1Q90D

Structure of the cytochrome b6f (plastohydroquinone : plastocyanin oxidoreductase) from chlamydomonas reinhardtii
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
156
structure length
156
Chain Sequence
b'TKKPDLSDPVLKAKLAKGMGHNTYGEPAWPNDLLYMFPVVILGTFACVIGLSVLDPAAMGEPANPFATPLEILPEWYFYPVFQILRVVPNKLLGVLLMAAVPAGLITVPFIESINKFQNPYRRPIATILFLLGTLVAVWLGIGSTFPIDISLTLGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apocytochrome f
publication title An Atypical Haem in the Cytochrome B6F Complex
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Photosynthesis
total genus 44
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2003-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 1q90D02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1q90D01
2E74B 1ZRTE 3LW5J 2QJPC 4RKUJ 2WSFJ 2D2CB 2E76B 2QIWA 4I7ZB 2E75B 3C8VA 4KT0J 2K9YA 4Y28J 1S5LX 1VF5B 2QSIA 2YIUC 5L8RJ 5KKZC 2ZT9B 4H0LB 2FYNC 5KLIC 4IL6X 4H13B 2QJKC 2QJYC 2WSCJ 4H44B 2WPVB 1Q90D 1JB0J 4PV1B 4OGQB 2O01J 2WSEJ
chains in the Genus database with same CATH superfamily
5APQA 3BCCE 5IYZA 5KJ7C 1VP7A 4WVZA 2OYHA 4GOFA 2LFRA 3H1KH 5IJ9B 1Q82Q 2H89C 2YKOA 3K59A 4DV0O 4Y28J 2NPSC 1K04A 1RQVA 4P2ZA 5B66E 2PYLA 3VN0A 1KB9D 3JC22 3TSIA 4JI2B 1EZVI 2OIEA 1YQ4C 3CC2P 3SYCA 3HE4B 1V9PA 1M56D 2KK7A 1N86A 4UB6H 3ZMTA 4PDLA 1Q7YW 3AE7C 3L71H 3K9AA 1LTAC 2CTRA 2RMKB 4DUZB 3VYIA 4G27B 1VQOV 3G4SP 3UT5A 1B04A 3ML0A 2DW4A 1N4CA 4MVRA 3K57A 5B1AC 1V54B 3AG3B 2Q7CA 3TYYA 2MK3A 2GTSA 4TQDA 3L73G 4LF9B 4PD4H 3A7OA 1AP6A 3AE3C 1GN4A 4ICGA 1MSWD 1VQ4V 2PAJA 2Q1KA 5D5QA 3OFNG 1BE3G 3RK3C 1NTZE 3HKBA 1VARA 2JGDA 3GWOA 2EULA 3CP1A 2KNCA 5C39A 3H6PA 2N74A 4UB6Z 1RPOA 2QGNA 5B1BB 2UWJE 3ZBHA 3HUSB 3DGEA 3OEHG 3GHGC 3T4DA 5D5PA 1RE3C 4OGQD 3VQYA 2KS1A 5EC1C 4FLXA 4U3FE 1AJNA 1YJWV 2XNDG 1HUCA 5CMUA 5LHGA 4JI0O 4JI5O 1M56B 1NU1H 4WFEA 4B3SB 4IT5A 2M8RA 1P7GA 1F4MA 3EHBB 2W0XA 2FYUG 1WAZA 4LF6O 4O4HA 1YSCA 4U7OA 5H5NA 2QRXA 2Q68A 4LWSA 4UUJC 1YHQV 4LH6A 1AILA 3L71D 1DTOA 5BMVA 4TUYA 1J1DB 3WB0A 1W0JG 2V7QH 3B09A 3D36A 1JNMA 4B7EA 2IW5A 1WRGA 1OZHA 3K58A 4NR1A 1KILC 3L74G 4IYIA 2V4HA 5AVZB 1LNQA 1JX9A 4DV5B 1RE4C 1USDA 1HP8A 2N05A 5CBHA 1K3EA 2KZJA 3RWRD 4PD4D 1VQPV 4ZI7B 2R72A 2R70A 1M1JA 1OVRA 5CA3A 1L0LG 1Y6XA 4I6MC 4EB6B 3I56P 4BIZA 1O9GA 1SA0A 3HR0A 2OT5A 3M8AA 4MW8A 2DYRB 1XREA 2HODB 2ZVOB 4E2LA 1FFXA 3IF4A 1IC2A 4UCOA 1S72P 1SFCB 3RL0C 2HR3A 3L70G 1NU1D 1AB3A 4AQYO 1SC5B 3SWFA 1SQVE 5TJHA 2EIMC 2ZXXA 2A7WA 2Y0IA 3C3TA 1QLNA 4WB4A 3U1AA 3MZWB 3E89A 2HKOA 1QCEA 1S4XA 4GX0A 3UO2A 3Q4HA 1V55B 1H8HG 3BY6A 1NH2B 1F7YA 3TGUE 1JEKA 2FL4A 3B8MA 3PJSK 3TNUB 4JF3A 4NXMB 4H44D 1GL2A 4R7CA 3HE5A 1T3UA 2VQEB 5L3FA 1NJIW 1G4YB 4NYKA 4RAIA 1H0TB 1JCCA 5BU8B 2RDCA 1FKAO 2W83C 3E35A 2HG5D 2Y69C 1EM1A 4LF8O 1VQ8P 2IX7C 2W6JH 5H2FH 2DJVA 2ZVNB 1PPJE 5LGUA 3ABMC 4FFBA 2CH7A 5GTHE 3SFEC 1SQBH 2GUZB 4H0LD 4PV1B 5JVDA 1RF0A 3RW0A 4D6TH 2MJZA 1BCCH 3CJHA 1DF4A 3JCUE 3AK2A 1R3JC 2Q6QA 1H88A 2N1TC 1KFNA 1UFIA 4RQEA 3EQ2A 3G67A 3D6ZA 3DSQA 2IJKA 2E74C 1N73B 3JCZA 1DF5A 1YIJP 2ZT9B 1I5XA 3T97B 2ZD9A 1ZP0C 1QX8A 3KXDA 2AHZA 1JY2O 2WVRA 3WUVA 2GDSA 4JPZB 5H2FZ 4KJMA 4IFDK 2QE7H 3S1KA 1OW7A 3CWBJ 4ZNCA 2EJ7A 2QTOA 3L35A 3CCQP 1URQC 3WG7C 4Z2WA 1KILE 5B1OA 5LA6A 4JI2O 4GKKB 1PGJA 3P30A 3E1RA 3DC6A 4B7KA 1IFMA 2M0BA 4DR7B 4H0LB 3RL0g 1OJHA 4I7ZC 4DUZO 2R5BA 5E1AC 1EN6A 4FM0A 1NU1K 4BXLA 2M7WA 1MKMA 1VF6C 1XTGB 4QPJA 5KHIA 3F5TA 1Y66A 2GUSA 4YTPC 2EBOA 2LXBA 1K73W 3CYOA 2NPSA 1SQBD 3NFQA 4X1KA 2K3RA 4JI3B 1L0NJ 2A06G 1OCRC 1H8EG 1WPXA 4LF9O 1GMGA 2Q0OC 1IFIA 1VF7A 4D6TD 1BCCD 1KQGB 2JGDB 2BEZF 1XTCC 1MZFA 1PGOA 5CJ0A 2KLVA 3L74E 3CX5H 4LF5B 2M3EA 5FLXN 2OTLP 3CCJV 2FMLA 1R1BA 2WLHA 5AVSB 2ZE5A 5B3SC 1WNSA 1YVWA 2XAGA 1SQQJ 2QJPB 2WSCJ 2R44A 3A5TA 3APQA 2FXMA 1AQ5A 1ZX3A 2QG4A 4B3SO 5LHIA 2KB1A 1FXKB 2ZR2A 4LFCB 4X1IA 5KHKA 4Z1VA 1KP3A 3FX7A 1FJGB 3GF7A 1OHHG 4UFZA 1GD2E 3JARA 1M90Q 3ZHVA 5BY1A 1DEBA 4ZHQA 1QLED 3L70E 2IJIA 4FFKA 5L8RJ 4JZ2A 2XHBA 1IURA 1QQCA 1YTZI 2DWEC 2Q0AA 3JYCA 2JS5A 4DR5B 4H13B 2B1GA 3D8CA 5CBFA 1RE3A 2BEQD 1N8RQ 4FVMA 1GL2D 1UIIA 3CE2A 3QTCA 1K5QA 5FL7G 3CCLV 2QWQB 3QO8A 4DV5O 3ASOC 1ZV8A 2I8DA 1S0VA 1MABG 4GCZA 2Z3YA 1H2GA 2JWDA 1Z5VA 2B9ZA 3CWBE 4B3TB 4KHPB 2ILMA 2Q9IA 1KUQA 1S9KE 3CX5D 3PLNA 1YI2V 3RGUA 4OVNF 1NVOA 5KAIE 3J7AU 2M5AA 4P9OA 2ZR3A 3AE5C 3VQVA 2Y0DA 3ETEA 3CC7P 2WA3A 1IK7A 3K79A 4PA3A 1KILA 3H1JE 1ZSPA 4LH7A 3H1KG 1SQBK 2G3AA 1KECA 5LP6B 2BTQB 1GK4A 1RE4A 3UQ8A 2VRZA 3B40A 2GBOA 3Q4HB 5KAFE 3R65A 4I55B 4MW3A 4OGQC 1B06A 1X8YA 4DJGA 1L0NE 3HE5B 4OPAA 1F23A 1RH5B 1OMIA 1FZCA 4JBZA 4NXMO 3E83A 3JD3A 2VQEO 1R5LA 2A79B 5LHHA 3SWKA 1THZA 1NTMG 5EYPA 2NLJC 1BT8A 1N0NA 4J9ZB 1MV8A 1S5LE 4YXWG 2YXHA 3ZRVA 2H8PD 4YPCA 3QF7A 2CH7B 3G9RA 1GAXA 1KMIZ 3KPEA 1PL0A 4TV9A 5KX5B 1KTMA 3FB8C 5JVDB 3CXHI 3RBXA 5L3EA 4UCVA 3JAMN 2VQFB 2P4VA 3CJHB 1JY2N 3THOA 3NMDA 3A0HH 1RP3B 2WLJA 2ZXWB 1AA0A 2W6IG 2YIDA 2WLKA 4I4TB 2DYSC 1P84I 1WN7A 4JV5B 2NPSD 2H88C 1NO4A 2WSSH 4AQRD 3KYQA 5B5EE 1S2EA 2GM4A 3CSXA 3II6A 2IBZH 2PY5A 1Y8AA 2A06E 3CLQA 4JI8B 1XNRB 3SPHA 3MDSA 2Z4EA 1KB9F 5KLVH 1FAVA 5EIBD 2POHA 1KN7A 3JAKB 2XAFA 3AE8C 4KUMA 3H1HG 2YI8A 4NTXA 2WZ7A 1ROPA 2GSMB 3CCSP 1NU1G 4KL1A 2A45H 3F7YC 4FZ1A 1K33A 1XI1A 4HKZH 3CHXA 3HTKA 1IBMB 2M6YA 3E86A 3A0HZ 1N33B 2X7RB 3L37A 1HJBA 4NTYA 4UVAA 2XAJA 4GKKO 1KU9A 2DQ3A 2WPRA 2FTKA 1KYOI 1FAFA 3GW6A 2X6AA 3RK3D 1Q2NA 4DR7O 3AG2C 1JTHA 3OUSA 1OXZA 2YMYA 1ZL8B 3AEIA 2NPSB 1IBLB 3P8CD 3ZJZA 4H44C 1P7BA 1T6AA 4MS2A 4DZOA 1QVGO 1LUWA 4YJ2B 4KXRA 2R9RB 4JI3O 5KKZC 3KQGA 1URQA 3E22A 3OMNB 4JAVA 1ENVA 3L72H 3H1LG 3PHLA 2KSEA 1EZVH 4IHJB 2HPCA 3KHUA 1PFIA 1U7MA 3CC2V 2IBZD 1XMQB 3CMAV 3A2FA 1FZFA 3OGIB 1L4AC 5KLVD 2K9PA 3B71A 5CHXA 5LOVA 3G4SV 3OE7G 5EZYA 4GX2A 3OUFA 1WA8A 2R9IA 4EYYQ 3RK3B 4LFCO 1KILD 5CN0A 1FJGO 2KSJA 4PDVA 4IL6X 4BR6A 2XZRA 1OCOB 3N27A 1K4DC 2QJYC 1SZTA 2AW9A 4NKGB 5EFWB 1J5EB 2QSAA 3GHGB 1YQ3C 5AVYB 4X20B 1KQLA 2C0XA 3LNNA 4PD4F 2BCCJ 3L75J 1ZRTE 1MA1A 1SERA 4DR5O 3W7UA 2YNYA 3DC5A 2P7TC 3ZCCA 3D71A 5CMZA 4NTWA 1SQPG 1H2NA 3OMAB 3A8TA 1IFJA 3BRCA 1QGKB 1LTBC 5GTIE 2Y4UA 4GIFA 1OCZC 3Q5PA 3RL0D 3L36A 3ZDMA 2LJ2A 1OFCX 4GOEA 1RM1C 5AVQB 2EIKC 4IFMA 1JOYA 3L72D 4B3TO 4KHPO 1IK9A 1B3QA 1EZVD 1AI4A 5IYDO 5JQGB 1D5NA 4JF7A 3CCUP 2CTWA 2P2UA 1HR0B 4WFHA 1YJ9P 3D3IA 1QR8A 1VIBA 1COWG 2H43A 2WA4A 5IT9N 1EDKA 4Q20A 1KFMA 4N78D 3S9OA 5APYA 3KCYA 4LF6B 3JASA 2QE7G 1EZJA 3ZMVA 1RHZB 5J2UA 1XL4A 3BCCJ 2QJKC 4X64B 4IIJA 1YJNP 1OVVA 3UO3A 4Y99B 3N4XA 4WBAA 2N9YB 3H1HE 1NHLA 5AVTB 2ARHA 5EYPB 2YMKA 3E8HA 2I1JA 5KLVK 4XA4A 3CCMP 4J9YB 5L3BA 4DR6B 2YO3A 3CMEP 4QIWF 4MVUA 1YDXA 2UXBB 1LP1B 3Q1MA 4KT0J 4X1YB 1Q5OA 1WJZA 1XOUA 3CRQA 2QA4V 5APTA 1QLEC 2E74D 1KQSO 1RF1B 4G2KA 1S72V 1OX3A 1SQQH 2K9JB 2EZPA 5IY5B 3P3NA 4O4LA 2VQFO 1IX9A 4U7JA 3U0ZA 4TV8A 3AECC 2ITCC 3MHVA 1U96A 2CUGA 4JV5O 1MFZA 1W2EA 1A02J 5LYJB 1I5YA 4DV1B 5AVUB 4FJCC 3JD4A 4ZIBA 1URQD 3BA9A 2EX3A 2Q5UA 5TISE 4CH6A 2KXPB 2Y69B 4JI8O 1BGYG 2NNUA 4J41A 4J7ZA 1XNRO 4AQYB 3V4WA 1J95A 1M1KQ 3ABLC 1S5LX 2WTYA 2YIUC 2BCCE 3AG1B 3L75E 4F6EA 1NTZJ 1Q82W 2YS8A 4EIJA 2PP6A 1VQ7P 1SQXJ 1VQ8V 4P30A 4O2AA 3OD4A 3LDDA 3CXHE 1IBMO 4GT1A 3PRJA 5KHJA 1N33O 2N1TB 5AVWB 3ZMZA 4WY4A 4U3FJ 2E74B 1IFPA 2WPDG 1ZR4A 2JWAA 2OTJP 5C8YA 4YY3O 3FD9A 5IYBO 2QWNB 1QVGU 3I55P 4DYLA 1YIJV 1FXHA 2OWOA 1IBLO 4OXSA 4UCTA 1SQQD 2RNBA 1PIXA 3FXDA 3K3WA 3NR7A 3GG2A 4UB8E 5CB4A 3LDCA 5J2TB 2QR4A 4BIUA 3WG7B 1KKCA 4I5SA 1IVSA 4AILC 4X88A 3M0DA 3QWOC 4HNAB 2XASA 1X59A 3M7MX 3JALA 3STZC 3C9IA 4JYAB 3F5WC 1ZLZA 3V4QA 5AW2B 2XUMA 4I7ZB 4I0XB 1XMQO 2AXTE 1PNKA 1KYOE 4ZKIA 1PGPA 3JATA 1J2JB 1N7SB 2UUBB 2BOBC 3P32A 2IJJA 3TETA 3CPWO 1JFFB 1OCRB 1VQNP 1PV0A 1TUBA 1CEZA 2IFNA 2FFDC 3ZRWA 2PI5A 1U57A 3RYFA 1JMMA 3K04A 1GRJA 3B5NC 5EIBC 3IGAC 5IJ0A 5IWAB 4C7NB 3W67A 1K9MQ 1LT9C 1HNZB 3O65A 3AEFC 3LIDA 1CW5A 4U3JA 1J5EO 1JCDA 1PNLA 3G6BA 1SQVJ 3H01A 5B3SB 1L4AA 3FAVB 4JTDB 1FXVA 3AEBC 3N2KB 2JGUA 2OTLV 2XAQA 3CCVP 3CC4P 4N3YB 2AGAA 1EN5A 3TGUJ 1YCIA 1X22A 1HW7A 2XT9A 2OIGA 3CX5F 5GTIH 2E42A 4WBNB 3SJAC 1OCCC 3SPJA 3E7KA 3GVMA 3DTUB 4PA6A 4I9WA 2VWJA 1SQXE 2GA1A 5ITZB 1NI8A 4ZKUA 3V5BA 2L6LA 1GN3A 3JD0A 2EIJB 5FPOA 2IBZG 1HR0O 2WWWA 1PP9G 3CCEP 1HJ0A 3SGIA 4DO2A 5EBLC 1M7LA 4BAYA 1SQQK 5KLVG 3JASB 3ASOB 2EINC 2G38A 5GTIZ 1HVVA 1IO4A 2BSKA 4XDLA 3M9HA 1K5SA 3LNMB 3ZMUA 3L73J 1Q86Q 1BGYE 1VQ5V 4OWFA 4X64O 1FZEA 1EDJA 4KP4A 1AI7A 3PH0A 2OARA 1Z2GA 3RYHB 4UCRA 5JH7A 1BE3J 2PRRA 2H7HA 3OTOB 3X2QB 3W7TA 1AI6A 2XAHA 4N23A 1G8MA 3W7XA 3AE1C 5AW4B 4NPDA 1EFRG 3DXRA 3FWNA 1MFTA 4EI2A 2JRIA 1AVOA 1AR4A 1KQSU 5KLIC 1I0HA 4DR6O 4WY4D 3ABKC 3SR2C 2UXBO 1Q8IA 2N04A 1VF5C 3CC7V 1NT2B 3GLMA 2PTMA 2GTAA 4B3MB 5AW8B 4YJ3A 1EC5A 4OGQB 2Z5HA 2Y0CA 2Q6AA 1U7JA 3S4RA 3K0GA 2YDEA 2P22C 3OAKA 1FZCC 2KZIA 2FYUJ 1GU5A 4L76A 1SZXA 2IPPA 1Y47A 1YF2A 2IFMA 2AHYA 3STLC 3ABUA 2B87A 1WB7A 1BHAA 3EFGA 2G8YA 3GMAA 3L72G 1MMMA 4X65O 4FLUA 4DV1O 3G6EP 3BAAA 4PJ0H 1I7FA 4CS4A 3MHHC 3L75H 4RWUA 3CCRV 2QM8A 4DRXA 4I2LC 5DJTB 4GZRB 4XFJA 3L74J 5E79H 5EC2C 1X0TA 4DR3B 2ZE8A 3RYCA 3KDPB 4Z1MH 1P84H 4MTOA 3K5NA 4WFFA 1NTKG 2YIAA 4PJ0Z 1W2BO 5BZBA 2OTKE 3HB3B 2F66C 3H1IG 1M9NA 1K92A 2H3OA 4FM2A 3ZMSA 5KHGA 2OCCC 1HDJA 4DXWA 1L4AD 3L70J 4W7ZA 2WSFJ 3A2AA 5E79Z 3CCSV 1XILA 2D3OW 4LNUB 2BOCC 2FXOA 4ABMA 1GK6A 2Q69A 5IYZB 3FKSG 2FBWC 1E79H 3BCCH 4MVOA 2OYHB 4WFGA 4JYAO 4X9QA 4LF4B 2KB7P 1S76D 3L73E 4DR2B 1XHZA 2LQTA 4FLTA 3B8NA 5GONA 2NZ2A 4PDMA 4IGGA 1BE3E 4J7JA 2CK3H 3H25A 4GX1A 1BDDA 4H44B 3L75D 2CE4A 2UUBO 2E43A 3MD0A 5AW9B 5B66H 4B08A 1TUBB 1H2MA 4TSFG 2YXQB 3I5CA 3ZRWB 1SP4A 3EWKA 1G6UA 3RYFB 5KKZB 2ZAEB 4JI7B 1KBHA 4ZOLA 2ZYAA 3A3YB 3C90A 2PGGA 5IWAO 3O6QA 1P84D 1M90W 2C0WA 4I50A 3UT5B 4WCEV 3H1JJ 1HNZO 3LIEA 2E75C 2P58A 1L4AB 2FYUE 3WUUA 3IN6A 2HEPA 4P9PA 1Y9BA 1TGOA 1ZWIC 1R6NA 5JCOC 1N8RW 4TT3G 4UCUA 5B66Z 4D7SA 1GKFA 5AW6B 1T5EA 1KC8Q 3HKBB 1L8DA 4IL6E 1NTZH 2FFDA 1GM8A 1KV4A 1NAYA 1SQQG 5CA1A 1R6KA 3A0RA 2KNCB 5KUKA 3ABVC 3B5NA 2QJYB 1H8AA 2YIBA 2R3SA 3BCCD 4HB1A 3ZX6A 2F1MA 1LT9A 3Q3DA 1N36B 2WPSA 2KS1B 1VQMP 3E8GA 4DV6O 3VP8A 2VWKA 4ZMDA 1Q43A 4U3FH 1K05A 2YXYA 1L0LE 2AZ0A 2O1KA 2O3JA 2NN4A 3JAWA 2V4DA 1LTJC 3M99B 1NWQA 1DD4A 4GLXA 2UUAO 3USSA 4O4HB 2YKQA 1OCZB 2DE0X 2QWOB 4K35A 4LWSB 4LBEC 2LKMA 2JEXA 2JJ2G 2F95B 3JSNA 1RM1B 5AG2A 2EIKB 5JJEB 5BMVB 4TUYB 3E8FA 1K97A 2R9AA 3QO5A 3OA7A 3RK2D 4DUYB 3EFFK 5LBQA 1AP5A 3ZIAG 2O01N 4KFMA 2RKLA 3MIWA 4NPFX 1HNWB 1TVKA 1V54C 3T1HB 3C1LA 1VQ4P 3M06A 3AG3C 4FZ0A 1Q3EA 3OTOO 3KZIE 2NR5A 2JS3A 1X4TA 3LUTB 4YHHB 4I9QA 2JDIH 2ZIMA 1FZGA 2UXCB 4MSWC 3CCUV 3IC7A 4DV7B 2KYVA 1AI5A 2W27A 3LW5J 1MZEA 1M1JB 1YJ9V 4QE7A 4YJ3B 2JJLA 5APWA 2YKPA 1JPXA 3EVKA 1SA0B 1NTZD 4B3MO 1NTKE 1J1EB 1BZKA 1YJWP 1BSMA 5B1BC 2QKCA 3HUSC 1SQFA 4J11A 1FFXB 3H1IE 4L75A 4HYOA 4RO0A 3VQWA 1IFDA 4CH4A 1W5CE 1YJNV 1K8AQ 4UXNA 2JP3A 2LW1A 3BRTB 4U3FD 1I08A 1WMKA 2VRSA 3J81N 1QLEB 1ZOYC 1SQVH 1WT6A 3CCMV 4PHZA 4RQFA 4KHXA 3WB2A 3CMEV 3ZEDA 3HKCA 1CP9A 3F7VC 4MTFA 3TGUH 2NRGA 1AJPA 1GL2B 2LR2A 1PKXA 5AVXB 3BPZA 1J1DC 5CBNA 2C9NY 4DR3O 2W6BA 1LTTC 2AXCA 1NOHA 1RSOA 2ITDC 2P6JA 1HGZA 1W2BU 2F43G 4RUFA 1VQ6P 3L71G 1JCHA 2WQYC 1P49A 4DR4B 3CL3D 3ABLB 4FFBB 1HF9A 1PPJH 4FPPA 1VMGA 4UVCA 4K0KB 1AQTA 2YIUB 3FB6C 1QHTA 3C3SA 1JA8A 1PV3A 1JY2P 5GTHH 3JD2A 4GX5A 1RQUA 3J80N 3CRAA 2GUVA 4JQ0D 1HNXB 4GKGA 4LP8A 3H1KJ 2C9LY 1B6QA 5BXZA 1NQTA 2ZM6B 3JCUH 3UM7A 1JR9A 1VQ7V 2MKVA 1GK9A 4WY4C 4O2BA 3SPIA 1GDTA 4X66B 1SFCC 2DW3A 1IFNA 3SYPA 4LF4O 4DR2O 3N2GA 3B5ND 2YIBD 1O9HA 1GU4A 3WU2E 1VQKP 1SQVD 3T1CA 3CEIA 2OTJV 2KG7A 1V55C 5GTHZ 1NTMJ 1NTZK 2WMMA 4B3RB 5KA6A 5LA6B 3SJCC 3I55V 3M0DC 4BRYA 3TGUD 3ZN0A 3CXCU 2WLLA 4JI7O 1E5WA 2O1JA 3JCUZ 1H2LA 3TCUA 3E8BA 5H6RA 3K5MA 2GV9A 3GF3A 2MW2B 4F6RA 2B89A 4YY3B 3RYIA 5APVA 1AROP 2WITA 1H2SB 2HLDG 4HYTB 1NS1A 1R3IC 2V7QG 3SYQA 3A0BE 3F89A 1QL2A 4UV9A 2XKMA 2X0LA 1PPJD 4X1KB 3ZHTA 1Y76A 2K1EA 4PV1C 3AEDC 1FD9A 2Q5ZA 2Y0PA 3ZHRA 1G1XB 1ZTEA 4GUNA 3ETQA 1ZAUA 2FFDB 3LSUA 4O4JA 5CA1B 1M5IA 3U11A 4IL6H 1FYJA 3H1HJ 2FYNC 2WT7A 1EQ7A 3QVNA 1N73C 3LDEA 1VQNV 2IH3C 3L74H 1PD3A 3BEHA 5EK0A 4QPKA 1LT9B 1NU1J 2HLOA 4LF7B 3MAQA 3WMM0 5APXA 2EILC 2SPZA 1N36O 1KKDA 2CGOA 4BW9A 5B1AB 3CI9A 1GW4A 5AW3B 4GYCB 4JI4B 4LGDE 2I1KA 5JCOA 4R4LA 2E5TA 5DJUB 4X1IB 1PNMA 3OR6C 1Q6UA 1WB8A 2PZSA 1DX7A 1BL8A 1AR1B 1OCCB 1G2CA 2KLUA 1QR9A 3JARB 3CCVV 3CC4V 1KORA 1DLBA 3MP7B 2X6BA 4ZHQB 4MN4C 3QNEA 4GDOA 1BQ0A 2KP8A 3L70H 4C7RA 1VF5D 3H1KE 2WSFH 4DUYO 5IJ9A 4JTAB 3SJQC 2W90A 3AG4C 1HNWO 2AEMA 3T1HO 3H1LJ 1FC2C 2JEUA 1SQVK 4FLWA 2X6CA 4L74A 4YHHO 3IAYA 2LP7A 1G1JA 5K1XA 2UXCO 2EINB 1LTJA 2IJHA 2W6JG 4DV7O 1T8ZA 1ZXGA 1NVPD 3H9VA 3CCEV 4TQFA 3AE9C 4UB6E 1SQBG 2W6AA 1S5JA 3CWBH 3UKMA 1NTME 3L71E 1KD1Q 2KOGA 3L74D 4D6TG 5H6QA 1BCCG 1GN6A 4EEQA 1M4UA 2M5AB 4IFFA 4BWNA 3F5HA 5KAIH 2Q9LA 4W4LA 2HVKC 3TJTA 1IZ3A 2QJPC 3RFRA 2PGDA 2PUSA 1NKNA 2QIWA 1KILB 1ZLLA 5KLIB 2ZQMA 3H1JH 4PD4E 4CPGA 3APOA 1LTSC 2QJ1A 1AJYA 1SKVA 3IFMA 1VQ9P 1VF5B 1H89A 1M1KW 2EJRA 3MUDC 3LSSA 5KAFH 2UU9O 4JASA 1RPRA 3K0DA 2B1IA 1SQPJ 5CCHA 4O4IA 2LW7A 1L0NH 5BVZA 2VS0A 1FZCB 2BASA 5AVRB 3L70D 3D3QA 4L73A 3B77A 1NBMG 2K88A 3HUSA 1VQLP 3CCLP 1VL2A 4H13C 3I56V 1R73A 5KA5A 3AK1A 5KAIZ 4RKUJ 1R8EA 4K8XA 1NU1E 3M9BA 2KSDA 4D7TA 2WPQA 4HJGH 3RL0B 1WLEA 1S5LH 1F4NA 2J58A 1CSBA 4TV9B 4DR4O 2EIMB 2D2CD 3RK2C 4X8AA 3G6EV 4K8ZA 4K0KO 3TF5A 2E3CA 2UUCB 2WSCH 4EOTA 2HP8A 1FBMA 3BVHA 2CPSA 3KG2A 3RN4A 5KAFZ 1LWUC 5L3CA 3CWBD 1UPGA 3K5LA 1HNXO 3R66A 4UVBA 1S9KD 2DQ0A 1JQ0A 5A2QN 2ZM6O 5B5EH 1NTZG 2Q4PA 4FK5C 3S3XA 2UXNA 3BVOA 1US6A 5GW7A 5IE9A 1PL4A 4JGSA 4X65B 1JJ2U 1I94O 2QTSA 4I1LA 3N2GB 2A06H 4X66O 3BFRA 3Q2YA 1M57C 1Y67A 3HRNA 1S5LZ 3H1JD 2P10A 3ABMB 2KG7B 1USEA 2ZKOA 4ZI7A 3H1LE 3FGAD 2XDJA 3BASA 2E75D 1FOSF 4EB6A 3NTNA 3VMAA 4C46A 3HTKB 1G1IA 3KKYA 1L1FA 1YTFD 3AEGC 3VMXA 2IYPA 3BABA 1P84F 2ZINA 3W7SA 4B3RO 1L0ND 3AEEC 3LW5H 3MGNA 2P67A 2QKSA 2HODA 4QNHB 2P06A 4MVQA 5FPRA 1R5SA 2Q73A 1Y74A 5B5EZ 1BSHA 3RYIB 4WWIA 4OPHA 1X9VA 1JTHB 1SFCA 3IFXA 3VTPC 1SQGA 5LGTA 1K9MW 3A0BH 3GWKC 3M9QA 5AW5B 3OW2O 5APSA 1M8OB 3K9SA 2AEFA 1XDCA 1MNGA 1R6TA 2JDIG 1T3JA 5B1NA 1WP8A 3HKEA 2ZXWC 1BGYJ 2WLNA 3SPGA 3EXAA 1URQB 1XNQB 2KUBA 2WT7B 3D70A 3E22B 2B88A 3TNUA 3VP9A 2OYQA 2HPCB 4MVMA 1IXBA 1K34A 4W7YA 2XU6A 4TLFA 1Y4MA 3SYAA 2QEXP 3CCQV 4DR1B 5CBGA 1SQPE 3MTUE 1H0TA 3AK3A 2E75B 2A06D 4LF7O 5H2FE 1YXBA 1YTFB 1XQ8A 3A0BZ 1SQBE 1L2PA 2ZE6A 5LOVB 5L3DA 5EZYB 4JTCB 2Y0EA 1WA8B 3M0AA 2V1DA 5FNVA 4JI4O 1N32B 4JAUA 5HFLA 1H38A 2Q3IA 3M91A 2KQXA 4MVSA 1SQVG 2CPBA 5BR8O 2Z5IA 5K1PA 1YTZT 3RVZA 2Q3EA 2YXRB 1W59A 1HH0A 1A02F 1N73A 3TGUG 5CA0A 4ASUG 2HVJC 4ZKPA 3T97A 1Q86W 1FDMA 5CCHD 1SS1A 3HD7C 2XTAA 3G3ZA 1XL6A 1N2DC 2QSIA 2QVAA 1N0JA 1QU7A 2P1JA 1LTJB 1VQMV 1XBLA 3FFQA 1BQZA 5CBOA 1A32A 3CMAP 4BIOA 2YICA 1PPJG 4OH8B 1L0NK 3SJBC 1NTMH 4LFBB 1MZ9A 4R6ZA 2HJFC 3SPCA 1X79B 4YXWH 2KIKA 2OQQA 4CS2A 2WSSG 1JMBA 4DV6B 3QH9A 3VMZA 4LR3A 3AE4C 1WP7A 3L9DA 1EDIA 2Z5UA 2F4VB 1PM9A 4NXNB 3L4FA 2UUAB 2WPVB 3V2PA 5J2UB 1JUNA 2YUAA 4O4IB 3MHSC 1KQFB 4IIJB 5AW1B 2WSEJ 3CX5E 1OCOC 4FLYA 3IC9A 2A45G 1NR1A 4A5UB 3H1KD 2JVDA 3H1HH 2QWPB 1IBKB 4DV4B 1SS3A 1ZRTD 3ZHQA 2E76C 3OGCC 3V2NA 5KUMA 4HH2A 1NKDA 3GB7C 5KHHA 1CZQA 3G71P 1FXKA 1NH4A 1SFCD 1Q7YQ 1EXIA 2UXDB 4DK1A 4O4LB 2RCVA 1FPOA 1PP9J 3OM3B 2UUCO 3MUDA 2FY8A 1NTMD 4TV8B 5IYCO 5KLVJ 2H94A 2QKAA 4CBCA 1NH2D 2RN0A 1T2KC 4GKJB 3E1IA 1NR7A 4JYYA 1EXJA 3TDKA 1EZVG 5TISH 2HFEC 1KP2A 2P5OA 4DOJA 4PA9A 1H2KA 2BCCH 1VQ6V 2RN9A 2YEVA 3H1LH 3VOPA 1JB0J 1YEWA 4K3AA 4O2AB 3PTZA 1NAFA 3G80A 1D5AA 1LWUA 4Y99C 1EDLA 2JJ1G 2DYSB 3JSLA 2B5UA 1Y74B 2IZ0A 3CXHH 2LO1A 4PV1D 4AUWA 4WY4B 2QA4P 1JO5A 1Q81W 3H1HD 2YSUB 3OEEG 1L0LJ 3PN1A 4TOIA 4EKWA 5C8YB 1HWYA 5TISZ 3OW2U 2P90A 3K5OA 5IDJA 1VDFA 1S77D 1RF1C 5F2VO 2BTQA 5LP6A 2ZT9D 4JZGA 3VBBA 5AW0B 1M93A 5IY5C 3L72J 3ICXA 5CB4B 3HKEB 2RJZA 2AEJA 4UB8H 3ZRXA 2JR8A 4I55A 2O01J 1CPYA 3V6IA 1VQKV 4TWKA 4BW5A 1BSNA 4E4EA 1XNQO 3JALB 1ORQC 5L3GA 2M3BA 1KC8W 2OCHA 5CCGC 3CWBG 3RK3E 1SQPH 1YITP 3CB2A 5A9GA 2D2CC 1DH3A 4DR1O 3P3PA 4YIOA 1KB9I 3CD6P 4NPEA 4PELA 2AXTH 3AG2B 2IU3A 1CI6A 3JATB 1FS0G 4HZ3A 4LC1A 1KYOH 3P8CE 2JO1A 2IM9A 3AG1C 4HBNA 1DIPA 1R3KC 5KX5A 3CPWU 5FNVB 2BCCD 2JEEA 3H1LD 2ZNJA 3ASNC 1NTKJ 3A0HE 3H1JG 4UB8Z 1ZUQA 2AZ2A 1N32O 3BA8A 5JJJB 1NTMK 1SESA 1XUQA 1Q81Q 4I4TA 3RVYA 2FYNB 3H1IJ 4YIPA 1PL5A 5K5GB 3P8MC 2A0LA 5IJ0B 3CXHD 2IBZE 2JKVA 1PP9E 2K9YA 5CA0B 1TUEB 4X62B 3UCSC 1L0NG 3B8EB 2LGWA 4U3JB 5KLVE 2EILB 4QJFB 2AXTZ 1XMOB 4B86A 4QE9A 3JAKA 4QGPA 1S1CX 4DCKA 2Y9YA 2FYZA 1QVFO 3RGBA 3KCXA 3OJAB 4FIPC 3IJ4A 3WFVA 5AVVB 1LR1A 1Z5WA 1NJIQ 2K37A 3HKDA 4F4LA 2OYIC 4EFEA 3FB7C 4CS3A 2FKXA 1SQXH 3BRVB 4LFBO 3PP5A 5KJ7A 2XOKG 1SQPD 4J7KA 4JAAA 1YYCA 1FDIA 1E1RG 4WFAV 4OX9B 1K4CC 4N6JA 1GMJA 1OVUA 1N7SC 3AG4B 1KYOD 4R4MA 1ZL8A 3HD7A 3ZS8C 2QDOA 1K8AW 5KMGA 4H13D 2F4VO 4DW0A 1FFTB 2WLIA 4YJ2A 4NXNO 3RT3C 3FXEA 2F23A 2LFSA 3WB1A 4H33A 3SWYA 2BSKB 1VQOP 1ZR2A 1XEQA 4XBFA 2J59M 3L72E 2DMXA 1EZVE 4ASWA 5LGNA 4G28B 4IHJA 2ITAA 1BGYH 4FM1A 3ZHUA 5JH7B 5LMUB 4MT8A 4NVPA 3DXRB 1IBKO 4PD4I 1IZNB 4DV4O 1GM7A 1Q90D 3AG7A 1SETA 5DM6V 3LSQA 3Q5SA 4N78E 1LGHB 4LLHA 3K5BA 1Q6HA 4N21A 1ZW0A 1W0KG 2CGNA 2J5UA 2L35A 2UXDO 3VOUA 1ZN5A 3O8ZA 5CJ4A 1M57D 5CCHC 1TA8A 1VQ9V 2QJKB 1SQXD 2BTOA 3WUTA 3GHGA 1K73Q 2B87B 4X20A 2EIJC 3U10A 4DV3B 2KKWA 2PI4A 1NGMB 1ZMEC 4GKJO 1M56C 4PA7A 3H32A 1EBOA 2QWRB 3OMIB 1YHQP 1VQLV 4JPRA 1FJPA 3W68A 1VQ5P 1AVMA 2YEVB 5LXTA 4DRXB 3RK2B 2B9BA 4JYBA 2UU9B 1PZQA 2RQ6A 1LWUB 2PYJA 1AV1A 2R5DA 4CH5A 1FS0E 4AI8A 3RYCB 1BGYD 1SQPK 2RMZA 5JQGA 3RBZA 3NXSA 2WAMA 3X2QC 3SYOA 1DEEG 1VQPP 4WF9V 2E5LB 4Q6GA 4A7PA 1MSDA 1NYHA 4DV2B 2ZYGA 1K7DA 1M57B 5AW7B 1RY3A 2DOSA 2ATKC 3S3WA 1JMKC 3QG5A 2CDYA 5DEDA 1PGQA 3E2EA 4WFBV 1RFYA 2P7JA 2YI9A 2HHHB 2HYNA 1OWAA 4JYCA 4UCSA 1SF9A 2DYRC 1GN2A 1WPBA 1AR5A 4LFAB 1MUUA 3U1CA 3JSVC 1HTLC 2ZFCA 1SRYA 4J42A 1I94B 2WSEH 4AYCA 4MVZA 4JI1B 3CCRP 3OAAG 3IR9A 2CTQA 3ETGA 3L73H 1CI6B 1QL1A 5GONB 3IAOA 4IOIH 2ZJSE 1UJWB 1LP1A 4H37A 4X1YA 5KJ7D 4EFBA 1BE3H 1JJOA 2LGQA 1FJKA 1DK1A 1SQQE 5HFMA 2BE3A 1KZUB 1SVFA 2O57A 1N7LA 3TXSA 4ASVA 4EDFA 1RF1A 2K9JA 2ZDIC 3AE6C 2W0FC 3L71J 4CC5A 3HD7D 2FB5A 1NKZB 3CRCA 3P7KA 1SQXK 2DN9A 4ZOLB 5LMNB 2WLMA 4FLVA 2ZYDA 1PP9H 2XNDH 3O6QB 5LYJA 4RJTA 5CCGA 4I50B 4L87A 4X62O 1UIXA 4XE5B 2IDBA 2Q7GA 4NB5A 2FYUH 4DW1A 2QEXV 1QNMA 1QVFU 1XMOO 1JY3O 1VEWA 1KB9E 4IYHA 1F51A 2ADPA 2QM7A 1BS3A 3HKDB 3T1YB 1JM0A 2OGUA 2QM4A 3Q5RA 2ODMA 4FMTA 2N1TA 3B5NB 5EBMC 2R3CA 4QMAA 2OYHC 1OIPA 1N34B 2ZT9C 4JI6B 3L73D 1IDSA 3ZRSA 1KD1W 4U7NA 3HD7B 4OX9O 1AFOA 1BE3D 1L0LH 1OV9A 1DGSA 3JAWB 1CXZB 5DN6G 5KMGB 1TU3F 2E5YA 2YC0A 1BDCA 4C7UA 2PF4E 2WLIB 2FKWB 2YO2A 5J2TA 1D2DA 3FB5C 1S5HC 1FZBA 2V7QJ 5BR8B 2HG5C 2E76D 2BCCG 3L75G 4HNAA 1LT1A 2OYIA 4IL6Z 5EBWC 1YZBA 1LTIC 2O01H 1PP9D 4LF5O 2P4KA 1GO3F 2A9HA 4H0LC 1GTOA 2CAZC 4DV0B 1TVKB 4I0XA 4PA4A 1AJQA 5M1BA 2FXPA 1OZ0A 3OTFA 5LMUO 1VF6A 1QEXA 1N7SA 2FYUD 3KZIH 4Z1MG 5J9PC 4UV8A 1JVMA 2Z0AA 4CC6A 1OW8A 2C2AA 3B4SA 2R32A 4L8JA 3BATA 2RH0A 1JFFA 1T2KD 3K06A 3CX5I 4PI0A 2LXCB 2OYOA 5H9CA 3JD1A 3CCJP 5LL6Y 2HFED 2XV5A 3TXQA 3CRMA 3HE4A 4CH3A 2Y9ZA 1NTKH 4W80A 4C7NA 1MG1A 2HJDA 2IH1C 3N7NA 3H1IH 1HBWA 2DWDC 3H32B 2IU0A 3FAVA 2E76B 5DECA 1E79G 1URFA 3ABTA 1QBZA 3O9OA 3KZIZ 4DV3O 1L0LD 3BCCG 3N2KA 1Z56A 5LXTB 1GW3A 1GTWA 1FXKC 3ABKB 1E1QG 2CK3G 4WBNA 3HKCB 2ETNA 5APUA 4AHCA 2ZIOA 3ZHSA 1HWTC 3FWLA 1TAEA 1YBKA 1GH6A 3G71V 5ITZA 2L5GB 4HAMA 3FYIB 3U59A 1FU1A 4PI2A 3D36C 1RSOB 5KTBA 4JI5B 3K08A 4JI0B 1Q6IA 2ZNIA 1SQBJ 4O9BA 2K1AA 4RUEA 1NVPB 3OT7A 3W7WA 2E5LO 4D6TJ 4DV2O 1BCCJ 1FE6A 5JJNB 5CCGD 1M1JC 4ZBMA 3B2EE 3CRRA 1YI2P 4DK0A 1U97A 4RESB 1J1EC 5BU5A 1HGVA 2HHHO 4MTGA 1EN4A 1NTKD 2KI7B 1JOCA 3ITKA 3UIAA 1FZAA 4O2BB 3RYHA 3I5DA 4LFAO 3H1ID 1LJ2A 3R4YA 1BMFG 1SQXG 4RO2A 2FYUK 4TT3H 4JI1O 2IYOA 1S3JA 2N1TD 3ETDA 5LP6C 3SSUA 1LUVA 2UXXA 4MTXA 4R50A 1DD3A 3AEAC 3WU2H 4LCUC 1IXMA 3T4ZA 2Q67A 2Q7EA 4U3FG 3V2QA 3CXHF 1GM9A 2OCCB 3D6YA 1GZLA 2Y48A 4PDRA 4XDJA 3TK1A 2Y4TA 1JY3P 4YXDC 1GL2C 4BRYB 2JIZG 2ZCEA 2WLLB 1JY3N 3CS5A 3QO7A 3VMYA 5LMNO 2W8ZA 5C93A 4M3LA 1P4RA 4F6RB 3SFDC 2D2CB 2YXLA 4PJ0E 2ZXEB 2GHYA 2Q7HA 3OR7C 1L0LK 1SLQA 4J80A 2L91A 2XNXA 1YITV 1VPCA 2Q8VA 1Y76B 1KB9H 3WU2Z 1RF0C 3CD6V 1D7MA 2ZE7A 3ASNB 3FX0A 2ZDIA 3SDLA 5E79E 2CTPA 1N7SD 2IBZI 4O4JB 1LTGC 4GODA 3T1YO 2N9BA 3BHPA 1FOSE 1KYOF 4CZZA 1P84E 2F93B 2EZOA 3V2RA 2IZ1A 1NZ6A 4R8CA 4X89A 4LF8B 1N34O 3C8VA 2JK5C 4JI6O 3FYEB 2A3QA 1XHXA 2A45I 3R2PA 1OW6A 4DT0A 1FDOA 4XDKA 3ZN1A 4FLZA 1R3LC 4BWAA 1MOFA 4J10A 2GUZA 3T2MA 3VQXA 3AE2C 4D6TE 5JWPA 4W4KA 1BCCE 1G2CB 3HPLC 1BHBA 2OYIB 1NTKK 2H8PC 3K03A 2ADQB 1AVYA 4LNUA 1IJDB 2PFXA
chains in the Genus database with same CATH topology
2E74B 3G9RA 1KMIZ 1ZRTE 1ZOYC 3EWKA 1KTMA 1KQGB 3D71A 2BEZF 2OQQA 3Q2YA 2J5UA 2H89C 4R4LA 3AE1C 4Y28J 3AE4C 3RK3E 2P10A 3O6QA 1K04A 2D2CC 3Q5PA 1RQVA 2H88C 3Q5RA 3FGAD 1KORA 1PIXA 2E75C 5KLIC 2E75D 3IN6A 2JO1A 1Y9BA 4GDOA 1YQ4C 3AEGC 1VF5C 1VF5D 2WSCJ 3AEEC 2ZT9C 2WPVB 1NGMB 3GLMA 1ZMEC 1DIPA 2WQYC 1KQFB 4OGQB 2WSEJ 3AE7C 3R4YA 1HF9A 3AE8C 4H44D 3GF7A 1PV3A 4TT3H 1TU3F 4I7ZB 1PL5A 1RQUA 3ABVC 3S9OA 2K9YA 2G8YA 3GMAA 5L8RJ 2V7QJ 1DD3A 2E76C 3AEAC 2E76D 3D6YA 3AE9C 3Q3DA 2MKVA 4H13B 2BEQD 2QJKC 3AE3C 4YXDC 1K05A 1S1CX 1EXIA 3SFEC 3D70A 1U57A 4H0LC 1NYHA 4H0LD 4PV1B 4XFJA 5M1BA 2YMKA 2FXPA 1DD4A 2QJPC 3SFDC 2D2CB 3AEFC 4H44C 2QIWA 2E75B 1OW8A 3Q1MA 4KT0J 3D6ZA 4OGQD 1AJYA 4Z1MH 2E74C 1VF5B 2E74D 5KKZC 1EXJA 2ZT9B 3AEBC 1FDIA 3T97B 1ZP0C 1GMJA 4U7JA 3AE5C 3AECC 3GF3A 4R4MA 1IK7A 3IAOA 1OW7A 1JB0J 1VL2A 4H13C 2G3AA 4H13D 3LW5J 4RKUJ 3B71A 2WSFJ 1R8EA 1KILE 2E76B 4PV1C 3C8VA 3AEDC 4PV1D 3AE6C 4OGQC 2FBWC 1OW6A 1FDOA 1S5LX 2QSIA 2YIUC 2D2CD 1OMIA 4H0LB 1HJ0A 3RL0g 2FYNC 4I7ZC 2NZ2A 4IL6X 3AE2C 1MKMA 3H25A 2QJYC 2ZT9D 4YTPC 2JP3A 4H44B 1UIXA 1Q90D 3Q5SA 1WMKA 1YQ3C 2IDBA 2O01J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E74 B;  1ZRT E;  3LW5 J;  2QJP C;  4RKU J;  2WSF J;  2D2C B;  2E76 B;  2QIW A;  4I7Z B;  2E75 B;  3C8V A;  4KT0 J;  2K9Y A;  4Y28 J;  1S5L X;  1VF5 B;  2QSI A;  2YIU C;  5L8R J;  5KKZ C;  2ZT9 B;  4H0L B;  2FYN C;  5KLI C;  4IL6 X;  4H13 B;  2QJK C;  2QJY C;  2WSC J;  4H44 B;  2WPV B;  1Q90 D;  1JB0 J;  4PV1 B;  4OGQ B;  2O01 J;  2WSE J; 
#chains in the Genus database with same CATH topology
 5APQ A;  3BCC E;  5IYZ A;  5KJ7 C;  1VP7 A;  4WVZ A;  2OYH A;  4GOF A;  2LFR A;  3H1K H;  5IJ9 B;  1Q82 Q;  2H89 C;  2YKO A;  3K59 A;  4DV0 O;  4Y28 J;  2NPS C;  1K04 A;  1RQV A;  4P2Z A;  5B66 E;  2PYL A;  3VN0 A;  1KB9 D;  3JC2 2;  3TSI A;  4JI2 B;  1EZV I;  2OIE A;  1YQ4 C;  3CC2 P;  3SYC A;  3HE4 B;  1V9P A;  1M56 D;  2KK7 A;  1N86 A;  4UB6 H;  3ZMT A;  4PDL A;  1Q7Y W;  3AE7 C;  3L71 H;  3K9A A;  1LTA C;  2CTR A;  2RMK B;  4DUZ B;  3VYI A;  4G27 B;  1VQO V;  3G4S P;  3UT5 A;  1B04 A;  3ML0 A;  2DW4 A;  1N4C A;  4MVR A;  3K57 A;  5B1A C;  1V54 B;  3AG3 B;  2Q7C A;  3TYY A;  2MK3 A;  2GTS A;  4TQD A;  3L73 G;  4LF9 B;  4PD4 H;  3A7O A;  1AP6 A;  3AE3 C;  1GN4 A;  4ICG A;  1MSW D;  1VQ4 V;  2PAJ A;  2Q1K A;  5D5Q A;  3OFN G;  1BE3 G;  3RK3 C;  1NTZ E;  3HKB A;  1VAR A;  2JGD A;  3GWO A;  2EUL A;  3CP1 A;  2KNC A;  5C39 A;  3H6P A;  2N74 A;  4UB6 Z;  1RPO A;  2QGN A;  5B1B B;  2UWJ E;  3ZBH A;  3HUS B;  3DGE A;  3OEH G;  3GHG C;  3T4D A;  5D5P A;  1RE3 C;  4OGQ D;  3VQY A;  2KS1 A;  5EC1 C;  4FLX A;  4U3F E;  1AJN A;  1YJW V;  2XND G;  1HUC A;  5CMU A;  5LHG A;  4JI0 O;  4JI5 O;  1M56 B;  1NU1 H;  4WFE A;  4B3S B;  4IT5 A;  2M8R A;  1P7G A;  1F4M A;  3EHB B;  2W0X A;  2FYU G;  1WAZ A;  4LF6 O;  4O4H A;  1YSC A;  4U7O A;  5H5N A;  2QRX A;  2Q68 A;  4LWS A;  4UUJ C;  1YHQ V;  4LH6 A;  1AIL A;  3L71 D;  1DTO A;  5BMV A;  4TUY A;  1J1D B;  3WB0 A;  1W0J G;  2V7Q H;  3B09 A;  3D36 A;  1JNM A;  4B7E A;  2IW5 A;  1WRG A;  1OZH A;  3K58 A;  4NR1 A;  1KIL C;  3L74 G;  4IYI A;  2V4H A;  5AVZ B;  1LNQ A;  1JX9 A;  4DV5 B;  1RE4 C;  1USD A;  1HP8 A;  2N05 A;  5CBH A;  1K3E A;  2KZJ A;  3RWR D;  4PD4 D;  1VQP V;  4ZI7 B;  2R72 A;  2R70 A;  1M1J A;  1OVR A;  5CA3 A;  1L0L G;  1Y6X A;  4I6M C;  4EB6 B;  3I56 P;  4BIZ A;  1O9G A;  1SA0 A;  3HR0 A;  2OT5 A;  3M8A A;  4MW8 A;  2DYR B;  1XRE A;  2HOD B;  2ZVO B;  4E2L A;  1FFX A;  3IF4 A;  1IC2 A;  4UCO A;  1S72 P;  1SFC B;  3RL0 C;  2HR3 A;  3L70 G;  1NU1 D;  1AB3 A;  4AQY O;  1SC5 B;  3SWF A;  1SQV E;  5TJH A;  2EIM C;  2ZXX A;  2A7W A;  2Y0I A;  3C3T A;  1QLN A;  4WB4 A;  3U1A A;  3MZW B;  3E89 A;  2HKO A;  1QCE A;  1S4X A;  4GX0 A;  3UO2 A;  3Q4H A;  1V55 B;  1H8H G;  3BY6 A;  1NH2 B;  1F7Y A;  3TGU E;  1JEK A;  2FL4 A;  3B8M A;  3PJS K;  3TNU B;  4JF3 A;  4NXM B;  4H44 D;  1GL2 A;  4R7C A;  3HE5 A;  1T3U A;  2VQE B;  5L3F A;  1NJI W;  1G4Y B;  4NYK A;  4RAI A;  1H0T B;  1JCC A;  5BU8 B;  2RDC A;  1FKA O;  2W83 C;  3E35 A;  2HG5 D;  2Y69 C;  1EM1 A;  4LF8 O;  1VQ8 P;  2IX7 C;  2W6J H;  5H2F H;  2DJV A;  2ZVN B;  1PPJ E;  5LGU A;  3ABM C;  4FFB A;  2CH7 A;  5GTH E;  3SFE C;  1SQB H;  2GUZ B;  4H0L D;  4PV1 B;  5JVD A;  1RF0 A;  3RW0 A;  4D6T H;  2MJZ A;  1BCC H;  3CJH A;  1DF4 A;  3JCU E;  3AK2 A;  1R3J C;  2Q6Q A;  1H88 A;  2N1T C;  1KFN A;  1UFI A;  4RQE A;  3EQ2 A;  3G67 A;  3D6Z A;  3DSQ A;  2IJK A;  2E74 C;  1N73 B;  3JCZ A;  1DF5 A;  1YIJ P;  2ZT9 B;  1I5X A;  3T97 B;  2ZD9 A;  1ZP0 C;  1QX8 A;  3KXD A;  2AHZ A;  1JY2 O;  2WVR A;  3WUV A;  2GDS A;  4JPZ B;  5H2F Z;  4KJM A;  4IFD K;  2QE7 H;  3S1K A;  1OW7 A;  3CWB J;  4ZNC A;  2EJ7 A;  2QTO A;  3L35 A;  3CCQ P;  1URQ C;  3WG7 C;  4Z2W A;  1KIL E;  5B1O A;  5LA6 A;  4JI2 O;  4GKK B;  1PGJ A;  3P30 A;  3E1R A;  3DC6 A;  4B7K A;  1IFM A;  2M0B A;  4DR7 B;  4H0L B;  3RL0 g;  1OJH A;  4I7Z C;  4DUZ O;  2R5B A;  5E1A C;  1EN6 A;  4FM0 A;  1NU1 K;  4BXL A;  2M7W A;  1MKM A;  1VF6 C;  1XTG B;  4QPJ A;  5KHI A;  3F5T A;  1Y66 A;  2GUS A;  4YTP C;  2EBO A;  2LXB A;  1K73 W;  3CYO A;  2NPS A;  1SQB D;  3NFQ A;  4X1K A;  2K3R A;  4JI3 B;  1L0N J;  2A06 G;  1OCR C;  1H8E G;  1WPX A;  4LF9 O;  1GMG A;  2Q0O C;  1IFI A;  1VF7 A;  4D6T D;  1BCC D;  1KQG B;  2JGD B;  2BEZ F;  1XTC C;  1MZF A;  1PGO A;  5CJ0 A;  2KLV A;  3L74 E;  3CX5 H;  4LF5 B;  2M3E A;  5FLX N;  2OTL P;  3CCJ V;  2FML A;  1R1B A;  2WLH A;  5AVS B;  2ZE5 A;  5B3S C;  1WNS A;  1YVW A;  2XAG A;  1SQQ J;  2QJP B;  2WSC J;  2R44 A;  3A5T A;  3APQ A;  2FXM A;  1AQ5 A;  1ZX3 A;  2QG4 A;  4B3S O;  5LHI A;  2KB1 A;  1FXK B;  2ZR2 A;  4LFC B;  4X1I A;  5KHK A;  4Z1V A;  1KP3 A;  3FX7 A;  1FJG B;  3GF7 A;  1OHH G;  4UFZ A;  1GD2 E;  3JAR A;  1M90 Q;  3ZHV A;  5BY1 A;  1DEB A;  4ZHQ A;  1QLE D;  3L70 E;  2IJI A;  4FFK A;  5L8R J;  4JZ2 A;  2XHB A;  1IUR A;  1QQC A;  1YTZ I;  2DWE C;  2Q0A A;  3JYC A;  2JS5 A;  4DR5 B;  4H13 B;  2B1G A;  3D8C A;  5CBF A;  1RE3 A;  2BEQ D;  1N8R Q;  4FVM A;  1GL2 D;  1UII A;  3CE2 A;  3QTC A;  1K5Q A;  5FL7 G;  3CCL V;  2QWQ B;  3QO8 A;  4DV5 O;  3ASO C;  1ZV8 A;  2I8D A;  1S0V A;  1MAB G;  4GCZ A;  2Z3Y A;  1H2G A;  2JWD A;  1Z5V A;  2B9Z A;  3CWB E;  4B3T B;  4KHP B;  2ILM A;  2Q9I A;  1KUQ A;  1S9K E;  3CX5 D;  3PLN A;  1YI2 V;  3RGU A;  4OVN F;  1NVO A;  5KAI E;  3J7A U;  2M5A A;  4P9O A;  2ZR3 A;  3AE5 C;  3VQV A;  2Y0D A;  3ETE A;  3CC7 P;  2WA3 A;  1IK7 A;  3K79 A;  4PA3 A;  1KIL A;  3H1J E;  1ZSP A;  4LH7 A;  3H1K G;  1SQB K;  2G3A A;  1KEC A;  5LP6 B;  2BTQ B;  1GK4 A;  1RE4 A;  3UQ8 A;  2VRZ A;  3B40 A;  2GBO A;  3Q4H B;  5KAF E;  3R65 A;  4I55 B;  4MW3 A;  4OGQ C;  1B06 A;  1X8Y A;  4DJG A;  1L0N E;  3HE5 B;  4OPA A;  1F23 A;  1RH5 B;  1OMI A;  1FZC A;  4JBZ A;  4NXM O;  3E83 A;  3JD3 A;  2VQE O;  1R5L A;  2A79 B;  5LHH A;  3SWK A;  1THZ A;  1NTM G;  5EYP A;  2NLJ C;  1BT8 A;  1N0N A;  4J9Z B;  1MV8 A;  1S5L E;  4YXW G;  2YXH A;  3ZRV A;  2H8P D;  4YPC A;  3QF7 A;  2CH7 B;  3G9R A;  1GAX A;  1KMI Z;  3KPE A;  1PL0 A;  4TV9 A;  5KX5 B;  1KTM A;  3FB8 C;  5JVD B;  3CXH I;  3RBX A;  5L3E A;  4UCV A;  3JAM N;  2VQF B;  2P4V A;  3CJH B;  1JY2 N;  3THO A;  3NMD A;  3A0H H;  1RP3 B;  2WLJ A;  2ZXW B;  1AA0 A;  2W6I G;  2YID A;  2WLK A;  4I4T B;  2DYS C;  1P84 I;  1WN7 A;  4JV5 B;  2NPS D;  2H88 C;  1NO4 A;  2WSS H;  4AQR D;  3KYQ A;  5B5E E;  1S2E A;  2GM4 A;  3CSX A;  3II6 A;  2IBZ H;  2PY5 A;  1Y8A A;  2A06 E;  3CLQ A;  4JI8 B;  1XNR B;  3SPH A;  3MDS A;  2Z4E A;  1KB9 F;  5KLV H;  1FAV A;  5EIB D;  2POH A;  1KN7 A;  3JAK B;  2XAF A;  3AE8 C;  4KUM A;  3H1H G;  2YI8 A;  4NTX A;  2WZ7 A;  1ROP A;  2GSM B;  3CCS P;  1NU1 G;  4KL1 A;  2A45 H;  3F7Y C;  4FZ1 A;  1K33 A;  1XI1 A;  4HKZ H;  3CHX A;  3HTK A;  1IBM B;  2M6Y A;  3E86 A;  3A0H Z;  1N33 B;  2X7R B;  3L37 A;  1HJB A;  4NTY A;  4UVA A;  2XAJ A;  4GKK O;  1KU9 A;  2DQ3 A;  2WPR A;  2FTK A;  1KYO I;  1FAF A;  3GW6 A;  2X6A A;  3RK3 D;  1Q2N A;  4DR7 O;  3AG2 C;  1JTH A;  3OUS A;  1OXZ A;  2YMY A;  1ZL8 B;  3AEI A;  2NPS B;  1IBL B;  3P8C D;  3ZJZ A;  4H44 C;  1P7B A;  1T6A A;  4MS2 A;  4DZO A;  1QVG O;  1LUW A;  4YJ2 B;  4KXR A;  2R9R B;  4JI3 O;  5KKZ C;  3KQG A;  1URQ A;  3E22 A;  3OMN B;  4JAV A;  1ENV A;  3L72 H;  3H1L G;  3PHL A;  2KSE A;  1EZV H;  4IHJ B;  2HPC A;  3KHU A;  1PFI A;  1U7M A;  3CC2 V;  2IBZ D;  1XMQ B;  3CMA V;  3A2F A;  1FZF A;  3OGI B;  1L4A C;  5KLV D;  2K9P A;  3B71 A;  5CHX A;  5LOV A;  3G4S V;  3OE7 G;  5EZY A;  4GX2 A;  3OUF A;  1WA8 A;  2R9I A;  4EYY Q;  3RK3 B;  4LFC O;  1KIL D;  5CN0 A;  1FJG O;  2KSJ A;  4PDV A;  4IL6 X;  4BR6 A;  2XZR A;  1OCO B;  3N27 A;  1K4D C;  2QJY C;  1SZT A;  2AW9 A;  4NKG B;  5EFW B;  1J5E B;  2QSA A;  3GHG B;  1YQ3 C;  5AVY B;  4X20 B;  1KQL A;  2C0X A;  3LNN A;  4PD4 F;  2BCC J;  3L75 J;  1ZRT E;  1MA1 A;  1SER A;  4DR5 O;  3W7U A;  2YNY A;  3DC5 A;  2P7T C;  3ZCC A;  3D71 A;  5CMZ A;  4NTW A;  1SQP G;  1H2N A;  3OMA B;  3A8T A;  1IFJ A;  3BRC A;  1QGK B;  1LTB C;  5GTI E;  2Y4U A;  4GIF A;  1OCZ C;  3Q5P A;  3RL0 D;  3L36 A;  3ZDM A;  2LJ2 A;  1OFC X;  4GOE A;  1RM1 C;  5AVQ B;  2EIK C;  4IFM A;  1JOY A;  3L72 D;  4B3T O;  4KHP O;  1IK9 A;  1B3Q A;  1EZV D;  1AI4 A;  5IYD O;  5JQG B;  1D5N A;  4JF7 A;  3CCU P;  2CTW A;  2P2U A;  1HR0 B;  4WFH A;  1YJ9 P;  3D3I A;  1QR8 A;  1VIB A;  1COW G;  2H43 A;  2WA4 A;  5IT9 N;  1EDK A;  4Q20 A;  1KFM A;  4N78 D;  3S9O A;  5APY A;  3KCY A;  4LF6 B;  3JAS A;  2QE7 G;  1EZJ A;  3ZMV A;  1RHZ B;  5J2U A;  1XL4 A;  3BCC J;  2QJK C;  4X64 B;  4IIJ A;  1YJN P;  1OVV A;  3UO3 A;  4Y99 B;  3N4X A;  4WBA A;  2N9Y B;  3H1H E;  1NHL A;  5AVT B;  2ARH A;  5EYP B;  2YMK A;  3E8H A;  2I1J A;  5KLV K;  4XA4 A;  3CCM P;  4J9Y B;  5L3B A;  4DR6 B;  2YO3 A;  3CME P;  4QIW F;  4MVU A;  1YDX A;  2UXB B;  1LP1 B;  3Q1M A;  4KT0 J;  4X1Y B;  1Q5O A;  1WJZ A;  1XOU A;  3CRQ A;  2QA4 V;  5APT A;  1QLE C;  2E74 D;  1KQS O;  1RF1 B;  4G2K A;  1S72 V;  1OX3 A;  1SQQ H;  2K9J B;  2EZP A;  5IY5 B;  3P3N A;  4O4L A;  2VQF O;  1IX9 A;  4U7J A;  3U0Z A;  4TV8 A;  3AEC C;  2ITC C;  3MHV A;  1U96 A;  2CUG A;  4JV5 O;  1MFZ A;  1W2E A;  1A02 J;  5LYJ B;  1I5Y A;  4DV1 B;  5AVU B;  4FJC C;  3JD4 A;  4ZIB A;  1URQ D;  3BA9 A;  2EX3 A;  2Q5U A;  5TIS E;  4CH6 A;  2KXP B;  2Y69 B;  4JI8 O;  1BGY G;  2NNU A;  4J41 A;  4J7Z A;  1XNR O;  4AQY B;  3V4W A;  1J95 A;  1M1K Q;  3ABL C;  1S5L X;  2WTY A;  2YIU C;  2BCC E;  3AG1 B;  3L75 E;  4F6E A;  1NTZ J;  1Q82 W;  2YS8 A;  4EIJ A;  2PP6 A;  1VQ7 P;  1SQX J;  1VQ8 V;  4P30 A;  4O2A A;  3OD4 A;  3LDD A;  3CXH E;  1IBM O;  4GT1 A;  3PRJ A;  5KHJ A;  1N33 O;  2N1T B;  5AVW B;  3ZMZ A;  4WY4 A;  4U3F J;  2E74 B;  1IFP A;  2WPD G;  1ZR4 A;  2JWA A;  2OTJ P;  5C8Y A;  4YY3 O;  3FD9 A;  5IYB O;  2QWN B;  1QVG U;  3I55 P;  4DYL A;  1YIJ V;  1FXH A;  2OWO A;  1IBL O;  4OXS A;  4UCT A;  1SQQ D;  2RNB A;  1PIX A;  3FXD A;  3K3W A;  3NR7 A;  3GG2 A;  4UB8 E;  5CB4 A;  3LDC A;  5J2T B;  2QR4 A;  4BIU A;  3WG7 B;  1KKC A;  4I5S A;  1IVS A;  4AIL C;  4X88 A;  3M0D A;  3QWO C;  4HNA B;  2XAS A;  1X59 A;  3M7M X;  3JAL A;  3STZ C;  3C9I A;  4JYA B;  3F5W C;  1ZLZ A;  3V4Q A;  5AW2 B;  2XUM A;  4I7Z B;  4I0X B;  1XMQ O;  2AXT E;  1PNK A;  1KYO E;  4ZKI A;  1PGP A;  3JAT A;  1J2J B;  1N7S B;  2UUB B;  2BOB C;  3P32 A;  2IJJ A;  3TET A;  3CPW O;  1JFF B;  1OCR B;  1VQN P;  1PV0 A;  1TUB A;  1CEZ A;  2IFN A;  2FFD C;  3ZRW A;  2PI5 A;  1U57 A;  3RYF A;  1JMM A;  3K04 A;  1GRJ A;  3B5N C;  5EIB C;  3IGA C;  5IJ0 A;  5IWA B;  4C7N B;  3W67 A;  1K9M Q;  1LT9 C;  1HNZ B;  3O65 A;  3AEF C;  3LID A;  1CW5 A;  4U3J A;  1J5E O;  1JCD A;  1PNL A;  3G6B A;  1SQV J;  3H01 A;  5B3S B;  1L4A A;  3FAV B;  4JTD B;  1FXV A;  3AEB C;  3N2K B;  2JGU A;  2OTL V;  2XAQ A;  3CCV P;  3CC4 P;  4N3Y B;  2AGA A;  1EN5 A;  3TGU J;  1YCI A;  1X22 A;  1HW7 A;  2XT9 A;  2OIG A;  3CX5 F;  5GTI H;  2E42 A;  4WBN B;  3SJA C;  1OCC C;  3SPJ A;  3E7K A;  3GVM A;  3DTU B;  4PA6 A;  4I9W A;  2VWJ A;  1SQX E;  2GA1 A;  5ITZ B;  1NI8 A;  4ZKU A;  3V5B A;  2L6L A;  1GN3 A;  3JD0 A;  2EIJ B;  5FPO A;  2IBZ G;  1HR0 O;  2WWW A;  1PP9 G;  3CCE P;  1HJ0 A;  3SGI A;  4DO2 A;  5EBL C;  1M7L A;  4BAY A;  1SQQ K;  5KLV G;  3JAS B;  3ASO B;  2EIN C;  2G38 A;  5GTI Z;  1HVV A;  1IO4 A;  2BSK A;  4XDL A;  3M9H A;  1K5S A;  3LNM B;  3ZMU A;  3L73 J;  1Q86 Q;  1BGY E;  1VQ5 V;  4OWF A;  4X64 O;  1FZE A;  1EDJ A;  4KP4 A;  1AI7 A;  3PH0 A;  2OAR A;  1Z2G A;  3RYH B;  4UCR A;  5JH7 A;  1BE3 J;  2PRR A;  2H7H A;  3OTO B;  3X2Q B;  3W7T A;  1AI6 A;  2XAH A;  4N23 A;  1G8M A;  3W7X A;  3AE1 C;  5AW4 B;  4NPD A;  1EFR G;  3DXR A;  3FWN A;  1MFT A;  4EI2 A;  2JRI A;  1AVO A;  1AR4 A;  1KQS U;  5KLI C;  1I0H A;  4DR6 O;  4WY4 D;  3ABK C;  3SR2 C;  2UXB O;  1Q8I A;  2N04 A;  1VF5 C;  3CC7 V;  1NT2 B;  3GLM A;  2PTM A;  2GTA A;  4B3M B;  5AW8 B;  4YJ3 A;  1EC5 A;  4OGQ B;  2Z5H A;  2Y0C A;  2Q6A A;  1U7J A;  3S4R A;  3K0G A;  2YDE A;  2P22 C;  3OAK A;  1FZC C;  2KZI A;  2FYU J;  1GU5 A;  4L76 A;  1SZX A;  2IPP A;  1Y47 A;  1YF2 A;  2IFM A;  2AHY A;  3STL C;  3ABU A;  2B87 A;  1WB7 A;  1BHA A;  3EFG A;  2G8Y A;  3GMA A;  3L72 G;  1MMM A;  4X65 O;  4FLU A;  4DV1 O;  3G6E P;  3BAA A;  4PJ0 H;  1I7F A;  4CS4 A;  3MHH C;  3L75 H;  4RWU A;  3CCR V;  2QM8 A;  4DRX A;  4I2L C;  5DJT B;  4GZR B;  4XFJ A;  3L74 J;  5E79 H;  5EC2 C;  1X0T A;  4DR3 B;  2ZE8 A;  3RYC A;  3KDP B;  4Z1M H;  1P84 H;  4MTO A;  3K5N A;  4WFF A;  1NTK G;  2YIA A;  4PJ0 Z;  1W2B O;  5BZB A;  2OTK E;  3HB3 B;  2F66 C;  3H1I G;  1M9N A;  1K92 A;  2H3O A;  4FM2 A;  3ZMS A;  5KHG A;  2OCC C;  1HDJ A;  4DXW A;  1L4A D;  3L70 J;  4W7Z A;  2WSF J;  3A2A A;  5E79 Z;  3CCS V;  1XIL A;  2D3O W;  4LNU B;  2BOC C;  2FXO A;  4ABM A;  1GK6 A;  2Q69 A;  5IYZ B;  3FKS G;  2FBW C;  1E79 H;  3BCC H;  4MVO A;  2OYH B;  4WFG A;  4JYA O;  4X9Q A;  4LF4 B;  2KB7 P;  1S76 D;  3L73 E;  4DR2 B;  1XHZ A;  2LQT A;  4FLT A;  3B8N A;  5GON A;  2NZ2 A;  4PDM A;  4IGG A;  1BE3 E;  4J7J A;  2CK3 H;  3H25 A;  4GX1 A;  1BDD A;  4H44 B;  3L75 D;  2CE4 A;  2UUB O;  2E43 A;  3MD0 A;  5AW9 B;  5B66 H;  4B08 A;  1TUB B;  1H2M A;  4TSF G;  2YXQ B;  3I5C A;  3ZRW B;  1SP4 A;  3EWK A;  1G6U A;  3RYF B;  5KKZ B;  2ZAE B;  4JI7 B;  1KBH A;  4ZOL A;  2ZYA A;  3A3Y B;  3C90 A;  2PGG A;  5IWA O;  3O6Q A;  1P84 D;  1M90 W;  2C0W A;  4I50 A;  3UT5 B;  4WCE V;  3H1J J;  1HNZ O;  3LIE A;  2E75 C;  2P58 A;  1L4A B;  2FYU E;  3WUU A;  3IN6 A;  2HEP A;  4P9P A;  1Y9B A;  1TGO A;  1ZWI C;  1R6N A;  5JCO C;  1N8R W;  4TT3 G;  4UCU A;  5B66 Z;  4D7S A;  1GKF A;  5AW6 B;  1T5E A;  1KC8 Q;  3HKB B;  1L8D A;  4IL6 E;  1NTZ H;  2FFD A;  1GM8 A;  1KV4 A;  1NAY A;  1SQQ G;  5CA1 A;  1R6K A;  3A0R A;  2KNC B;  5KUK A;  3ABV C;  3B5N A;  2QJY B;  1H8A A;  2YIB A;  2R3S A;  3BCC D;  4HB1 A;  3ZX6 A;  2F1M A;  1LT9 A;  3Q3D A;  1N36 B;  2WPS A;  2KS1 B;  1VQM P;  3E8G A;  4DV6 O;  3VP8 A;  2VWK A;  4ZMD A;  1Q43 A;  4U3F H;  1K05 A;  2YXY A;  1L0L E;  2AZ0 A;  2O1K A;  2O3J A;  2NN4 A;  3JAW A;  2V4D A;  1LTJ C;  3M99 B;  1NWQ A;  1DD4 A;  4GLX A;  2UUA O;  3USS A;  4O4H B;  2YKQ A;  1OCZ B;  2DE0 X;  2QWO B;  4K35 A;  4LWS B;  4LBE C;  2LKM A;  2JEX A;  2JJ2 G;  2F95 B;  3JSN A;  1RM1 B;  5AG2 A;  2EIK B;  5JJE B;  5BMV B;  4TUY B;  3E8F A;  1K97 A;  2R9A A;  3QO5 A;  3OA7 A;  3RK2 D;  4DUY B;  3EFF K;  5LBQ A;  1AP5 A;  3ZIA G;  2O01 N;  4KFM A;  2RKL A;  3MIW A;  4NPF X;  1HNW B;  1TVK A;  1V54 C;  3T1H B;  3C1L A;  1VQ4 P;  3M06 A;  3AG3 C;  4FZ0 A;  1Q3E A;  3OTO O;  3KZI E;  2NR5 A;  2JS3 A;  1X4T A;  3LUT B;  4YHH B;  4I9Q A;  2JDI H;  2ZIM A;  1FZG A;  2UXC B;  4MSW C;  3CCU V;  3IC7 A;  4DV7 B;  2KYV A;  1AI5 A;  2W27 A;  3LW5 J;  1MZE A;  1M1J B;  1YJ9 V;  4QE7 A;  4YJ3 B;  2JJL A;  5APW A;  2YKP A;  1JPX A;  3EVK A;  1SA0 B;  1NTZ D;  4B3M O;  1NTK E;  1J1E B;  1BZK A;  1YJW P;  1BSM A;  5B1B C;  2QKC A;  3HUS C;  1SQF A;  4J11 A;  1FFX B;  3H1I E;  4L75 A;  4HYO A;  4RO0 A;  3VQW A;  1IFD A;  4CH4 A;  1W5C E;  1YJN V;  1K8A Q;  4UXN A;  2JP3 A;  2LW1 A;  3BRT B;  4U3F D;  1I08 A;  1WMK A;  2VRS A;  3J81 N;  1QLE B;  1ZOY C;  1SQV H;  1WT6 A;  3CCM V;  4PHZ A;  4RQF A;  4KHX A;  3WB2 A;  3CME V;  3ZED A;  3HKC A;  1CP9 A;  3F7V C;  4MTF A;  3TGU H;  2NRG A;  1AJP A;  1GL2 B;  2LR2 A;  1PKX A;  5AVX B;  3BPZ A;  1J1D C;  5CBN A;  2C9N Y;  4DR3 O;  2W6B A;  1LTT C;  2AXC A;  1NOH A;  1RSO A;  2ITD C;  2P6J A;  1HGZ A;  1W2B U;  2F43 G;  4RUF A;  1VQ6 P;  3L71 G;  1JCH A;  2WQY C;  1P49 A;  4DR4 B;  3CL3 D;  3ABL B;  4FFB B;  1HF9 A;  1PPJ H;  4FPP A;  1VMG A;  4UVC A;  4K0K B;  1AQT A;  2YIU B;  3FB6 C;  1QHT A;  3C3S A;  1JA8 A;  1PV3 A;  1JY2 P;  5GTH H;  3JD2 A;  4GX5 A;  1RQU A;  3J80 N;  3CRA A;  2GUV A;  4JQ0 D;  1HNX B;  4GKG A;  4LP8 A;  3H1K J;  2C9L Y;  1B6Q A;  5BXZ A;  1NQT A;  2ZM6 B;  3JCU H;  3UM7 A;  1JR9 A;  1VQ7 V;  2MKV A;  1GK9 A;  4WY4 C;  4O2B A;  3SPI A;  1GDT A;  4X66 B;  1SFC C;  2DW3 A;  1IFN A;  3SYP A;  4LF4 O;  4DR2 O;  3N2G A;  3B5N D;  2YIB D;  1O9H A;  1GU4 A;  3WU2 E;  1VQK P;  1SQV D;  3T1C A;  3CEI A;  2OTJ V;  2KG7 A;  1V55 C;  5GTH Z;  1NTM J;  1NTZ K;  2WMM A;  4B3R B;  5KA6 A;  5LA6 B;  3SJC C;  3I55 V;  3M0D C;  4BRY A;  3TGU D;  3ZN0 A;  3CXC U;  2WLL A;  4JI7 O;  1E5W A;  2O1J A;  3JCU Z;  1H2L A;  3TCU A;  3E8B A;  5H6R A;  3K5M A;  2GV9 A;  3GF3 A;  2MW2 B;  4F6R A;  2B89 A;  4YY3 B;  3RYI A;  5APV A;  1ARO P;  2WIT A;  1H2S B;  2HLD G;  4HYT B;  1NS1 A;  1R3I C;  2V7Q G;  3SYQ A;  3A0B E;  3F89 A;  1QL2 A;  4UV9 A;  2XKM A;  2X0L A;  1PPJ D;  4X1K B;  3ZHT A;  1Y76 A;  2K1E A;  4PV1 C;  3AED C;  1FD9 A;  2Q5Z A;  2Y0P A;  3ZHR A;  1G1X B;  1ZTE A;  4GUN A;  3ETQ A;  1ZAU A;  2FFD B;  3LSU A;  4O4J A;  5CA1 B;  1M5I A;  3U11 A;  4IL6 H;  1FYJ A;  3H1H J;  2FYN C;  2WT7 A;  1EQ7 A;  3QVN A;  1N73 C;  3LDE A;  1VQN V;  2IH3 C;  3L74 H;  1PD3 A;  3BEH A;  5EK0 A;  4QPK A;  1LT9 B;  1NU1 J;  2HLO A;  4LF7 B;  3MAQ A;  3WMM 0;  5APX A;  2EIL C;  2SPZ A;  1N36 O;  1KKD A;  2CGO A;  4BW9 A;  5B1A B;  3CI9 A;  1GW4 A;  5AW3 B;  4GYC B;  4JI4 B;  4LGD E;  2I1K A;  5JCO A;  4R4L A;  2E5T A;  5DJU B;  4X1I B;  1PNM A;  3OR6 C;  1Q6U A;  1WB8 A;  2PZS A;  1DX7 A;  1BL8 A;  1AR1 B;  1OCC B;  1G2C A;  2KLU A;  1QR9 A;  3JAR B;  3CCV V;  3CC4 V;  1KOR A;  1DLB A;  3MP7 B;  2X6B A;  4ZHQ B;  4MN4 C;  3QNE A;  4GDO A;  1BQ0 A;  2KP8 A;  3L70 H;  4C7R A;  1VF5 D;  3H1K E;  2WSF H;  4DUY O;  5IJ9 A;  4JTA B;  3SJQ C;  2W90 A;  3AG4 C;  1HNW O;  2AEM A;  3T1H O;  3H1L J;  1FC2 C;  2JEU A;  1SQV K;  4FLW A;  2X6C A;  4L74 A;  4YHH O;  3IAY A;  2LP7 A;  1G1J A;  5K1X A;  2UXC O;  2EIN B;  1LTJ A;  2IJH A;  2W6J G;  4DV7 O;  1T8Z A;  1ZXG A;  1NVP D;  3H9V A;  3CCE V;  4TQF A;  3AE9 C;  4UB6 E;  1SQB G;  2W6A A;  1S5J A;  3CWB H;  3UKM A;  1NTM E;  3L71 E;  1KD1 Q;  2KOG A;  3L74 D;  4D6T G;  5H6Q A;  1BCC G;  1GN6 A;  4EEQ A;  1M4U A;  2M5A B;  4IFF A;  4BWN A;  3F5H A;  5KAI H;  2Q9L A;  4W4L A;  2HVK C;  3TJT A;  1IZ3 A;  2QJP C;  3RFR A;  2PGD A;  2PUS A;  1NKN A;  2QIW A;  1KIL B;  1ZLL A;  5KLI B;  2ZQM A;  3H1J H;  4PD4 E;  4CPG A;  3APO A;  1LTS C;  2QJ1 A;  1AJY A;  1SKV A;  3IFM A;  1VQ9 P;  1VF5 B;  1H89 A;  1M1K W;  2EJR A;  3MUD C;  3LSS A;  5KAF H;  2UU9 O;  4JAS A;  1RPR A;  3K0D A;  2B1I A;  1SQP J;  5CCH A;  4O4I A;  2LW7 A;  1L0N H;  5BVZ A;  2VS0 A;  1FZC B;  2BAS A;  5AVR B;  3L70 D;  3D3Q A;  4L73 A;  3B77 A;  1NBM G;  2K88 A;  3HUS A;  1VQL P;  3CCL P;  1VL2 A;  4H13 C;  3I56 V;  1R73 A;  5KA5 A;  3AK1 A;  5KAI Z;  4RKU J;  1R8E A;  4K8X A;  1NU1 E;  3M9B A;  2KSD A;  4D7T A;  2WPQ A;  4HJG H;  3RL0 B;  1WLE A;  1S5L H;  1F4N A;  2J58 A;  1CSB A;  4TV9 B;  4DR4 O;  2EIM B;  2D2C D;  3RK2 C;  4X8A A;  3G6E V;  4K8Z A;  4K0K O;  3TF5 A;  2E3C A;  2UUC B;  2WSC H;  4EOT A;  2HP8 A;  1FBM A;  3BVH A;  2CPS A;  3KG2 A;  3RN4 A;  5KAF Z;  1LWU C;  5L3C A;  3CWB D;  1UPG A;  3K5L A;  1HNX O;  3R66 A;  4UVB A;  1S9K D;  2DQ0 A;  1JQ0 A;  5A2Q N;  2ZM6 O;  5B5E H;  1NTZ G;  2Q4P A;  4FK5 C;  3S3X A;  2UXN A;  3BVO A;  1US6 A;  5GW7 A;  5IE9 A;  1PL4 A;  4JGS A;  4X65 B;  1JJ2 U;  1I94 O;  2QTS A;  4I1L A;  3N2G B;  2A06 H;  4X66 O;  3BFR A;  3Q2Y A;  1M57 C;  1Y67 A;  3HRN A;  1S5L Z;  3H1J D;  2P10 A;  3ABM B;  2KG7 B;  1USE A;  2ZKO A;  4ZI7 A;  3H1L E;  3FGA D;  2XDJ A;  3BAS A;  2E75 D;  1FOS F;  4EB6 A;  3NTN A;  3VMA A;  4C46 A;  3HTK B;  1G1I A;  3KKY A;  1L1F A;  1YTF D;  3AEG C;  3VMX A;  2IYP A;  3BAB A;  1P84 F;  2ZIN A;  3W7S A;  4B3R O;  1L0N D;  3AEE C;  3LW5 H;  3MGN A;  2P67 A;  2QKS A;  2HOD A;  4QNH B;  2P06 A;  4MVQ A;  5FPR A;  1R5S A;  2Q73 A;  1Y74 A;  5B5E Z;  1BSH A;  3RYI B;  4WWI A;  4OPH A;  1X9V A;  1JTH B;  1SFC A;  3IFX A;  3VTP C;  1SQG A;  5LGT A;  1K9M W;  3A0B H;  3GWK C;  3M9Q A;  5AW5 B;  3OW2 O;  5APS A;  1M8O B;  3K9S A;  2AEF A;  1XDC A;  1MNG A;  1R6T A;  2JDI G;  1T3J A;  5B1N A;  1WP8 A;  3HKE A;  2ZXW C;  1BGY J;  2WLN A;  3SPG A;  3EXA A;  1URQ B;  1XNQ B;  2KUB A;  2WT7 B;  3D70 A;  3E22 B;  2B88 A;  3TNU A;  3VP9 A;  2OYQ A;  2HPC B;  4MVM A;  1IXB A;  1K34 A;  4W7Y A;  2XU6 A;  4TLF A;  1Y4M A;  3SYA A;  2QEX P;  3CCQ V;  4DR1 B;  5CBG A;  1SQP E;  3MTU E;  1H0T A;  3AK3 A;  2E75 B;  2A06 D;  4LF7 O;  5H2F E;  1YXB A;  1YTF B;  1XQ8 A;  3A0B Z;  1SQB E;  1L2P A;  2ZE6 A;  5LOV B;  5L3D A;  5EZY B;  4JTC B;  2Y0E A;  1WA8 B;  3M0A A;  2V1D A;  5FNV A;  4JI4 O;  1N32 B;  4JAU A;  5HFL A;  1H38 A;  2Q3I A;  3M91 A;  2KQX A;  4MVS A;  1SQV G;  2CPB A;  5BR8 O;  2Z5I A;  5K1P A;  1YTZ T;  3RVZ A;  2Q3E A;  2YXR B;  1W59 A;  1HH0 A;  1A02 F;  1N73 A;  3TGU G;  5CA0 A;  4ASU G;  2HVJ C;  4ZKP A;  3T97 A;  1Q86 W;  1FDM A;  5CCH D;  1SS1 A;  3HD7 C;  2XTA A;  3G3Z A;  1XL6 A;  1N2D C;  2QSI A;  2QVA A;  1N0J A;  1QU7 A;  2P1J A;  1LTJ B;  1VQM V;  1XBL A;  3FFQ A;  1BQZ A;  5CBO A;  1A32 A;  3CMA P;  4BIO A;  2YIC A;  1PPJ G;  4OH8 B;  1L0N K;  3SJB C;  1NTM H;  4LFB B;  1MZ9 A;  4R6Z A;  2HJF C;  3SPC A;  1X79 B;  4YXW H;  2KIK A;  2OQQ A;  4CS2 A;  2WSS G;  1JMB A;  4DV6 B;  3QH9 A;  3VMZ A;  4LR3 A;  3AE4 C;  1WP7 A;  3L9D A;  1EDI A;  2Z5U A;  2F4V B;  1PM9 A;  4NXN B;  3L4F A;  2UUA B;  2WPV B;  3V2P A;  5J2U B;  1JUN A;  2YUA A;  4O4I B;  3MHS C;  1KQF B;  4IIJ B;  5AW1 B;  2WSE J;  3CX5 E;  1OCO C;  4FLY A;  3IC9 A;  2A45 G;  1NR1 A;  4A5U B;  3H1K D;  2JVD A;  3H1H H;  2QWP B;  1IBK B;  4DV4 B;  1SS3 A;  1ZRT D;  3ZHQ A;  2E76 C;  3OGC C;  3V2N A;  5KUM A;  4HH2 A;  1NKD A;  3GB7 C;  5KHH A;  1CZQ A;  3G71 P;  1FXK A;  1NH4 A;  1SFC D;  1Q7Y Q;  1EXI A;  2UXD B;  4DK1 A;  4O4L B;  2RCV A;  1FPO A;  1PP9 J;  3OM3 B;  2UUC O;  3MUD A;  2FY8 A;  1NTM D;  4TV8 B;  5IYC O;  5KLV J;  2H94 A;  2QKA A;  4CBC A;  1NH2 D;  2RN0 A;  1T2K C;  4GKJ B;  3E1I A;  1NR7 A;  4JYY A;  1EXJ A;  3TDK A;  1EZV G;  5TIS H;  2HFE C;  1KP2 A;  2P5O A;  4DOJ A;  4PA9 A;  1H2K A;  2BCC H;  1VQ6 V;  2RN9 A;  2YEV A;  3H1L H;  3VOP A;  1JB0 J;  1YEW A;  4K3A A;  4O2A B;  3PTZ A;  1NAF A;  3G80 A;  1D5A A;  1LWU A;  4Y99 C;  1EDL A;  2JJ1 G;  2DYS B;  3JSL A;  2B5U A;  1Y74 B;  2IZ0 A;  3CXH H;  2LO1 A;  4PV1 D;  4AUW A;  4WY4 B;  2QA4 P;  1JO5 A;  1Q81 W;  3H1H D;  2YSU B;  3OEE G;  1L0L J;  3PN1 A;  4TOI A;  4EKW A;  5C8Y B;  1HWY A;  5TIS Z;  3OW2 U;  2P90 A;  3K5O A;  5IDJ A;  1VDF A;  1S77 D;  1RF1 C;  5F2V O;  2BTQ A;  5LP6 A;  2ZT9 D;  4JZG A;  3VBB A;  5AW0 B;  1M93 A;  5IY5 C;  3L72 J;  3ICX A;  5CB4 B;  3HKE B;  2RJZ A;  2AEJ A;  4UB8 H;  3ZRX A;  2JR8 A;  4I55 A;  2O01 J;  1CPY A;  3V6I A;  1VQK V;  4TWK A;  4BW5 A;  1BSN A;  4E4E A;  1XNQ O;  3JAL B;  1ORQ C;  5L3G A;  2M3B A;  1KC8 W;  2OCH A;  5CCG C;  3CWB G;  3RK3 E;  1SQP H;  1YIT P;  3CB2 A;  5A9G A;  2D2C C;  1DH3 A;  4DR1 O;  3P3P A;  4YIO A;  1KB9 I;  3CD6 P;  4NPE A;  4PEL A;  2AXT H;  3AG2 B;  2IU3 A;  1CI6 A;  3JAT B;  1FS0 G;  4HZ3 A;  4LC1 A;  1KYO H;  3P8C E;  2JO1 A;  2IM9 A;  3AG1 C;  4HBN A;  1DIP A;  1R3K C;  5KX5 A;  3CPW U;  5FNV B;  2BCC D;  2JEE A;  3H1L D;  2ZNJ A;  3ASN C;  1NTK J;  3A0H E;  3H1J G;  4UB8 Z;  1ZUQ A;  2AZ2 A;  1N32 O;  3BA8 A;  5JJJ B;  1NTM K;  1SES A;  1XUQ A;  1Q81 Q;  4I4T A;  3RVY A;  2FYN B;  3H1I J;  4YIP A;  1PL5 A;  5K5G B;  3P8M C;  2A0L A;  5IJ0 B;  3CXH D;  2IBZ E;  2JKV A;  1PP9 E;  2K9Y A;  5CA0 B;  1TUE B;  4X62 B;  3UCS C;  1L0N G;  3B8E B;  2LGW A;  4U3J B;  5KLV E;  2EIL B;  4QJF B;  2AXT Z;  1XMO B;  4B86 A;  4QE9 A;  3JAK A;  4QGP A;  1S1C X;  4DCK A;  2Y9Y A;  2FYZ A;  1QVF O;  3RGB A;  3KCX A;  3OJA B;  4FIP C;  3IJ4 A;  3WFV A;  5AVV B;  1LR1 A;  1Z5W A;  1NJI Q;  2K37 A;  3HKD A;  4F4L A;  2OYI C;  4EFE A;  3FB7 C;  4CS3 A;  2FKX A;  1SQX H;  3BRV B;  4LFB O;  3PP5 A;  5KJ7 A;  2XOK G;  1SQP D;  4J7K A;  4JAA A;  1YYC A;  1FDI A;  1E1R G;  4WFA V;  4OX9 B;  1K4C C;  4N6J A;  1GMJ A;  1OVU A;  1N7S C;  3AG4 B;  1KYO D;  4R4M A;  1ZL8 A;  3HD7 A;  3ZS8 C;  2QDO A;  1K8A W;  5KMG A;  4H13 D;  2F4V O;  4DW0 A;  1FFT B;  2WLI A;  4YJ2 A;  4NXN O;  3RT3 C;  3FXE A;  2F23 A;  2LFS A;  3WB1 A;  4H33 A;  3SWY A;  2BSK B;  1VQO P;  1ZR2 A;  1XEQ A;  4XBF A;  2J59 M;  3L72 E;  2DMX A;  1EZV E;  4ASW A;  5LGN A;  4G28 B;  4IHJ A;  2ITA A;  1BGY H;  4FM1 A;  3ZHU A;  5JH7 B;  5LMU B;  4MT8 A;  4NVP A;  3DXR B;  1IBK O;  4PD4 I;  1IZN B;  4DV4 O;  1GM7 A;  1Q90 D;  3AG7 A;  1SET A;  5DM6 V;  3LSQ A;  3Q5S A;  4N78 E;  1LGH B;  4LLH A;  3K5B A;  1Q6H A;  4N21 A;  1ZW0 A;  1W0K G;  2CGN A;  2J5U A;  2L35 A;  2UXD O;  3VOU A;  1ZN5 A;  3O8Z A;  5CJ4 A;  1M57 D;  5CCH C;  1TA8 A;  1VQ9 V;  2QJK B;  1SQX D;  2BTO A;  3WUT A;  3GHG A;  1K73 Q;  2B87 B;  4X20 A;  2EIJ C;  3U10 A;  4DV3 B;  2KKW A;  2PI4 A;  1NGM B;  1ZME C;  4GKJ O;  1M56 C;  4PA7 A;  3H32 A;  1EBO A;  2QWR B;  3OMI B;  1YHQ P;  1VQL V;  4JPR A;  1FJP A;  3W68 A;  1VQ5 P;  1AVM A;  2YEV B;  5LXT A;  4DRX B;  3RK2 B;  2B9B A;  4JYB A;  2UU9 B;  1PZQ A;  2RQ6 A;  1LWU B;  2PYJ A;  1AV1 A;  2R5D A;  4CH5 A;  1FS0 E;  4AI8 A;  3RYC B;  1BGY D;  1SQP K;  2RMZ A;  5JQG A;  3RBZ A;  3NXS A;  2WAM A;  3X2Q C;  3SYO A;  1DEE G;  1VQP P;  4WF9 V;  2E5L B;  4Q6G A;  4A7P A;  1MSD A;  1NYH A;  4DV2 B;  2ZYG A;  1K7D A;  1M57 B;  5AW7 B;  1RY3 A;  2DOS A;  2ATK C;  3S3W A;  1JMK C;  3QG5 A;  2CDY A;  5DED A;  1PGQ A;  3E2E A;  4WFB V;  1RFY A;  2P7J A;  2YI9 A;  2HHH B;  2HYN A;  1OWA A;  4JYC A;  4UCS A;  1SF9 A;  2DYR C;  1GN2 A;  1WPB A;  1AR5 A;  4LFA B;  1MUU A;  3U1C A;  3JSV C;  1HTL C;  2ZFC A;  1SRY A;  4J42 A;  1I94 B;  2WSE H;  4AYC A;  4MVZ A;  4JI1 B;  3CCR P;  3OAA G;  3IR9 A;  2CTQ A;  3ETG A;  3L73 H;  1CI6 B;  1QL1 A;  5GON B;  3IAO A;  4IOI H;  2ZJS E;  1UJW B;  1LP1 A;  4H37 A;  4X1Y A;  5KJ7 D;  4EFB A;  1BE3 H;  1JJO A;  2LGQ A;  1FJK A;  1DK1 A;  1SQQ E;  5HFM A;  2BE3 A;  1KZU B;  1SVF A;  2O57 A;  1N7L A;  3TXS A;  4ASV A;  4EDF A;  1RF1 A;  2K9J A;  2ZDI C;  3AE6 C;  2W0F C;  3L71 J;  4CC5 A;  3HD7 D;  2FB5 A;  1NKZ B;  3CRC A;  3P7K A;  1SQX K;  2DN9 A;  4ZOL B;  5LMN B;  2WLM A;  4FLV A;  2ZYD A;  1PP9 H;  2XND H;  3O6Q B;  5LYJ A;  4RJT A;  5CCG A;  4I50 B;  4L87 A;  4X62 O;  1UIX A;  4XE5 B;  2IDB A;  2Q7G A;  4NB5 A;  2FYU H;  4DW1 A;  2QEX V;  1QNM A;  1QVF U;  1XMO O;  1JY3 O;  1VEW A;  1KB9 E;  4IYH A;  1F51 A;  2ADP A;  2QM7 A;  1BS3 A;  3HKD B;  3T1Y B;  1JM0 A;  2OGU A;  2QM4 A;  3Q5R A;  2ODM A;  4FMT A;  2N1T A;  3B5N B;  5EBM C;  2R3C A;  4QMA A;  2OYH C;  1OIP A;  1N34 B;  2ZT9 C;  4JI6 B;  3L73 D;  1IDS A;  3ZRS A;  1KD1 W;  4U7N A;  3HD7 B;  4OX9 O;  1AFO A;  1BE3 D;  1L0L H;  1OV9 A;  1DGS A;  3JAW B;  1CXZ B;  5DN6 G;  5KMG B;  1TU3 F;  2E5Y A;  2YC0 A;  1BDC A;  4C7U A;  2PF4 E;  2WLI B;  2FKW B;  2YO2 A;  5J2T A;  1D2D A;  3FB5 C;  1S5H C;  1FZB A;  2V7Q J;  5BR8 B;  2HG5 C;  2E76 D;  2BCC G;  3L75 G;  4HNA A;  1LT1 A;  2OYI A;  4IL6 Z;  5EBW C;  1YZB A;  1LTI C;  2O01 H;  1PP9 D;  4LF5 O;  2P4K A;  1GO3 F;  2A9H A;  4H0L C;  1GTO A;  2CAZ C;  4DV0 B;  1TVK B;  4I0X A;  4PA4 A;  1AJQ A;  5M1B A;  2FXP A;  1OZ0 A;  3OTF A;  5LMU O;  1VF6 A;  1QEX A;  1N7S A;  2FYU D;  3KZI H;  4Z1M G;  5J9P C;  4UV8 A;  1JVM A;  2Z0A A;  4CC6 A;  1OW8 A;  2C2A A;  3B4S A;  2R32 A;  4L8J A;  3BAT A;  2RH0 A;  1JFF A;  1T2K D;  3K06 A;  3CX5 I;  4PI0 A;  2LXC B;  2OYO A;  5H9C A;  3JD1 A;  3CCJ P;  5LL6 Y;  2HFE D;  2XV5 A;  3TXQ A;  3CRM A;  3HE4 A;  4CH3 A;  2Y9Z A;  1NTK H;  4W80 A;  4C7N A;  1MG1 A;  2HJD A;  2IH1 C;  3N7N A;  3H1I H;  1HBW A;  2DWD C;  3H32 B;  2IU0 A;  3FAV A;  2E76 B;  5DEC A;  1E79 G;  1URF A;  3ABT A;  1QBZ A;  3O9O A;  3KZI Z;  4DV3 O;  1L0L D;  3BCC G;  3N2K A;  1Z56 A;  5LXT B;  1GW3 A;  1GTW A;  1FXK C;  3ABK B;  1E1Q G;  2CK3 G;  4WBN A;  3HKC B;  2ETN A;  5APU A;  4AHC A;  2ZIO A;  3ZHS A;  1HWT C;  3FWL A;  1TAE A;  1YBK A;  1GH6 A;  3G71 V;  5ITZ A;  2L5G B;  4HAM A;  3FYI B;  3U59 A;  1FU1 A;  4PI2 A;  3D36 C;  1RSO B;  5KTB A;  4JI5 B;  3K08 A;  4JI0 B;  1Q6I A;  2ZNI A;  1SQB J;  4O9B A;  2K1A A;  4RUE A;  1NVP B;  3OT7 A;  3W7W A;  2E5L O;  4D6T J;  4DV2 O;  1BCC J;  1FE6 A;  5JJN B;  5CCG D;  1M1J C;  4ZBM A;  3B2E E;  3CRR A;  1YI2 P;  4DK0 A;  1U97 A;  4RES B;  1J1E C;  5BU5 A;  1HGV A;  2HHH O;  4MTG A;  1EN4 A;  1NTK D;  2KI7 B;  1JOC A;  3ITK A;  3UIA A;  1FZA A;  4O2B B;  3RYH A;  3I5D A;  4LFA O;  3H1I D;  1LJ2 A;  3R4Y A;  1BMF G;  1SQX G;  4RO2 A;  2FYU K;  4TT3 H;  4JI1 O;  2IYO A;  1S3J A;  2N1T D;  3ETD A;  5LP6 C;  3SSU A;  1LUV A;  2UXX A;  4MTX A;  4R50 A;  1DD3 A;  3AEA C;  3WU2 H;  4LCU C;  1IXM A;  3T4Z A;  2Q67 A;  2Q7E A;  4U3F G;  3V2Q A;  3CXH F;  1GM9 A;  2OCC B;  3D6Y A;  1GZL A;  2Y48 A;  4PDR A;  4XDJ A;  3TK1 A;  2Y4T A;  1JY3 P;  4YXD C;  1GL2 C;  4BRY B;  2JIZ G;  2ZCE A;  2WLL B;  1JY3 N;  3CS5 A;  3QO7 A;  3VMY A;  5LMN O;  2W8Z A;  5C93 A;  4M3L A;  1P4R A;  4F6R B;  3SFD C;  2D2C B;  2YXL A;  4PJ0 E;  2ZXE B;  2GHY A;  2Q7H A;  3OR7 C;  1L0L K;  1SLQ A;  4J80 A;  2L91 A;  2XNX A;  1YIT V;  1VPC A;  2Q8V A;  1Y76 B;  1KB9 H;  3WU2 Z;  1RF0 C;  3CD6 V;  1D7M A;  2ZE7 A;  3ASN B;  3FX0 A;  2ZDI A;  3SDL A;  5E79 E;  2CTP A;  1N7S D;  2IBZ I;  4O4J B;  1LTG C;  4GOD A;  3T1Y O;  2N9B A;  3BHP A;  1FOS E;  1KYO F;  4CZZ A;  1P84 E;  2F93 B;  2EZO A;  3V2R A;  2IZ1 A;  1NZ6 A;  4R8C A;  4X89 A;  4LF8 B;  1N34 O;  3C8V A;  2JK5 C;  4JI6 O;  3FYE B;  2A3Q A;  1XHX A;  2A45 I;  3R2P A;  1OW6 A;  4DT0 A;  1FDO A;  4XDK A;  3ZN1 A;  4FLZ A;  1R3L C;  4BWA A;  1MOF A;  4J10 A;  2GUZ A;  3T2M A;  3VQX A;  3AE2 C;  4D6T E;  5JWP A;  4W4K A;  1BCC E;  1G2C B;  3HPL C;  1BHB A;  2OYI B;  1NTK K;  2H8P C;  3K03 A;  2ADQ B;  1AVY A;  4LNU A;  1IJD B;  2PFX A; 
#chains in the Genus database with same CATH homology
 2E74 B;  3G9R A;  1KMI Z;  1ZRT E;  1ZOY C;  3EWK A;  1KTM A;  1KQG B;  3D71 A;  2BEZ F;  2OQQ A;  3Q2Y A;  2J5U A;  2H89 C;  4R4L A;  3AE1 C;  4Y28 J;  3AE4 C;  3RK3 E;  2P10 A;  3O6Q A;  1K04 A;  2D2C C;  3Q5P A;  1RQV A;  2H88 C;  3Q5R A;  3FGA D;  1KOR A;  1PIX A;  2E75 C;  5KLI C;  2E75 D;  3IN6 A;  2JO1 A;  1Y9B A;  4GDO A;  1YQ4 C;  3AEG C;  1VF5 C;  1VF5 D;  2WSC J;  3AEE C;  2ZT9 C;  2WPV B;  1NGM B;  3GLM A;  1ZME C;  1DIP A;  2WQY C;  1KQF B;  4OGQ B;  2WSE J;  3AE7 C;  3R4Y A;  1HF9 A;  3AE8 C;  4H44 D;  3GF7 A;  1PV3 A;  4TT3 H;  1TU3 F;  4I7Z B;  1PL5 A;  1RQU A;  3ABV C;  3S9O A;  2K9Y A;  2G8Y A;  3GMA A;  5L8R J;  2V7Q J;  1DD3 A;  2E76 C;  3AEA C;  2E76 D;  3D6Y A;  3AE9 C;  3Q3D A;  2MKV A;  4H13 B;  2BEQ D;  2QJK C;  3AE3 C;  4YXD C;  1K05 A;  1S1C X;  1EXI A;  3SFE C;  3D70 A;  1U57 A;  4H0L C;  1NYH A;  4H0L D;  4PV1 B;  4XFJ A;  5M1B A;  2YMK A;  2FXP A;  1DD4 A;  2QJP C;  3SFD C;  2D2C B;  3AEF C;  4H44 C;  2QIW A;  2E75 B;  1OW8 A;  3Q1M A;  4KT0 J;  3D6Z A;  4OGQ D;  1AJY A;  4Z1M H;  2E74 C;  1VF5 B;  2E74 D;  5KKZ C;  1EXJ A;  2ZT9 B;  3AEB C;  1FDI A;  3T97 B;  1ZP0 C;  1GMJ A;  4U7J A;  3AE5 C;  3AEC C;  3GF3 A;  4R4M A;  1IK7 A;  3IAO A;  1OW7 A;  1JB0 J;  1VL2 A;  4H13 C;  2G3A A;  4H13 D;  3LW5 J;  4RKU J;  3B71 A;  2WSF J;  1R8E A;  1KIL E;  2E76 B;  4PV1 C;  3C8V A;  3AED C;  4PV1 D;  3AE6 C;  4OGQ C;  2FBW C;  1OW6 A;  1FDO A;  1S5L X;  2QSI A;  2YIU C;  2D2C D;  1OMI A;  4H0L B;  1HJ0 A;  3RL0 g;  2FYN C;  4I7Z C;  2NZ2 A;  4IL6 X;  3AE2 C;  1MKM A;  3H25 A;  2QJY C;  2ZT9 D;  4YTP C;  2JP3 A;  4H44 B;  1UIX A;  1Q90 D;  3Q5S A;  1WMK A;  1YQ3 C;  2IDB A;  2O01 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...