 4RKUJ 2E3CA 4BWNA 4DK1A 5JWPA 2Z3YA 3M9HA 4FPPA 1M8OB 1FZGA 4ASUG 1US6A 3AG7A 1AB3A 1KD1W 5KAFZ 1EDKA 2EIKB 4EB6B 1Q7YW 1S0VA 3L73E 4UB6H 1HNZO 1S77D 4X64B 1NQTA 1OJHA 1GN4A 4D6TJ 2MK3A 5KLIB 1OVRA 3CMAP 1SQQH 2BE3A 1PGJA 2ZYGA 4B7EA 1PGQA 2FB5A 1M7LA 1SS1A 5BY1A 1SQBE 2D3OW 2VQEB 1HP8A 5BXZA 3RBZA 5LA6B 2P10A 1OCCC 4EFBA 4TLFA 5APYA 3THOA 3FKSG 2HLOA 2E5LB 1UIXA 1A02J 4F6RA 1KQSU 1BMFG 3SPIA 4JI3B 2ZQMA 2JEUA 1E5WA 1S5LX 5KX5A 1NTME 2AHZA 4ASWA 4JPZB 3BASA 2I8DA 1VQ5P 3D3QA 1H8EG 3II6A 3WG7C 5EZYB 4I7ZB 1SQQK 4LF6B 1SQXH 3K3WA 3SWYA 2EILB 3DC5A 1X9VA 2WPQA 2ZT9C 3CRRA 1EXIA 3V5BA 3KCXA 4LF7B 3ZHQA 2FYUK 2Y9YA 1GH6A 4GCZA 4YXWG 4LFBB 2IBZD 1D2DA 4QMAA 4JI0O 4X8AA 1SP4A 3IR9A 3PRJA 1MZ9A 3N2KB 1JY2N 1OZ0A 2AXTZ 2UXXA 1MV8A 2F66C 1SQPH 3CS5A 2Y69C 5BZBA 2XNDH 4PI0A 3L71H 1HVVA 5DJTB 1J5EB 3A3YB 1Q6HA 1NHLA 2BSKA 2IBZI 5LYJA 3VQVA 2QRXA 3ABUA 1GMGA 4OH8B 2GSMB 4KL1A 2O01H 2JGDB 1Q5OA 1K8AW 1KYOH 1Q2NA 1SQBJ 4WBNA 2QVAA 4O4IA 1XNQB 1DD3A 2JWDA 3W68A 4DR3B 5KUMA 3O6QA 4FIPC 5KA5A 3QH9A 2YICA 4DUZB 2G3AA 2ILMA 2P6JA 2GV9A 2A9HA 3F5WC 4U3FD 3CXHD 1FDIA 3HKBB 3B71A 2JWAA 2FXMA 1N7SA 5KLVD 2FKXA 1MMMA 2NN4A 4DV3B 4GKJB 1VARA 2Q6QA 1OXZA 2YC0A 5B1BC 1SESA 3ZN1A 1EZVH 1FZCA 4AUWA 3OEEG 4PDVA 1H38A 2A06H 1VQ4P 2WLLA 4GX2A 1EZVI 4BRYB 2P7JA 3B5NA 4MVQA 1K9MQ 2WSEJ 4DUYB 1M57D 2BEQD 1J1EB 5LP6B 3TXQA 1P7BA 1Q43A 5L8RJ 5APUA 1A32A 3ABKB 2HR3A 4K35A 1HGVA 1WB7A 1NH2B 2ZD9A 1LP1A 1FYJA 1BSNA 2OIEA 1BE3D 5M1BA 3TNUA 3OR6C 1OCCB 4IFMA 1KQLA 1NTZH 1T5EA 1LTJB 4GX0A 1SQGA 4L87A 5GONA 2HFEC 4UB8Z 3JALA 4JV5O 2R5BA 5E79E 3OUSA 4LBEC 5IY5C 3VMYA 1VF6A 1BQ0A 2HPCA 1X22A 4C46A 4LF9O 4KFMA 4FLZA 1RH5B 2Q1KA 2Q0OC 1XREA 2PUSA 3CCQP 1NU1G 1NH2D 3A0HE 2LFRA 3RBXA 3BFRA 2AZ2A 3RFRA 3T1CA 4JASA 1VP7A 3H1HJ 3ZHSA 4U3FG 1H8HG 1KB9D 1VF5B 3IFMA 2MKVA 2Q9IA 2RMKB 4DXWA 2XNXA 1KILB 2LXBA 4ZIBA 1SF9A 1AR4A 3HUSA 1URQC 3BHPA 2Z5UA 1JVMA 3ZCCA 4DV5B 2E76B 2QSIA 4IL6E 1YIJP 4UCUA 3CRCA 1NVOA 2H7HA 2EIJC 4O4JB 2F4VO 3RL0g 4PA9A 3SWKA 1NTZK 4YPCA 5H6RA 1S5JA 1QX8A 4PA4A 4K3AA 3SDLA 5DN6G 2WLLB 5A2QN 1ZR4A 3P7KA 3G71P 3CCSV 2E76C 1YDXA 1L8DA 4MVMA 1SQQE 1FZFA 4U7OA 1ZUQA 1CI6A 2CTRA 4X64O 2OYHC 3WB2A 1U7MA 3L73D 2IW5A 2YIAA 2CTPA 1YEWA 1OCOB 2ZJSE 3AEBC 1PP9G 4CZZA 3D6ZA 5FPRA 2XAJA 5KAFH 4RQEA 2Q6AA 3LIDA 2ZDIA 1PP9H 4X20B 5ITZA 1FJGB 2FXOA 3M06A 4OGQC 2QIWA 3MAQA 5GTIE 3K03A 2GUVA 2B87B 4P9PA 4Y28J 4IL6Z 1RPOA 5AW6B 1SQPK 5KLVG 1K4CC 1O9GA 4IFDK 1NR1A 5LGTA 1LTAC 3TDKA 1K7DA 3RYCA 5APSA 4DV1B 1GDTA 3OA7A 1H2LA 4NB5A 4HJGH 1VQ8P 3BCCD 2E74B 3D70A 4DUYO 3OUFA 1VQ9V 1DIPA 1G8MA 3AE7C 5LMNO 4J7KA 2WLIB 4O2BA 4D6TG 3O65A 5CBNA 4F6RB 2QE7G 3FB6C 4HKZH 3G4SV 1OFCX 3MTUE 1XDCA 2FYUJ 1LJ2A 2ATKC 3M7MX 4UB6E 1ZLLA 2OGUA 3ASOB 2YO2A 4BW9A 1LWUB 1SFCC 5IYBO 2H3OA 1GTOA 4R4MA 4H0LC 1GU5A 4U7NA 5EZYA 1HNWB 2KLUA 3H1LE 2L35A 2O1JA 1WP8A 1JY2O 2R70A 5B66Z 3FXEA 1NVPD 3QTCA 2KP8A 2FYUH 2RKLA 2ZIOA 3RYFA 2QJKC 2XTAA 5KMGA 2IDBA 3OJAB 2QJPB 5TISE 4DW1A 2YSUB 2QWOB 3UT5A 3RK2C 4DV6O 4NXMB 4FLXA 4H13B 4JTAB 3BAAA 3A8TA 1PZQA 3GB7C 4I4TB 3BVOA 1Q86Q 1KB9F 2Q7CA 2CE4A 3H1LD 3S1KA 3BCCE 4L76A 2A06G 4ZI7A 2FBWC 5IYDO 4GYCB 2E5YA 2YIUB 3A0BE 3QF7A 4FM1A 3F7VC 4AHCA 1I5XA 1NJIW 1OCZC 2WLIA 4UCTA 5EC2C 1VQ4V 4PDMA 1VQKV 5EFWB 4FVMA 5KTBA 2A0LA 3K0DA 3E2EA 1KMIZ 1B04A 2P58A 4YHHB 2Q0AA 2KYVA 3B5NC 4EB6A 5K1PA 5AVTB 2RQ6A 1NTMJ 1F23A 1UIIA 4DR4O 4P2ZA 1S5LZ 1SQBH 1G1JA 4OX9O 3JSNA 2KG7B 2OT5A 2ZT9B 3CEIA 1JR9A 3IFXA 5GTHZ 5KX5B 4JI2O 2ZYAA 5IYZA 3F7YC 1A02F 4ZMDA 3B5NB 4LGDE 4DR5B 3B40A 4FM2A 5LA6A 4WFAV 1T3JA 2PFXA 1SA0A 2ZM6B 1IURA 3FYEB 3SJCC 3GF7A 1KKDA 1AV1A 3MDSA 2UUBO 1K5QA 1QVFO 3JAWA 4AQYO 4YTPC 5GONB 3L73G 4PA6A 1SQXE 4FFKA 1G6UA 1BHAA 3OFNG 3OE7G 1YI2P 1XHXA 3OTOO 1AP5A 1L0NJ 2FKWB 3H1KH 3CCLP 4RWUA 3X2QC 4DV7O 1AFOA 1IX9A 1JJ2U 1PGOA 3SYOA 4FLYA 2EZPA 3ABVC 2BCCE 2KK7A 2LR2A 1SERA 1KILC 1E79H 3P32A 1AP6A 1OWAA 2PRRA 2SPZA 2Y0EA 5AVXB 5IYCO 1KU9A 2QEXV 1V55B 1VQPP 1EZJA 5CN0A 3SYQA 3G6EP 4N78D 2YXQB 3JD3A 3JSLA 3CLQA 5AW4B 4LF8O 2JGDA 2OQQA 3HTKA 1OCRC 1HGZA 3L73J 1JMBA 3L74G 2XAQA 3ETEA 5JH7B 4B86A 1FPOA 3M99B 3AECC 2VRZA 3W7TA 2IZ0A 4NPFX 3UIAA 2GDSA 3RN4A 2WLKA 4O4JA 3APQA 3E35A 3RVYA 4J7JA 3T4ZA 4B3SO 1V54C 1NU1E 5EBWC 4TQDA 2D2CC 5B66E 3T1HO 2WA3A 3MHSC 4B3RO 4W80A 4L8JA 2YKPA 3G6EV 2IJKA 3S3XA 3AEFC 1NAFA 3G9RA 2JIZG 3H1KJ 5J9PC 3H32B 3H25A 1KV4A 3DTUB 4JTCB 4WFFA 4QNHB 1FDOA 3CC2P 1URFA 1YVWA 2PY5A 4LF7O 2HODB 1XL6A 3JASB 4LFBO 3O9OA 3JCUZ 3G4SP 3FGAD 1XMQO 1IXBA 2HYNA 3K58A 2JJLA 3L35A 1AILA 5LP6A 1WNSA 3ABLB 1OMIA 4PD4E 3V2NA 3G3ZA 1ZL8A 1NTMH 1LTSC 1FZAA 4PDRA 2QJYC 4MTOA 2CPBA 1NR7A 3SSUA 2RN0A 1XTGB 4G2KA 4DT0A 2HHHO 3H1LH 3MD0A 1GMJA 3CMEV 3ABLC 1D5AA 5CBGA 4IT5A 2N1TA 3ASOC 1PV3A 1HR0B 4DR3O 2YEVA 4EKWA 3CRAA 1TUBA 4QIWF 3CXHH 3CCUV 1SETA 4R50A 1OW6A 2IBZE 3E86A 4I55A 1G4YB 2JK5C 2FYUD 2R9AA 3HTKB 3L71E 3VMAA 4X65B 3FWLA 2IU3A 2QDOA 1K8AQ 3Q1MA 1RQVA 5KAIH 4DUZO 5F2VO 2A45I 4H0LD 3RK3E 4H13C 3PP5A 5CCGD 1NTMD 1I7FA 1OCOC 1VEWA 2B1GA 2POHA 3MIWA 1GKFA 5E79H 4LR3A 4J9ZB 2FYZA 1SQPD 1PNLA 2FFDC 5J2UB 4N21A 3ZHTA 4H33A 4TV8A 1YBKA 4PI2A 4O2AA 1SQXJ 2EULA 1N34O 5KLVJ 4E2LA 2J58A 1GN3A 3OGIB 4L75A 3BRCA 3RK3B 2ZIMA 3ZS8C 1OCRB 3VQYA 3N2GB 4JI8O 2A79B 3CHXA 1NJIQ 1WLEA 2ZR2A 4X20A 5EIBC 5ITZB 4JGSA 5TISZ 5L3DA 1KILD 2Q8VA 3K57A 1K4DC 5APQA 2UXCB 1NTMK 1U96A 1L4AB 3T97A 3P30A 1W59A 3QNEA 1ZRTE 1YXBA 3PN1A 4J41A 2B9BA 1KTMA 1PP9D 4X66O 3CD6V 1TU3F 2NPSD 3AG1C 1YF2A 1D7MA 3BA8A 5B5EE 1IXMA 3RGBA 1JB0J 3ETGA 5JQGA 3WG7B 4UCSA 3L73H 2W6IG 1JMMA 2QWRB 1ORQC 2C0XA 3EVKA 3HKCA 5BR8O 4YXWH 1B06A 1Y76A 2EILC 1XEQA 2F93B 1ZX3A 1NTZE 1FD9A 2JRIA 2M7WA 1NOHA 1FC2C 5FPOA 4RJTA 3HD7C 3HR0A 2JDIG 2WLHA 3D8CA 2WLNA 4GOEA 5LOVB 1Y9BA 2IJHA 3CWBE 3M9BA 3LDEA 3HD7D 4JZ2A 1MZFA 1VQ7V 2N05A 2W8ZA 3LSQA 2C2AA 3BCCJ 2R32A 2R9RB 4MW8A 2EJ7A 2NRGA 4UCRA 1VQ8V 4EEQA 1SRYA 3H1IJ 3CCJP 5JJEB 1OCZB 2C9NY 1R8EA 2K3RA 2P2UA 3JSVC 2QJ1A 2ADQB 1DEEG 2HKOA 2A3QA 4IL6H 3K5OA 3FX0A 2WT7B 3AE6C 3ZRXA 2YUAA 4CH4A 2YIUC 5H9CA 1MNGA 3UT5B 1XBLA 3RK3C 2KI7B 5BMVA 2M5AA 4ICGA 3PLNA 2BEZF 1FAVA 3K06A 4RUFA 4LWSA 1KP3A 5LMUB 1SQBD 2K88A 3L74J 2HHHB 2WWWA 3SPJA 1Q6IA 3H9VA 1Y67A 2QKCA 5C93A 1N8RQ 2EZOA 1MUUA 1YCIA 1JY3N 2PAJA 1BE3H 1MABG 1K73Q 3OMAB 5JH7A 4JPRA 5IY5B 1URQA 5LOVA 1N34B 1IDSA 1TUBB 4C7NA 2P4VA 2W6AA 4WCEV 3KHUA 4YY3B 3ZMVA 2RJZA 4FZ0A 1SKVA 4PA3A 3A0RA 3STLC 2CTWA 5H6QA 1KYOI 2Y69B 4WBNB 2OTLV 1KILA 3GHGA 5AVUB 1KYOE 2GBOA 1RF0A 1S5HC 5C8YB 2OYIA 1EZVD 2Q5ZA 2PTMA 5CJ4A 2YNYA 3HKEA 5EK0A 2Z5HA 3E22A 5APTA 1ZAUA 2Q7GA 3ABMC 2A06E 1QVGU 3PHLA 1YI2V 1I08A 1F4MA 2OYQA 1JCHA 3WFVA 1SZXA 1S9KD 2HEPA 3H1IG 2QJYB 3E8GA 4U3FH 1T6AA 3VOPA 2YMKA 1S5LE 1NTKD 3JD1A 2R44A 1SQPE 3SYAA 2BTOA 4H37A 2Q3EA 5GTHE 1M1JA 3VOUA 1EZVE 4WBAA 1R3KC 1RM1B 1GK4A 2GUZA 4B3SB 1PL5A 1N33B 2AHYA 2NZ2A 1S9KE 3U1CA 1JCCA 5B1BB 1IBMO 4AILC 2OTJP 4DR1B 4KJMA 5FNVB 3L71D 3KKYA 3W7XA 1KQFB 4DW0A 5IWAB 2WSSH 3M0DA 3E1IA 4MVSA 1GL2B 4DR2B 1L0NE 3AG2B 2WZ7A 1HNXB 2LGQA 2ZYDA 2HP8A 1P4RA 2BOCC 4CH5A 3RYCB 4UCVA 2K9JB 3CB2A 3KCYA 2PI4A 1VQNP 3GHGB 4WB4A 1AQ5A 2QSAA 1WPBA 2VWKA 5JQGB 2UXCO 4ZBMA 3BCCH 2GA1A 4IHJB 3Q5PA 1N7SD 4G27B 4Q20A 3U11A 3JYCA 4KXRA 3A0BH 4UVAA 1AI7A 3R4YA 3E22B 2K1AA 3JARB 2RDCA 4DV2O 1QR9A 1UFIA 5EC1C 4LF4B 1BZKA 2M3EA 1BGYE 2AXCA 2O57A 4TSFG 3ZIAG 2K37A 4LF8B 1IZNB 5J2UA 4B08A 4LCUC 3IAOA 5LGNA 1FOSF 4TT3H 1U7JA 4FFBB 1JOCA 3ZRWB 1MFTA 5H2FZ 4NTYA 2ZVNB 4B3TO 2ZM6O 1GAXA 2V7QJ 1R5LA 3FB8C 1Q90D 1VQPV 3CP1A 5B66H 3GWOA 3VQWA 2XHBA 4NVPA 1XI1A 5IJ0B 1LWUC 2GTSA 2VQFO 4U7JA 1YTZT 4Y99B 1ZN5A 3H6PA 1YTZI 1PP9J 4L73A 4X62B 2Z5IA 1UPGA 3FD9A 1JX9A 1Z5WA 3R2PA 2G38A 2FFDA 2VS0A 3KDPB 1YYCA 3H1KD 1JY3P 3H32A 1XOUA 3CPWU 4X1KB 2ADPA 4A5UB 5BMVB 3F89A 2Y9ZA 2WSCJ 1H0TA 3AEEC 1RE3A 4JYCA 1KB9E 1EN6A 1N7LA 2KSDA 2XASA 4OGQB 5EBMC 2N9YB 3APOA 2DQ3A 3CC4P 3G67A 3T1YO 3K04A 2OYHB 1IO4A 1NKZB 4HAMA 3RL0B 4BIUA 5JVDA 4HBNA 3K5LA 1GO3F 2J59M 2CDYA 2KKWA 4U3FJ 2ZE7A 4WFGA 1H88A 2E75D 5CBHA 4GX5A 3K9SA 4NKGB 3AE3C 3MGNA 1BDCA 2L5GB 1VQLP 4UVCA 3ICXA 4YJ3B 4CC6A 4PD4F 2V4HA 1OV9A 4O2BB 2UUCB 3AG2C 4RESB 4D6TD 4KP4A 1PM9A 1PGPA 3HRNA 4NXNO 3PTZA 2AXTH 2ODMA 2N9BA 4QE9A 3GMAA 4GDOA 3JAKA 1XQ8A 3B5ND 3WUUA 2DYRB 3L70J 1AJNA 4ZOLA 3K08A 1GZLA 1FJPA 1YJ9V 3JAWB 2Z0AA 5L3CA 1ZWIC 4TV8B 2GUSA 5IJ0A 1NTKK 4WY4B 5AW2B 3H1HG 1N73B 1T2KD 1J95A 1WP7A 3L37A 1ZMEC 5KUKA 2A06D 2LGWA 2X6AA 4XDJA 1RY3A 4JBZA 3UO3A 2ZE5A 2LJ2A 5L3EA 5IT9N 4OVNF 5APVA 1LT9B 1YQ4C 2YKQA 3RYHA 5AW5B 5AW8B 2JS5A 1OZHA 1P84E 1VIBA 4Z1MG 1RPRA 1NU1K 1N73C 1IFNA 1U57A 4X1KA 1P84F 1I94O 4TUYA 3U1AA 2O01N 1RF1C 4MTFA 1S3JA 3SPHA 3TGUJ 3WU2E 3B8MA 5KAIZ 3L70D 3GVMA 1ZRTD 1HBWA 2ITDC 2LXCB 2W90A 3I55V 1HJ0A 2XKMA 1HWYA 4UV8A 4BR6A 1H2GA 3TETA 3TGUE 1VQ6P 2JEXA 4XBFA 4MTXA 4N3YB 2W27A 1E79G 3CC2V 1QHTA 1J2JB 1K3EA 2W6JG 5KLIC 1TAEA 1P7GA 3SPGA 2AEMA 3CC7P 4FMTA 2YXLA 2QEXP 3R65A 1LTTC 1WB8A 4YY3O 2VQFB 3S4RA 5KLVK 1MSDA 3AG4C 4D7SA 1OIPA 3MUDA 1NAYA 1CEZA 3ZMUA 3J80N 3A7OA 3RK2D 4CC5A 3BRTB 1HH0A 3B4SA 4DV7B 4PD4I 4O4LA 1QQCA 5C39A 2LW1A 3ZBHA 1SQVJ 1Y66A 4JQ0D 3KXDA 2FL4A 3W7WA 3CXHI 1CXZB 3E7KA 1AROP 2OWOA 1PIXA 2DWEC 5DEDA 1BE3G 4N78E 1AJPA 2WAMA 3J7AU 2EIJB 1GM9A 2JJ2G 4BAYA 1IFMA 3RWRD 2ZAEB 1R3LC 4H0LB 1SQQD 1MKMA 3JARA 1F7YA 2Q9LA 2N74A 4P30A 2FXPA 1M56D 3CI9A 3M0DC 2LFSA 3QO5A 2W83C 5JVDB 4A7PA 1NTMG 1FFTB 5IJ9B 4DRXA 1BCCE 4NPDA 1MA1A 4JI5O 1URQD 3KZIZ 4P9OA 1NS1A 4YJ3A 2P4KA 3M8AA 3DXRA 1FS0G 4BRYA 3Q4HA 2L91A 1OVVA 3NXSA 2QKAA 4HNAA 1G2CA 2IZ1A 3AE1C 1KB9H 2Q5UA 2XZRA 4LLHA 3JATA 5EBLC 1L4AD 1QLEB 5B3SC 5IE9A 4O4LB 5CHXA 5CBFA 1LP1B 4Z2WA 1USEA 4JI6O 5AG2A 2IFMA 2PI5A 3AE5C 1DF5A 2KSEA 1AVOA 1FE6A 2Q69A 4X1IA 5LMNB 3IC7A 3CWBH 1LTGC 4IGGA 4FJCC 2DOSA 1HWTC 4X9QA 2ZNJA 3GW6A 3ZN0A 1YTFB 1W5CE 3V2PA 4IYIA 2XV5A 3FXDA 4JYAO 4KUMA 4NYKA 5LHIA 1NTZD 1ROPA 2FYUE 1JQ0A 4ZI7B 1G1IA 4DO2A 1J1DB 5AW9B 2YKOA 4DR7B 4UB6Z 2IJIA 2AXTE 3HD7A 3CPWO 3GHGC 3K9AA 3OAKA 4UV9A 1BCCJ 3AE4C 3AG4B 1GL2A 2UUBB 1H2KA 1ZL8B 3V6IA 3R66A 3CXHE 3B2EE 1M56C 1QEXA 3VP9A 3L74H 1EN5A 1IBLO 1WPXA 2M8RA 1HNXO 3JD0A 3CC7V 3IAYA 2IFNA 2GM4A 2P22C 2C0WA 2N04A 3SJBC 3ABTA 4O4IB 4FFBA 5EYPB 3ZJZA 1RHZB 5IJ9A 1X8YA 3L75E 1EDLA 1MFZA 2FMLA 1EZVG 4JAAA 4XA4A 1VQKP 5KLVH 1SQFA 3HKBA 1U97A 2RNBA 4DR6B 5IYZB 3AE9C 4H13D 3K5BA 4W4LA 1M1JC 2UXDB 4WFHA 2RH0A 1K97A 1LTIC 1OW7A 5CCHA 4K0KO 5CA0B 1SA0B 2EIMC 5B5EH 4MS2A 3AEAC 1DGSA 1FXVA 4LP8A 1NTZG 4J10A 4YJ2B 1D5NA 4R4LA 2K1EA 4JV5B 1KN7A 1S4XA 4RO0A 1KYOD 2QR4A 3P3PA 3HPLC 2JDIH 1AI4A 3ITKA 2GHYA 2R3CA 1SQVH 1DH3A 2EIMB 2V7QH 5GTIZ 3SPCA 4DV6B 2YIDA 4NXMO 2FY8A 1NI8A 1VL2A 4MVZA 1UJWB 2ZKOA 4BW5A 2W0XA 3USSA 1KD1Q 2QTSA 2K9YA 3CCRP 3MP7B 1WRGA 2FFDB 2IBZH 5D5QA 1N33O 4ZKUA 1JM0A 4UFZA 1RSOB 5LP6C 1NU1H 4NR1A 1SQXD 1LUVA 1EXJA 2AZ0A 5J2TA 4D7TA 4FM0A 3FFQA 1JUNA 3ASNC 3L4FA 2BCCD 3BPZA 1W2BO 2KIKA 4OX9B 3OT7A 3UCSC 3H1KE 5CCGA 1M1KQ 4GT1A 2V1DA 5KKZB 1GD2E 3A0HZ 4IL6X 1FZEA 1LWUA 3KZIE 1M56B 3CD6P 2P7TC 4DV0B 3CCMP 1SQQG 3A5TA 1N86A 4YJ2A 2R3SA 5L3GA 4OGQD 4ABMA 1Y4MA 2QM4A 2JP3A 2LO1A 4F6EA 2C9LY 1SS3A 3F5HA 1PKXA 5HFMA 1KC8W 1PNMA 5CBOA 2YIBD 3TCUA 2JGUA 1VQ9P 4AQYB 4DR7O 2KNCA 3L72D 3RL0D 4I4TA 3AEIA 4GUNA 2E76D 1GL2D 3H01A 4F4LA 4CBCA 1SQBG 3AEDC 4YXDC 4UVBA 2PGGA 1L0LG 2E43A 3LW5H 4OXSA 3OTOB 1T2KC 1ZXGA 1DEBA 4XE5B 1PL4A 2DW4A 1K73W 1DD4A 4HH2A 3JAMN 3NR7A 1QR8A 5J2TB 1L0LD 5LGUA 1SLQA 3MZWB 2YXHA 2R9IA 2QJKB 1GW4A 2LKMA 4CS2A 1PD3A 2DN9A 1BHBA 4JI6B 2KXPB 3P8CD 4GIFA 4J7ZA 4GKKO 4NTXA 2X6CA 1B3QA 3FYIB 4QGPA 1N32O 3T1YB 4MT8A 1TGOA 1YQ3C 1YJ9P 4PD4H 1KBHA 4I2LC 5KJ7C 1SQPJ 1L0ND 4TOIA 2F4VB 3E8BA 1FFXB 3C8VA 3ZRSA 3UO2A 5KHGA 1Y6XA 1QVGO 2Q7HA 5EYPA 1USDA 2BASA 1HDJA 4EDFA 4YIPA 3JD2A 1JFFB 1J5EO 3TGUH 3QO8A 1S76D 4UCOA 3C1LA 3HKEB 5B1NA 1FZBA 1QBZA 2BOBC 4EFEA 2OYOA 1KZUB 1AI6A 1M57B 4JYYA 3BCCG 3V4QA 4DOJA 1VQNV 3L75J 1R6TA 1HR0O 5K1XA 1JJOA 1K5SA 1FJGO 1T3UA 4B3RB 1XHZA 2F23A 3HKDA 3JC22 2I1KA 4J9YB 1YJNP 5KAIE 3I55P 2WPDG 1FZCB 1IC2A 2WMMA 1FS0E 4TT3G 4LFCB 1GM7A 1OHHG 4FLVA 5AVVB 5APXA 1TVKA 3Q5RA 1NYHA 3T97B 3EXAA 3RGUA 2Q4PA 1PPJH 3VN0A 2CUGA 3JALB 2Y0PA 1QCEA 5GW7A 1T8ZA 4TV9A 3H1HD 3OAAG 1BQZA 1FU1A 4PJ0H 2HPCB 2A45G 1GW3A 1Q81Q 1IZ3A 2CTQA 1DTOA 2ZE6A 2A45H 3HE5B 4PV1D 2NPSA 3KYQA 1W0JG 3L75D 3CYOA 1LTJA 2B89A 1EFRG 3CX5D 3P8CE 1VF5D 4QE7A 2WSFJ 3G80A 5LBQA 1XL4A 1VMGA 4MSWC 3VQXA 3L9DA 2ZXEB 4JI1B 1LNQA 4QPKA 1ZLZA 5CMZA 3WUVA 1W2BU 2EJRA 1WA8B 2BTQB 1NTKE 1BCCH 4GZRB 4PDLA 3JD4A 3K79A 1BS3A 3HB3B 3G6BA 1N0NA 2E75B 3PJSK 1HUCA 2Y0DA 1JNMA 1SQXG 1Q82W 5GTHH 5LMUO 3CCEV 2OARA 4DV1O 4KT0J 3I56V 2DW3A 4MN4C 1KILE 3V2RA 1LUWA 4LH7A 3IC9A 3S9OA 2ZT9D 2YDEA 1GTWA 1BE3E 2KS1B 1CP9A 3JATB 1Q81W 5EIBD 2E42A 4OPHA 3E89A 1N73A 5JJJB 5CCHD 2CH7A 3RYIA 1MOFA 2N1TC 4FLTA 4R8CA 3TF5A 2CPSA 1H2SB 1H89A 2D2CB 4I1LA 1WN7A 1N2DC 4X66B 1X59A 4CS3A 2NPSB 3RYHB 4DK0A 3T2MA 4ZHQB 5E79Z 2B87A 2WSEH 3CX5E 1Q6UA 1SQBK 3CE2A 2M6YA 2N1TB 1W0KG 2M5AB 2I1JA 4TUYB 3L72J 4LWSB 2DYRC 1TUEB 3WU2Z 2P06A 4I50A 1XNRO 4I55B 3KQGA 3A2FA 3IN6A 2JJ1G 5DECA 1X4TA 3H1HE 1THZA 3VYIA 3HD7B 3OTFA 3TK1A 4H44C 5KHIA 1SFCB 2JR8A 3AK1A 2DJVA 3ZHVA 1PP9E 2XOKG 1BE3J 4K8ZA 2YXRB 4FZ1A 1P84D 5JCOA 3C9IA 2DE0X 2OCHA 1MSWD 1VQOP 5KA6A 2UUAB 4GKJO 2QJPC 3STZC 4IIJB 5C8YA 3RK2B 3SYCA 1BSMA 3CC4V 4JYBA 2QG4A 1V55C 3OEHG 1HJBA 3DC6A 3EWKA 1OW8A 4N23A 4PA7A 2PP6A 5KHJA 3A0BZ 4MVOA 1ZR2A 1R3JC 3H1JD 3ZMTA 2QWQB 1Z5VA 5JJNB 2WPSA 4DZOA 1NGMB 1YSCA 5AVYB 3BA9A 1JY2P 4ZKPA 1SQVG 2F95B 1ZP0C 4WFEA 2EX3A 1EDIA 5B1AC 4BWAA 2L6LA 2UXBO 1HTLC 4D6TE 4GLXA 3TGUG 2LW7A 1JTHA 3OW2O 4CH6A 5K5GB 2CH7B 3RYIB 1K34A 3M91A 2W6JH 4GKGA 3VTPC 1DK1A 4I50B 1RFYA 3CRMA 4O4HA 2IBZG 1KKCA 2M3BA 3ABKC 4WY4A 5FNVA 5H2FH 1VPCA 3H1LG 1N36O 1XUQA 4TV9B 1RE4C 4X65O 1CW5A 3LNMB 3ABMB 2BSKB 3ASNB 4FLWA 5BU8B 1EN4A 3H1ID 2LQTA 2CAZC 3OM3B 3K59A 2KSJA 3NTNA 5CMUA 3TGUD 1YJWP 1RE3C 4RAIA 1RE4A 1M57C 1F4NA 5KKZC 3WMM0 2LP7A 4X62O 1JO5A 3J81N 4LC1A 3T1HB 4EOTA 3LIEA 5LHGA 1L0NH 3H1JG 2UU9B 1AJQA 3L70E 2H43A 2NPSC 1RP3B 3OMIB 3KZIH 3H1JH 4DR6O 2H8PD 1K05A 3FX7A 4JI0B 4NTWA 4X1YB 2ZXXA 3QVNA 1LT1A 1KYOF 1KORA 1KUQA 4DCKA 1XMQB 3JCUE 1BDDA 1B6QA 1YTFD 1NKNA 4DYLA 2PF4E 5KHHA 3CMAV 2KB7P 5AW0B 1HW7A 4PELA 4ZKIA 3AK2A 1AJYA 3EFFK 2WLMA 1CZQA 3CCVP 1YZBA 1BGYH 4LFAB 2WA4A 4RQFA 1BCCG 1P84H 1EM1A 4LNUB 5CB4A 4PHZA 4UUJC 2IYPA 4DR1O 1YITV 4UB8H 1SQXK 3VMZA 2J5UA 1FXKB 2IM9A 3VMXA 1GL2C 1J1EC 3P8MC 4DR2O 3K0GA 3L72E 4Z1MH 4R7CA 5BR8B 4BIZA 2YO3A 3SWFA 2OTLP 3L72H 1CSBA 2CGNA 2HLDG 4U3JB 2NR5A 5CCGC 1W2EA 2WPRA 3B77A 4FLUA 4JI7B 3NMDA 1FBMA 1RF0C 3ETQA 5IWAO 1H0TB 3C90A 3SYPA 2OYIC 1FXKC 2QE7H 1JMKC 4DJGA 1XMOO 3CWBG 2N1TD 3VP8A 1F51A 2IJJA 3QWOC 1V9PA 2O3JA 1O9HA 3ZMZA 1GN6A 1N7SC 3ETDA 2XAHA 3ZX6A 1NH4A 4LF5O 3SJAC 1M4UA 2CK3G 1SFCD 4DV0O 2UUAO 5L3FA 4GOFA 4QPJA 1M9NA 2FYUG 3KG2A 2Y0IA 1FZCC 5HFLA 2IH1C 2BCCG 4XFJA 4RUEA 3CXCU 3HKDB 5AVRB 2JVDA 2FYNB 4QJFB 3EHBB 1I94B 1N36B 1I5YA 1JFFA 5LXTA 2UUCO 2WT7A 2B1IA 1R1BA 2KG7A 3BY6A 3T4DA 1XNRB 3LSSA 2E5TA 2MW2B 5B3SB 2KOGA 1SC5B 3V4WA 1ZSPA 4U3JA 2FYNC 5FL7G 3JASA 1BGYD 1HNWO 1BL8A 2KZIA 1G1XB 3L75G 3TYYA 5B5EZ 1PNKA 3IGAC 1VF5C 1PPJG 4B3MO 3L75H 1BT8A 1N4CA 4EI2A 5JCOC 2BCCJ 4MW3A 2QA4P 2DQ0A 4I9WA 4LF6O 3E1RA 1Q86W 4Q6GA 1LT9A 1NBMG 4I0XB 5IDJA 1JEKA 1YHQP 3FAVA 2XDJA 3LDDA 1IFJA 1Z56A 1M93A 3K5MA 4JI4B 1RM1C 2UXBB 1KFNA 4TWKA 1E1QG 1VQ7P 2PYLA 2QTOA 2IPPA 1BSHA 2AEFA 1J1DC 1Y8AA 2UWJE 1IFDA 2Q73A 5DJUB 2DYSB 3G71V 3TJTA 2WPVB 2P1JA 1R6KA 4IOIH 5KHKA 3LDCA 3H1IE 3HE5A 3CJHA 3H1IH 5AVQB 1L0LJ 4DR4B 1IFIA 3ZRWA 1GK6A 2RMZA 3AK3A 3NFQA 1LR1A 4WF9V 2QA4V 5KAFE 1P49A 1WA8A 2JS3A 2ITCC 2KLVA 1MZEA 3BEHA 3WB0A 1K33A 1K9MW 3E8HA 1PL0A 3IJ4A 2PYJA 2X7RB 4WY4C 1BGYJ 1M1JB 4M3LA 5TJHA 1N8RW 5E1AC 1R6NA 1RF1B 3N27A 1NTKJ 4W7YA 1R5SA 4JI2B 4I7ZC 5CA3A 3H1KG 1DF4A 1SQQJ 1AQTA 1L0NG 3TNUB 3N2GA 3SR2C 1EC5A 3L71G 2JO1A 2WVRA 1H8AA 4DR5O 4X88A 3RYFB 2WSCH 5AW3B 4LNUA 5CA0A 5CB4B 2KS1A 2ZR3A 1S72V 3CWBD 3Q5SA 2H89C 3CRQA 2WITA 2DWDC 1Y47A 4ZNCA 3VBBA 1YIJV 3SGIA 5LHHA 3CCUP 5AVSB 4HYOA 1H2NA 1WAZA 2KZJA 3GG2A 4HYTB 1ENVA 2QM7A 1NTKG 1S2EA 3A0HH 2DMXA 4W4KA 2HFED 4HB1A 1BGYG 1SQVE 4I0XA 3K5NA 1L0LH 2YI8A 3HE4A 2F43G 1L0LE 1L4AA 3BABA 3BVHA 1QLEC 3I5DA 4OPAA 3L71J 3V2QA 3BRVB 4KHXA 2K9JA 1YITP 1Y74A 4IIJA 1E1RG 4J42A 3S3WA 3HUSB 3UKMA 4DRXB 2RN9A 3SFDC 2IX7C 3C3TA 4JI7O 3CXHF 2DYSC 3TSIA 4BIOA 1SFCA 3ZHRA 3N7NA 1KC8Q 3HKCB 1QL1A 4JI1O 3OD4A 4GODA 2AW9A 3GWKC 4J11A 2YS8A 3LW5J 3Q4HB 1LTBC 2KNCB 4PJ0Z 1IVSA 5CJ0A 1LGHB 1SVFA 1JCDA 2UU9O 2ZVOB 2QGNA 1NT2B 1N0JA 1RF1A 1FXKA 2CK3H 2HJDA 5CCHC 2H94A 4C7UA 1NKDA 4C7RA 4PV1B 2BCCH 4X1IB 3JCUH 3AG1B 1JOYA 1VQMP 1L1FA 1M90Q 1QVFU 2W6BA 2Y0CA 2Y4UA 1CI6B 3IF4A 4YIOA 4JF3A 1XILA 1N32B 5A9GA 1K04A 4Z1VA 4Y99C 4JI4O 1V54B 3FAVB 2ZE8A 1EBOA 2XU6A 1URQB 3U59A 4EIJA 2ZCEA 1BCCD 3WU2H 2ARHA 2ETNA 1WMKA 4MTGA 3U0ZA 1S1CX 1FFXA 5CA1A 1SQVD 4WFBV 2ITAA 2G8YA 1VF7A 3OR7C 4IFFA 1IBMB 2ZXWC 1VQ5V 3MUDC 3ZMSA 1X0TA 3ML0A 3AG3C 5AW7B 3CCVV 1R73A 5B1OA 1VF6C 4CH3A 4RO2A 3JAKB 3L70H 2B88A 4JI3O 1FAFA 3X2QB 1XMOB 1QNMA 3H1HH 3RW0A 1VDFA 1PFIA 2R5DA 2M0BA 1S72P 1KP2A 2XUMA 3PH0A 1KQSO 3B09A 1CPYA 4WWIA 1AVMA 1GK9A 1GM8A 1AR1B 2E75C 3AEGC 2Q67A 2VRSA 4K0KB 2HJFC 2H8PC 2W0FC 4X1YA 1RQUA 1IBKB 1IFPA 3Q2YA 3ZRVA 5KLVE 1KECA 4G28B 3HUSC 2GTAA 1QGKB 2HODA 4JZGA 4LFAO 3ZDMA 3C3SA 1SZTA 3M9QA 1EQ7A 4WY4D 3KPEA 1VQLV 2EBOA
chains in the Genus database with same CATH topology
3ABVC 4H44B 2E75B 3GLMA 1DD4A 5M1BA 2FYNC 2WSCJ 3AEEC 4KT0J 4R4MA 1KILE 1VF5C 4H0LC 4OGQB 5KKZC 3S9OA 2OQQA 2ZT9D 2P10A 3LW5J 1ZOYC 3AE9C 4H13D 1ZRTE 3AECC 2QJKC 2IDBA 1UIXA 1YQ3C 2H88C 1KTMA 1OW7A 4H13B 1TU3F 2YMKA 1K05A 2D2CB 2E75D 3AEAC 3AE3C 1KORA 1S5LX 1PIXA 1JB0J 3C8VA 4PV1B 4R4LA 2WPVB 2FBWC 2D2CC 1PL5A 2NZ2A 1HF9A 4I7ZB 1VF5B 4H0LB 2MKVA 1AJYA 2E74D 3AEFC 1MKMA 2ZT9C 1EXIA 3G9RA 1K04A 1VL2A 3GMAA 4GDOA 1KQFB 3IN6A 2FXPA 3H25A 2QSIA 2E76B 2K9YA 1FDOA 1KMIZ 2J5UA 2E74C 4H44C 1Y9BA 3RL0g 3Q3DA 3FGAD 4Z1MH 1WMKA 1OMIA 1S1CX 4PV1C 3AE8C 1ZMEC 2G8YA 3Q5PA 2QJYC 2O01J 4I7ZC 2E76C 1EXJA 3AE1C 2QJPC 1YQ4C 3R4YA 2WQYC 2ZT9B 1DD3A 2JO1A 1R8EA 1GMJA 3O6QA 3SFEC 3AEBC 1U57A 1OW8A 3EWKA 1NYHA 2G3AA 3D6ZA 3T97B 3Q5RA 1PV3A 3Q5SA 2H89C 3AE5C 4IL6X 3IAOA 1KQGB 1FDIA 1OW6A 4TT3H 4OGQC 3D71A 1NGMB 2QIWA 3B71A 3AE6C 2YIUC 3GF7A 4Y28J 4H44D 2V7QJ 1ZP0C 2E75C 4OGQD 3AEGC 1Q90D 2BEZF 4PV1D 2JP3A 3AE2C 1RQUA 4U7JA 1HJ0A 3Q1MA 4YTPC 1RQVA 3RK3E 1VF5D 4H0LD 4XFJA 2WSFJ 4H13C 3Q2YA 1IK7A 2E74B 3D70A 3D6YA 1DIPA 3AE7C 4RKUJ 2E76D 2WSEJ 3GF3A 2BEQD 3AEDC 5L8RJ 4YXDC 3AE4C 5KLIC 3SFDC 2D2CD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YIU C;  4H44 B;  2E75 B;  4Y28 J;  1S5L X;  2FYN C;  1JB0 J;  3C8V A;  1Q90 D;  4PV1 B;  2WSC J;  4KT0 J;  2WPV B;  2QJY C;  2O01 J;  4OGQ B;  4I7Z B;  1VF5 B;  4H0L B;  2QJP C;  5KKZ C;  2WSF J;  2ZT9 B;  2E74 B;  3LW5 J;  4RKU J;  1ZRT E;  2QJK C;  2WSE J;  2QSI A;  2E76 B;  2K9Y A;  4IL6 X;  5L8R J;  5KLI C;  4H13 B;  2QIW A;  2D2C B; 
#chains in the Genus database with same CATH topology
 3H1J E;  5FLX N;  3CX5 F;  5CA1 B;  4XDK A;  5LYJ B;  2HVJ C;  3F5T A;  4E4E A;  1KB9 I;  2HG5 D;  2JEE A;  3ZHU A;  4D6T H;  1RSO A;  3LSU A;  4K8X A;  4DV4 O;  2IH3 C;  4JAU A;  1SQV K;  2IU0 A;  3RK3 D;  2XND G;  2RCV A;  3CCS P;  1SQP G;  1ZV8 A;  2WSS G;  4JAV A;  3TXS A;  3CJH B;  3LNN A;  2PZS A;  2YIB A;  3RVZ A;  2P67 A;  1JY3 O;  1PPJ E;  1AA0 A;  3QG5 A;  1LT9 C;  2Y4T A;  4PD4 D;  1Y74 B;  5H2F E;  5D5P A;  4UB8 E;  2B5U A;  1ZW0 A;  2Q3I A;  3MHH C;  1EDJ A;  4HNA B;  1G2C B;  1KFM A;  1M1K W;  2AGA A;  5KJ7 D;  2YI9 A;  4WVZ A;  2V4D A;  2ZXW B;  1NU1 J;  3O6Q B;  2YXY A;  4JF7 A;  1HF9 A;  4LF5 B;  1ZTE A;  1VQM V;  3CWB J;  1K92 A;  2OTK E;  2P5O A;  2UXD O;  4I6M C;  3ZED A;  2YMY A;  2X6B A;  2ZFC A;  3H1J J;  2E74 D;  4EYY Q;  2OCC B;  2QKS A;  3EQ2 A;  4B7K A;  4NPE A;  1QLN A;  5AW1 B;  2P90 A;  1X79 B;  2QM8 A;  4MVR A;  4DV2 B;  4LF4 O;  1JTH B;  4C7N B;  4U3F E;  5GTI H;  4FK5 C;  3Q3D A;  3N4X A;  4PJ0 E;  1GRJ A;  4GX1 A;  5H5N A;  2OCC C;  3AE8 C;  1Q8I A;  4ASV A;  3B8E B;  4MVU A;  4TQF A;  4R6Z A;  2A7W A;  3O8Z A;  4AYC A;  3CCE P;  3DSQ A;  1GU4 A;  4B3T B;  1VQ6 V;  2VWJ A;  4NXN B;  4AI8 A;  2E5L O;  3RL0 C;  2WQY C;  2CGO A;  4I9Q A;  3HE4 B;  2WSF H;  4B3M B;  3QO7 A;  1L0L K;  2EIN B;  2FTK A;  4JI5 B;  5TIS H;  4OWF A;  4W7Z A;  3FWN A;  3P3N A;  1IJD B;  1NWQ A;  1L2P A;  3E83 A;  3E8F A;  1KQG B;  3D71 A;  2OYH A;  5B1A B;  4H44 D;  1JPX A;  2XT9 A;  2EIN C;  1Y76 B;  3AE2 C;  1YJN V;  1HNZ B;  1IK9 A;  1WT6 A;  3A2A A;  3WUT A;  1LTJ C;  1JA8 A;  3H1L J;  2AEJ A;  2QWN B;  3CCJ V;  1NU1 D;  2OIG A;  1R3I C;  4IHJ A;  4I5S A;  2K9P A;  2VQE O;  2OTJ V;  1OVU A;  2KUB A;  4N6J A;  1NZ6 A;  2UXN A;  1Q7Y Q;  3GF3 A;  3DGE A;  5AVZ B;  3JCZ A;  4KHP O;  1QU7 A;  1PV0 A;  4ZOL B;  2D2C D;  3D3I A;  5AVW B;  1M5I A;  4H44 B;  1FKA O;  3GLM A;  2F1M A;  4XDL A;  3DXR B;  1YJW V;  4JYA B;  1FJK A;  4X89 A;  3CSX A;  3WB1 A;  1OX3 A;  1MG1 A;  4L74 A;  3L36 A;  2EIK C;  1NTZ J;  3CX5 H;  3OW2 U;  1M90 W;  2MJZ A;  3L70 G;  4O9B A;  3UM7 A;  1FXH A;  1QLE D;  2WLJ A;  3B8N A;  1ZOY C;  3CX5 I;  3OMN B;  1Q3E A;  1NTK H;  3W7U A;  1IBL B;  3M0A A;  4LFC O;  2H88 C;  1XTC C;  3L74 E;  3RT3 C;  3N2K A;  1TVK B;  3CCM V;  1PPJ D;  1DX7 A;  1FDM A;  3D36 C;  1S5L H;  5BU5 A;  1VQO V;  1FOS E;  2X0L A;  2ZNI A;  2KB1 A;  4O4H B;  3SJQ C;  4GKK B;  1H2M A;  1QL2 A;  2NNU A;  4AQR D;  2B9Z A;  2XAF A;  3D36 A;  4DV5 O;  2JKV A;  5BVZ A;  2Z4E A;  3OGC C;  2ZIN A;  1AVY A;  3CCR V;  3L74 D;  1DLB A;  3L72 G;  1NVP B;  2YEV B;  4IYH A;  3CCL V;  4YHH O;  2E74 C;  2BTQ A;  2PGD A;  1YHQ V;  2WTY A;  3FB5 C;  1N7S B;  3W67 A;  4PV1 C;  2Q68 A;  5L3B A;  1GN2 A;  4LH6 A;  4O2A B;  1NO4 A;  4JTD B;  2OYI B;  2KQX A;  2O01 J;  1WJZ A;  2V7Q G;  5LXT B;  5APW A;  1AI5 A;  4LF9 B;  1TA8 A;  2IYO A;  3EFG A;  3CME P;  2Y48 A;  3MHV A;  4DV4 B;  5LL6 Y;  2O1K A;  3W7S A;  5KMG B;  2QWP B;  3SFE C;  3UQ8 A;  1XNQ O;  1Z2G A;  2R72 A;  3U10 A;  2XAG A;  3FB7 C;  2ZDI C;  3CL3 D;  4CPG A;  3CCQ V;  3I5C A;  3LUT B;  2GUZ B;  1AR5 A;  5KJ7 A;  5DM6 V;  1COW G;  1L4A C;  2HVK C;  1I0H A;  3I56 P;  2HG5 C;  4UXN A;  4BXL A;  4DV3 O;  3AG3 B;  1P84 I;  4JI8 B;  4CS4 A;  4HZ3 A;  2Q7E A;  4J80 A;  1IK7 A;  1IBK O;  4ZHQ A;  2NLJ C;  1L0N K;  3BAT A;  1Q82 Q;  3D6Y A;  4KHP B;  4RKU J;  2E3C A;  4BWN A;  4DK1 A;  5JWP A;  2Z3Y A;  3M9H A;  4FPP A;  1M8O B;  1FZG A;  4ASU G;  1US6 A;  3AG7 A;  1AB3 A;  1KD1 W;  5KAF Z;  1EDK A;  2EIK B;  4EB6 B;  1Q7Y W;  1S0V A;  3L73 E;  4UB6 H;  1HNZ O;  1S77 D;  4X64 B;  1NQT A;  1OJH A;  1GN4 A;  4D6T J;  2MK3 A;  5KLI B;  1OVR A;  3CMA P;  1SQQ H;  2BE3 A;  1PGJ A;  2ZYG A;  4B7E A;  1PGQ A;  2FB5 A;  1M7L A;  1SS1 A;  5BY1 A;  1SQB E;  2D3O W;  2VQE B;  1HP8 A;  5BXZ A;  3RBZ A;  5LA6 B;  2P10 A;  1OCC C;  4EFB A;  4TLF A;  5APY A;  3THO A;  3FKS G;  2HLO A;  2E5L B;  1UIX A;  1A02 J;  4F6R A;  1KQS U;  1BMF G;  3SPI A;  4JI3 B;  2ZQM A;  2JEU A;  1E5W A;  1S5L X;  5KX5 A;  1NTM E;  2AHZ A;  4ASW A;  4JPZ B;  3BAS A;  2I8D A;  1VQ5 P;  3D3Q A;  1H8E G;  3II6 A;  3WG7 C;  5EZY B;  4I7Z B;  1SQQ K;  4LF6 B;  1SQX H;  3K3W A;  3SWY A;  2EIL B;  3DC5 A;  1X9V A;  2WPQ A;  2ZT9 C;  3CRR A;  1EXI A;  3V5B A;  3KCX A;  4LF7 B;  3ZHQ A;  2FYU K;  2Y9Y A;  1GH6 A;  4GCZ A;  4YXW G;  4LFB B;  2IBZ D;  1D2D A;  4QMA A;  4JI0 O;  4X8A A;  1SP4 A;  3IR9 A;  3PRJ A;  1MZ9 A;  3N2K B;  1JY2 N;  1OZ0 A;  2AXT Z;  2UXX A;  1MV8 A;  2F66 C;  1SQP H;  3CS5 A;  2Y69 C;  5BZB A;  2XND H;  4PI0 A;  3L71 H;  1HVV A;  5DJT B;  1J5E B;  3A3Y B;  1Q6H A;  1NHL A;  2BSK A;  2IBZ I;  5LYJ A;  3VQV A;  2QRX A;  3ABU A;  1GMG A;  4OH8 B;  2GSM B;  4KL1 A;  2O01 H;  2JGD B;  1Q5O A;  1K8A W;  1KYO H;  1Q2N A;  1SQB J;  4WBN A;  2QVA A;  4O4I A;  1XNQ B;  1DD3 A;  2JWD A;  3W68 A;  4DR3 B;  5KUM A;  3O6Q A;  4FIP C;  5KA5 A;  3QH9 A;  2YIC A;  4DUZ B;  2G3A A;  2ILM A;  2P6J A;  2GV9 A;  2A9H A;  3F5W C;  4U3F D;  3CXH D;  1FDI A;  3HKB B;  3B71 A;  2JWA A;  2FXM A;  1N7S A;  5KLV D;  2FKX A;  1MMM A;  2NN4 A;  4DV3 B;  4GKJ B;  1VAR A;  2Q6Q A;  1OXZ A;  2YC0 A;  5B1B C;  1SES A;  3ZN1 A;  1EZV H;  1FZC A;  4AUW A;  3OEE G;  4PDV A;  1H38 A;  2A06 H;  1VQ4 P;  2WLL A;  4GX2 A;  1EZV I;  4BRY B;  2P7J A;  3B5N A;  4MVQ A;  1K9M Q;  2WSE J;  4DUY B;  1M57 D;  2BEQ D;  1J1E B;  5LP6 B;  3TXQ A;  1P7B A;  1Q43 A;  5L8R J;  5APU A;  1A32 A;  3ABK B;  2HR3 A;  4K35 A;  1HGV A;  1WB7 A;  1NH2 B;  2ZD9 A;  1LP1 A;  1FYJ A;  1BSN A;  2OIE A;  1BE3 D;  5M1B A;  3TNU A;  3OR6 C;  1OCC B;  4IFM A;  1KQL A;  1NTZ H;  1T5E A;  1LTJ B;  4GX0 A;  1SQG A;  4L87 A;  5GON A;  2HFE C;  4UB8 Z;  3JAL A;  4JV5 O;  2R5B A;  5E79 E;  3OUS A;  4LBE C;  5IY5 C;  3VMY A;  1VF6 A;  1BQ0 A;  2HPC A;  1X22 A;  4C46 A;  4LF9 O;  4KFM A;  4FLZ A;  1RH5 B;  2Q1K A;  2Q0O C;  1XRE A;  2PUS A;  3CCQ P;  1NU1 G;  1NH2 D;  3A0H E;  2LFR A;  3RBX A;  3BFR A;  2AZ2 A;  3RFR A;  3T1C A;  4JAS A;  1VP7 A;  3H1H J;  3ZHS A;  4U3F G;  1H8H G;  1KB9 D;  1VF5 B;  3IFM A;  2MKV A;  2Q9I A;  2RMK B;  4DXW A;  2XNX A;  1KIL B;  2LXB A;  4ZIB A;  1SF9 A;  1AR4 A;  3HUS A;  1URQ C;  3BHP A;  2Z5U A;  1JVM A;  3ZCC A;  4DV5 B;  2E76 B;  2QSI A;  4IL6 E;  1YIJ P;  4UCU A;  3CRC A;  1NVO A;  2H7H A;  2EIJ C;  4O4J B;  2F4V O;  3RL0 g;  4PA9 A;  3SWK A;  1NTZ K;  4YPC A;  5H6R A;  1S5J A;  1QX8 A;  4PA4 A;  4K3A A;  3SDL A;  5DN6 G;  2WLL B;  5A2Q N;  1ZR4 A;  3P7K A;  3G71 P;  3CCS V;  2E76 C;  1YDX A;  1L8D A;  4MVM A;  1SQQ E;  1FZF A;  4U7O A;  1ZUQ A;  1CI6 A;  2CTR A;  4X64 O;  2OYH C;  3WB2 A;  1U7M A;  3L73 D;  2IW5 A;  2YIA A;  2CTP A;  1YEW A;  1OCO B;  2ZJS E;  3AEB C;  1PP9 G;  4CZZ A;  3D6Z A;  5FPR A;  2XAJ A;  5KAF H;  4RQE A;  2Q6A A;  3LID A;  2ZDI A;  1PP9 H;  4X20 B;  5ITZ A;  1FJG B;  2FXO A;  3M06 A;  4OGQ C;  2QIW A;  3MAQ A;  5GTI E;  3K03 A;  2GUV A;  2B87 B;  4P9P A;  4Y28 J;  4IL6 Z;  1RPO A;  5AW6 B;  1SQP K;  5KLV G;  1K4C C;  1O9G A;  4IFD K;  1NR1 A;  5LGT A;  1LTA C;  3TDK A;  1K7D A;  3RYC A;  5APS A;  4DV1 B;  1GDT A;  3OA7 A;  1H2L A;  4NB5 A;  4HJG H;  1VQ8 P;  3BCC D;  2E74 B;  3D70 A;  4DUY O;  3OUF A;  1VQ9 V;  1DIP A;  1G8M A;  3AE7 C;  5LMN O;  4J7K A;  2WLI B;  4O2B A;  4D6T G;  3O65 A;  5CBN A;  4F6R B;  2QE7 G;  3FB6 C;  4HKZ H;  3G4S V;  1OFC X;  3MTU E;  1XDC A;  2FYU J;  1LJ2 A;  2ATK C;  3M7M X;  4UB6 E;  1ZLL A;  2OGU A;  3ASO B;  2YO2 A;  4BW9 A;  1LWU B;  1SFC C;  5IYB O;  2H3O A;  1GTO A;  4R4M A;  4H0L C;  1GU5 A;  4U7N A;  5EZY A;  1HNW B;  2KLU A;  3H1L E;  2L35 A;  2O1J A;  1WP8 A;  1JY2 O;  2R70 A;  5B66 Z;  3FXE A;  1NVP D;  3QTC A;  2KP8 A;  2FYU H;  2RKL A;  2ZIO A;  3RYF A;  2QJK C;  2XTA A;  5KMG A;  2IDB A;  3OJA B;  2QJP B;  5TIS E;  4DW1 A;  2YSU B;  2QWO B;  3UT5 A;  3RK2 C;  4DV6 O;  4NXM B;  4FLX A;  4H13 B;  4JTA B;  3BAA A;  3A8T A;  1PZQ A;  3GB7 C;  4I4T B;  3BVO A;  1Q86 Q;  1KB9 F;  2Q7C A;  2CE4 A;  3H1L D;  3S1K A;  3BCC E;  4L76 A;  2A06 G;  4ZI7 A;  2FBW C;  5IYD O;  4GYC B;  2E5Y A;  2YIU B;  3A0B E;  3QF7 A;  4FM1 A;  3F7V C;  4AHC A;  1I5X A;  1NJI W;  1OCZ C;  2WLI A;  4UCT A;  5EC2 C;  1VQ4 V;  4PDM A;  1VQK V;  5EFW B;  4FVM A;  5KTB A;  2A0L A;  3K0D A;  3E2E A;  1KMI Z;  1B04 A;  2P58 A;  4YHH B;  2Q0A A;  2KYV A;  3B5N C;  4EB6 A;  5K1P A;  5AVT B;  2RQ6 A;  1NTM J;  1F23 A;  1UII A;  4DR4 O;  4P2Z A;  1S5L Z;  1SQB H;  1G1J A;  4OX9 O;  3JSN A;  2KG7 B;  2OT5 A;  2ZT9 B;  3CEI A;  1JR9 A;  3IFX A;  5GTH Z;  5KX5 B;  4JI2 O;  2ZYA A;  5IYZ A;  3F7Y C;  1A02 F;  4ZMD A;  3B5N B;  4LGD E;  4DR5 B;  3B40 A;  4FM2 A;  5LA6 A;  4WFA V;  1T3J A;  2PFX A;  1SA0 A;  2ZM6 B;  1IUR A;  3FYE B;  3SJC C;  3GF7 A;  1KKD A;  1AV1 A;  3MDS A;  2UUB O;  1K5Q A;  1QVF O;  3JAW A;  4AQY O;  4YTP C;  5GON B;  3L73 G;  4PA6 A;  1SQX E;  4FFK A;  1G6U A;  1BHA A;  3OFN G;  3OE7 G;  1YI2 P;  1XHX A;  3OTO O;  1AP5 A;  1L0N J;  2FKW B;  3H1K H;  3CCL P;  4RWU A;  3X2Q C;  4DV7 O;  1AFO A;  1IX9 A;  1JJ2 U;  1PGO A;  3SYO A;  4FLY A;  2EZP A;  3ABV C;  2BCC E;  2KK7 A;  2LR2 A;  1SER A;  1KIL C;  1E79 H;  3P32 A;  1AP6 A;  1OWA A;  2PRR A;  2SPZ A;  2Y0E A;  5AVX B;  5IYC O;  1KU9 A;  2QEX V;  1V55 B;  1VQP P;  1EZJ A;  5CN0 A;  3SYQ A;  3G6E P;  4N78 D;  2YXQ B;  3JD3 A;  3JSL A;  3CLQ A;  5AW4 B;  4LF8 O;  2JGD A;  2OQQ A;  3HTK A;  1OCR C;  1HGZ A;  3L73 J;  1JMB A;  3L74 G;  2XAQ A;  3ETE A;  5JH7 B;  4B86 A;  1FPO A;  3M99 B;  3AEC C;  2VRZ A;  3W7T A;  2IZ0 A;  4NPF X;  3UIA A;  2GDS A;  3RN4 A;  2WLK A;  4O4J A;  3APQ A;  3E35 A;  3RVY A;  4J7J A;  3T4Z A;  4B3S O;  1V54 C;  1NU1 E;  5EBW C;  4TQD A;  2D2C C;  5B66 E;  3T1H O;  2WA3 A;  3MHS C;  4B3R O;  4W80 A;  4L8J A;  2YKP A;  3G6E V;  2IJK A;  3S3X A;  3AEF C;  1NAF A;  3G9R A;  2JIZ G;  3H1K J;  5J9P C;  3H32 B;  3H25 A;  1KV4 A;  3DTU B;  4JTC B;  4WFF A;  4QNH B;  1FDO A;  3CC2 P;  1URF A;  1YVW A;  2PY5 A;  4LF7 O;  2HOD B;  1XL6 A;  3JAS B;  4LFB O;  3O9O A;  3JCU Z;  3G4S P;  3FGA D;  1XMQ O;  1IXB A;  2HYN A;  3K58 A;  2JJL A;  3L35 A;  1AIL A;  5LP6 A;  1WNS A;  3ABL B;  1OMI A;  4PD4 E;  3V2N A;  3G3Z A;  1ZL8 A;  1NTM H;  1LTS C;  1FZA A;  4PDR A;  2QJY C;  4MTO A;  2CPB A;  1NR7 A;  3SSU A;  2RN0 A;  1XTG B;  4G2K A;  4DT0 A;  2HHH O;  3H1L H;  3MD0 A;  1GMJ A;  3CME V;  3ABL C;  1D5A A;  5CBG A;  4IT5 A;  2N1T A;  3ASO C;  1PV3 A;  1HR0 B;  4DR3 O;  2YEV A;  4EKW A;  3CRA A;  1TUB A;  4QIW F;  3CXH H;  3CCU V;  1SET A;  4R50 A;  1OW6 A;  2IBZ E;  3E86 A;  4I55 A;  1G4Y B;  2JK5 C;  2FYU D;  2R9A A;  3HTK B;  3L71 E;  3VMA A;  4X65 B;  3FWL A;  2IU3 A;  2QDO A;  1K8A Q;  3Q1M A;  1RQV A;  5KAI H;  4DUZ O;  5F2V O;  2A45 I;  4H0L D;  3RK3 E;  4H13 C;  3PP5 A;  5CCG D;  1NTM D;  1I7F A;  1OCO C;  1VEW A;  2B1G A;  2POH A;  3MIW A;  1GKF A;  5E79 H;  4LR3 A;  4J9Z B;  2FYZ A;  1SQP D;  1PNL A;  2FFD C;  5J2U B;  4N21 A;  3ZHT A;  4H33 A;  4TV8 A;  1YBK A;  4PI2 A;  4O2A A;  1SQX J;  2EUL A;  1N34 O;  5KLV J;  4E2L A;  2J58 A;  1GN3 A;  3OGI B;  4L75 A;  3BRC A;  3RK3 B;  2ZIM A;  3ZS8 C;  1OCR B;  3VQY A;  3N2G B;  4JI8 O;  2A79 B;  3CHX A;  1NJI Q;  1WLE A;  2ZR2 A;  4X20 A;  5EIB C;  5ITZ B;  4JGS A;  5TIS Z;  5L3D A;  1KIL D;  2Q8V A;  3K57 A;  1K4D C;  5APQ A;  2UXC B;  1NTM K;  1U96 A;  1L4A B;  3T97 A;  3P30 A;  1W59 A;  3QNE A;  1ZRT E;  1YXB A;  3PN1 A;  4J41 A;  2B9B A;  1KTM A;  1PP9 D;  4X66 O;  3CD6 V;  1TU3 F;  2NPS D;  3AG1 C;  1YF2 A;  1D7M A;  3BA8 A;  5B5E E;  1IXM A;  3RGB A;  1JB0 J;  3ETG A;  5JQG A;  3WG7 B;  4UCS A;  3L73 H;  2W6I G;  1JMM A;  2QWR B;  1ORQ C;  2C0X A;  3EVK A;  3HKC A;  5BR8 O;  4YXW H;  1B06 A;  1Y76 A;  2EIL C;  1XEQ A;  2F93 B;  1ZX3 A;  1NTZ E;  1FD9 A;  2JRI A;  2M7W A;  1NOH A;  1FC2 C;  5FPO A;  4RJT A;  3HD7 C;  3HR0 A;  2JDI G;  2WLH A;  3D8C A;  2WLN A;  4GOE A;  5LOV B;  1Y9B A;  2IJH A;  3CWB E;  3M9B A;  3LDE A;  3HD7 D;  4JZ2 A;  1MZF A;  1VQ7 V;  2N05 A;  2W8Z A;  3LSQ A;  2C2A A;  3BCC J;  2R32 A;  2R9R B;  4MW8 A;  2EJ7 A;  2NRG A;  4UCR A;  1VQ8 V;  4EEQ A;  1SRY A;  3H1I J;  3CCJ P;  5JJE B;  1OCZ B;  2C9N Y;  1R8E A;  2K3R A;  2P2U A;  3JSV C;  2QJ1 A;  2ADQ B;  1DEE G;  2HKO A;  2A3Q A;  4IL6 H;  3K5O A;  3FX0 A;  2WT7 B;  3AE6 C;  3ZRX A;  2YUA A;  4CH4 A;  2YIU C;  5H9C A;  1MNG A;  3UT5 B;  1XBL A;  3RK3 C;  2KI7 B;  5BMV A;  2M5A A;  4ICG A;  3PLN A;  2BEZ F;  1FAV A;  3K06 A;  4RUF A;  4LWS A;  1KP3 A;  5LMU B;  1SQB D;  2K88 A;  3L74 J;  2HHH B;  2WWW A;  3SPJ A;  1Q6I A;  3H9V A;  1Y67 A;  2QKC A;  5C93 A;  1N8R Q;  2EZO A;  1MUU A;  1YCI A;  1JY3 N;  2PAJ A;  1BE3 H;  1MAB G;  1K73 Q;  3OMA B;  5JH7 A;  4JPR A;  5IY5 B;  1URQ A;  5LOV A;  1N34 B;  1IDS A;  1TUB B;  4C7N A;  2P4V A;  2W6A A;  4WCE V;  3KHU A;  4YY3 B;  3ZMV A;  2RJZ A;  4FZ0 A;  1SKV A;  4PA3 A;  3A0R A;  3STL C;  2CTW A;  5H6Q A;  1KYO I;  2Y69 B;  4WBN B;  2OTL V;  1KIL A;  3GHG A;  5AVU B;  1KYO E;  2GBO A;  1RF0 A;  1S5H C;  5C8Y B;  2OYI A;  1EZV D;  2Q5Z A;  2PTM A;  5CJ4 A;  2YNY A;  3HKE A;  5EK0 A;  2Z5H A;  3E22 A;  5APT A;  1ZAU A;  2Q7G A;  3ABM C;  2A06 E;  1QVG U;  3PHL A;  1YI2 V;  1I08 A;  1F4M A;  2OYQ A;  1JCH A;  3WFV A;  1SZX A;  1S9K D;  2HEP A;  3H1I G;  2QJY B;  3E8G A;  4U3F H;  1T6A A;  3VOP A;  2YMK A;  1S5L E;  1NTK D;  3JD1 A;  2R44 A;  1SQP E;  3SYA A;  2BTO A;  4H37 A;  2Q3E A;  5GTH E;  1M1J A;  3VOU A;  1EZV E;  4WBA A;  1R3K C;  1RM1 B;  1GK4 A;  2GUZ A;  4B3S B;  1PL5 A;  1N33 B;  2AHY A;  2NZ2 A;  1S9K E;  3U1C A;  1JCC A;  5B1B B;  1IBM O;  4AIL C;  2OTJ P;  4DR1 B;  4KJM A;  5FNV B;  3L71 D;  3KKY A;  3W7X A;  1KQF B;  4DW0 A;  5IWA B;  2WSS H;  3M0D A;  3E1I A;  4MVS A;  1GL2 B;  4DR2 B;  1L0N E;  3AG2 B;  2WZ7 A;  1HNX B;  2LGQ A;  2ZYD A;  2HP8 A;  1P4R A;  2BOC C;  4CH5 A;  3RYC B;  4UCV A;  2K9J B;  3CB2 A;  3KCY A;  2PI4 A;  1VQN P;  3GHG B;  4WB4 A;  1AQ5 A;  2QSA A;  1WPB A;  2VWK A;  5JQG B;  2UXC O;  4ZBM A;  3BCC H;  2GA1 A;  4IHJ B;  3Q5P A;  1N7S D;  4G27 B;  4Q20 A;  3U11 A;  3JYC A;  4KXR A;  3A0B H;  4UVA A;  1AI7 A;  3R4Y A;  3E22 B;  2K1A A;  3JAR B;  2RDC A;  4DV2 O;  1QR9 A;  1UFI A;  5EC1 C;  4LF4 B;  1BZK A;  2M3E A;  1BGY E;  2AXC A;  2O57 A;  4TSF G;  3ZIA G;  2K37 A;  4LF8 B;  1IZN B;  5J2U A;  4B08 A;  4LCU C;  3IAO A;  5LGN A;  1FOS F;  4TT3 H;  1U7J A;  4FFB B;  1JOC A;  3ZRW B;  1MFT A;  5H2F Z;  4NTY A;  2ZVN B;  4B3T O;  2ZM6 O;  1GAX A;  2V7Q J;  1R5L A;  3FB8 C;  1Q90 D;  1VQP V;  3CP1 A;  5B66 H;  3GWO A;  3VQW A;  2XHB A;  4NVP A;  1XI1 A;  5IJ0 B;  1LWU C;  2GTS A;  2VQF O;  4U7J A;  1YTZ T;  4Y99 B;  1ZN5 A;  3H6P A;  1YTZ I;  1PP9 J;  4L73 A;  4X62 B;  2Z5I A;  1UPG A;  3FD9 A;  1JX9 A;  1Z5W A;  3R2P A;  2G38 A;  2FFD A;  2VS0 A;  3KDP B;  1YYC A;  3H1K D;  1JY3 P;  3H32 A;  1XOU A;  3CPW U;  4X1K B;  2ADP A;  4A5U B;  5BMV B;  3F89 A;  2Y9Z A;  2WSC J;  1H0T A;  3AEE C;  1RE3 A;  4JYC A;  1KB9 E;  1EN6 A;  1N7L A;  2KSD A;  2XAS A;  4OGQ B;  5EBM C;  2N9Y B;  3APO A;  2DQ3 A;  3CC4 P;  3G67 A;  3T1Y O;  3K04 A;  2OYH B;  1IO4 A;  1NKZ B;  4HAM A;  3RL0 B;  4BIU A;  5JVD A;  4HBN A;  3K5L A;  1GO3 F;  2J59 M;  2CDY A;  2KKW A;  4U3F J;  2ZE7 A;  4WFG A;  1H88 A;  2E75 D;  5CBH A;  4GX5 A;  3K9S A;  4NKG B;  3AE3 C;  3MGN A;  1BDC A;  2L5G B;  1VQL P;  4UVC A;  3ICX A;  4YJ3 B;  4CC6 A;  4PD4 F;  2V4H A;  1OV9 A;  4O2B B;  2UUC B;  3AG2 C;  4RES B;  4D6T D;  4KP4 A;  1PM9 A;  1PGP A;  3HRN A;  4NXN O;  3PTZ A;  2AXT H;  2ODM A;  2N9B A;  4QE9 A;  3GMA A;  4GDO A;  3JAK A;  1XQ8 A;  3B5N D;  3WUU A;  2DYR B;  3L70 J;  1AJN A;  4ZOL A;  3K08 A;  1GZL A;  1FJP A;  1YJ9 V;  3JAW B;  2Z0A A;  5L3C A;  1ZWI C;  4TV8 B;  2GUS A;  5IJ0 A;  1NTK K;  4WY4 B;  5AW2 B;  3H1H G;  1N73 B;  1T2K D;  1J95 A;  1WP7 A;  3L37 A;  1ZME C;  5KUK A;  2A06 D;  2LGW A;  2X6A A;  4XDJ A;  1RY3 A;  4JBZ A;  3UO3 A;  2ZE5 A;  2LJ2 A;  5L3E A;  5IT9 N;  4OVN F;  5APV A;  1LT9 B;  1YQ4 C;  2YKQ A;  3RYH A;  5AW5 B;  5AW8 B;  2JS5 A;  1OZH A;  1P84 E;  1VIB A;  4Z1M G;  1RPR A;  1NU1 K;  1N73 C;  1IFN A;  1U57 A;  4X1K A;  1P84 F;  1I94 O;  4TUY A;  3U1A A;  2O01 N;  1RF1 C;  4MTF A;  1S3J A;  3SPH A;  3TGU J;  3WU2 E;  3B8M A;  5KAI Z;  3L70 D;  3GVM A;  1ZRT D;  1HBW A;  2ITD C;  2LXC B;  2W90 A;  3I55 V;  1HJ0 A;  2XKM A;  1HWY A;  4UV8 A;  4BR6 A;  1H2G A;  3TET A;  3TGU E;  1VQ6 P;  2JEX A;  4XBF A;  4MTX A;  4N3Y B;  2W27 A;  1E79 G;  3CC2 V;  1QHT A;  1J2J B;  1K3E A;  2W6J G;  5KLI C;  1TAE A;  1P7G A;  3SPG A;  2AEM A;  3CC7 P;  4FMT A;  2YXL A;  2QEX P;  3R65 A;  1LTT C;  1WB8 A;  4YY3 O;  2VQF B;  3S4R A;  5KLV K;  1MSD A;  3AG4 C;  4D7S A;  1OIP A;  3MUD A;  1NAY A;  1CEZ A;  3ZMU A;  3J80 N;  3A7O A;  3RK2 D;  4CC5 A;  3BRT B;  1HH0 A;  3B4S A;  4DV7 B;  4PD4 I;  4O4L A;  1QQC A;  5C39 A;  2LW1 A;  3ZBH A;  1SQV J;  1Y66 A;  4JQ0 D;  3KXD A;  2FL4 A;  3W7W A;  3CXH I;  1CXZ B;  3E7K A;  1ARO P;  2OWO A;  1PIX A;  2DWE C;  5DED A;  1BE3 G;  4N78 E;  1AJP A;  2WAM A;  3J7A U;  2EIJ B;  1GM9 A;  2JJ2 G;  4BAY A;  1IFM A;  3RWR D;  2ZAE B;  1R3L C;  4H0L B;  1SQQ D;  1MKM A;  3JAR A;  1F7Y A;  2Q9L A;  2N74 A;  4P30 A;  2FXP A;  1M56 D;  3CI9 A;  3M0D C;  2LFS A;  3QO5 A;  2W83 C;  5JVD B;  4A7P A;  1NTM G;  1FFT B;  5IJ9 B;  4DRX A;  1BCC E;  4NPD A;  1MA1 A;  4JI5 O;  1URQ D;  3KZI Z;  4P9O A;  1NS1 A;  4YJ3 A;  2P4K A;  3M8A A;  3DXR A;  1FS0 G;  4BRY A;  3Q4H A;  2L91 A;  1OVV A;  3NXS A;  2QKA A;  4HNA A;  1G2C A;  2IZ1 A;  3AE1 C;  1KB9 H;  2Q5U A;  2XZR A;  4LLH A;  3JAT A;  5EBL C;  1L4A D;  1QLE B;  5B3S C;  5IE9 A;  4O4L B;  5CHX A;  5CBF A;  1LP1 B;  4Z2W A;  1USE A;  4JI6 O;  5AG2 A;  2IFM A;  2PI5 A;  3AE5 C;  1DF5 A;  2KSE A;  1AVO A;  1FE6 A;  2Q69 A;  4X1I A;  5LMN B;  3IC7 A;  3CWB H;  1LTG C;  4IGG A;  4FJC C;  2DOS A;  1HWT C;  4X9Q A;  2ZNJ A;  3GW6 A;  3ZN0 A;  1YTF B;  1W5C E;  3V2P A;  4IYI A;  2XV5 A;  3FXD A;  4JYA O;  4KUM A;  4NYK A;  5LHI A;  1NTZ D;  1ROP A;  2FYU E;  1JQ0 A;  4ZI7 B;  1G1I A;  4DO2 A;  1J1D B;  5AW9 B;  2YKO A;  4DR7 B;  4UB6 Z;  2IJI A;  2AXT E;  3HD7 A;  3CPW O;  3GHG C;  3K9A A;  3OAK A;  4UV9 A;  1BCC J;  3AE4 C;  3AG4 B;  1GL2 A;  2UUB B;  1H2K A;  1ZL8 B;  3V6I A;  3R66 A;  3CXH E;  3B2E E;  1M56 C;  1QEX A;  3VP9 A;  3L74 H;  1EN5 A;  1IBL O;  1WPX A;  2M8R A;  1HNX O;  3JD0 A;  3CC7 V;  3IAY A;  2IFN A;  2GM4 A;  2P22 C;  2C0W A;  2N04 A;  3SJB C;  3ABT A;  4O4I B;  4FFB A;  5EYP B;  3ZJZ A;  1RHZ B;  5IJ9 A;  1X8Y A;  3L75 E;  1EDL A;  1MFZ A;  2FML A;  1EZV G;  4JAA A;  4XA4 A;  1VQK P;  5KLV H;  1SQF A;  3HKB A;  1U97 A;  2RNB A;  4DR6 B;  5IYZ B;  3AE9 C;  4H13 D;  3K5B A;  4W4L A;  1M1J C;  2UXD B;  4WFH A;  2RH0 A;  1K97 A;  1LTI C;  1OW7 A;  5CCH A;  4K0K O;  5CA0 B;  1SA0 B;  2EIM C;  5B5E H;  4MS2 A;  3AEA C;  1DGS A;  1FXV A;  4LP8 A;  1NTZ G;  4J10 A;  4YJ2 B;  1D5N A;  4R4L A;  2K1E A;  4JV5 B;  1KN7 A;  1S4X A;  4RO0 A;  1KYO D;  2QR4 A;  3P3P A;  3HPL C;  2JDI H;  1AI4 A;  3ITK A;  2GHY A;  2R3C A;  1SQV H;  1DH3 A;  2EIM B;  2V7Q H;  5GTI Z;  3SPC A;  4DV6 B;  2YID A;  4NXM O;  2FY8 A;  1NI8 A;  1VL2 A;  4MVZ A;  1UJW B;  2ZKO A;  4BW5 A;  2W0X A;  3USS A;  1KD1 Q;  2QTS A;  2K9Y A;  3CCR P;  3MP7 B;  1WRG A;  2FFD B;  2IBZ H;  5D5Q A;  1N33 O;  4ZKU A;  1JM0 A;  4UFZ A;  1RSO B;  5LP6 C;  1NU1 H;  4NR1 A;  1SQX D;  1LUV A;  1EXJ A;  2AZ0 A;  5J2T A;  4D7T A;  4FM0 A;  3FFQ A;  1JUN A;  3ASN C;  3L4F A;  2BCC D;  3BPZ A;  1W2B O;  2KIK A;  4OX9 B;  3OT7 A;  3UCS C;  3H1K E;  5CCG A;  1M1K Q;  4GT1 A;  2V1D A;  5KKZ B;  1GD2 E;  3A0H Z;  4IL6 X;  1FZE A;  1LWU A;  3KZI E;  1M56 B;  3CD6 P;  2P7T C;  4DV0 B;  3CCM P;  1SQQ G;  3A5T A;  1N86 A;  4YJ2 A;  2R3S A;  5L3G A;  4OGQ D;  4ABM A;  1Y4M A;  2QM4 A;  2JP3 A;  2LO1 A;  4F6E A;  2C9L Y;  1SS3 A;  3F5H A;  1PKX A;  5HFM A;  1KC8 W;  1PNM A;  5CBO A;  2YIB D;  3TCU A;  2JGU A;  1VQ9 P;  4AQY B;  4DR7 O;  2KNC A;  3L72 D;  3RL0 D;  4I4T A;  3AEI A;  4GUN A;  2E76 D;  1GL2 D;  3H01 A;  4F4L A;  4CBC A;  1SQB G;  3AED C;  4YXD C;  4UVB A;  2PGG A;  1L0L G;  2E43 A;  3LW5 H;  4OXS A;  3OTO B;  1T2K C;  1ZXG A;  1DEB A;  4XE5 B;  1PL4 A;  2DW4 A;  1K73 W;  1DD4 A;  4HH2 A;  3JAM N;  3NR7 A;  1QR8 A;  5J2T B;  1L0L D;  5LGU A;  1SLQ A;  3MZW B;  2YXH A;  2R9I A;  2QJK B;  1GW4 A;  2LKM A;  4CS2 A;  1PD3 A;  2DN9 A;  1BHB A;  4JI6 B;  2KXP B;  3P8C D;  4GIF A;  4J7Z A;  4GKK O;  4NTX A;  2X6C A;  1B3Q A;  3FYI B;  4QGP A;  1N32 O;  3T1Y B;  4MT8 A;  1TGO A;  1YQ3 C;  1YJ9 P;  4PD4 H;  1KBH A;  4I2L C;  5KJ7 C;  1SQP J;  1L0N D;  4TOI A;  2F4V B;  3E8B A;  1FFX B;  3C8V A;  3ZRS A;  3UO2 A;  5KHG A;  1Y6X A;  1QVG O;  2Q7H A;  5EYP A;  1USD A;  2BAS A;  1HDJ A;  4EDF A;  4YIP A;  3JD2 A;  1JFF B;  1J5E O;  3TGU H;  3QO8 A;  1S76 D;  4UCO A;  3C1L A;  3HKE B;  5B1N A;  1FZB A;  1QBZ A;  2BOB C;  4EFE A;  2OYO A;  1KZU B;  1AI6 A;  1M57 B;  4JYY A;  3BCC G;  3V4Q A;  4DOJ A;  1VQN V;  3L75 J;  1R6T A;  1HR0 O;  5K1X A;  1JJO A;  1K5S A;  1FJG O;  1T3U A;  4B3R B;  1XHZ A;  2F23 A;  3HKD A;  3JC2 2;  2I1K A;  4J9Y B;  1YJN P;  5KAI E;  3I55 P;  2WPD G;  1FZC B;  1IC2 A;  2WMM A;  1FS0 E;  4TT3 G;  4LFC B;  1GM7 A;  1OHH G;  4FLV A;  5AVV B;  5APX A;  1TVK A;  3Q5R A;  1NYH A;  3T97 B;  3EXA A;  3RGU A;  2Q4P A;  1PPJ H;  3VN0 A;  2CUG A;  3JAL B;  2Y0P A;  1QCE A;  5GW7 A;  1T8Z A;  4TV9 A;  3H1H D;  3OAA G;  1BQZ A;  1FU1 A;  4PJ0 H;  2HPC B;  2A45 G;  1GW3 A;  1Q81 Q;  1IZ3 A;  2CTQ A;  1DTO A;  2ZE6 A;  2A45 H;  3HE5 B;  4PV1 D;  2NPS A;  3KYQ A;  1W0J G;  3L75 D;  3CYO A;  1LTJ A;  2B89 A;  1EFR G;  3CX5 D;  3P8C E;  1VF5 D;  4QE7 A;  2WSF J;  3G80 A;  5LBQ A;  1XL4 A;  1VMG A;  4MSW C;  3VQX A;  3L9D A;  2ZXE B;  4JI1 B;  1LNQ A;  4QPK A;  1ZLZ A;  5CMZ A;  3WUV A;  1W2B U;  2EJR A;  1WA8 B;  2BTQ B;  1NTK E;  1BCC H;  4GZR B;  4PDL A;  3JD4 A;  3K79 A;  1BS3 A;  3HB3 B;  3G6B A;  1N0N A;  2E75 B;  3PJS K;  1HUC A;  2Y0D A;  1JNM A;  1SQX G;  1Q82 W;  5GTH H;  5LMU O;  3CCE V;  2OAR A;  4DV1 O;  4KT0 J;  3I56 V;  2DW3 A;  4MN4 C;  1KIL E;  3V2R A;  1LUW A;  4LH7 A;  3IC9 A;  3S9O A;  2ZT9 D;  2YDE A;  1GTW A;  1BE3 E;  2KS1 B;  1CP9 A;  3JAT B;  1Q81 W;  5EIB D;  2E42 A;  4OPH A;  3E89 A;  1N73 A;  5JJJ B;  5CCH D;  2CH7 A;  3RYI A;  1MOF A;  2N1T C;  4FLT A;  4R8C A;  3TF5 A;  2CPS A;  1H2S B;  1H89 A;  2D2C B;  4I1L A;  1WN7 A;  1N2D C;  4X66 B;  1X59 A;  4CS3 A;  2NPS B;  3RYH B;  4DK0 A;  3T2M A;  4ZHQ B;  5E79 Z;  2B87 A;  2WSE H;  3CX5 E;  1Q6U A;  1SQB K;  3CE2 A;  2M6Y A;  2N1T B;  1W0K G;  2M5A B;  2I1J A;  4TUY B;  3L72 J;  4LWS B;  2DYR C;  1TUE B;  3WU2 Z;  2P06 A;  4I50 A;  1XNR O;  4I55 B;  3KQG A;  3A2F A;  3IN6 A;  2JJ1 G;  5DEC A;  1X4T A;  3H1H E;  1THZ A;  3VYI A;  3HD7 B;  3OTF A;  3TK1 A;  4H44 C;  5KHI A;  1SFC B;  2JR8 A;  3AK1 A;  2DJV A;  3ZHV A;  1PP9 E;  2XOK G;  1BE3 J;  4K8Z A;  2YXR B;  4FZ1 A;  1P84 D;  5JCO A;  3C9I A;  2DE0 X;  2OCH A;  1MSW D;  1VQO P;  5KA6 A;  2UUA B;  4GKJ O;  2QJP C;  3STZ C;  4IIJ B;  5C8Y A;  3RK2 B;  3SYC A;  1BSM A;  3CC4 V;  4JYB A;  2QG4 A;  1V55 C;  3OEH G;  1HJB A;  3DC6 A;  3EWK A;  1OW8 A;  4N23 A;  4PA7 A;  2PP6 A;  5KHJ A;  3A0B Z;  4MVO A;  1ZR2 A;  1R3J C;  3H1J D;  3ZMT A;  2QWQ B;  1Z5V A;  5JJN B;  2WPS A;  4DZO A;  1NGM B;  1YSC A;  5AVY B;  3BA9 A;  1JY2 P;  4ZKP A;  1SQV G;  2F95 B;  1ZP0 C;  4WFE A;  2EX3 A;  1EDI A;  5B1A C;  4BWA A;  2L6L A;  2UXB O;  1HTL C;  4D6T E;  4GLX A;  3TGU G;  2LW7 A;  1JTH A;  3OW2 O;  4CH6 A;  5K5G B;  2CH7 B;  3RYI B;  1K34 A;  3M91 A;  2W6J H;  4GKG A;  3VTP C;  1DK1 A;  4I50 B;  1RFY A;  3CRM A;  4O4H A;  2IBZ G;  1KKC A;  2M3B A;  3ABK C;  4WY4 A;  5FNV A;  5H2F H;  1VPC A;  3H1L G;  1N36 O;  1XUQ A;  4TV9 B;  1RE4 C;  4X65 O;  1CW5 A;  3LNM B;  3ABM B;  2BSK B;  3ASN B;  4FLW A;  5BU8 B;  1EN4 A;  3H1I D;  2LQT A;  2CAZ C;  3OM3 B;  3K59 A;  2KSJ A;  3NTN A;  5CMU A;  3TGU D;  1YJW P;  1RE3 C;  4RAI A;  1RE4 A;  1M57 C;  1F4N A;  5KKZ C;  3WMM 0;  2LP7 A;  4X62 O;  1JO5 A;  3J81 N;  4LC1 A;  3T1H B;  4EOT A;  3LIE A;  5LHG A;  1L0N H;  3H1J G;  2UU9 B;  1AJQ A;  3L70 E;  2H43 A;  2NPS C;  1RP3 B;  3OMI B;  3KZI H;  3H1J H;  4DR6 O;  2H8P D;  1K05 A;  3FX7 A;  4JI0 B;  4NTW A;  4X1Y B;  2ZXX A;  3QVN A;  1LT1 A;  1KYO F;  1KOR A;  1KUQ A;  4DCK A;  1XMQ B;  3JCU E;  1BDD A;  1B6Q A;  1YTF D;  1NKN A;  4DYL A;  2PF4 E;  5KHH A;  3CMA V;  2KB7 P;  5AW0 B;  1HW7 A;  4PEL A;  4ZKI A;  3AK2 A;  1AJY A;  3EFF K;  2WLM A;  1CZQ A;  3CCV P;  1YZB A;  1BGY H;  4LFA B;  2WA4 A;  4RQF A;  1BCC G;  1P84 H;  1EM1 A;  4LNU B;  5CB4 A;  4PHZ A;  4UUJ C;  2IYP A;  4DR1 O;  1YIT V;  4UB8 H;  1SQX K;  3VMZ A;  2J5U A;  1FXK B;  2IM9 A;  3VMX A;  1GL2 C;  1J1E C;  3P8M C;  4DR2 O;  3K0G A;  3L72 E;  4Z1M H;  4R7C A;  5BR8 B;  4BIZ A;  2YO3 A;  3SWF A;  2OTL P;  3L72 H;  1CSB A;  2CGN A;  2HLD G;  4U3J B;  2NR5 A;  5CCG C;  1W2E A;  2WPR A;  3B77 A;  4FLU A;  4JI7 B;  3NMD A;  1FBM A;  1RF0 C;  3ETQ A;  5IWA O;  1H0T B;  3C90 A;  3SYP A;  2OYI C;  1FXK C;  2QE7 H;  1JMK C;  4DJG A;  1XMO O;  3CWB G;  2N1T D;  3VP8 A;  1F51 A;  2IJJ A;  3QWO C;  1V9P A;  2O3J A;  1O9H A;  3ZMZ A;  1GN6 A;  1N7S C;  3ETD A;  2XAH A;  3ZX6 A;  1NH4 A;  4LF5 O;  3SJA C;  1M4U A;  2CK3 G;  1SFC D;  4DV0 O;  2UUA O;  5L3F A;  4GOF A;  4QPJ A;  1M9N A;  2FYU G;  3KG2 A;  2Y0I A;  1FZC C;  5HFL A;  2IH1 C;  2BCC G;  4XFJ A;  4RUE A;  3CXC U;  3HKD B;  5AVR B;  2JVD A;  2FYN B;  4QJF B;  3EHB B;  1I94 B;  1N36 B;  1I5Y A;  1JFF A;  5LXT A;  2UUC O;  2WT7 A;  2B1I A;  1R1B A;  2KG7 A;  3BY6 A;  3T4D A;  1XNR B;  3LSS A;  2E5T A;  2MW2 B;  5B3S B;  2KOG A;  1SC5 B;  3V4W A;  1ZSP A;  4U3J A;  2FYN C;  5FL7 G;  3JAS A;  1BGY D;  1HNW O;  1BL8 A;  2KZI A;  1G1X B;  3L75 G;  3TYY A;  5B5E Z;  1PNK A;  3IGA C;  1VF5 C;  1PPJ G;  4B3M O;  3L75 H;  1BT8 A;  1N4C A;  4EI2 A;  5JCO C;  2BCC J;  4MW3 A;  2QA4 P;  2DQ0 A;  4I9W A;  4LF6 O;  3E1R A;  1Q86 W;  4Q6G A;  1LT9 A;  1NBM G;  4I0X B;  5IDJ A;  1JEK A;  1YHQ P;  3FAV A;  2XDJ A;  3LDD A;  1IFJ A;  1Z56 A;  1M93 A;  3K5M A;  4JI4 B;  1RM1 C;  2UXB B;  1KFN A;  4TWK A;  1E1Q G;  1VQ7 P;  2PYL A;  2QTO A;  2IPP A;  1BSH A;  2AEF A;  1J1D C;  1Y8A A;  2UWJ E;  1IFD A;  2Q73 A;  5DJU B;  2DYS B;  3G71 V;  3TJT A;  2WPV B;  2P1J A;  1R6K A;  4IOI H;  5KHK A;  3LDC A;  3H1I E;  3HE5 A;  3CJH A;  3H1I H;  5AVQ B;  1L0L J;  4DR4 B;  1IFI A;  3ZRW A;  1GK6 A;  2RMZ A;  3AK3 A;  3NFQ A;  1LR1 A;  4WF9 V;  2QA4 V;  5KAF E;  1P49 A;  1WA8 A;  2JS3 A;  2ITC C;  2KLV A;  1MZE A;  3BEH A;  3WB0 A;  1K33 A;  1K9M W;  3E8H A;  1PL0 A;  3IJ4 A;  2PYJ A;  2X7R B;  4WY4 C;  1BGY J;  1M1J B;  4M3L A;  5TJH A;  1N8R W;  5E1A C;  1R6N A;  1RF1 B;  3N27 A;  1NTK J;  4W7Y A;  1R5S A;  4JI2 B;  4I7Z C;  5CA3 A;  3H1K G;  1DF4 A;  1SQQ J;  1AQT A;  1L0N G;  3TNU B;  3N2G A;  3SR2 C;  1EC5 A;  3L71 G;  2JO1 A;  2WVR A;  1H8A A;  4DR5 O;  4X88 A;  3RYF B;  2WSC H;  5AW3 B;  4LNU A;  5CA0 A;  5CB4 B;  2KS1 A;  2ZR3 A;  1S72 V;  3CWB D;  3Q5S A;  2H89 C;  3CRQ A;  2WIT A;  2DWD C;  1Y47 A;  4ZNC A;  3VBB A;  1YIJ V;  3SGI A;  5LHH A;  3CCU P;  5AVS B;  4HYO A;  1H2N A;  1WAZ A;  2KZJ A;  3GG2 A;  4HYT B;  1ENV A;  2QM7 A;  1NTK G;  1S2E A;  3A0H H;  2DMX A;  4W4K A;  2HFE D;  4HB1 A;  1BGY G;  1SQV E;  4I0X A;  3K5N A;  1L0L H;  2YI8 A;  3HE4 A;  2F43 G;  1L0L E;  1L4A A;  3BAB A;  3BVH A;  1QLE C;  3I5D A;  4OPA A;  3L71 J;  3V2Q A;  3BRV B;  4KHX A;  2K9J A;  1YIT P;  1Y74 A;  4IIJ A;  1E1R G;  4J42 A;  3S3W A;  3HUS B;  3UKM A;  4DRX B;  2RN9 A;  3SFD C;  2IX7 C;  3C3T A;  4JI7 O;  3CXH F;  2DYS C;  3TSI A;  4BIO A;  1SFC A;  3ZHR A;  3N7N A;  1KC8 Q;  3HKC B;  1QL1 A;  4JI1 O;  3OD4 A;  4GOD A;  2AW9 A;  3GWK C;  4J11 A;  2YS8 A;  3LW5 J;  3Q4H B;  1LTB C;  2KNC B;  4PJ0 Z;  1IVS A;  5CJ0 A;  1LGH B;  1SVF A;  1JCD A;  2UU9 O;  2ZVO B;  2QGN A;  1NT2 B;  1N0J A;  1RF1 A;  1FXK A;  2CK3 H;  2HJD A;  5CCH C;  2H94 A;  4C7U A;  1NKD A;  4C7R A;  4PV1 B;  2BCC H;  4X1I B;  3JCU H;  3AG1 B;  1JOY A;  1VQM P;  1L1F A;  1M90 Q;  1QVF U;  2W6B A;  2Y0C A;  2Y4U A;  1CI6 B;  3IF4 A;  4YIO A;  4JF3 A;  1XIL A;  1N32 B;  5A9G A;  1K04 A;  4Z1V A;  4Y99 C;  4JI4 O;  1V54 B;  3FAV B;  2ZE8 A;  1EBO A;  2XU6 A;  1URQ B;  3U59 A;  4EIJ A;  2ZCE A;  1BCC D;  3WU2 H;  2ARH A;  2ETN A;  1WMK A;  4MTG A;  3U0Z A;  1S1C X;  1FFX A;  5CA1 A;  1SQV D;  4WFB V;  2ITA A;  2G8Y A;  1VF7 A;  3OR7 C;  4IFF A;  1IBM B;  2ZXW C;  1VQ5 V;  3MUD C;  3ZMS A;  1X0T A;  3ML0 A;  3AG3 C;  5AW7 B;  3CCV V;  1R73 A;  5B1O A;  1VF6 C;  4CH3 A;  4RO2 A;  3JAK B;  3L70 H;  2B88 A;  4JI3 O;  1FAF A;  3X2Q B;  1XMO B;  1QNM A;  3H1H H;  3RW0 A;  1VDF A;  1PFI A;  2R5D A;  2M0B A;  1S72 P;  1KP2 A;  2XUM A;  3PH0 A;  1KQS O;  3B09 A;  1CPY A;  4WWI A;  1AVM A;  1GK9 A;  1GM8 A;  1AR1 B;  2E75 C;  3AEG C;  2Q67 A;  2VRS A;  4K0K B;  2HJF C;  2H8P C;  2W0F C;  4X1Y A;  1RQU A;  1IBK B;  1IFP A;  3Q2Y A;  3ZRV A;  5KLV E;  1KEC A;  4G28 B;  3HUS C;  2GTA A;  1QGK B;  2HOD A;  4JZG A;  4LFA O;  3ZDM A;  3C3S A;  1SZT A;  3M9Q A;  1EQ7 A;  4WY4 D;  3KPE A;  1VQL V;  2EBO A; 
#chains in the Genus database with same CATH homology
 3ABV C;  4H44 B;  2E75 B;  3GLM A;  1DD4 A;  5M1B A;  2FYN C;  2WSC J;  3AEE C;  4KT0 J;  4R4M A;  1KIL E;  1VF5 C;  4H0L C;  4OGQ B;  5KKZ C;  3S9O A;  2OQQ A;  2ZT9 D;  2P10 A;  3LW5 J;  1ZOY C;  3AE9 C;  4H13 D;  1ZRT E;  3AEC C;  2QJK C;  2IDB A;  1UIX A;  1YQ3 C;  2H88 C;  1KTM A;  1OW7 A;  4H13 B;  1TU3 F;  2YMK A;  1K05 A;  2D2C B;  2E75 D;  3AEA C;  3AE3 C;  1KOR A;  1S5L X;  1PIX A;  1JB0 J;  3C8V A;  4PV1 B;  4R4L A;  2WPV B;  2FBW C;  2D2C C;  1PL5 A;  2NZ2 A;  1HF9 A;  4I7Z B;  1VF5 B;  4H0L B;  2MKV A;  1AJY A;  2E74 D;  3AEF C;  1MKM A;  2ZT9 C;  1EXI A;  3G9R A;  1K04 A;  1VL2 A;  3GMA A;  4GDO A;  1KQF B;  3IN6 A;  2FXP A;  3H25 A;  2QSI A;  2E76 B;  2K9Y A;  1FDO A;  1KMI Z;  2J5U A;  2E74 C;  4H44 C;  1Y9B A;  3RL0 g;  3Q3D A;  3FGA D;  4Z1M H;  1WMK A;  1OMI A;  1S1C X;  4PV1 C;  3AE8 C;  1ZME C;  2G8Y A;  3Q5P A;  2QJY C;  2O01 J;  4I7Z C;  2E76 C;  1EXJ A;  3AE1 C;  2QJP C;  1YQ4 C;  3R4Y A;  2WQY C;  2ZT9 B;  1DD3 A;  2JO1 A;  1R8E A;  1GMJ A;  3O6Q A;  3SFE C;  3AEB C;  1U57 A;  1OW8 A;  3EWK A;  1NYH A;  2G3A A;  3D6Z A;  3T97 B;  3Q5R A;  1PV3 A;  3Q5S A;  2H89 C;  3AE5 C;  4IL6 X;  3IAO A;  1KQG B;  1FDI A;  1OW6 A;  4TT3 H;  4OGQ C;  3D71 A;  1NGM B;  2QIW A;  3B71 A;  3AE6 C;  2YIU C;  3GF7 A;  4Y28 J;  4H44 D;  2V7Q J;  1ZP0 C;  2E75 C;  4OGQ D;  3AEG C;  1Q90 D;  2BEZ F;  4PV1 D;  2JP3 A;  3AE2 C;  1RQU A;  4U7J A;  1HJ0 A;  3Q1M A;  4YTP C;  1RQV A;  3RK3 E;  1VF5 D;  4H0L D;  4XFJ A;  2WSF J;  4H13 C;  3Q2Y A;  1IK7 A;  2E74 B;  3D70 A;  3D6Y A;  1DIP A;  3AE7 C;  4RKU J;  2E76 D;  2WSE J;  3GF3 A;  2BEQ D;  3AED C;  5L8R J;  4YXD C;  3AE4 C;  5KLI C;  3SFD C;  2D2C D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...