1Q90D

Structure of the cytochrome b6f (plastohydroquinone : plastocyanin oxidoreductase) from chlamydomonas reinhardtii
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
156
structure length
156
Chain Sequence
TKKPDLSDPVLKAKLAKGMGHNTYGEPAWPNDLLYMFPVVILGTFACVIGLSVLDPAAMGEPANPFATPLEILPEWYFYPVFQILRVVPNKLLGVLLMAAVPAGLITVPFIESINKFQNPYRRPIATILFLLGTLVAVWLGIGSTFPIDISLTLGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apocytochrome f
publication title An Atypical Haem in the Cytochrome B6F Complex
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Photosynthesis
total genus 44
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2003-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 1q90D02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1q90D01
4IL6X 5L8RJ 4RKUJ 1JB0J 4I7ZB 2YIUC 2D2CB 4OGQB 2QSIA 2WSCJ 2FYNC 4H0LB 2WPVB 2QJKC 3LW5J 1Q90D 5KKZC 2WSEJ 2QIWA 2E76B 1S5LX 4H44B 2K9YA 4PV1B 2E75B 2O01J 2ZT9B 2QJPC 5KLIC 4H13B 2QJYC 4KT0J 1VF5B 2WSFJ 4Y28J 3C8VA 1ZRTE 2E74B
chains in the Genus database with same CATH superfamily
2QA4P 3FB6C 3G9RA 5CJ0A 5APWA 4RAIA 5CB4A 1GW4A 2PYLA 3H6PA 2YC0A 3H1JJ 3SR2C 1EDIA 2ZCEA 1RP3B 2NN4A 4I9QA 4EIJA 3RWRD 2RJZA 1M1KW 3MHVA 4O4JB 1RFYA 1BDDA 1QR8A 2GUVA 1JCCA 5CA0A 4XDJA 3SJBC 3P8MC 4DT0A 4OPAA 3OEHG 4FLXA 4J9YB 1NTZJ 2V1DA 1WB7A 1N8RW 2ZNIA 3L70D 3NFQA 2H3OA 2GV9A 2WLIB 1GN4A 2N1TC 1IK9A 1R6NA 1MSWD 2JRIA 5AVYB 1YHQV 2LFRA 1YYCA 2FYUD 2PI4A 5FLXN 1N34B 2HPCA 1NH2B 4DUYO 2E76C 1FFXB 2P06A 1K9MW 3CL3D 4DV4B 1S77D 3HE5B 2F95B 1KB9D 5IYZB 1M1JA 2N05A 4GX2A 1LTTC 2VQFO 2O01J 4NXMO 1L0LD 3SDLA 1YQ4C 1HH0A 2IJIA 4JTCB 5L3GA 3M91A 5LMNB 3FWNA 3HUSC 3BRTB 1N73A 5EIBD 3CCEV 2LXCB 1H8AA 4ABMA 1KC8W 1VEWA 2E42A 2VQEO 2A06D 2PTMA 4U7NA 1Y74B 1SQBJ 3AE8C 4HZ3A 1T2KD 1KQFB 3X2QB 2GDSA 4TSFG 1CI6A 2W6BA 4ZOLA 2FY8A 4PD4D 1J5EO 3MUDA 4FIPC 1ZXGA 4UUJC 1PGOA 4MVRA 2JEXA 1IFDA 1USEA 5JVDB 2CGNA 1KMIZ 4X64O 1YTFB 1S76D 1G1JA 1SQPJ 1TA8A 4XDKA 2HEPA 5BU5A 3V2PA 3QTCA 1XHZA 2YXRB 1W5CE 4FFBA 1BCCJ 1JA8A 1NZ6A 1F4NA 2WSSH 2Q0OC 2UXXA 4NPDA 2ZQMA 3E8FA 2PP6A 4QE9A 1VF6A 4UB6H 4JYBA 5JJJB 2B1IA 3IC7A 2BTQA 3VP8A 3DC6A 3JARA 3N2KB 2B1GA 5AVWB 2PF4E 1CZQA 1BHBA 2W6IG 3I55P 3ABKB 2I1KA 1XUQA 1SRYA 1KD1Q 2QKAA 1SFCA 1NTKH 1Y8AA 1YITP 1NTMD 4LCUC 2DYRB 3BATA 1HJBA 4DV3B 4JTAB 1HGVA 1YJ9P 3I5DA 3L74H 1FDIA 4LP8A 2ITCC 2E74D 4O4IA 1VQOP 5CMZA 1LT1A 2NZ2A 5KLVJ 1CW5A 1COWG 4UB6Z 4ZI7B 1NR7A 4W4LA 5B1OA 1EN5A 1FZGA 1RQUA 3H9VA 2K9JA 1G4YB 3CCQV 5B1BC 3D6ZA 1KECA 2QM8A 4DV4O 1MABG 2WWWA 3E22B 3IJ4A 1MMMA 4UV9A 3MAQA 1KILC 1QNMA 1J1EB 3VMZA 1JO5A 2CAZC 5BZBA 2DW4A 3JAKA 3HKBB 4X1YB 1SQQD 1SQVH 1IFJA 2AEFA 4CS4A 5JQGA 3HD7A 4EB6A 1Q82W 3RL0C 1I08A 4KP4A 3KKYA 1SQFA 4HJGH 4J11A 2FXOA 3T1CA 1SQQJ 2K88A 1OXZA 3KZIE 1VQ7P 5BMVB 5IT9N 3OAKA 2WPRA 1KP3A 4H13C 5EK0A 3SWKA 4DV6B 5KJ7A 1FD9A 1DF5A 3WG7B 2E75B 1B3QA 2N04A 1M56B 1NTZE 2CK3H 1M90W 1AI4A 5LBQA 1RPOA 2IU3A 1M1KQ 4L73A 3HTKB 3B5NC 4FM2A 1FZCB 2EINB 1PNMA 3E7KA 1BSNA 1GTOA 5KHJA 4U3FH 3CXCU 5JH7B 3CX5I 4GODA 1N8RQ 2QTSA 4YJ2B 3G6EV 3KQGA 3CX5E 3HB3B 1ORQC 3A0HZ 4YIOA 2EILB 1EBOA 1MKMA 1IURA 1VQ5P 2OTJV 1J2JB 1VF5C 2Q9IA 2YI9A 4J9ZB 1KB9I 2VRZA 3CC4V 3V4WA 4B3SO 1R1BA 5GTIZ 1KB9F 1N36O 2WPQA 1SQXE 2UUBB 4YPCA 2UWJE 1G1XB 4M3LA 5LA6B 2Y4UA 1P7BA 1NBMG 1KZUB 1V54B 1NVOA 1S5JA 1AR4A 4CS2A 2PAJA 1SQBE 4MVSA 1G6UA 3BA8A 2ZM6O 2E76B 2JJ2G 1GU5A 1KC8Q 4O4HB 3P8CD 2OCCC 1XNRO 3T4ZA 5IJ9B 5LGTA 1SQPE 1BZKA 5KHKA 1SZTA 4PD4F 3NR7A 3BABA 4DK1A 4IT5A 4JYCA 1BCCE 3JAMN 1JX9A 2UXBO 3WUTA 2QSIA 3W7XA 1WA8A 1FS0G 1JOYA 2NPSA 1KV4A 3L73D 1XI1A 1JJOA 3AG1C 2WAMA 3B8MA 3JCUZ 2WSCH 3I56P 4UXNA 2Q0AA 3AG2B 3LDEA 2D3OW 4O4HA 2F4VO 2BCCG 4DV5O 2I8DA 2BSKA 4JYAB 4N21A 4Q20A 3V2QA 4LF6O 3SPIA 3R2PA 3OMNB 1O9HA 4JI2O 2RN0A 4EFBA 2V7QJ 2IYOA 2ZT9D 2QVAA 1EZVI 4JGSA 3QWOC 2QSAA 4O4JA 2YIDA 1VQMV 4K0KB 2UUAO 4CC5A 1JMBA 1DX7A 4R8CA 4JI6O 5KLVE 4GX5A 3M9QA 4U3JB 4I4TB 4WY4D 1AP6A 5GW7A 1RPRA 3TJTA 5BU8B 1FFTB 4Y99B 2IBZG 3H1JH 2KQXA 5JCOA 3TXSA 1MZEA 3L72G 2WLIA 2JJLA 1NKDA 3KZIH 3TGUG 2KSJA 2OYHA 3V4QA 4Z1MG 3F89A 4WBAA 1QBZA 1UIXA 3E1IA 5LHHA 1FFXA 2FBWC 4PDVA 3SFEC 1R5LA 1E5WA 3ABVC 3OM3B 2WLMA 1NU1K 2E5YA 3HE5A 5IYZA 1GH6A 1QLEC 1HGZA 2ZYGA 1IO4A 4YIPA 4DR5O 3CWBD 5APTA 3RK3D 3M9BA 1KILE 4LFBO 2XAQA 3O6QB 1K92A 2IZ1A 3H1ID 5B66H 5LXTB 1AR5A 4H44B 3CX5H 4LBEC 3GVMA 1Q82Q 2OCHA 2QM4A 3L75D 2RDCA 4ZKIA 3CXHI 4ZKUA 4QMAA 1GRJA 1Y74A 2HJDA 2QKSA 1HDJA 3CXHE 2O1KA 3QNEA 2DWEC 3D3IA 4EKWA 2O01H 3GW6A 3MP7B 1KB9H 1WRGA 5H6QA 3RVZA 4LF9B 3SPJA 5LL6Y 1M9NA 1SFCD 1OMIA 3CRQA 1MZ9A 1M90Q 5JVDA 3TSIA 2L5GB 2QJKC 1EXIA 1HF9A 5B66Z 4UCSA 3AK1A 4Q6GA 4WFGA 1Q6IA 1HNZB 3FX0A 1NAYA 3JAWB 4PI0A 3KPEA 2GHYA 4TQDA 1IFMA 3D70A 1JY2P 4W4KA 5LHIA 3H25A 2A06H 4H13B 2DOSA 1TU3F 4FJCC 3WMM0 1M57C 1RY3A 2A0LA 3K0DA 4I7ZC 3J81N 1SQPH 1KKCA 3RK2D 4BW5A 2Y0IA 1JB0J 4PD4H 3S9OA 3A2FA 1YXBA 1BCCH 3L70G 4F6RA 4X88A 5DJUB 2D2CD 3OGIB 3GMAA 3L37A 4JI0B 2ZYDA 2RNBA 3FKSG 2FYUG 2HG5C 2FFDB 3UO2A 4GLXA 1OWAA 3HD7D 3HKDB 4NKGB 2Q3EA 4JZGA 2R3SA 3PTZA 2BE3A 4ZI7A 1WPBA 1VF5B 1JY3N 4OGQC 3CD6P 4CH5A 1F7YA 1BDCA 2DE0X 1FZFA 5KJ7D 2QEXP 3SJCC 1QVGO 1EZVH 2B88A 1L0LG 3AE6C 3ZJZA 1FOSE 4OX9O 3OTFA 1NS1A 4L8JA 5AVUB 1K05A 4X1YA 3HKBA 4NTYA 1XDCA 1ZWIC 3VMXA 3AE2C 4MVUA 3HKCB 4DR6B 3AEFC 1YCIA 2IM9A 4TV8B 5H9CA 1Q6UA 4K8ZA 1SF9A 2IU0A 4H37A 4D6TD 2R9IA 5KLIB 4RO2A 1I0HA 4N78D 5FL7G 2WLNA 2CGOA 3M0AA 5AW4B 3CSXA 2JJ1G 4N23A 4ZMDA 4JYYA 3CCLV 2QM7A 5KKZC 4GKJB 3SWYA 1S9KD 1DEBA 2MK3A 5KA5A 3OGCC 3CCUV 2QR4A 3HTKA 1WPXA 1HNZO 1SQQH 1F51A 1FZCA 2RMZA 1UPGA 1WP7A 2YSUB 3ABUA 3A5TA 2XNDH 2UXDB 4TLFA 5JH7A 3AE7C 1GL2C 5CCGC 3CMEP 1AJYA 1YJWP 2M3BA 3MDSA 3CCRP 2WLHA 4ZKPA 4HYOA 4QGPA 3ZRWB 3CXHH 1ROPA 4X62O 4LFCB 1JQ0A 1NTMG 1IFNA 4O2BB 4GOFA 2FYNC 3P30A 4DUZO 4GKGA 2FMLA 4JI5B 1XHXA 4AILC 4I9WA 1EZJA 4JI3B 3PRJA 2P22C 5LOVB 4MTXA 2WVRA 2CH7B 1NTZK 2ZXWB 4GX0A 2R3CA 5KHHA 1QL1A 3BHPA 1QVGU 5CA1B 1Q5OA 5LA6A 3K06A 1RE4C 3AEDC 1YIJP 1VL2A 4J7KA 1JPXA 2QWRB 2X7RB 3H1LD 4TUYA 2LO1A 4NXNO 4DV2O 1AR1B 3D71A 3BPZA 3AEIA 5HFMA 3W7SA 1XNQO 4I0XB 4X9QA 1YJNV 3STZC 3N2GB 4EI2A 1DD3A 3B2EE 2P90A 1A32A 4X65O 1VQ8V 5IJ9A 3UCSC 2A45H 1XEQA 2L91A 4OH8B 2VS0A 2XZRA 2XNDG 4PV1C 1URQC 3SFDC 4LC1A 4TT3G 4L76A 1VQPP 2H43A 1SQXK 2F1MA 1P84I 1LTSC 1NU1D 2P5OA 2FB5A 1KQGB 2KSDA 1P84F 3ASOC 1P84E 2XAGA 2E3CA 4FK5C 5JJEB 1HVVA 3VQXA 2YXQB 2CTWA 3QO7A 1SQBK 3Q4HB 2AXTZ 3ZHSA 3GWOA 4RJTA 3CC7V 1X0TA 2KZIA 3DSQA 2EIMB 3J7AU 1XOUA 4PA3A 3AEBC 1OCZC 3G6BA 2QJKB 3BCCG 5AW2B 1PP9D 2QE7G 1LP1B 1R3LC 3THOA 4BIZA 5EZYB 4NTXA 2IPPA 3W7TA 4U3JA 4I4TA 1JY2O 1RQVA 2QDOA 2I1JA 1ZAUA 3SYOA 2V7QH 1R73A 4IFMA 4U3FJ 1M57B 2OYOA 2JS5A 4AQYB 2ADQB 2A45G 1UIIA 2BCCD 5AVSB 1R6TA 4JI7O 1VQ6V 5L3DA 1Z2GA 2Q7GA 2O57A 1G1IA 2F66C 4KUMA 5B1NA 4B3RB 3CPWO 1F23A 1W0KG 3UQ8A 1OIPA 1A02J 1M8OB 1JTHA 3WB1A 3ZS8C 4B08A 3SGIA 1S72P 2OYIC 5D5PA 5EYPB 2GM4A 4AI8A 4YHHO 1FBMA 5KLVK 2V4HA 2POHA 1P7GA 3O6QA 3KCXA 5LXTA 2YKPA 4GCZA 5J9PC 4DUYB 4C46A 2FKXA 3TGUD 2WPSA 3LW5J 2CUGA 3FYEB 5DECA 2LJ2A 1GO3F 4NB5A 4MTOA 4O4LB 2LKMA 1FJKA 3L72J 1ZTEA 1AQTA 4WB4A 1KTMA 3L73G 1UFIA 2VQFB 1YTZT 1S5HC 3TGUJ 2P10A 2AEJA 3GLMA 3EHBB 4NXMB 1S1CX 4MT8A 1BGYD 1I94B 4WFBV 4N6JA 1SERA 1SVFA 2LP7A 1US6A 1N7SC 1LTJB 3MD0A 3ABLC 3JAWA 2VQEB 1AP5A 4UB6E 2M5AB 1K73W 1ZLZA 3ETDA 2Z0AA 1RF0C 1HWTC 2EULA 4K3AA 3KXDA 2YIAA 5J2UB 5C8YB 3U1CA 2EZOA 1J5EB 1XMOO 2G3AA 3GF3A 1KUQA 3CCSP 3OTOO 4QNHB 3QH9A 1RM1C 1VP7A 2O1JA 4P9OA 4X64B 3MTUE 4JF3A 2JGUA 1QEXA 4BRYB 4FLTA 1TVKB 3AE1C 1PGQA 3IFMA 4EOTA 3CPWU 2QIWA 5M1BA 1P84H 2FFDA 1PPJD 4YTPC 1KQLA 1JFFB 4AQYO 3HKDA 3BAAA 4DV7B 1DIPA 2CTQA 1EDLA 1FDMA 4JI4B 3P3PA 3VMYA 3CWBG 4B3RO 1L4AB 4HH2A 1Q8IA 1N2DC 5LGUA 4GYCB 2ZDIC 1RE3A 2E75D 3E8BA 3NXSA 3K57A 3L36A 3A7OA 3H1IG 2JWAA 2EZPA 1VQNV 2Y0DA 1SQVE 3BFRA 3H32B 5APQA 4F6EA 3GB7C 3OAAG 3L75G 3RW0A 3JATB 2AHZA 2Z5HA 2LQTA 4PA4A 3HKCA 2Y4TA 4DK0A 2AZ2A 4WFHA 1ZOYC 3OE7G 3L70J 3W68A 4JZ2A 4TV8A 4KHPO 3BEHA 4LWSB 4FM1A 2GTSA 4TOIA 1Y9BA 2JDIG 1M4UA 5GONB 2FYUJ 1PNKA 5FNVB 1FXHA 3A0HE 1UJWB 2EIKC 2OQQA 4PV1B 3ITKA 1URQB 4FLZA 2PUSA 1LT9B 4X8AA 1Y76B 3H1HG 3CCEP 5EIBC 1VQLP 4FZ0A 1I94O 2ZR3A 5GTIE 1FXKC 3H01A 3TXQA 3AE4C 4CS3A 2KG7B 3L35A 2JWDA 1WNSA 2X6BA 5DM6V 1BSHA 1T2KC 2W0FC 3S3XA 2PZSA 1K04A 4U3FE 5LP6C 3M0DC 1SZXA 1L0LJ 1RF1C 3LUTB 3W67A 1N32O 1FS0E 4FFKA 2Z5UA 4MS2A 5FPRA 4Z1VA 1SQXD 1EN4A 4DXWA 4HB1A 3A2AA 2XT9A 1Y4MA 5LMUO 2XUMA 3ZRWA 4GOEA 1A02F 2EIJB 4O2BA 5LHGA 2QRXA 4LF5O 3M7MX 3IGAC 2CTRA 3B71A 2R5BA 5GTHZ 3I5CA 2ZFCA 3HE4B 2M0BA 5LOVA 2H94A 2CH7A 3SJQC 4O9BA 1E1QG 4E2LA 4DW1A 3RVYA 4B3TO 5CA1A 2K37A 3OD4A 4H0LB 2WPVB 3K0GA 4DV7O 2WLKA 4PDLA 2IBZI 2JP3A 4P9PA 3JCUE 4JI4O 1KKDA 1GM7A 4G28B 1JOCA 3JSNA 2IBZE 5AW1B 2WT7B 3D8CA 5IJ0B 5IYCO 1HJ0A 2QWPB 3BASA 3L72E 2Z4EA 4I0XA 3MGNA 4EYYQ 2XAHA 4B3SB 4N3YB 2E74C 1X22A 3LDDA 3N2GA 1N36B 2OYIB 1IXBA 1HP8A 2XKMA 3ZN1A 5CCHD 3E8HA 1OV9A 3P32A 3CCQP 4PI2A 3VYIA 2KS1A 1SC5B 2EX3A 2YEVB 1NTMJ 4IIJA 1N33O 4D6TG 2YS8A 1MV8A 4QIWF 3E8GA 4HKZH 2CE4A 1OW6A 2BTOA 3BVOA 2JEEA 3A0BE 5CHXA 2ZM6B 3B8NA 3IC9A 3V2RA 3ZIAG 2Q7CA 1OCOC 2VRSA 3H1KG 3Q4HA 1XNRB 1K73Q 5E1AC 1FZBA 3OUSA 5DN6G 4DR1O 1AB3A 2QJYB 3OR7C 2UXBB 1VQ4P 1MFTA 1H2GA 1LP1A 3E86A 5EZYA 1USDA 4XFJA 1L0NK 1GN6A 3H1JE 1PL4A 2F4VB 1M93A 4DV5B 3AK3A 4J41A 1H89A 1H88A 1IBLO 3U10A 4LF6B 3RL0g 4H44D 3N4XA 4MN4C 4JI2B 2Q7HA 3Q5SA 1DK1A 1THZA 3A0HH 4DR7O 2Y9YA 4EDFA 1OCRC 2WSFJ 1RM1B 3D36A 3Q2YA 4DRXB 4FLYA 4C7RA 5GTIH 2UUAB 1KBHA 1U96A 4DOJA 3G6EP 1PP9H 4JI6B 1LNQA 3KYQA 1MA1A 3H1LG 1I5XA 3BCCD 2F43G 3O8ZA 3RGUA 3L70E 4OWFA 1ZR2A 2OTJP 5EYPA 4TV9A 1LTIC 4D7SA 5B66E 2HLOA 3DGEA 3CC4P 4CZZA 4FLWA 2Q3IA 3BCCJ 2FYUE 5EBLC 2W6JG 1VQ7V 1SP4A 1RSOA 2N74A 4LF7O 2BCCH 4C7NB 4W7ZA 4LNUB 1JNMA 2KUBA 2P2UA 1KB9E 1BE3D 1H8HG 2NR5A 4I2LC 1K9MQ 2SPZA 2KLVA 1NU1G 2XDJA 1NGMB 4DR5B 3OEEG 2R5DA 4ZIBA 2N1TB 4PA9A 1L0LE 3HKEA 3ZDMA 4LFBB 1IXMA 1VQ9V 1J1DC 3CHXA 2PGGA 1FXVA 3JCUH 3FB5C 3LW5H 1LTJA 2ARHA 4LLHA 5BXZA 1LTGC 4XA4A 3ZHUA 5APVA 2A06E 1PNLA 2IBZH 1URFA 3WU2Z 1BS3A 2IH1C 4YXWG 3L72H 3EXAA 3T97B 2M5AA 3TGUH 2EIKB 4PD4I 4Z1MH 1J95A 3CRMA 1PP9G 4K8XA 2G8YA 1K8AW 4PD4E 2Q1KA 5J2UA 5C8YA 5KUMA 4MVQA 1ENVA 1WB8A 2GA1A 2P4KA 3HUSB 2R72A 1FYJA 2JIZG 2FL4A 4LFAO 2K3RA 4BRYA 1RF1B 4GKKO 1TVKA 2E5TA 1XQ8A 2P1JA 3A0BH 1ZX3A 2ZT9C 3VBBA 2P58A 1ZL8B 4LH6A 2J59M 2ZYAA 1GMJA 3L73J 2ATKC 4CH4A 2Y9ZA 1JFFA 1VQMP 3ZEDA 1FAFA 3AK2A 4FLUA 4DV1O 4WFFA 1DLBA 4WY4C 2QGNA 2WLJA 1ZMEC 2E5LO 1EZVE 3AECC 3R66A 4J10A 1L4AA 5KA6A 2P7JA 1K5QA 2OYQA 1N73C 1NTME 3ABMC 1FZEA 4R4LA 1LWUC 1S4XA 3A0BZ 2Q9LA 3B4SA 1JM0A 1NTKK 4MTGA 3RFRA 2NRGA 3H32A 3PLNA 5B1AC 3IF4A 2C9NY 3JATA 1K97A 3MUDC 1KYOD 4PJ0H 3Q5PA 5AVZB 2RCVA 4I1LA 3L71D 2LW1A 2E74B 5DJTB 2ITAA 3RK3C 3FFQA 5GONA 1KQSO 1BGYG 5FNVA 3CCJP 4NR1A 4OX9B 3CLQA 1URQA 4CPGA 5A9GA 2RN9A 1LT9A 1Y76A 1D7MA 5AW3B 2BEZF 1VMGA 4P30A 1GK4A 1IZ3A 3L70H 2X0LA 1SQQE 1VF6C 1SS3A 1ZRTD 3EQ2A 3Q5RA 5BY1A 5B1BB 3CWBJ 1DF4A 3EFGA 4PJ0Z 3TDKA 1WN7A 2FYUH 4G2KA 4RUEA 5BR8O 2PY5A 2XAJA 1SQVK 2YO2A 4RESB 2YICA 4I50B 5B3SC 5L3FA 1MOFA 1SFCC 3H1IJ 3RT3C 1KILB 4GZRB 1SLQA 1KP2A 3L75J 5TISE 3K3WA 2HFEC 1T5EA 2QWOB 4WFAV 3B09A 1PPJG 3MIWA 3RL0B 1L0LH 4CC6A 2W27A 1FC2C 3H1HD 2A3QA 3HE4A 1LR1A 3QO5A 1ZSPA 2F23A 1H8EG 3TETA 5KAFH 3ETGA 1DGSA 2KP8A 3RK2C 1IFPA 3CCVV 1U7MA 1OW7A 3CMAP 2D2CC 2ZKOA 3RYFB 1L0ND 4X62B 2WT7A 2A45I 1HW7A 3N2KA 5IJ0A 3B5NB 1LTAC 4IFFA 2WQYC 1FPOA 4DUZB 3APOA 2AXTE 2YO3A 2QWQB 3CB2A 5EC1C 2DN9A 3LIEA 3HD7C 4JI8O 4AHCA 2OYIA 1PD3A 2M3EA 1PZQA 5IE9A 1KQSU 5KAFZ 1XL4A 1NI8A 1NTZG 1PV0A 3WB0A 2RKLA 5K1XA 3ASNC 1NR1A 5B5EH 1IBMO 4IHJB 2KZJA 2YEVA 1VQKV 1QQCA 4NXNB 3CP1A 5KJ7C 4DV2B 3NMDA 3EFFK 2M8RA 4IYHA 1XNQB 5KX5B 1M57D 1QU7A 4J42A 2ZXXA 2N9BA 3AE3C 1YEWA 3P8CE 3E22A 1VPCA 3S4RA 3QF7A 2B89A 4X65B 2FYZA 3SSUA 4MVZA 1DTOA 1FKAO 1S0VA 1EXJA 1NTMH 3JC22 2OIEA 5EBMC 1K8AQ 3CE2A 3K08A 2B5UA 1N0JA 5B5EZ 4J7JA 1V55C 1OCCC 1DH3A 2EJ7A 2LW7A 3E89A 1NOHA 3L73E 2JR8A 2ITDC 2YXLA 1SQXG 3WUUA 3ZHQA 5K5GB 3SYAA 2LGQA 5C39A 2OCCB 2IYPA 2Y48A 3CCLP 2P4VA 1R5SA 1EQ7A 1RF0A 5BMVA 4LF4O 1W59A 2DYSC 4GX1A 3RYCB 4HYTB 2YUAA 2UUCO 3CCUP 3OJAB 1SQBG 3JD0A 5KTBA 1B06A 2H88C 4JAVA 4D6TJ 3L9DA 2B9BA 2UU9O 2DMXA 4C7UA 3H1KD 5E79H 1WP8A 5KHGA 4LH7A 1T3UA 4DRXA 5AG2A 2DW3A 3AG1B 3GWKC 4FZ1A 5KHIA 2KLUA 2Y0PA 3SYQA 4PA6A 2ZT9B 2WTYA 4GDOA 2BASA 3SWFA 3K79A 4R6ZA 2W6AA 4TT3H 1R6KA 2Y0CA 3CYOA 3AEAC 2QG4A 4YJ2A 4IL6Z 1KYOI 2KB7P 2WSFH 1XMQO 1HNXO 1KYOF 4WY4B 4JI7B 3BRVB 4L87A 1XTGB 5TISH 5H2FZ 5E79Z 5IWAO 1YSCA 4C7NA 3QO8A 1N73B 3S1KA 1L1FA 1WT6A 3B77A 2Q5UA 4O2AB 4KXRA 3ZRSA 1LWUB 3KG2A 2H8PD 3O9OA 1EDKA 2W90A 2LR2A 3CWBE 1FJGB 3CC2P 4B3MO 3RK3E 4ASUG 2DQ0A 3BCCH 2NPSD 2N1TA 1WLEA 1CI6B 5B1AB 4YHHB 1D2DA 1R3JC 1VDFA 2IX7C 2H89C 1AI5A 2QE7H 1ZW0A 1YJNP 2FKWB 3K9SA 3RGBA 1XREA 3CMEV 5KLVG 1E79G 1OHHG 5CBHA 4DV0O 5TISZ 1NTKD 2HJFC 3L75E 1M7LA 3RK3B 3FXEA 3H1LJ 2HR3A 4UFZA 4MW8A 3T97A 1QLEB 4X1KB 3K5NA 2OTLV 2AXTH 2YMKA 3L74D 2Z3YA 1ZLLA 4IOIH 1IDSA 1N86A 1L4AD 3DTUB 1KFNA 2CTPA 3G4SV 2OYHC 3HUSA 4E4EA 2XU6A 5L3EA 3LNNA 2PI5A 2YDEA 1I5YA 3M0DA 1RF1A 3CC7P 1LUVA 3JASB 1HBWA 2JS3A 5A2QN 3LSUA 1GN3A 1NU1J 2Q6QA 1ZL8A 2YXYA 2PGDA 4OVNF 2C2AA 3RYHB 4I55B 1PV3A 1D5NA 1NH2D 1T6AA 1SQVD 2O01N 5AVXB 1XMOB 3RYIB 3OTOB 3FGAD 2HKOA 3UO3A 5IYDO 2LFSA 4JQ0D 5CBOA 1SQPK 2QJPC 1AA0A 4QE7A 2IJHA 2AGAA 1WAZA 3L73H 4HAMA 5JWPA 3PP5A 2YXHA 1IJDB 2ZE8A 3O65A 1H2NA 1PP9J 1VQ6P 2YI8A 3NTNA 3T1HO 5IY5C 1R3IC 2KIKA 4I7ZB 2D2CB 1CP9A 3OW2U 3AG7A 2DWDC 3G71V 1TUBB 5APYA 1EC5A 1BE3G 3K5BA 1K5SA 3CCMV 3JAKB 4L74A 1PGJA 1QX8A 3L4FA 1AFOA 4JV5O 2BCCJ 4FLVA 1HR0O 3PHLA 2ETNA 1H2SB 2L6LA 1FJGO 1YTFD 4JF7A 3ASNB 5GTHE 1XBLA 4XBFA 3OMAB 5CN0A 1PGPA 2QTOA 1YI2V 1SQGA 2B87B 1FZAA 2WZ7A 1LGHB 4ASVA 4OGQB 3F5TA 3TNUB 3IFXA 1AVYA 4KHPB 1KYOH 4H0LD 3ZBHA 1S2EA 2GUZB 2Q6AA 2OT5A 3ABKC 1NJIW 3FXDA 1MUUA 3IR9A 4N78E 4F4LA 1KILA 3SYPA 2Z5IA 3U59A 3C3SA 1CPYA 1H2KA 1VIBA 4EFEA 1Q7YW 1V55B 3CEIA 3CWBH 3N7NA 4DR2O 5CBNA 3D3QA 1S9KE 4FMTA 3FB7C 1WMKA 3USSA 2B9ZA 3T1YO 3H1IH 1BGYJ 4IFDK 1DEEG 2OTKE 1WJZA 1G2CB 1SQQK 1N32B 4NTWA 3L75H 4DJGA 3HR0A 2ZR2A 1MZFA 5LMUB 2WA4A 3RYFA 5KKZB 4DR3B 1YTZI 3JD3A 3FAVB 4LGDE 2JDIH 3B5NA 4LF5B 3F7VC 1E1RG 5CBFA 1AROP 4BW9A 2BEQD 1XTCC 3H1HH 1GL2B 4ICGA 3OR6C 2Q69A 1JCHA 4B3TB 2P67A 3L71G 2UXCO 3ICXA 4IHJA 2HODB 3H1LE 3IAOA 5J2TB 1IK7A 3VN0A 4ASWA 3JSLA 2FYNB 2E75C 4UCVA 4MW3A 4ZNCA 1SESA 3JALB 1S3JA 5KX5A 2HP8A 1VQNP 1JY3P 2K1AA 3V5BA 1FZCC 2NNUA 3APQA 1M56D 1HTLC 3H1JD 1YHQP 3B40A 3C8VA 5KAIZ 3ZMVA 3ABTA 1T8ZA 3STLC 1PM9A 3ZRVA 1NU1E 4LF8O 1N33B 3N27A 4G27B 3LIDA 2XAFA 2QA4V 1NTZD 1EFRG 2EILC 3K04A 4DW0A 3LNMB 3F7YC 4YY3O 4JI1O 1VF7A 2JGDB 2XHBA 1KN7A 2HVJC 2PRRA 1NHLA 3RYCA 1Y47A 2VWJA 1NO4A 1EDJA 5AW9B 1U7JA 1V54C 4DR1B 2OYHB 1YZBA 2HLDG 3CX5D 5ITZB 1PP9E 1D5AA 5GTHH 3ASOB 2K1EA 1PL0A 3QG5A 1ZN5A 3UIAA 2N1TD 4BIUA 2XASA 3A0RA 1L0NG 2V4DA 1IBKO 3U11A 1GW3A 1NH4A 2XV5A 3T2MA 1DD4A 1OFCX 3ETEA 3AG3C 4D6TH 1IBLB 2R70A 5APXA 3W7WA 2RH0A 2E76D 1CSBA 2J58A 1KU9A 5KMGB 2BCCE 3CRRA 1OCZB 2ZE7A 4MVOA 4U7OA 4DR3O 2MW2B 4RQFA 4DR7B 1KORA 2CPBA 4WY4A 3V2NA 1SQXJ 2G38A 1HNWO 1SQBD 3H1KH 2QJPB 4X20B 3ZHVA 1HUCA 4X66B 1VQLV 4O2AA 4IGGA 2OWOA 1LWUA 2R32A 3GG2A 3AG2C 3UKMA 5IY5B 2X6CA 1ZR4A 1Q43A 1SQPD 1N4CA 4BR6A 1AVMA 4JAAA 5AW7B 1BMFG 1BCCD 2K9YA 3CRAA 4X1IB 3EVKA 4LF7B 4U7JA 4JPRA 1BT8A 2UXNA 5CCHC 3TGUE 1MSDA 3MHSC 1CEZA 3OUFA 2AXCA 1KFMA 2IFNA 4X1KA 1JY2N 1NJIQ 3OFNG 3W7UA 3CJHB 2K9PA 3TCUA 3E35A 1FU1A 4Y99C 1GDTA 1BGYE 2ZE6A 2O3JA 1Q7YQ 1SKVA 2WLLB 5IYBO 2YNYA 4MVMA 4XDLA 4P2ZA 1TGOA 2PFXA 3H1LH 4IYIA 3E1RA 2DJVA 1EZVD 2XOKG 3JASA 4F6RB 1QVFO 4RQEA 1NKZB 2A9HA 3OA7A 5KLVD 2W6JH 4Z2WA 3RYHA 4I55A 3C9IA 1PFIA 4KFMA 4KJMA 3I55V 4EEQA 2IFMA 4W7YA 3JD1A 1MNGA 3IN6A 5AW0B 1Y6XA 1YITV 3RYIA 1YJ9V 2PYJA 1N7SB 3CRCA 3ZRXA 3ABLB 2YMYA 1N34O 1GK9A 1NU1H 4LFAB 1VQOV 1RHZB 4H44C 4GKKB 1IFIA 5D5QA 3A3YB 3U1AA 1PPJE 1LTBC 1FDOA 2ZXEB 4UB8E 1S5LE 4R50A 4BWAA 4JBZA 4BXLA 4PA7A 1Q81W 4WFEA 4PJ0E 1Q3EA 1NVPB 1Q6HA 1TUBA 3J80N 3F5HA 2WSSG 4DV1B 2ZJSE 1V9PA 4YXWH 1KILD 4FM0A 2E5LB 5LMNO 4RKUJ 4X66O 3KHUA 3UM7A 3MZWB 1VQ4V 2WMMA 1QCEA 3K5LA 1IVSA 1P49A 3FYIB 3VOUA 2WSEJ 3K5OA 2A7WA 3CXHD 3RL0D 1NTKG 3TF5A 1NWQA 2B87A 4H33A 3L74G 4PELA 1IZNB 3GHGC 1JY3O 3GF7A 4H13D 3TNUA 3WU2H 2IJKA 2YKOA 3WB2A 3G3ZA 3II6A 2GUZA 1AILA 2P7TC 2ILMA 3ZMSA 1QVFU 1T3JA 4O4LA 2JKVA 4WBNB 4QJFB 1VQ9P 3B5ND 2RMKB 2FXPA 2FFDC 2R9RB 1YQ3C 4UCOA 3P3NA 4JTDB 1BE3J 5L3CA 3CX5F 1OJHA 3ETQA 3U0ZA 1ZV8A 1AI7A 5KAFE 4DZOA 5L3BA 2C0WA 5BR8B 4D7TA 1G2CA 2W8ZA 1SQVG 3VP9A 1RE3C 1X9VA 4DV3O 1VQ5V 1VF5D 2ZAEB 2W83C 2AHYA 3BA9A 1H2LA 3C90A 5L8RJ 4KHXA 3TK1A 1FXKB 2MKVA 4NPFX 3UT5B 3FAVA 3E2EA 1OVRA 3DC5A 4TUYB 1QLNA 1BGYH 5LP6B 2EJRA 2KSEA 4NPEA 2IJJA 2CK3G 1S5LX 4ZHQB 1P4RA 4L75A 1GL2A 5CCGA 5B5EE 4BWNA 3OMIB 3JSVC 3AG3B 1TAEA 5KLIC 1M1JC 4UVAA 2HODA 5J2TA 3B8EB 4U3FG 3VQVA 1LJ2A 2KXPB 4MSWC 3DXRB 1NT2B 3E83A 3JALA 5APSA 3HRNA 4JI8B 3PH0A 3JYCA 1Q90D 3WUVA 5AVQB 2FTKA 1RE4A 2Q8VA 2XNXA 5AW5B 1PPJH 4UB8H 3P7KA 3I56V 1IBMB 4DV6O 2KI7B 1S5LH 4A5UB 4J7ZA 1OW8A 1GZLA 1U97A 2VWKA 3M8AA 4TWKA 3VQYA 2KNCB 2WITA 5KUKA 4Y28J 2ZIOA 4LWSA 3V6IA 4IL6E 1GN2A 2ZVOB 2QKCA 3OT7A 2JGDA 4CBCA 3BY6A 5HFLA 3L71J 2ZXWC 5H2FE 5E79E 1H0TB 3F5WC 3AE9C 3RBZA 4UB8Z 3C3TA 1S5LZ 5ITZA 2KG7A 2W0XA 1SETA 5LYJB 1JUNA 5CMUA 1VARA 3ZHTA 2R44A 4KT0J 2A79B 1QL2A 3VQWA 1NTZH 2ODMA 1OCOB 4PDMA 3TYYA 2CPSA 3R65A 2E43A 1X4TA 1JTHB 2ZD9A 4LF4B 2UUBO 1F4MA 1Q86W 1X79B 2DQ3A 2UUCB 2M7WA 3RBXA 1Q81Q 5KMGA 2UU9B 1QGKB 4YJ3B 3KZIZ 1QLED 3CCJV 1OZ0A 4X20A 1X8YA 3CCVP 4HNAB 1FAVA 1RH5B 5AW8B 2NLJC 3AE5C 2Q5ZA 1GKFA 3BCCE 3FB8C 2L35A 3M99B 4FVMA 3CXHF 3ZX6A 2YIBA 5CA3A 2Q73A 3H1HJ 1NYHA 2Y0EA 2OARA 1GTWA 1SQXH 1OCRB 1XMQB 1HNXB 1JMMA 2EIMC 3ZMTA 1SA0B 4X1IA 4GIFA 1QHTA 3FWLA 3H1JG 5IWAB 3G80A 3K9AA 4B7KA 4BAYA 5F2VO 4RUFA 1BE3E 1L0NJ 1YF2A 1P84D 4AQRD 1SQBH 2HFED 1VQKP 4OPHA 3ZCCA 2BOCC 2Q7EA 4JYAO 3JCZA 1BQZA 3CJHA 5LGNA 4B3MB 2GTAA 4J80A 2QWNB 2WLLA 1GU4A 2ZE5A 1HWYA 1K3EA 2AEMA 3GHGB 2OGUA 4IL6X 3AG4C 4ZBMA 3BVHA 3D36C 4K0KO 1GMGA 4DV0B 1W2BO 2WPDG 2YIUC 1EM1A 3CMAV 2KYVA 3M9HA 2R9AA 1JVMA 1G8MA 1Z56A 3LSSA 5TJHA 5CB4B 1BSMA 2GUSA 3HPLC 1FE6A 2JVDA 1J1DB 4PHZA 3LDCA 2YKQA 5K1PA 4UV8A 2GSMB 1AJPA 2HG5D 1N7SA 3SPGA 4R4MA 5AVRB 3K59A 1X59A 4R7CA 5CA0B 1Z5VA 2LXBA 1FOSF 2Y69C 2IH3C 3K03A 4IL6H 2ZINA 4OGQD 5KLVH 3CD6V 1E79H 1ZP0C 1CXZB 2QEXV 1IC2A 3S3WA 5H2FH 2A06G 2ADPA 4WVZA 3T4DA 1BQ0A 1IX9A 4A7PA 2IZ0A 2HPCB 1SQPG 1LTJC 4DR4B 3H1KJ 3WFVA 2J5UA 1BCCG 2N9YB 1M1JB 5BVZA 5AW6B 4DO2A 3T1HB 3FD9A 4LF9O 3K5MA 1KYOE 1YBKA 5H5NA 4X89A 2H8PC 3L71E 3FX7A 4B7EA 4LNUA 1Q2NA 2ZDIA 1FJPA 4JV5B 2GBOA 3ABMB 3JD2A 2NPSC 1GD2E 1W2BU 1HR0B 2WSEH 1YVWA 4WBNA 4JPZB 3MHHC 3OW2O 1M5IA 1U57A 1Z5WA 4WF9V 1EZVG 1K7DA 4ZOLB 1GAXA 1ZRTE 1BL8A 5CCGD 2XTAA 1GL2D 3H1IE 1H2MA 4K35A 2OTLP 1VQ8P 1YJWV 4QPKA 3CCRV 2Q4PA 1SS1A 3PN1A 1NQTA 1Y67A 2KB1A 1GM9A 1H38A 1L4AC 4FFBB 1GM8A 4JI0O 2FYUK 1O9GA 3ML0A 2CDYA 3G4SP 1BE3H 3RN4A 1NTKJ 2HHHB 1N0NA 2HVKC 1Q86Q 2M6YA 2QJ1A 5EC2C 1FXKA 3D6YA 3M06A 5H6RA 1AQ5A 5JCOC 3L74J 4DR2B 3UT5A 1NAFA 2BTQB 2AZ0A 1L2PA 3CC2V 5LP6A 4TQFA 3JARB 3H1HE 4UVCA 1W2EA 4AUWA 2HYNA 1YIJV 5KAIE 3T1YB 5IDJA 2H7HA 2AW9A 4ZHQA 5B3SB 1L0LK 1OVUA 1K34A 3QVNA 1SFCB 1AJQA 3KDPB 2C0XA 1EN6A 4UVBA 1AV1A 1SQQG 1NKNA 5AVVB 1L0NE 4O4IB 2KS1B 4WWIA 5AVTB 1LT9C 2BOBC 4IIJB 3DXRA 1PKXA 4WCEV 4DR6O 1B04A 3SPCA 2K9JB 4PV1D 3LSQA 1URQD 5EFWB 4JASA 5CBGA 1SQVJ 5EBWC 4DR4O 3G71P 1VQPV 3IAYA 1JJ2U 2Q67A 3RK2B 2EBOA 4DCKA 1XL6A 3A8TA 4NYKA 3EWKA 4I5SA 3CCMP 1N7LA 2ZVNB 3X2QC 4LR3A 2UXCB 1W0JG 1MG1A 2KNCA 4GKJO 1AJNA 1K33A 2ZNJA 4W80A 5CCHA 4FPPA 3AEEC 2EIJC 1JEKA 5JQGB 2FXMA 2IW5A 3HD7B 4EB6B 3R4YA 3Q3DA 2OIGA 4UCTA 4U3FD 4GT1A 1R3KC 1ZUQA 5DEDA 2UXDO 1YI2P 1GK6A 4OXSA 5C93A 1H0TA 1AVOA 4RWUA 5FPOA 1QR9A 4H0LC 3G67A 1NTMK 4LF8B 4LFCO 1K4DC 5LYJA 1PIXA 3AG4B 2YIBD 4JI5O 2YIUB 4NVPA 1JR9A 4CH6A 4AYCA 4D6TE 4JI3O 4UCUA 4I50A 4YY3B 3L71H 1K4CC 1B6QA 4JI1B 2IDBA 3ZMZA 4B86A 2DYRC 2HHHO 4HBNA 1JMKC 4TV9B 3VOPA 1OVVA 2X6AA 1OX3A 2RQ6A 1OCCB 3H1KE 2WA3A 3KCYA 3K58A 4YJ3A 3VMAA 4RO0A 4DYLA 1S72V 3ZMUA 1RSOB 2IBZD 4XE5B 4QPJA 4HNAA 1OZHA 3AEGC 3L72D 4YXDC 1KD1W 3SPHA 2KOGA 1BHAA 2DYSB 1IBKB 2Y69B 3ZN0A 3CI9A 2Q68A 1MFZA 2JEUA 4GUNA 1J1EC 1JCDA 2V7QG 1SA0A 1PL5A 3HKEB 2QJYC 2ZIMA 3JD4A 3Q1MA 1HNWB 4CH3A 3WU2E 2LGWA 5JJNB 2MJZA 2F93B 3VTPC 4UCRA 5KAIH 2WSCJ 1N7SD 3C1LA 2C9LY 2KK7A 4KL1A 3ZHRA 4MTFA 2KKWA 4I6MC 1AI6A 5APUA 3SYCA 5CJ4A 2P6JA 4JAUA 3WG7C 3GHGA 1M56C 1R8EA 1L0NH 1NTKE 1I7FA 4BIOA 1Y66A 1WA8B 3SJAC 2NPSB 1LUWA 3BRCA 3PJSK 1NVPD 1XILA 3L74E 1TUEB 2EINC 2JK5C 3CCSV 2JO1A 1L8DA 1YDXA 3CS5A 4PDRA 2BSKB
chains in the Genus database with same CATH topology
3EWKA 3G9RA 2E74D 4RKUJ 1JB0J 3S9OA 2NZ2A 1NGMB 2QSIA 4OGQB 4OGQD 1RQUA 2D2CD 4H0LB 2WPVB 1ZP0C 3GMAA 4H0LD 1DD3A 2JP3A 3D6ZA 2WSEJ 1DD4A 3AE9C 3AEEC 4PV1C 3SFDC 2G3AA 3GF3A 3R4YA 2E76D 1HJ0A 3Q3DA 1KORA 3RK3E 2V7QJ 1KQGB 2E74C 2ZT9D 4KT0J 3GF7A 3T97B 4H13D 1VF5B 1OW7A 2H89C 2J5UA 4Z1MH 3AE1C 4OGQC 1WMKA 2QIWA 2G8YA 2D2CC 5M1BA 4H0LC 4YTPC 2WQYC 1PIXA 2FXPA 3AE6C 1YQ3C 1DIPA 2E76C 1OW6A 2YMKA 3AEBC 1K05A 2IDBA 2ZT9C 4H13C 2K9YA 1GMJA 3AE2C 3AE5C 3AEFC 4U7JA 2E75B 2O01J 2E75D 1UIXA 1U57A 1RQVA 1NYHA 2BEQD 1YQ4C 2FBWC 1VF5D 3SFEC 1ZRTE 3ABVC 5L8RJ 1ZMEC 3AECC 2MKVA 3AE3C 3AEGC 4YXDC 1ZOYC 4XFJA 3AE8C 3IAOA 1PV3A 1IK7A 4R4LA 5KKZC 1KQFB 1EXJA 1KILE 1Y9BA 2E75C 1S5LX 3FGAD 4H44B 1MKMA 4H44D 3RL0g 2OQQA 1VF5C 3D6YA 4PV1B 3Q5SA 1KMIZ 1PL5A 2QJPC 5KLIC 3AE7C 2QJYC 1AJYA 3Q5PA 3Q1MA 2WSFJ 3Q2YA 3AE4C 3C8VA 2E74B 3IN6A 4IL6X 1K04A 3O6QA 4I7ZB 2YIUC 2D2CB 2WSCJ 1OMIA 2FYNC 2H88C 2QJKC 3LW5J 1Q90D 4H44C 1EXIA 1HF9A 2BEZF 2E76B 1FDOA 3Q5RA 1KTMA 1R8EA 3D70A 2P10A 3AEDC 3GLMA 3H25A 2ZT9B 1S1CX 1OW8A 4GDOA 4H13B 4PV1D 1VL2A 3B71A 1TU3F 4R4MA 4TT3H 4Y28J 2JO1A 4I7ZC 3AEAC 1FDIA 3D71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IL6 X;  5L8R J;  4RKU J;  1JB0 J;  4I7Z B;  2YIU C;  2D2C B;  4OGQ B;  2QSI A;  2WSC J;  2FYN C;  4H0L B;  2WPV B;  2QJK C;  3LW5 J;  1Q90 D;  5KKZ C;  2WSE J;  2QIW A;  2E76 B;  1S5L X;  4H44 B;  2K9Y A;  4PV1 B;  2E75 B;  2O01 J;  2ZT9 B;  2QJP C;  5KLI C;  4H13 B;  2QJY C;  4KT0 J;  1VF5 B;  2WSF J;  4Y28 J;  3C8V A;  1ZRT E;  2E74 B; 
#chains in the Genus database with same CATH topology
 2QA4 P;  3FB6 C;  3G9R A;  5CJ0 A;  5APW A;  4RAI A;  5CB4 A;  1GW4 A;  2PYL A;  3H6P A;  2YC0 A;  3H1J J;  3SR2 C;  1EDI A;  2ZCE A;  1RP3 B;  2NN4 A;  4I9Q A;  4EIJ A;  3RWR D;  2RJZ A;  1M1K W;  3MHV A;  4O4J B;  1RFY A;  1BDD A;  1QR8 A;  2GUV A;  1JCC A;  5CA0 A;  4XDJ A;  3SJB C;  3P8M C;  4DT0 A;  4OPA A;  3OEH G;  4FLX A;  4J9Y B;  1NTZ J;  2V1D A;  1WB7 A;  1N8R W;  2ZNI A;  3L70 D;  3NFQ A;  2H3O A;  2GV9 A;  2WLI B;  1GN4 A;  2N1T C;  1IK9 A;  1R6N A;  1MSW D;  2JRI A;  5AVY B;  1YHQ V;  2LFR A;  1YYC A;  2FYU D;  2PI4 A;  5FLX N;  1N34 B;  2HPC A;  1NH2 B;  4DUY O;  2E76 C;  1FFX B;  2P06 A;  1K9M W;  3CL3 D;  4DV4 B;  1S77 D;  3HE5 B;  2F95 B;  1KB9 D;  5IYZ B;  1M1J A;  2N05 A;  4GX2 A;  1LTT C;  2VQF O;  2O01 J;  4NXM O;  1L0L D;  3SDL A;  1YQ4 C;  1HH0 A;  2IJI A;  4JTC B;  5L3G A;  3M91 A;  5LMN B;  3FWN A;  3HUS C;  3BRT B;  1N73 A;  5EIB D;  3CCE V;  2LXC B;  1H8A A;  4ABM A;  1KC8 W;  1VEW A;  2E42 A;  2VQE O;  2A06 D;  2PTM A;  4U7N A;  1Y74 B;  1SQB J;  3AE8 C;  4HZ3 A;  1T2K D;  1KQF B;  3X2Q B;  2GDS A;  4TSF G;  1CI6 A;  2W6B A;  4ZOL A;  2FY8 A;  4PD4 D;  1J5E O;  3MUD A;  4FIP C;  1ZXG A;  4UUJ C;  1PGO A;  4MVR A;  2JEX A;  1IFD A;  1USE A;  5JVD B;  2CGN A;  1KMI Z;  4X64 O;  1YTF B;  1S76 D;  1G1J A;  1SQP J;  1TA8 A;  4XDK A;  2HEP A;  5BU5 A;  3V2P A;  3QTC A;  1XHZ A;  2YXR B;  1W5C E;  4FFB A;  1BCC J;  1JA8 A;  1NZ6 A;  1F4N A;  2WSS H;  2Q0O C;  2UXX A;  4NPD A;  2ZQM A;  3E8F A;  2PP6 A;  4QE9 A;  1VF6 A;  4UB6 H;  4JYB A;  5JJJ B;  2B1I A;  3IC7 A;  2BTQ A;  3VP8 A;  3DC6 A;  3JAR A;  3N2K B;  2B1G A;  5AVW B;  2PF4 E;  1CZQ A;  1BHB A;  2W6I G;  3I55 P;  3ABK B;  2I1K A;  1XUQ A;  1SRY A;  1KD1 Q;  2QKA A;  1SFC A;  1NTK H;  1Y8A A;  1YIT P;  1NTM D;  4LCU C;  2DYR B;  3BAT A;  1HJB A;  4DV3 B;  4JTA B;  1HGV A;  1YJ9 P;  3I5D A;  3L74 H;  1FDI A;  4LP8 A;  2ITC C;  2E74 D;  4O4I A;  1VQO P;  5CMZ A;  1LT1 A;  2NZ2 A;  5KLV J;  1CW5 A;  1COW G;  4UB6 Z;  4ZI7 B;  1NR7 A;  4W4L A;  5B1O A;  1EN5 A;  1FZG A;  1RQU A;  3H9V A;  2K9J A;  1G4Y B;  3CCQ V;  5B1B C;  3D6Z A;  1KEC A;  2QM8 A;  4DV4 O;  1MAB G;  2WWW A;  3E22 B;  3IJ4 A;  1MMM A;  4UV9 A;  3MAQ A;  1KIL C;  1QNM A;  1J1E B;  3VMZ A;  1JO5 A;  2CAZ C;  5BZB A;  2DW4 A;  3JAK A;  3HKB B;  4X1Y B;  1SQQ D;  1SQV H;  1IFJ A;  2AEF A;  4CS4 A;  5JQG A;  3HD7 A;  4EB6 A;  1Q82 W;  3RL0 C;  1I08 A;  4KP4 A;  3KKY A;  1SQF A;  4HJG H;  4J11 A;  2FXO A;  3T1C A;  1SQQ J;  2K88 A;  1OXZ A;  3KZI E;  1VQ7 P;  5BMV B;  5IT9 N;  3OAK A;  2WPR A;  1KP3 A;  4H13 C;  5EK0 A;  3SWK A;  4DV6 B;  5KJ7 A;  1FD9 A;  1DF5 A;  3WG7 B;  2E75 B;  1B3Q A;  2N04 A;  1M56 B;  1NTZ E;  2CK3 H;  1M90 W;  1AI4 A;  5LBQ A;  1RPO A;  2IU3 A;  1M1K Q;  4L73 A;  3HTK B;  3B5N C;  4FM2 A;  1FZC B;  2EIN B;  1PNM A;  3E7K A;  1BSN A;  1GTO A;  5KHJ A;  4U3F H;  3CXC U;  5JH7 B;  3CX5 I;  4GOD A;  1N8R Q;  2QTS A;  4YJ2 B;  3G6E V;  3KQG A;  3CX5 E;  3HB3 B;  1ORQ C;  3A0H Z;  4YIO A;  2EIL B;  1EBO A;  1MKM A;  1IUR A;  1VQ5 P;  2OTJ V;  1J2J B;  1VF5 C;  2Q9I A;  2YI9 A;  4J9Z B;  1KB9 I;  2VRZ A;  3CC4 V;  3V4W A;  4B3S O;  1R1B A;  5GTI Z;  1KB9 F;  1N36 O;  2WPQ A;  1SQX E;  2UUB B;  4YPC A;  2UWJ E;  1G1X B;  4M3L A;  5LA6 B;  2Y4U A;  1P7B A;  1NBM G;  1KZU B;  1V54 B;  1NVO A;  1S5J A;  1AR4 A;  4CS2 A;  2PAJ A;  1SQB E;  4MVS A;  1G6U A;  3BA8 A;  2ZM6 O;  2E76 B;  2JJ2 G;  1GU5 A;  1KC8 Q;  4O4H B;  3P8C D;  2OCC C;  1XNR O;  3T4Z A;  5IJ9 B;  5LGT A;  1SQP E;  1BZK A;  5KHK A;  1SZT A;  4PD4 F;  3NR7 A;  3BAB A;  4DK1 A;  4IT5 A;  4JYC A;  1BCC E;  3JAM N;  1JX9 A;  2UXB O;  3WUT A;  2QSI A;  3W7X A;  1WA8 A;  1FS0 G;  1JOY A;  2NPS A;  1KV4 A;  3L73 D;  1XI1 A;  1JJO A;  3AG1 C;  2WAM A;  3B8M A;  3JCU Z;  2WSC H;  3I56 P;  4UXN A;  2Q0A A;  3AG2 B;  3LDE A;  2D3O W;  4O4H A;  2F4V O;  2BCC G;  4DV5 O;  2I8D A;  2BSK A;  4JYA B;  4N21 A;  4Q20 A;  3V2Q A;  4LF6 O;  3SPI A;  3R2P A;  3OMN B;  1O9H A;  4JI2 O;  2RN0 A;  4EFB A;  2V7Q J;  2IYO A;  2ZT9 D;  2QVA A;  1EZV I;  4JGS A;  3QWO C;  2QSA A;  4O4J A;  2YID A;  1VQM V;  4K0K B;  2UUA O;  4CC5 A;  1JMB A;  1DX7 A;  4R8C A;  4JI6 O;  5KLV E;  4GX5 A;  3M9Q A;  4U3J B;  4I4T B;  4WY4 D;  1AP6 A;  5GW7 A;  1RPR A;  3TJT A;  5BU8 B;  1FFT B;  4Y99 B;  2IBZ G;  3H1J H;  2KQX A;  5JCO A;  3TXS A;  1MZE A;  3L72 G;  2WLI A;  2JJL A;  1NKD A;  3KZI H;  3TGU G;  2KSJ A;  2OYH A;  3V4Q A;  4Z1M G;  3F89 A;  4WBA A;  1QBZ A;  1UIX A;  3E1I A;  5LHH A;  1FFX A;  2FBW C;  4PDV A;  3SFE C;  1R5L A;  1E5W A;  3ABV C;  3OM3 B;  2WLM A;  1NU1 K;  2E5Y A;  3HE5 A;  5IYZ A;  1GH6 A;  1QLE C;  1HGZ A;  2ZYG A;  1IO4 A;  4YIP A;  4DR5 O;  3CWB D;  5APT A;  3RK3 D;  3M9B A;  1KIL E;  4LFB O;  2XAQ A;  3O6Q B;  1K92 A;  2IZ1 A;  3H1I D;  5B66 H;  5LXT B;  1AR5 A;  4H44 B;  3CX5 H;  4LBE C;  3GVM A;  1Q82 Q;  2OCH A;  2QM4 A;  3L75 D;  2RDC A;  4ZKI A;  3CXH I;  4ZKU A;  4QMA A;  1GRJ A;  1Y74 A;  2HJD A;  2QKS A;  1HDJ A;  3CXH E;  2O1K A;  3QNE A;  2DWE C;  3D3I A;  4EKW A;  2O01 H;  3GW6 A;  3MP7 B;  1KB9 H;  1WRG A;  5H6Q A;  3RVZ A;  4LF9 B;  3SPJ A;  5LL6 Y;  1M9N A;  1SFC D;  1OMI A;  3CRQ A;  1MZ9 A;  1M90 Q;  5JVD A;  3TSI A;  2L5G B;  2QJK C;  1EXI A;  1HF9 A;  5B66 Z;  4UCS A;  3AK1 A;  4Q6G A;  4WFG A;  1Q6I A;  1HNZ B;  3FX0 A;  1NAY A;  3JAW B;  4PI0 A;  3KPE A;  2GHY A;  4TQD A;  1IFM A;  3D70 A;  1JY2 P;  4W4K A;  5LHI A;  3H25 A;  2A06 H;  4H13 B;  2DOS A;  1TU3 F;  4FJC C;  3WMM 0;  1M57 C;  1RY3 A;  2A0L A;  3K0D A;  4I7Z C;  3J81 N;  1SQP H;  1KKC A;  3RK2 D;  4BW5 A;  2Y0I A;  1JB0 J;  4PD4 H;  3S9O A;  3A2F A;  1YXB A;  1BCC H;  3L70 G;  4F6R A;  4X88 A;  5DJU B;  2D2C D;  3OGI B;  3GMA A;  3L37 A;  4JI0 B;  2ZYD A;  2RNB A;  3FKS G;  2FYU G;  2HG5 C;  2FFD B;  3UO2 A;  4GLX A;  1OWA A;  3HD7 D;  3HKD B;  4NKG B;  2Q3E A;  4JZG A;  2R3S A;  3PTZ A;  2BE3 A;  4ZI7 A;  1WPB A;  1VF5 B;  1JY3 N;  4OGQ C;  3CD6 P;  4CH5 A;  1F7Y A;  1BDC A;  2DE0 X;  1FZF A;  5KJ7 D;  2QEX P;  3SJC C;  1QVG O;  1EZV H;  2B88 A;  1L0L G;  3AE6 C;  3ZJZ A;  1FOS E;  4OX9 O;  3OTF A;  1NS1 A;  4L8J A;  5AVU B;  1K05 A;  4X1Y A;  3HKB A;  4NTY A;  1XDC A;  1ZWI C;  3VMX A;  3AE2 C;  4MVU A;  3HKC B;  4DR6 B;  3AEF C;  1YCI A;  2IM9 A;  4TV8 B;  5H9C A;  1Q6U A;  4K8Z A;  1SF9 A;  2IU0 A;  4H37 A;  4D6T D;  2R9I A;  5KLI B;  4RO2 A;  1I0H A;  4N78 D;  5FL7 G;  2WLN A;  2CGO A;  3M0A A;  5AW4 B;  3CSX A;  2JJ1 G;  4N23 A;  4ZMD A;  4JYY A;  3CCL V;  2QM7 A;  5KKZ C;  4GKJ B;  3SWY A;  1S9K D;  1DEB A;  2MK3 A;  5KA5 A;  3OGC C;  3CCU V;  2QR4 A;  3HTK A;  1WPX A;  1HNZ O;  1SQQ H;  1F51 A;  1FZC A;  2RMZ A;  1UPG A;  1WP7 A;  2YSU B;  3ABU A;  3A5T A;  2XND H;  2UXD B;  4TLF A;  5JH7 A;  3AE7 C;  1GL2 C;  5CCG C;  3CME P;  1AJY A;  1YJW P;  2M3B A;  3MDS A;  3CCR P;  2WLH A;  4ZKP A;  4HYO A;  4QGP A;  3ZRW B;  3CXH H;  1ROP A;  4X62 O;  4LFC B;  1JQ0 A;  1NTM G;  1IFN A;  4O2B B;  4GOF A;  2FYN C;  3P30 A;  4DUZ O;  4GKG A;  2FML A;  4JI5 B;  1XHX A;  4AIL C;  4I9W A;  1EZJ A;  4JI3 B;  3PRJ A;  2P22 C;  5LOV B;  4MTX A;  2WVR A;  2CH7 B;  1NTZ K;  2ZXW B;  4GX0 A;  2R3C A;  5KHH A;  1QL1 A;  3BHP A;  1QVG U;  5CA1 B;  1Q5O A;  5LA6 A;  3K06 A;  1RE4 C;  3AED C;  1YIJ P;  1VL2 A;  4J7K A;  1JPX A;  2QWR B;  2X7R B;  3H1L D;  4TUY A;  2LO1 A;  4NXN O;  4DV2 O;  1AR1 B;  3D71 A;  3BPZ A;  3AEI A;  5HFM A;  3W7S A;  1XNQ O;  4I0X B;  4X9Q A;  1YJN V;  3STZ C;  3N2G B;  4EI2 A;  1DD3 A;  3B2E E;  2P90 A;  1A32 A;  4X65 O;  1VQ8 V;  5IJ9 A;  3UCS C;  2A45 H;  1XEQ A;  2L91 A;  4OH8 B;  2VS0 A;  2XZR A;  2XND G;  4PV1 C;  1URQ C;  3SFD C;  4LC1 A;  4TT3 G;  4L76 A;  1VQP P;  2H43 A;  1SQX K;  2F1M A;  1P84 I;  1LTS C;  1NU1 D;  2P5O A;  2FB5 A;  1KQG B;  2KSD A;  1P84 F;  3ASO C;  1P84 E;  2XAG A;  2E3C A;  4FK5 C;  5JJE B;  1HVV A;  3VQX A;  2YXQ B;  2CTW A;  3QO7 A;  1SQB K;  3Q4H B;  2AXT Z;  3ZHS A;  3GWO A;  4RJT A;  3CC7 V;  1X0T A;  2KZI A;  3DSQ A;  2EIM B;  3J7A U;  1XOU A;  4PA3 A;  3AEB C;  1OCZ C;  3G6B A;  2QJK B;  3BCC G;  5AW2 B;  1PP9 D;  2QE7 G;  1LP1 B;  1R3L C;  3THO A;  4BIZ A;  5EZY B;  4NTX A;  2IPP A;  3W7T A;  4U3J A;  4I4T A;  1JY2 O;  1RQV A;  2QDO A;  2I1J A;  1ZAU A;  3SYO A;  2V7Q H;  1R73 A;  4IFM A;  4U3F J;  1M57 B;  2OYO A;  2JS5 A;  4AQY B;  2ADQ B;  2A45 G;  1UII A;  2BCC D;  5AVS B;  1R6T A;  4JI7 O;  1VQ6 V;  5L3D A;  1Z2G A;  2Q7G A;  2O57 A;  1G1I A;  2F66 C;  4KUM A;  5B1N A;  4B3R B;  3CPW O;  1F23 A;  1W0K G;  3UQ8 A;  1OIP A;  1A02 J;  1M8O B;  1JTH A;  3WB1 A;  3ZS8 C;  4B08 A;  3SGI A;  1S72 P;  2OYI C;  5D5P A;  5EYP B;  2GM4 A;  4AI8 A;  4YHH O;  1FBM A;  5KLV K;  2V4H A;  2POH A;  1P7G A;  3O6Q A;  3KCX A;  5LXT A;  2YKP A;  4GCZ A;  5J9P C;  4DUY B;  4C46 A;  2FKX A;  3TGU D;  2WPS A;  3LW5 J;  2CUG A;  3FYE B;  5DEC A;  2LJ2 A;  1GO3 F;  4NB5 A;  4MTO A;  4O4L B;  2LKM A;  1FJK A;  3L72 J;  1ZTE A;  1AQT A;  4WB4 A;  1KTM A;  3L73 G;  1UFI A;  2VQF B;  1YTZ T;  1S5H C;  3TGU J;  2P10 A;  2AEJ A;  3GLM A;  3EHB B;  4NXM B;  1S1C X;  4MT8 A;  1BGY D;  1I94 B;  4WFB V;  4N6J A;  1SER A;  1SVF A;  2LP7 A;  1US6 A;  1N7S C;  1LTJ B;  3MD0 A;  3ABL C;  3JAW A;  2VQE B;  1AP5 A;  4UB6 E;  2M5A B;  1K73 W;  1ZLZ A;  3ETD A;  2Z0A A;  1RF0 C;  1HWT C;  2EUL A;  4K3A A;  3KXD A;  2YIA A;  5J2U B;  5C8Y B;  3U1C A;  2EZO A;  1J5E B;  1XMO O;  2G3A A;  3GF3 A;  1KUQ A;  3CCS P;  3OTO O;  4QNH B;  3QH9 A;  1RM1 C;  1VP7 A;  2O1J A;  4P9O A;  4X64 B;  3MTU E;  4JF3 A;  2JGU A;  1QEX A;  4BRY B;  4FLT A;  1TVK B;  3AE1 C;  1PGQ A;  3IFM A;  4EOT A;  3CPW U;  2QIW A;  5M1B A;  1P84 H;  2FFD A;  1PPJ D;  4YTP C;  1KQL A;  1JFF B;  4AQY O;  3HKD A;  3BAA A;  4DV7 B;  1DIP A;  2CTQ A;  1EDL A;  1FDM A;  4JI4 B;  3P3P A;  3VMY A;  3CWB G;  4B3R O;  1L4A B;  4HH2 A;  1Q8I A;  1N2D C;  5LGU A;  4GYC B;  2ZDI C;  1RE3 A;  2E75 D;  3E8B A;  3NXS A;  3K57 A;  3L36 A;  3A7O A;  3H1I G;  2JWA A;  2EZP A;  1VQN V;  2Y0D A;  1SQV E;  3BFR A;  3H32 B;  5APQ A;  4F6E A;  3GB7 C;  3OAA G;  3L75 G;  3RW0 A;  3JAT B;  2AHZ A;  2Z5H A;  2LQT A;  4PA4 A;  3HKC A;  2Y4T A;  4DK0 A;  2AZ2 A;  4WFH A;  1ZOY C;  3OE7 G;  3L70 J;  3W68 A;  4JZ2 A;  4TV8 A;  4KHP O;  3BEH A;  4LWS B;  4FM1 A;  2GTS A;  4TOI A;  1Y9B A;  2JDI G;  1M4U A;  5GON B;  2FYU J;  1PNK A;  5FNV B;  1FXH A;  3A0H E;  1UJW B;  2EIK C;  2OQQ A;  4PV1 B;  3ITK A;  1URQ B;  4FLZ A;  2PUS A;  1LT9 B;  4X8A A;  1Y76 B;  3H1H G;  3CCE P;  5EIB C;  1VQL P;  4FZ0 A;  1I94 O;  2ZR3 A;  5GTI E;  1FXK C;  3H01 A;  3TXQ A;  3AE4 C;  4CS3 A;  2KG7 B;  3L35 A;  2JWD A;  1WNS A;  2X6B A;  5DM6 V;  1BSH A;  1T2K C;  2W0F C;  3S3X A;  2PZS A;  1K04 A;  4U3F E;  5LP6 C;  3M0D C;  1SZX A;  1L0L J;  1RF1 C;  3LUT B;  3W67 A;  1N32 O;  1FS0 E;  4FFK A;  2Z5U A;  4MS2 A;  5FPR A;  4Z1V A;  1SQX D;  1EN4 A;  4DXW A;  4HB1 A;  3A2A A;  2XT9 A;  1Y4M A;  5LMU O;  2XUM A;  3ZRW A;  4GOE A;  1A02 F;  2EIJ B;  4O2B A;  5LHG A;  2QRX A;  4LF5 O;  3M7M X;  3IGA C;  2CTR A;  3B71 A;  2R5B A;  5GTH Z;  3I5C A;  2ZFC A;  3HE4 B;  2M0B A;  5LOV A;  2H94 A;  2CH7 A;  3SJQ C;  4O9B A;  1E1Q G;  4E2L A;  4DW1 A;  3RVY A;  4B3T O;  5CA1 A;  2K37 A;  3OD4 A;  4H0L B;  2WPV B;  3K0G A;  4DV7 O;  2WLK A;  4PDL A;  2IBZ I;  2JP3 A;  4P9P A;  3JCU E;  4JI4 O;  1KKD A;  1GM7 A;  4G28 B;  1JOC A;  3JSN A;  2IBZ E;  5AW1 B;  2WT7 B;  3D8C A;  5IJ0 B;  5IYC O;  1HJ0 A;  2QWP B;  3BAS A;  3L72 E;  2Z4E A;  4I0X A;  3MGN A;  4EYY Q;  2XAH A;  4B3S B;  4N3Y B;  2E74 C;  1X22 A;  3LDD A;  3N2G A;  1N36 B;  2OYI B;  1IXB A;  1HP8 A;  2XKM A;  3ZN1 A;  5CCH D;  3E8H A;  1OV9 A;  3P32 A;  3CCQ P;  4PI2 A;  3VYI A;  2KS1 A;  1SC5 B;  2EX3 A;  2YEV B;  1NTM J;  4IIJ A;  1N33 O;  4D6T G;  2YS8 A;  1MV8 A;  4QIW F;  3E8G A;  4HKZ H;  2CE4 A;  1OW6 A;  2BTO A;  3BVO A;  2JEE A;  3A0B E;  5CHX A;  2ZM6 B;  3B8N A;  3IC9 A;  3V2R A;  3ZIA G;  2Q7C A;  1OCO C;  2VRS A;  3H1K G;  3Q4H A;  1XNR B;  1K73 Q;  5E1A C;  1FZB A;  3OUS A;  5DN6 G;  4DR1 O;  1AB3 A;  2QJY B;  3OR7 C;  2UXB B;  1VQ4 P;  1MFT A;  1H2G A;  1LP1 A;  3E86 A;  5EZY A;  1USD A;  4XFJ A;  1L0N K;  1GN6 A;  3H1J E;  1PL4 A;  2F4V B;  1M93 A;  4DV5 B;  3AK3 A;  4J41 A;  1H89 A;  1H88 A;  1IBL O;  3U10 A;  4LF6 B;  3RL0 g;  4H44 D;  3N4X A;  4MN4 C;  4JI2 B;  2Q7H A;  3Q5S A;  1DK1 A;  1THZ A;  3A0H H;  4DR7 O;  2Y9Y A;  4EDF A;  1OCR C;  2WSF J;  1RM1 B;  3D36 A;  3Q2Y A;  4DRX B;  4FLY A;  4C7R A;  5GTI H;  2UUA B;  1KBH A;  1U96 A;  4DOJ A;  3G6E P;  1PP9 H;  4JI6 B;  1LNQ A;  3KYQ A;  1MA1 A;  3H1L G;  1I5X A;  3BCC D;  2F43 G;  3O8Z A;  3RGU A;  3L70 E;  4OWF A;  1ZR2 A;  2OTJ P;  5EYP A;  4TV9 A;  1LTI C;  4D7S A;  5B66 E;  2HLO A;  3DGE A;  3CC4 P;  4CZZ A;  4FLW A;  2Q3I A;  3BCC J;  2FYU E;  5EBL C;  2W6J G;  1VQ7 V;  1SP4 A;  1RSO A;  2N74 A;  4LF7 O;  2BCC H;  4C7N B;  4W7Z A;  4LNU B;  1JNM A;  2KUB A;  2P2U A;  1KB9 E;  1BE3 D;  1H8H G;  2NR5 A;  4I2L C;  1K9M Q;  2SPZ A;  2KLV A;  1NU1 G;  2XDJ A;  1NGM B;  4DR5 B;  3OEE G;  2R5D A;  4ZIB A;  2N1T B;  4PA9 A;  1L0L E;  3HKE A;  3ZDM A;  4LFB B;  1IXM A;  1VQ9 V;  1J1D C;  3CHX A;  2PGG A;  1FXV A;  3JCU H;  3FB5 C;  3LW5 H;  1LTJ A;  2ARH A;  4LLH A;  5BXZ A;  1LTG C;  4XA4 A;  3ZHU A;  5APV A;  2A06 E;  1PNL A;  2IBZ H;  1URF A;  3WU2 Z;  1BS3 A;  2IH1 C;  4YXW G;  3L72 H;  3EXA A;  3T97 B;  2M5A A;  3TGU H;  2EIK B;  4PD4 I;  4Z1M H;  1J95 A;  3CRM A;  1PP9 G;  4K8X A;  2G8Y A;  1K8A W;  4PD4 E;  2Q1K A;  5J2U A;  5C8Y A;  5KUM A;  4MVQ A;  1ENV A;  1WB8 A;  2GA1 A;  2P4K A;  3HUS B;  2R72 A;  1FYJ A;  2JIZ G;  2FL4 A;  4LFA O;  2K3R A;  4BRY A;  1RF1 B;  4GKK O;  1TVK A;  2E5T A;  1XQ8 A;  2P1J A;  3A0B H;  1ZX3 A;  2ZT9 C;  3VBB A;  2P58 A;  1ZL8 B;  4LH6 A;  2J59 M;  2ZYA A;  1GMJ A;  3L73 J;  2ATK C;  4CH4 A;  2Y9Z A;  1JFF A;  1VQM P;  3ZED A;  1FAF A;  3AK2 A;  4FLU A;  4DV1 O;  4WFF A;  1DLB A;  4WY4 C;  2QGN A;  2WLJ A;  1ZME C;  2E5L O;  1EZV E;  3AEC C;  3R66 A;  4J10 A;  1L4A A;  5KA6 A;  2P7J A;  1K5Q A;  2OYQ A;  1N73 C;  1NTM E;  3ABM C;  1FZE A;  4R4L A;  1LWU C;  1S4X A;  3A0B Z;  2Q9L A;  3B4S A;  1JM0 A;  1NTK K;  4MTG A;  3RFR A;  2NRG A;  3H32 A;  3PLN A;  5B1A C;  3IF4 A;  2C9N Y;  3JAT A;  1K97 A;  3MUD C;  1KYO D;  4PJ0 H;  3Q5P A;  5AVZ B;  2RCV A;  4I1L A;  3L71 D;  2LW1 A;  2E74 B;  5DJT B;  2ITA A;  3RK3 C;  3FFQ A;  5GON A;  1KQS O;  1BGY G;  5FNV A;  3CCJ P;  4NR1 A;  4OX9 B;  3CLQ A;  1URQ A;  4CPG A;  5A9G A;  2RN9 A;  1LT9 A;  1Y76 A;  1D7M A;  5AW3 B;  2BEZ F;  1VMG A;  4P30 A;  1GK4 A;  1IZ3 A;  3L70 H;  2X0L A;  1SQQ E;  1VF6 C;  1SS3 A;  1ZRT D;  3EQ2 A;  3Q5R A;  5BY1 A;  5B1B B;  3CWB J;  1DF4 A;  3EFG A;  4PJ0 Z;  3TDK A;  1WN7 A;  2FYU H;  4G2K A;  4RUE A;  5BR8 O;  2PY5 A;  2XAJ A;  1SQV K;  2YO2 A;  4RES B;  2YIC A;  4I50 B;  5B3S C;  5L3F A;  1MOF A;  1SFC C;  3H1I J;  3RT3 C;  1KIL B;  4GZR B;  1SLQ A;  1KP2 A;  3L75 J;  5TIS E;  3K3W A;  2HFE C;  1T5E A;  2QWO B;  4WFA V;  3B09 A;  1PPJ G;  3MIW A;  3RL0 B;  1L0L H;  4CC6 A;  2W27 A;  1FC2 C;  3H1H D;  2A3Q A;  3HE4 A;  1LR1 A;  3QO5 A;  1ZSP A;  2F23 A;  1H8E G;  3TET A;  5KAF H;  3ETG A;  1DGS A;  2KP8 A;  3RK2 C;  1IFP A;  3CCV V;  1U7M A;  1OW7 A;  3CMA P;  2D2C C;  2ZKO A;  3RYF B;  1L0N D;  4X62 B;  2WT7 A;  2A45 I;  1HW7 A;  3N2K A;  5IJ0 A;  3B5N B;  1LTA C;  4IFF A;  2WQY C;  1FPO A;  4DUZ B;  3APO A;  2AXT E;  2YO3 A;  2QWQ B;  3CB2 A;  5EC1 C;  2DN9 A;  3LIE A;  3HD7 C;  4JI8 O;  4AHC A;  2OYI A;  1PD3 A;  2M3E A;  1PZQ A;  5IE9 A;  1KQS U;  5KAF Z;  1XL4 A;  1NI8 A;  1NTZ G;  1PV0 A;  3WB0 A;  2RKL A;  5K1X A;  3ASN C;  1NR1 A;  5B5E H;  1IBM O;  4IHJ B;  2KZJ A;  2YEV A;  1VQK V;  1QQC A;  4NXN B;  3CP1 A;  5KJ7 C;  4DV2 B;  3NMD A;  3EFF K;  2M8R A;  4IYH A;  1XNQ B;  5KX5 B;  1M57 D;  1QU7 A;  4J42 A;  2ZXX A;  2N9B A;  3AE3 C;  1YEW A;  3P8C E;  3E22 A;  1VPC A;  3S4R A;  3QF7 A;  2B89 A;  4X65 B;  2FYZ A;  3SSU A;  4MVZ A;  1DTO A;  1FKA O;  1S0V A;  1EXJ A;  1NTM H;  3JC2 2;  2OIE A;  5EBM C;  1K8A Q;  3CE2 A;  3K08 A;  2B5U A;  1N0J A;  5B5E Z;  4J7J A;  1V55 C;  1OCC C;  1DH3 A;  2EJ7 A;  2LW7 A;  3E89 A;  1NOH A;  3L73 E;  2JR8 A;  2ITD C;  2YXL A;  1SQX G;  3WUU A;  3ZHQ A;  5K5G B;  3SYA A;  2LGQ A;  5C39 A;  2OCC B;  2IYP A;  2Y48 A;  3CCL P;  2P4V A;  1R5S A;  1EQ7 A;  1RF0 A;  5BMV A;  4LF4 O;  1W59 A;  2DYS C;  4GX1 A;  3RYC B;  4HYT B;  2YUA A;  2UUC O;  3CCU P;  3OJA B;  1SQB G;  3JD0 A;  5KTB A;  1B06 A;  2H88 C;  4JAV A;  4D6T J;  3L9D A;  2B9B A;  2UU9 O;  2DMX A;  4C7U A;  3H1K D;  5E79 H;  1WP8 A;  5KHG A;  4LH7 A;  1T3U A;  4DRX A;  5AG2 A;  2DW3 A;  3AG1 B;  3GWK C;  4FZ1 A;  5KHI A;  2KLU A;  2Y0P A;  3SYQ A;  4PA6 A;  2ZT9 B;  2WTY A;  4GDO A;  2BAS A;  3SWF A;  3K79 A;  4R6Z A;  2W6A A;  4TT3 H;  1R6K A;  2Y0C A;  3CYO A;  3AEA C;  2QG4 A;  4YJ2 A;  4IL6 Z;  1KYO I;  2KB7 P;  2WSF H;  1XMQ O;  1HNX O;  1KYO F;  4WY4 B;  4JI7 B;  3BRV B;  4L87 A;  1XTG B;  5TIS H;  5H2F Z;  5E79 Z;  5IWA O;  1YSC A;  4C7N A;  3QO8 A;  1N73 B;  3S1K A;  1L1F A;  1WT6 A;  3B77 A;  2Q5U A;  4O2A B;  4KXR A;  3ZRS A;  1LWU B;  3KG2 A;  2H8P D;  3O9O A;  1EDK A;  2W90 A;  2LR2 A;  3CWB E;  1FJG B;  3CC2 P;  4B3M O;  3RK3 E;  4ASU G;  2DQ0 A;  3BCC H;  2NPS D;  2N1T A;  1WLE A;  1CI6 B;  5B1A B;  4YHH B;  1D2D A;  1R3J C;  1VDF A;  2IX7 C;  2H89 C;  1AI5 A;  2QE7 H;  1ZW0 A;  1YJN P;  2FKW B;  3K9S A;  3RGB A;  1XRE A;  3CME V;  5KLV G;  1E79 G;  1OHH G;  5CBH A;  4DV0 O;  5TIS Z;  1NTK D;  2HJF C;  3L75 E;  1M7L A;  3RK3 B;  3FXE A;  3H1L J;  2HR3 A;  4UFZ A;  4MW8 A;  3T97 A;  1QLE B;  4X1K B;  3K5N A;  2OTL V;  2AXT H;  2YMK A;  3L74 D;  2Z3Y A;  1ZLL A;  4IOI H;  1IDS A;  1N86 A;  1L4A D;  3DTU B;  1KFN A;  2CTP A;  3G4S V;  2OYH C;  3HUS A;  4E4E A;  2XU6 A;  5L3E A;  3LNN A;  2PI5 A;  2YDE A;  1I5Y A;  3M0D A;  1RF1 A;  3CC7 P;  1LUV A;  3JAS B;  1HBW A;  2JS3 A;  5A2Q N;  3LSU A;  1GN3 A;  1NU1 J;  2Q6Q A;  1ZL8 A;  2YXY A;  2PGD A;  4OVN F;  2C2A A;  3RYH B;  4I55 B;  1PV3 A;  1D5N A;  1NH2 D;  1T6A A;  1SQV D;  2O01 N;  5AVX B;  1XMO B;  3RYI B;  3OTO B;  3FGA D;  2HKO A;  3UO3 A;  5IYD O;  2LFS A;  4JQ0 D;  5CBO A;  1SQP K;  2QJP C;  1AA0 A;  4QE7 A;  2IJH A;  2AGA A;  1WAZ A;  3L73 H;  4HAM A;  5JWP A;  3PP5 A;  2YXH A;  1IJD B;  2ZE8 A;  3O65 A;  1H2N A;  1PP9 J;  1VQ6 P;  2YI8 A;  3NTN A;  3T1H O;  5IY5 C;  1R3I C;  2KIK A;  4I7Z B;  2D2C B;  1CP9 A;  3OW2 U;  3AG7 A;  2DWD C;  3G71 V;  1TUB B;  5APY A;  1EC5 A;  1BE3 G;  3K5B A;  1K5S A;  3CCM V;  3JAK B;  4L74 A;  1PGJ A;  1QX8 A;  3L4F A;  1AFO A;  4JV5 O;  2BCC J;  4FLV A;  1HR0 O;  3PHL A;  2ETN A;  1H2S B;  2L6L A;  1FJG O;  1YTF D;  4JF7 A;  3ASN B;  5GTH E;  1XBL A;  4XBF A;  3OMA B;  5CN0 A;  1PGP A;  2QTO A;  1YI2 V;  1SQG A;  2B87 B;  1FZA A;  2WZ7 A;  1LGH B;  4ASV A;  4OGQ B;  3F5T A;  3TNU B;  3IFX A;  1AVY A;  4KHP B;  1KYO H;  4H0L D;  3ZBH A;  1S2E A;  2GUZ B;  2Q6A A;  2OT5 A;  3ABK C;  1NJI W;  3FXD A;  1MUU A;  3IR9 A;  4N78 E;  4F4L A;  1KIL A;  3SYP A;  2Z5I A;  3U59 A;  3C3S A;  1CPY A;  1H2K A;  1VIB A;  4EFE A;  1Q7Y W;  1V55 B;  3CEI A;  3CWB H;  3N7N A;  4DR2 O;  5CBN A;  3D3Q A;  1S9K E;  4FMT A;  3FB7 C;  1WMK A;  3USS A;  2B9Z A;  3T1Y O;  3H1I H;  1BGY J;  4IFD K;  1DEE G;  2OTK E;  1WJZ A;  1G2C B;  1SQQ K;  1N32 B;  4NTW A;  3L75 H;  4DJG A;  3HR0 A;  2ZR2 A;  1MZF A;  5LMU B;  2WA4 A;  3RYF A;  5KKZ B;  4DR3 B;  1YTZ I;  3JD3 A;  3FAV B;  4LGD E;  2JDI H;  3B5N A;  4LF5 B;  3F7V C;  1E1R G;  5CBF A;  1ARO P;  4BW9 A;  2BEQ D;  1XTC C;  3H1H H;  1GL2 B;  4ICG A;  3OR6 C;  2Q69 A;  1JCH A;  4B3T B;  2P67 A;  3L71 G;  2UXC O;  3ICX A;  4IHJ A;  2HOD B;  3H1L E;  3IAO A;  5J2T B;  1IK7 A;  3VN0 A;  4ASW A;  3JSL A;  2FYN B;  2E75 C;  4UCV A;  4MW3 A;  4ZNC A;  1SES A;  3JAL B;  1S3J A;  5KX5 A;  2HP8 A;  1VQN P;  1JY3 P;  2K1A A;  3V5B A;  1FZC C;  2NNU A;  3APQ A;  1M56 D;  1HTL C;  3H1J D;  1YHQ P;  3B40 A;  3C8V A;  5KAI Z;  3ZMV A;  3ABT A;  1T8Z A;  3STL C;  1PM9 A;  3ZRV A;  1NU1 E;  4LF8 O;  1N33 B;  3N27 A;  4G27 B;  3LID A;  2XAF A;  2QA4 V;  1NTZ D;  1EFR G;  2EIL C;  3K04 A;  4DW0 A;  3LNM B;  3F7Y C;  4YY3 O;  4JI1 O;  1VF7 A;  2JGD B;  2XHB A;  1KN7 A;  2HVJ C;  2PRR A;  1NHL A;  3RYC A;  1Y47 A;  2VWJ A;  1NO4 A;  1EDJ A;  5AW9 B;  1U7J A;  1V54 C;  4DR1 B;  2OYH B;  1YZB A;  2HLD G;  3CX5 D;  5ITZ B;  1PP9 E;  1D5A A;  5GTH H;  3ASO B;  2K1E A;  1PL0 A;  3QG5 A;  1ZN5 A;  3UIA A;  2N1T D;  4BIU A;  2XAS A;  3A0R A;  1L0N G;  2V4D A;  1IBK O;  3U11 A;  1GW3 A;  1NH4 A;  2XV5 A;  3T2M A;  1DD4 A;  1OFC X;  3ETE A;  3AG3 C;  4D6T H;  1IBL B;  2R70 A;  5APX A;  3W7W A;  2RH0 A;  2E76 D;  1CSB A;  2J58 A;  1KU9 A;  5KMG B;  2BCC E;  3CRR A;  1OCZ B;  2ZE7 A;  4MVO A;  4U7O A;  4DR3 O;  2MW2 B;  4RQF A;  4DR7 B;  1KOR A;  2CPB A;  4WY4 A;  3V2N A;  1SQX J;  2G38 A;  1HNW O;  1SQB D;  3H1K H;  2QJP B;  4X20 B;  3ZHV A;  1HUC A;  4X66 B;  1VQL V;  4O2A A;  4IGG A;  2OWO A;  1LWU A;  2R32 A;  3GG2 A;  3AG2 C;  3UKM A;  5IY5 B;  2X6C A;  1ZR4 A;  1Q43 A;  1SQP D;  1N4C A;  4BR6 A;  1AVM A;  4JAA A;  5AW7 B;  1BMF G;  1BCC D;  2K9Y A;  3CRA A;  4X1I B;  3EVK A;  4LF7 B;  4U7J A;  4JPR A;  1BT8 A;  2UXN A;  5CCH C;  3TGU E;  1MSD A;  3MHS C;  1CEZ A;  3OUF A;  2AXC A;  1KFM A;  2IFN A;  4X1K A;  1JY2 N;  1NJI Q;  3OFN G;  3W7U A;  3CJH B;  2K9P A;  3TCU A;  3E35 A;  1FU1 A;  4Y99 C;  1GDT A;  1BGY E;  2ZE6 A;  2O3J A;  1Q7Y Q;  1SKV A;  2WLL B;  5IYB O;  2YNY A;  4MVM A;  4XDL A;  4P2Z A;  1TGO A;  2PFX A;  3H1L H;  4IYI A;  3E1R A;  2DJV A;  1EZV D;  2XOK G;  3JAS A;  4F6R B;  1QVF O;  4RQE A;  1NKZ B;  2A9H A;  3OA7 A;  5KLV D;  2W6J H;  4Z2W A;  3RYH A;  4I55 A;  3C9I A;  1PFI A;  4KFM A;  4KJM A;  3I55 V;  4EEQ A;  2IFM A;  4W7Y A;  3JD1 A;  1MNG A;  3IN6 A;  5AW0 B;  1Y6X A;  1YIT V;  3RYI A;  1YJ9 V;  2PYJ A;  1N7S B;  3CRC A;  3ZRX A;  3ABL B;  2YMY A;  1N34 O;  1GK9 A;  1NU1 H;  4LFA B;  1VQO V;  1RHZ B;  4H44 C;  4GKK B;  1IFI A;  5D5Q A;  3A3Y B;  3U1A A;  1PPJ E;  1LTB C;  1FDO A;  2ZXE B;  4UB8 E;  1S5L E;  4R50 A;  4BWA A;  4JBZ A;  4BXL A;  4PA7 A;  1Q81 W;  4WFE A;  4PJ0 E;  1Q3E A;  1NVP B;  1Q6H A;  1TUB A;  3J80 N;  3F5H A;  2WSS G;  4DV1 B;  2ZJS E;  1V9P A;  4YXW H;  1KIL D;  4FM0 A;  2E5L B;  5LMN O;  4RKU J;  4X66 O;  3KHU A;  3UM7 A;  3MZW B;  1VQ4 V;  2WMM A;  1QCE A;  3K5L A;  1IVS A;  1P49 A;  3FYI B;  3VOU A;  2WSE J;  3K5O A;  2A7W A;  3CXH D;  3RL0 D;  1NTK G;  3TF5 A;  1NWQ A;  2B87 A;  4H33 A;  3L74 G;  4PEL A;  1IZN B;  3GHG C;  1JY3 O;  3GF7 A;  4H13 D;  3TNU A;  3WU2 H;  2IJK A;  2YKO A;  3WB2 A;  3G3Z A;  3II6 A;  2GUZ A;  1AIL A;  2P7T C;  2ILM A;  3ZMS A;  1QVF U;  1T3J A;  4O4L A;  2JKV A;  4WBN B;  4QJF B;  1VQ9 P;  3B5N D;  2RMK B;  2FXP A;  2FFD C;  2R9R B;  1YQ3 C;  4UCO A;  3P3N A;  4JTD B;  1BE3 J;  5L3C A;  3CX5 F;  1OJH A;  3ETQ A;  3U0Z A;  1ZV8 A;  1AI7 A;  5KAF E;  4DZO A;  5L3B A;  2C0W A;  5BR8 B;  4D7T A;  1G2C A;  2W8Z A;  1SQV G;  3VP9 A;  1RE3 C;  1X9V A;  4DV3 O;  1VQ5 V;  1VF5 D;  2ZAE B;  2W83 C;  2AHY A;  3BA9 A;  1H2L A;  3C90 A;  5L8R J;  4KHX A;  3TK1 A;  1FXK B;  2MKV A;  4NPF X;  3UT5 B;  3FAV A;  3E2E A;  1OVR A;  3DC5 A;  4TUY B;  1QLN A;  1BGY H;  5LP6 B;  2EJR A;  2KSE A;  4NPE A;  2IJJ A;  2CK3 G;  1S5L X;  4ZHQ B;  1P4R A;  4L75 A;  1GL2 A;  5CCG A;  5B5E E;  4BWN A;  3OMI B;  3JSV C;  3AG3 B;  1TAE A;  5KLI C;  1M1J C;  4UVA A;  2HOD A;  5J2T A;  3B8E B;  4U3F G;  3VQV A;  1LJ2 A;  2KXP B;  4MSW C;  3DXR B;  1NT2 B;  3E83 A;  3JAL A;  5APS A;  3HRN A;  4JI8 B;  3PH0 A;  3JYC A;  1Q90 D;  3WUV A;  5AVQ B;  2FTK A;  1RE4 A;  2Q8V A;  2XNX A;  5AW5 B;  1PPJ H;  4UB8 H;  3P7K A;  3I56 V;  1IBM B;  4DV6 O;  2KI7 B;  1S5L H;  4A5U B;  4J7Z A;  1OW8 A;  1GZL A;  1U97 A;  2VWK A;  3M8A A;  4TWK A;  3VQY A;  2KNC B;  2WIT A;  5KUK A;  4Y28 J;  2ZIO A;  4LWS A;  3V6I A;  4IL6 E;  1GN2 A;  2ZVO B;  2QKC A;  3OT7 A;  2JGD A;  4CBC A;  3BY6 A;  5HFL A;  3L71 J;  2ZXW C;  5H2F E;  5E79 E;  1H0T B;  3F5W C;  3AE9 C;  3RBZ A;  4UB8 Z;  3C3T A;  1S5L Z;  5ITZ A;  2KG7 A;  2W0X A;  1SET A;  5LYJ B;  1JUN A;  5CMU A;  1VAR A;  3ZHT A;  2R44 A;  4KT0 J;  2A79 B;  1QL2 A;  3VQW A;  1NTZ H;  2ODM A;  1OCO B;  4PDM A;  3TYY A;  2CPS A;  3R65 A;  2E43 A;  1X4T A;  1JTH B;  2ZD9 A;  4LF4 B;  2UUB O;  1F4M A;  1Q86 W;  1X79 B;  2DQ3 A;  2UUC B;  2M7W A;  3RBX A;  1Q81 Q;  5KMG A;  2UU9 B;  1QGK B;  4YJ3 B;  3KZI Z;  1QLE D;  3CCJ V;  1OZ0 A;  4X20 A;  1X8Y A;  3CCV P;  4HNA B;  1FAV A;  1RH5 B;  5AW8 B;  2NLJ C;  3AE5 C;  2Q5Z A;  1GKF A;  3BCC E;  3FB8 C;  2L35 A;  3M99 B;  4FVM A;  3CXH F;  3ZX6 A;  2YIB A;  5CA3 A;  2Q73 A;  3H1H J;  1NYH A;  2Y0E A;  2OAR A;  1GTW A;  1SQX H;  1OCR B;  1XMQ B;  1HNX B;  1JMM A;  2EIM C;  3ZMT A;  1SA0 B;  4X1I A;  4GIF A;  1QHT A;  3FWL A;  3H1J G;  5IWA B;  3G80 A;  3K9A A;  4B7K A;  4BAY A;  5F2V O;  4RUF A;  1BE3 E;  1L0N J;  1YF2 A;  1P84 D;  4AQR D;  1SQB H;  2HFE D;  1VQK P;  4OPH A;  3ZCC A;  2BOC C;  2Q7E A;  4JYA O;  3JCZ A;  1BQZ A;  3CJH A;  5LGN A;  4B3M B;  2GTA A;  4J80 A;  2QWN B;  2WLL A;  1GU4 A;  2ZE5 A;  1HWY A;  1K3E A;  2AEM A;  3GHG B;  2OGU A;  4IL6 X;  3AG4 C;  4ZBM A;  3BVH A;  3D36 C;  4K0K O;  1GMG A;  4DV0 B;  1W2B O;  2WPD G;  2YIU C;  1EM1 A;  3CMA V;  2KYV A;  3M9H A;  2R9A A;  1JVM A;  1G8M A;  1Z56 A;  3LSS A;  5TJH A;  5CB4 B;  1BSM A;  2GUS A;  3HPL C;  1FE6 A;  2JVD A;  1J1D B;  4PHZ A;  3LDC A;  2YKQ A;  5K1P A;  4UV8 A;  2GSM B;  1AJP A;  2HG5 D;  1N7S A;  3SPG A;  4R4M A;  5AVR B;  3K59 A;  1X59 A;  4R7C A;  5CA0 B;  1Z5V A;  2LXB A;  1FOS F;  2Y69 C;  2IH3 C;  3K03 A;  4IL6 H;  2ZIN A;  4OGQ D;  5KLV H;  3CD6 V;  1E79 H;  1ZP0 C;  1CXZ B;  2QEX V;  1IC2 A;  3S3W A;  5H2F H;  2A06 G;  2ADP A;  4WVZ A;  3T4D A;  1BQ0 A;  1IX9 A;  4A7P A;  2IZ0 A;  2HPC B;  1SQP G;  1LTJ C;  4DR4 B;  3H1K J;  3WFV A;  2J5U A;  1BCC G;  2N9Y B;  1M1J B;  5BVZ A;  5AW6 B;  4DO2 A;  3T1H B;  3FD9 A;  4LF9 O;  3K5M A;  1KYO E;  1YBK A;  5H5N A;  4X89 A;  2H8P C;  3L71 E;  3FX7 A;  4B7E A;  4LNU A;  1Q2N A;  2ZDI A;  1FJP A;  4JV5 B;  2GBO A;  3ABM B;  3JD2 A;  2NPS C;  1GD2 E;  1W2B U;  1HR0 B;  2WSE H;  1YVW A;  4WBN A;  4JPZ B;  3MHH C;  3OW2 O;  1M5I A;  1U57 A;  1Z5W A;  4WF9 V;  1EZV G;  1K7D A;  4ZOL B;  1GAX A;  1ZRT E;  1BL8 A;  5CCG D;  2XTA A;  1GL2 D;  3H1I E;  1H2M A;  4K35 A;  2OTL P;  1VQ8 P;  1YJW V;  4QPK A;  3CCR V;  2Q4P A;  1SS1 A;  3PN1 A;  1NQT A;  1Y67 A;  2KB1 A;  1GM9 A;  1H38 A;  1L4A C;  4FFB B;  1GM8 A;  4JI0 O;  2FYU K;  1O9G A;  3ML0 A;  2CDY A;  3G4S P;  1BE3 H;  3RN4 A;  1NTK J;  2HHH B;  1N0N A;  2HVK C;  1Q86 Q;  2M6Y A;  2QJ1 A;  5EC2 C;  1FXK A;  3D6Y A;  3M06 A;  5H6R A;  1AQ5 A;  5JCO C;  3L74 J;  4DR2 B;  3UT5 A;  1NAF A;  2BTQ B;  2AZ0 A;  1L2P A;  3CC2 V;  5LP6 A;  4TQF A;  3JAR B;  3H1H E;  4UVC A;  1W2E A;  4AUW A;  2HYN A;  1YIJ V;  5KAI E;  3T1Y B;  5IDJ A;  2H7H A;  2AW9 A;  4ZHQ A;  5B3S B;  1L0L K;  1OVU A;  1K34 A;  3QVN A;  1SFC B;  1AJQ A;  3KDP B;  2C0X A;  1EN6 A;  4UVB A;  1AV1 A;  1SQQ G;  1NKN A;  5AVV B;  1L0N E;  4O4I B;  2KS1 B;  4WWI A;  5AVT B;  1LT9 C;  2BOB C;  4IIJ B;  3DXR A;  1PKX A;  4WCE V;  4DR6 O;  1B04 A;  3SPC A;  2K9J B;  4PV1 D;  3LSQ A;  1URQ D;  5EFW B;  4JAS A;  5CBG A;  1SQV J;  5EBW C;  4DR4 O;  3G71 P;  1VQP V;  3IAY A;  1JJ2 U;  2Q67 A;  3RK2 B;  2EBO A;  4DCK A;  1XL6 A;  3A8T A;  4NYK A;  3EWK A;  4I5S A;  3CCM P;  1N7L A;  2ZVN B;  3X2Q C;  4LR3 A;  2UXC B;  1W0J G;  1MG1 A;  2KNC A;  4GKJ O;  1AJN A;  1K33 A;  2ZNJ A;  4W80 A;  5CCH A;  4FPP A;  3AEE C;  2EIJ C;  1JEK A;  5JQG B;  2FXM A;  2IW5 A;  3HD7 B;  4EB6 B;  3R4Y A;  3Q3D A;  2OIG A;  4UCT A;  4U3F D;  4GT1 A;  1R3K C;  1ZUQ A;  5DED A;  2UXD O;  1YI2 P;  1GK6 A;  4OXS A;  5C93 A;  1H0T A;  1AVO A;  4RWU A;  5FPO A;  1QR9 A;  4H0L C;  3G67 A;  1NTM K;  4LF8 B;  4LFC O;  1K4D C;  5LYJ A;  1PIX A;  3AG4 B;  2YIB D;  4JI5 O;  2YIU B;  4NVP A;  1JR9 A;  4CH6 A;  4AYC A;  4D6T E;  4JI3 O;  4UCU A;  4I50 A;  4YY3 B;  3L71 H;  1K4C C;  1B6Q A;  4JI1 B;  2IDB A;  3ZMZ A;  4B86 A;  2DYR C;  2HHH O;  4HBN A;  1JMK C;  4TV9 B;  3VOP A;  1OVV A;  2X6A A;  1OX3 A;  2RQ6 A;  1OCC B;  3H1K E;  2WA3 A;  3KCY A;  3K58 A;  4YJ3 A;  3VMA A;  4RO0 A;  4DYL A;  1S72 V;  3ZMU A;  1RSO B;  2IBZ D;  4XE5 B;  4QPJ A;  4HNA A;  1OZH A;  3AEG C;  3L72 D;  4YXD C;  1KD1 W;  3SPH A;  2KOG A;  1BHA A;  2DYS B;  1IBK B;  2Y69 B;  3ZN0 A;  3CI9 A;  2Q68 A;  1MFZ A;  2JEU A;  4GUN A;  1J1E C;  1JCD A;  2V7Q G;  1SA0 A;  1PL5 A;  3HKE B;  2QJY C;  2ZIM A;  3JD4 A;  3Q1M A;  1HNW B;  4CH3 A;  3WU2 E;  2LGW A;  5JJN B;  2MJZ A;  2F93 B;  3VTP C;  4UCR A;  5KAI H;  2WSC J;  1N7S D;  3C1L A;  2C9L Y;  2KK7 A;  4KL1 A;  3ZHR A;  4MTF A;  2KKW A;  4I6M C;  1AI6 A;  5APU A;  3SYC A;  5CJ4 A;  2P6J A;  4JAU A;  3WG7 C;  3GHG A;  1M56 C;  1R8E A;  1L0N H;  1NTK E;  1I7F A;  4BIO A;  1Y66 A;  1WA8 B;  3SJA C;  2NPS B;  1LUW A;  3BRC A;  3PJS K;  1NVP D;  1XIL A;  3L74 E;  1TUE B;  2EIN C;  2JK5 C;  3CCS V;  2JO1 A;  1L8D A;  1YDX A;  3CS5 A;  4PDR A;  2BSK B; 
#chains in the Genus database with same CATH homology
 3EWK A;  3G9R A;  2E74 D;  4RKU J;  1JB0 J;  3S9O A;  2NZ2 A;  1NGM B;  2QSI A;  4OGQ B;  4OGQ D;  1RQU A;  2D2C D;  4H0L B;  2WPV B;  1ZP0 C;  3GMA A;  4H0L D;  1DD3 A;  2JP3 A;  3D6Z A;  2WSE J;  1DD4 A;  3AE9 C;  3AEE C;  4PV1 C;  3SFD C;  2G3A A;  3GF3 A;  3R4Y A;  2E76 D;  1HJ0 A;  3Q3D A;  1KOR A;  3RK3 E;  2V7Q J;  1KQG B;  2E74 C;  2ZT9 D;  4KT0 J;  3GF7 A;  3T97 B;  4H13 D;  1VF5 B;  1OW7 A;  2H89 C;  2J5U A;  4Z1M H;  3AE1 C;  4OGQ C;  1WMK A;  2QIW A;  2G8Y A;  2D2C C;  5M1B A;  4H0L C;  4YTP C;  2WQY C;  1PIX A;  2FXP A;  3AE6 C;  1YQ3 C;  1DIP A;  2E76 C;  1OW6 A;  2YMK A;  3AEB C;  1K05 A;  2IDB A;  2ZT9 C;  4H13 C;  2K9Y A;  1GMJ A;  3AE2 C;  3AE5 C;  3AEF C;  4U7J A;  2E75 B;  2O01 J;  2E75 D;  1UIX A;  1U57 A;  1RQV A;  1NYH A;  2BEQ D;  1YQ4 C;  2FBW C;  1VF5 D;  3SFE C;  1ZRT E;  3ABV C;  5L8R J;  1ZME C;  3AEC C;  2MKV A;  3AE3 C;  3AEG C;  4YXD C;  1ZOY C;  4XFJ A;  3AE8 C;  3IAO A;  1PV3 A;  1IK7 A;  4R4L A;  5KKZ C;  1KQF B;  1EXJ A;  1KIL E;  1Y9B A;  2E75 C;  1S5L X;  3FGA D;  4H44 B;  1MKM A;  4H44 D;  3RL0 g;  2OQQ A;  1VF5 C;  3D6Y A;  4PV1 B;  3Q5S A;  1KMI Z;  1PL5 A;  2QJP C;  5KLI C;  3AE7 C;  2QJY C;  1AJY A;  3Q5P A;  3Q1M A;  2WSF J;  3Q2Y A;  3AE4 C;  3C8V A;  2E74 B;  3IN6 A;  4IL6 X;  1K04 A;  3O6Q A;  4I7Z B;  2YIU C;  2D2C B;  2WSC J;  1OMI A;  2FYN C;  2H88 C;  2QJK C;  3LW5 J;  1Q90 D;  4H44 C;  1EXI A;  1HF9 A;  2BEZ F;  2E76 B;  1FDO A;  3Q5R A;  1KTM A;  1R8E A;  3D70 A;  2P10 A;  3AED C;  3GLM A;  3H25 A;  2ZT9 B;  1S1C X;  1OW8 A;  4GDO A;  4H13 B;  4PV1 D;  1VL2 A;  3B71 A;  1TU3 F;  4R4M A;  4TT3 H;  4Y28 J;  2JO1 A;  4I7Z C;  3AEA C;  1FDI A;  3D71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...