1Q90D

Structure of the cytochrome b6f (plastohydroquinone : plastocyanin oxidoreductase) from chlamydomonas reinhardtii
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
156
structure length
156
Chain Sequence
TKKPDLSDPVLKAKLAKGMGHNTYGEPAWPNDLLYMFPVVILGTFACVIGLSVLDPAAMGEPANPFATPLEILPEWYFYPVFQILRVVPNKLLGVLLMAAVPAGLITVPFIESINKFQNPYRRPIATILFLLGTLVAVWLGIGSTFPIDISLTLGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Atypical Haem in the Cytochrome B6F Complex
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Photosynthesis
molecule keywords Apocytochrome f
total genus 44
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2003-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 1q90D02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1q90D01
2WSEJ 1JB0J 4Y28J 2ZT9B 4H0LB 4IL6X 4OGQB 1S5LX 5KLIC 2WSFJ 4I7ZB 1VF5B 5L8RJ 5KKZC 1ZRTE 2QIWA 2WSCJ 2QJPC 3C8VA 2QJYC 3LW5J 2QJKC 2WPVB 2E75B 4PV1B 2D2CB 4H13B 2O01J 2QSIA 2FYNC 4RKUJ 1Q90D 4H44B 2YIUC 2E76B 2K9YA 2E74B 4KT0J
chains in the Genus database with same CATH superfamily
4IL6X 1YI2P 4O9BA 1H8HG 1T5EA 3D36C 4WFAV 2IFMA 3P8CE 2PAJA 3MZWB 2W6JG 3UT5B 4DW0A 3K9SA 2Q7GA 2X6BA 2X7RB 2D2CD 5LHGA 1OIPA 3B2EE 1K73W 2K9JA 3EFGA 2CDYA 1SQPJ 2HG5C 1VQ9P 3L73D 2FTKA 5AW1B 4GKGA 2Y0IA 1V54B 5EZYB 1Z56A 1RE3C 2HODB 1SQXK 5GONA 4LNUA 1NTMH 4TUYB 4Y28J 2LFSA 1BCCH 2YIDA 1URFA 3M06A 3C1LA 1JY3O 4DJGA 3OR6C 2FYNB 1U57A 1SFCA 5LOVA 2QWNB 2F66C 1AR1B 2Q4PA 1RF1A 4TV8A 5GTHZ 1Q8IA 5BMVB 1YIJV 2C2AA 1KB9H 5EK0A 5B1AC 1BMFG 1LUWA 1BGYE 2O01J 4NXMB 4I55A 3QO7A 1S77D 2Q68A 3WUTA 1HGZA 1Y4MA 1EZVI 4J7ZA 4IL6Z 4J7JA 2QKAA 2N1TD 3SYAA 4DV7O 2WLKA 4HBNA 2WSEJ 3CX5D 1WP7A 2ZCEA 4B86A 4GDOA 1OW6A 1YZBA 4B08A 4IHJB 1M57C 5TISH 3OMAB 1GM7A 2AEFA 1OMIA 5AVQB 2P7TC 4UCUA 2XAJA 1THZA 1KTMA 5KAIH 4O2AA 4TT3G 1SVFA 4LF8O 3S3XA 1PKXA 5EYPB 4XDKA 1FS0E 2R3SA 1NH2B 5ITZA 1XMQO 4ICGA 3L74G 1KQFB 1SQQD 3ABMB 3KZIH 2A3QA 2JWAA 3JARB 4DR3B 1WA8A 3NTNA 5B5EH 5BVZA 1LTSC 3V5BA 2QE7G 2H7HA 1XNQB 2HG5D 3FB8C 3THOA 3CRRA 4LF8B 4X89A 2Q3EA 3K5MA 3U1AA 1KD1W 1KP2A 2HFED 3HD7B 2QEXP 1GMGA 1GL2D 2ZIMA 2HVKC 3S1KA 1AI6A 1CEZA 1E5WA 3ABKB 4EB6A 4JI1B 4JI4O 4LFCO 1E1RG 1XNQO 5KLVG 1WT6A 3WU2Z 3L74D 2RCVA 2NZ2A 3TNUA 1VQOP 1GD2E 1QLEB 5BMVA 2XT9A 4ZI7A 1OW7A 3GHGA 1JB0J 3H1HD 1H0TB 5APQA 1VQ6P 2OCHA 4LFBO 1SFCC 3SPCA 1NHLA 4BRYA 1HNXO 3PN1A 2CH7B 1M1JA 2QM8A 5IT9N 4OXSA 1D5NA 2CTWA 2K1AA 5CN0A 1SS3A 4PD4E 3ZRWA 4ZIBA 3WU2E 2IJHA 1URQD 4O4JB 5L3GA 2YI8A 4K8XA 4QNHB 2XZRA 1YTZT 2YIBD 2OYHA 2B1IA 4U3FG 3CRQA 4JGSA 5B1AB 1XHXA 2V7QH 3P7KA 1PIXA 4TQDA 1E79G 2ADQB 4TLFA 3H1LD 1QX8A 3CCEP 2YEVB 1JPXA 2O57A 1IBKB 4JYBA 4X1IA 3SWKA 3RBZA 1IFMA 5AW4B 3CCVV 5LGTA 1LTJB 2E5LB 3JASA 3ZHRA 2ZFCA 2BOCC 4JTAB 1N33B 5DM6V 3HKEA 1GN6A 5LA6B 1TU3F 4BR6A 2QJKC 1JA8A 1IFIA 1EZVD 1R3IC 1P49A 4K8ZA 4O4IB 3A3YB 4GOEA 5TISE 4A7PA 4J11A 1R3LC 5KLIB 1K9MW 1M5IA 1KILE 1SQGA 2R5BA 1JQ0A 4X64O 3OAAG 1FDOA 2WPRA 2AZ0A 2P2UA 1OCOC 1TGOA 3PJSK 1N7LA 1CW5A 4UCSA 3BABA 1MUUA 4DRXA 1ZN5A 4JYAO 2CE4A 1RH5B 3AE2C 3L72E 3E1IA 5L8RJ 1OX3A 1LTIC 4TSFG 3H1KG 2HJDA 3H1HE 3ASOC 1QVGO 4OPAA 1YBKA 1JUNA 1GK9A 4UUJC 2NPSB 3BA8A 1M56B 2CAZC 2XUMA 2F1MA 2PUSA 5K1XA 1BS3A 1EZVG 1LT9C 1VDFA 5FLXN 1NTME 1V55B 3MHHC 4WBAA 1K73Q 5D5PA 1AJNA 1CI6B 3M8AA 4LGDE 4HZ3A 1A02F 1KKCA 4CZZA 2CPSA 1S72P 1YEWA 2Q69A 1SERA 3CCVP 3OEEG 5CA1B 3R4YA 3CSXA 4H13C 4I4TA 1NU1E 2PGGA 3TXSA 2Q6QA 3SPJA 5FNVB 3W68A 4QE7A 3RK3C 1JNMA 1DX7A 4UB8H 2B87B 4NTXA 4ABMA 1QQCA 2OCCC 2YSUB 3QNEA 1ORQC 4HAMA 3SFDC 1L0LE 4I4TB 3AE1C 4UVAA 1ZR2A 1TVKB 4JF7A 2Y69B 4DV6O 1VQNV 4DV4B 2Q9IA 1GM9A 4LFCB 3RK3E 2ARHA 4KHXA 2KSDA 1FXVA 1URQC 3DTUB 3ZCCA 1YTZI 5AVYB 5KHHA 1MOFA 4JYAB 3RK3B 1OFCX 2FKWB 2RN0A 4LF4B 3J7AU 2BOBC 3GG2A 4N78D 5LP6C 3KHUA 1RM1B 1Q81W 1HWTC 2QSIA 3CCQV 3H1HJ 2WPSA 3IFXA 3ABTA 2H88C 2OTLP 1LR1A 1VIBA 4FFKA 4O2BB 1NKNA 4WY4A 2Y0CA 2JDIH 2DYRB 3L74H 3L70J 4PJ0Z 1KYOH 2K3RA 4PJ0H 1HW7A 2HLDG 1FZAA 1XNRB 2E42A 3SWFA 2MK3A 5B66E 1N73A 1X79B 2A06D 2E76C 3SPHA 4AQYB 4F6RB 2B88A 4FK5C 2LQTA 3E89A 2K1EA 4K35A 3RYHA 3S3WA 3E7KA 2H8PD 2G3AA 2JKVA 3EQ2A 2ZVOB 1L0NH 1OVUA 4UXNA 2JGUA 3CCSP 3EVKA 1OCCC 3T2MA 5H6RA 3FB6C 5B1OA 4P9OA 2M3EA 5BR8B 4JI5B 3EWKA 3PHLA 3RK3D 2IM9A 2IBZG 2AZ2A 4X1IB 3H1JE 2P10A 2WSFJ 3JAKB 2Q7CA 1HNWO 1NU1K 1EN6A 2W0XA 1QU7A 4UB8E 2ZM6O 4RUFA 5GW7A 1L0LJ 3E8GA 2WSCJ 2YO2A 2O3JA 2ZQMA 1FZCC 4B3RO 2KP8A 5AW9B 1BE3E 1RSOA 2DYSB 4O4JA 3TGUD 4H37A 1KQLA 1AQ5A 2FYNC 4FM2A 3TF5A 3L70H 1S5HC 1NT2B 4P2ZA 3JATA 1YVWA 3VP8A 1PL4A 4H13D 5KMGA 1IXBA 2IYOA 2GV9A 3QF7A 2PI4A 3ZRXA 1IZ3A 5KUMA 3CCEV 4K0KB 2EJ7A 3OJAB 1PM9A 5H9CA 4ZHQB 5LMNB 3BATA 1JY3N 2J58A 3SYOA 3QVNA 1N2DC 1YIJP 4MN4C 1EFRG 3L75D 5C8YA 3FYEB 3K06A 2R5DA 3P8MC 1R73A 4N6JA 3TSIA 1IK9A 1PNKA 1SZXA 2XAQA 3L70D 1QBZA 1TA8A 2KB7P 3KZIE 1XMOO 4O2BA 4WY4B 2M5AB 3CX5I 2K37A 4DV1O 3CC2V 1KILC 4JI7O 5CBHA 5KAFH 1NTZH 1YJ9V 4NXNB 5LMNO 3TYYA 3OD4A 4LH7A 2C0WA 3SWYA 2KNCB 1K9MQ 2E3CA 4G27B 2WITA 2GA1A 4TQFA 2N05A 1KYOE 1NTZE 3H6PA 1M1KW 2O01N 1PD3A 1S2EA 4HKZH 2OYIB 1Z5VA 2P4VA 1L0LD 2JO1A 3L37A 2BCCH 3RYCA 1GU4A 1P84F 1SQQG 3DGEA 1S9KE 3N4XA 1QR8A 3EFFK 5JVDA 2YICA 2QRXA 3M0AA 3ITKA 3RL0C 4O4LA 2BTOA 3M9QA 4EKWA 4OWFA 3B8MA 2UXBO 2EILC 1NTKJ 4Y99B 1GTOA 4AI8A 5AW2B 4MVQA 3APOA 2JP3A 1LJ2A 4DT0A 1PPJH 5L3DA 4C7RA 5LGNA 2Q9LA 5KJ7D 3TXQA 5IYZB 4JI8O 4KHPO 3H32B 1NVPD 2Q6AA 3K5OA 1NR7A 2BCCG 5LP6B 2M7WA 3N2KA 4PA4A 1EQ7A 4GX1A 1S5LH 1BGYD 5KUKA 1N8RW 3MUDC 3RGBA 1AJQA 1VF5B 5CBGA 4LF7B 4H44C 3CHXA 1CZQA 2YMKA 3H1KE 5JQGA 3CD6V 2E75D 3JCUZ 1UIIA 5FPOA 1VQMP 4RWUA 4K0KO 5H5NA 1SRYA 2CTRA 3L73H 1JM0A 2E5YA 1ZLLA 1NAYA 1AV1A 1P84I 1SFCB 1I5XA 2UWJE 2HPCB 2OTJP 2E43A 3O8ZA 4GIFA 5L3FA 1P7GA 2LXBA 3U10A 5KAFE 1AJYA 4LNUB 1ZL8A 4YJ2A 5GTHE 1KV4A 3KCXA 1K4DC 4TOIA 3A0HH 1W2BO 2DOSA 1FJGO 2BEQD 1KC8W 4B3TO 1N32O 4EIJA 2ZDIC 2DJVA 3KZIZ 3T4ZA 3A0BZ 2QIWA 3TGUH 2VS0A 4IFMA 1ZL8B 4L75A 1Y66A 5AVWB 3FB5C 3N27A 3CI9A 2IU3A 4UB8Z 5CA3A 4D6TE 3RK2B 3J81N 3QO8A 1NTKK 4UV8A 1LP1A 1IFJA 2WSSH 3KKYA 3JD1A 1YI2V 1WB7A 3NXSA 2Q5ZA 1JTHA 5EC1C 2P06A 3Q4HB 3OM3B 4ZMDA 4PHZA 4X65O 3CWBE 2KZJA 4ZOLB 1SFCD 1IO4A 5CA0B 5AW8B 5JH7A 4U3FE 3AG7A 3OT7A 3CB2A 4C7NB 4UV9A 3ETDA 1QNMA 1F7YA 1JJOA 5EBWC 5GTIZ 2EIKC 2Y9YA 5E79E 4RJTA 1HVVA 1HNZO 5AVVB 1VF6C 4PDLA 5JVDB 2JGDA 1XEQA 4W7YA 5KA6A 1QHTA 1ZV8A 3A2AA 3EXAA 3H1LJ 1P7BA 4GX2A 2R9RB 2P67A 2H43A 2OYOA 2QTSA 3CS5A 4H0LC 3JC22 1PP9D 5EBMC 1ZRTD 2FFDC 1BSMA 1RHZB 1BGYG 4RQEA 1D2DA 4DR7O 2Q0AA 2V1DA 3QO5A 3VBBA 2OT5A 5CBFA 2O1JA 3QTCA 2A45I 2RH0A 1VMGA 1TUEB 3ICXA 2XHBA 3JARA 5BR8O 1R6NA 4JZGA 1CP9A 2ZE6A 1SQBK 5IWAO 2WWWA 2FXOA 1DEBA 3CCUV 3H1HH 1N36O 3BVHA 3ABMC 2B5UA 1LTAC 4H0LB 3NFQA 3K0DA 4JPZB 2UUAO 2W6BA 3I55V 2ZVNB 4CH4A 1FFXB 3LDEA 3N2GB 4NYKA 5EBLC 2H94A 5CMUA 4RQFA 2Q0OC 2UU9O 1RY3A 1FYJA 2XV5A 4U3JB 2XDJA 2E76B 1N73C 1OZ0A 1HNWB 2XNDG 3CPWO 1OCOB 4LCUC 3CC4P 2ITAA 4HNAB 3G80A 4I9QA 4LFAO 4I55B 1ZUQA 2XAGA 2IX7C 1J1EC 1AI7A 1QVGU 3FAVA 2KZIA 1SQVH 4MTFA 2Z5UA 4FLVA 2DYRC 2RDCA 3DSQA 2ZKOA 4D6TG 5B1BC 1N86A 1OHHG 1NU1G 1RSOB 3OTOO 1MFZA 2UUCB 1CSBA 1FE6A 2Z0AA 2HODA 3ASNB 2LO1A 1OW8A 5AG2A 4H0LD 4BIUA 5IWAB 4N23A 4IFFA 2YIBA 1FZCB 3VOUA 1GH6A 3R2PA 2DMXA 1WPBA 2P1JA 1QGKB 3BCCE 1FXKC 4RESB 2X6CA 1NTZK 1H2MA 3IC9A 4J9ZB 1L8DA 1SQBJ 2IYPA 2L5GB 3AG3B 3SFEC 1JX9A 2VQFB 5AVSB 1HBWA 2DW4A 1IBLO 1M57D 2Q3IA 2XNXA 1NTZG 1EC5A 4I7ZC 1I94O 3ABVC 1GL2A 3M0DC 1K8AQ 1SQBE 2XOKG 1I5YA 1K34A 1KMIZ 5KHGA 4JI7B 1JCCA 2SPZA 3D6YA 3RYHB 3BCCJ 5L3BA 4FLYA 1G2CA 2KI7B 2PI5A 1BT8A 2I8DA 3T97B 2V4DA 2YIUB 1AFOA 1ZP0C 4ZKUA 4JI8B 1H8AA 2F23A 2JS5A 4FLTA 4QGPA 4P30A 3WB0A 2C9NY 4OPHA 1VQ7P 1KZUB 2YS8A 2IJKA 3CCSV 3A5TA 4OH8B 2V7QG 5HFMA 5GTHH 4NR1A 4UB6Z 1HH0A 3L70G 1RPOA 1R3JC 2VWJA 1U96A 4HYOA 1TVKA 3GLMA 5APVA 2IJIA 1Y76B 1L4AD 1H2LA 3WG7C 1BE3G 4GKKO 4X66B 3BFRA 1W5CE 2WPVB 3L35A 3KDPB 3Q1MA 3L75H 4L87A 3MAQA 1IJDB 1PL0A 1SQQH 2QA4V 1PZQA 1SQXE 4FLUA 1DIPA 4CS3A 3BCCH 5CA1A 3HD7C 1WB8A 1L0NE 1PL5A 2KIKA 1B3QA 4BW9A 1FDIA 3BAAA 1M90Q 2GUVA 4GLXA 3ZHVA 3ASNC 2BCCJ 3IN6A 4PDVA 2A06H 4RAIA 2P4KA 3R65A 1N34B 1V54C 1QLNA 1HNZB 1Y9BA 1IX9A 4ZOLA 2FB5A 5FL7G 1KORA 4W4LA 2YXRB 1TUBB 1NTKH 3JYCA 2OWOA 1YQ4C 2QE7H 2WLJA 4CC6A 4DV5O 1GL2B 2R32A 3L75E 1IFDA 4G2KA 5IYCO 1RFYA 1LP1B 5CA0A 2L6LA 4NVPA 5EFWB 4DRXB 2ZJSE 1NJIQ 2KG7B 1NOHA 4DR1B 2EZOA 3ETQA 2AHYA 4B3RB 2WLLB 1U97A 4UCTA 1AR5A 1MA1A 2EIMB 3SPIA 4DV3O 3B5ND 3B8NA 2OTJV 1SQBG 4B3MO 3C3TA 2ZYGA 2ZE5A 1K5SA 1PPJD 3KG2A 3U1CA 2OQQA 4J9YB 1FFTB 4UCOA 3TK1A 1IBMO 2ZE7A 2UUBO 1KB9E 2G38A 2FYUK 3G71V 5IE9A 1VQ5V 3G71P 2JRIA 4LF6O 2HPCA 4O4IA 3GVMA 1BCCD 2EIMC 2EZPA 5J2UA 3G4SP 1AI5A 4EI2A 4IL6E 1QCEA 4X64B 1NAFA 3F7VC 2C9LY 3JASB 1J1EB 4LP8A 5CBOA 1YXBA 5LYJB 4L76A 2AGAA 1FPOA 3ASOB 4FLXA 1L4AC 1NKZB 3MTUE 3CX5H 5JJNB 3CCLP 2DQ0A 2IU0A 1QVFO 3H9VA 4LF9O 2UXNA 2X6AA 1J1DC 1Q86W 3L70E 3H32A 1NZ6A 1OVRA 4CS4A 4DK0A 1G6UA 4FMTA 3D71A 2PFXA 3AK3A 3RN4A 4ZI7B 3GHGB 4AILC 4JYCA 1S5LE 4LF5O 3CCQP 4PA3A 1SQFA 3HD7A 2VWKA 1FXKB 5JCOC 3H1HG 5BZBA 1NTMG 2E74B 1GRJA 3HKDB 1SQBD 5B66Z 1KILD 4PDMA 4FM1A 1R5SA 2P5OA 3TNUB 1N36B 1FOSE 3FD9A 2QM7A 5AVXB 3C9IA 4PI2A 4LLHA 1SQVK 3HUSB 4I6MC 2GTAA 4MW3A 3L73E 3CCMP 4UCVA 1MZ9A 1KP3A 4QIWF 3W7UA 1K8AW 3RYIB 1L0NJ 4DV1B 2UXCB 1XTCC 4Q20A 2PYJA 3OFNG 2JWDA 1VQ7V 2AXCA 4ZKPA 3CXHF 3S4RA 4LFAB 3C3SA 3A7OA 1PP9G 3BCCD 2FYUE 2AXTZ 2OIEA 4NXMO 1AB3A 2QEXV 1NVOA 1N7SD 5KLVD 2ETNA 3U59A 2KNCA 3F7YC 1FXKA 2H8PC 5CB4A 3JSNA 1JEKA 1K05A 3JD3A 1OVVA 1Q6UA 3IF4A 3UO2A 1LTTC 4KP4A 1KFNA 2YKQA 4OGQB 2RMKB 2IZ1A 3FX0A 4UB6H 3E1RA 4JAVA 4DR4B 2UXBB 2GUZB 1VF6A 3AECC 1FU1A 1RF0C 4DV0O 2WPQA 4CC5A 1SQQJ 2C0XA 4LH6A 2M8RA 3IJ4A 3RYFB 3L36A 1RQVA 1KILB 2CK3H 1GN4A 3JD2A 1SQXH 2PTMA 2NLJC 1XL4A 3M91A 4EEQA 4C7NA 1L1FA 1YHQP 1PGOA 2N1TC 2WLMA 2PGDA 4EOTA 4BAYA 2R44A 1USDA 1UFIA 4DR6O 2A79B 3Q4HA 3JATB 5LOVB 1YTFB 4FJCC 2ZNJA 3VQYA 2E75C 3HR0A 4DR5B 3ZS8C 1M90W 2ZIOA 4J10A 2P58A 1V55C 4DV2B 1SQVJ 2JJLA 3V4WA 1WRGA 3USSA 3TETA 5CCHC 4YJ2B 1NGMB 3HKCA 5EZYA 4IYHA 4BIZA 1NYHA 3OTFA 3JAKA 1VP7A 3CRMA 1L0NK 4L74A 4GUNA 4IT5A 4MVZA 2XKMA 1S0VA 2IBZE 2P7JA 2Q1KA 3SJAC 4X66O 3IR9A 2BCCE 4E2LA 3ABUA 1DEEG 4NB5A 3AEIA 3VQWA 4B7EA 3B40A 4IGGA 4DV3B 4LF9B 4FLZA 1H2NA 1DTOA 1AVYA 1FS0G 3WB1A 4Z1MH 3I55P 1DF4A 4YY3O 1SQXJ 4JAUA 3A0HZ 3B77A 4WBNB 3L72G 2DWDC 1LT9A 4C46A 2RN9A 3UT5A 4DR2B 1Y67A 2HHHB 4F6RA 3M99B 1E79H 5AW5B 3H1ID 1KBHA 2XAHA 1SQQK 4Z1VA 4AHCA 4JI0O 1Q6HA 1NTMD 4HH2A 1YTFD 4PD4I 4X88A 2E74D 1NBMG 2N1TA 1OCRB 1GM8A 3AG1B 1WLEA 3H01A 4LC1A 4I50A 3STLC 3VTPC 5LXTB 3SYQA 4JI4B 2E5LO 1FC2C 1FBMA 1NR1A 4GKJO 4DR2O 1RP3B 1T6AA 2ITDC 4GODA 2WVRA 1B06A 1AROP 1BCCG 2IBZI 4YXWG 1IFPA 1AVMA 2A45H 5IYZA 1QVFU 2ZXWC 3ML0A 2GBOA 4GT1A 3RYCB 1NI8A 3NR7A 2J59M 2RMZA 2PRRA 3CL3D 4KUMA 1SQPD 3HTKA 4JQ0D 1JY3P 2FFDA 3CC7P 3V2NA 3B09A 1NS1A 4O4LB 1GAXA 1USEA 1JMKC 3H1KH 2WLIA 3ZIAG 1BGYH 1IZNB 1VQ4V 1BQ0A 2E5TA 4C7UA 1Z5WA 3V2RA 5LHIA 3AG4C 1T3JA 3CRAA 1AILA 3L71J 5IYBO 2KS1A 1NH4A 1EZJA 1Q86Q 1DD4A 2FFDB 1BL8A 1K3EA 3W7WA 5FPRA 1AI4A 3DXRA 2QWOB 4JI3B 5J2TA 1A32A 2KSEA 3AEDC 2XAFA 3CPWU 3SJCC 2KKWA 5JJJB 1NH2D 1NU1D 4YHHB 2JIZG 2Q7EA 1BSHA 3A0BE 3CCMV 1JCDA 4K3AA 2OCCB 1KYOF 3D36A 5GTIH 1VQLV 3G6BA 2NPSA 3ZMZA 2Y69C 4GX0A 3TCUA 3Q3DA 2QJPC 1WMKA 3SGIA 4X9QA 4O4HA 1DD3A 3LSSA 5IDJA 4ASVA 3E86A 5C93A 1T3UA 5JJEB 3T97A 4L73A 3HE4B 1QL1A 5B3SC 1HR0B 3JSVC 3L72D 1YJ9P 2J5UA 3WUVA 4DUZB 2WT7B 2EULA 3JCUE 5AW0B 1CPYA 3CCRV 3CC7V 3L74J 1UPGA 3AEAC 3CRCA 4ZBMA 4MTOA 2KYVA 5KTBA 4JTDB 1H38A 5LA6A 1N0JA 3ZRSA 1OXZA 2AEJA 5APYA 1T2KD 1EZVE 3VOPA 4YTPC 1YHQV 3HB3B 1LTJA 3ZHQA 3E8FA 1GW4A 2K88A 1DGSA 3L72J 2IBZD 1VQ8V 2LKMA 3GB7C 1SQXG 1FZCA 3H1LH 2JJ2G 3CJHA 1KYOI 2R3CA 3PP5A 1SQPK 1K33A 2JEEA 3CE2A 2JVDA 1XMQB 2OGUA 3P8CD 4N3YB 3CP1A 4R50A 2ZT9D 2AHZA 4MVUA 3H1JH 5APWA 2WT7A 5APXA 3SSUA 3OA7A 4KXRA 2PF4E 2LGWA 1IBLB 1DH3A 4MVOA 1J1DB 1GDTA 4MT8A 2YEVA 4H44B 1VF5C 3NMDA 3OUSA 3D3QA 4OVNF 3AE4C 4U3JA 1D7MA 3KXDA 2ZXXA 4X20A 4O4HB 3H1IG 2VQFO 3CCUP 3BASA 3GHGC 5CCHD 2P22C 3J80N 1FFXA 1RF1C 3CXHE 3CMAV 4YIOA 3N7NA 3A2FA 1OCCB 4HNAA 3L9DA 1IC2A 2LP7A 1VQMV 2QJ1A 1W0JG 1SQVG 2KUBA 1B6QA 3SYPA 3B8EB 3B5NA 1PNLA 3GW6A 2L35A 4DW1A 3VMAA 3M0DA 5KKZB 4I0XB 2YXYA 1GMJA 2YXQB 1SLQA 4R6ZA 3RGUA 1JCHA 4NXNO 1SKVA 4R7CA 1NKDA 1S5JA 1YJWP 1KD1Q 2VRZA 2DWEC 2ZT9B 4GKJB 3F89A 2GSMB 3H1JJ 4U7JA 5AVZB 1XUQA 1VQPP 1VQ5P 1VQLP 5A2QN 1VQPV 1B04A 2P6JA 2GHYA 4D7TA 5J2TB 4GCZA 3UM7A 4EFBA 2QJYC 1KB9D 1LWUB 3CYOA 4O2AB 4JI2B 1H8EG 4PA9A 2NN4A 3HUSA 3GWOA 3T1HO 2Y9ZA 2CGOA 4ASUG 4LF4O 1KFMA 1PP9J 2ZR2A 2B9BA 1JMMA 3S9OA 1VQOV 1M8OB 4R4MA 4IFDK 2D3OW 2ZYAA 2YDEA 1VQNP 1KQSO 1SQBH 1NU1H 1FDMA 2JGDB 3E22A 3K79A 1Q82W 2FY8A 1D5AA 3K58A 5LXTA 2A06E 1R5LA 4IIJA 1MMMA 4LWSA 2ZINA 3CWBH 3IAOA 3MP7B 1YSCA 2W6JH 3LW5J 2LJ2A 2QDOA 1I08A 4H13B 1ENVA 1X0TA 1ZOYC 3RL0B 2QA4P 1FAFA 2FYZA 4JBZA 4XFJA 1EBOA 1H2KA 4PD4F 4XBFA 4RUEA 3CXHH 1R8EA 1PNMA 3CEIA 4WBNA 3L74E 4FIPC 3T1YO 1Q81Q 1TAEA 4PDRA 5K5GB 3G3ZA 2PP6A 3SPGA 3ETGA 4D6TH 1JOCA 1OCZB 3E35A 4FM0A 1XMOB 2OYIC 1I0HA 2DYSC 1M93A 1N0NA 1RF1B 5J2UB 2PYLA 4D7SA 1YQ3C 5KAIE 4CH6A 4BWNA 1VQKP 1LT1A 2WPDG 2E74C 1LT9B 2YO3A 3T1HB 1L0LG 5KLVE 1O9HA 1O9GA 1GW3A 1HJ0A 4RKUJ 1NU1J 1WJZA 1EZVH 1MV8A 1EN5A 1R3KC 4OGQD 3BCCG 5LBQA 3HKEB 2W6IG 5LMUO 1AA0A 1J95A 2QVAA 5M1BA 3G6EP 4GKKB 5KAIZ 1PV3A 3L75G 4YPCA 5AVTB 5KLVK 4W80A 4HB1A 5CCGC 2R70A 5CBNA 5LGUA 3CCRP 4NTYA 1MZFA 4BRYB 2OIGA 1ZTEA 1SZTA 4DYLA 2Z4EA 1VQ4P 4FLWA 4JI2O 2UXDB 2Z5HA 3FWNA 2X0LA 1X8YA 1P84H 2ZYDA 1URQB 4CS2A 2BTQB 3JCUH 4LWSB 4DR3O 4WFEA 4TV9A 4LFBB 2ZNIA 5KJ7C 3N2KB 5B1BB 2CK3G 2B1GA 2IW5A 3IFMA 5KLIC 5D5QA 3I5CA 3E22B 2YKOA 3V4QA 3ABKC 1P84E 3FXEA 3F5WC 2AXTE 3VQVA 4UB6E 4Z2WA 3MD0A 2HR3A 1FJPA 1YDXA 4PA7A 3ZHSA 4JF3A 1NVPB 3RYFA 2PY5A 1SC5B 1JO5A 3CCJP 1OJHA 1GK6A 2WSSG 1G1JA 3X2QC 1FOSF 1J5EO 4M3LA 5CHXA 2GUZA 3WMM0 1NTKD 3OAKA 2EINC 4U3FH 2YXLA 5DEDA 1G1XB 4TWKA 1H2GA 1Q2NA 4KT0J 1H89A 4LF5B 4DR1O 3CC2P 5AVRB 3BHPA 1BE3D 4RO0A 5IJ9A 2FYUD 4R4LA 1L4AA 1LTGC 4NTWA 2FL4A 2F4VO 2OYIA 1N33O 3JCZA 1SA0B 1AVOA 5GTIE 5L3EA 1MNGA 4PJ0E 4PV1D 1Y76A 2GM4A 2WQYC 3BPZA 1G4YB 1WA8B 3W67A 5KLVJ 2N9YB 1L4AB 2Y4TA 1BGYJ 2KLUA 2RJZA 1S3JA 1KQGB 3APQA 1YJNP 4DUYB 1HTLC 1EM1A 3RWRD 2R72A 4JV5O 3R66A 2Q7HA 3ZMSA 2Y48A 2QSAA 5EYPA 2M3BA 2QJPB 1M56D 3IC7A 3L73G 5C8YB 5LMUB 1M1KQ 1L0NG 3CX5E 1ROPA 4PA6A 3IAYA 3AEFC 4WY4C 3C90A 5B1NA 1COWG 4J42A 5KHIA 5KHJA 5TJHA 1SQPH 1Y74A 3G4SV 1K97A 5KAFZ 3HKDA 3AK2A 1HF9A 3D3IA 2M5AA 4X65B 2M6YA 2Q8VA 3K5NA 1PGPA 3PTZA 4J7KA 4MVMA 3K9AA 4P9PA 3CXHD 2KOGA 1GTWA 4TUYA 5LYJA 4ZHQA 3I5DA 3M9BA 4MS2A 4XA4A 2QWRB 1PV0A 1KUQA 3BVOA 5H6QA 1FJKA 2ZR3A 1XQ8A 1LWUC 5KMGB 3B4SA 1R6KA 2DQ3A 4TV8B 1RPRA 5APUA 2EIJC 1BHBA 4YJ3B 2NPSC 4D6TD 4UCRA 4TT3H 3VYIA 1HP8A 1T8ZA 2IH1C 2A9HA 2HEPA 1SQPG 2H89C 4U7NA 3C8VA 1X59A 4NPFX 1NO4A 3LNMB 2W90A 1Q82Q 2FKXA 3W7TA 1Q43A 3G9RA 3E2EA 3GWKC 4WWIA 1SQQE 4JTCB 5IY5B 1L0LK 2WLLA 4I9WA 3MHVA 2NNUA 2MKVA 2UXCO 1KYOD 2POHA 5H2FZ 1X22A 1FAVA 1M1JC 3L72H 2CUGA 4EDFA 1XHZA 2EINB 3ZJZA 3AE7C 4ZKIA 2BSKA 4AYCA 3RVYA 2NR5A 4Z1MG 1VL2A 1JOYA 5F2VO 3V6IA 2R9AA 3I56P 1FXHA 3MGNA 3K5LA 3FGAD 3I56V 4MSWC 4WY4D 1Z2GA 2IBZH 3ZDMA 5LL6Y 3U0ZA 1KC8Q 1OCZC 3STZC 3H1IH 1P84D 2KK7A 3E8HA 1YCIA 3T1CA 1JY2P 2KG7A 3RK2D 4B3SO 1FZEA 3AEGC 3GF7A 3CMAP 3HE5A 5DECA 3HE4A 1DK1A 1IURA 3H1JG 1VARA 2YXHA 2WTYA 2A06G 3AE6C 1FZBA 1W0KG 1G1IA 1OV9A 2IPPA 4I5SA 3L71D 1YF2A 2YIUC 3HPLC 4X1YB 3W7XA 3KCYA 1LTJC 4B3TB 2JS3A 4DUZO 1YJWV 1N32B 4DOJA 2EX3A 3FX7A 1J2JB 1VQ8P 1Q7YW 1XREA 2BCCD 1R6TA 3ZN0A 1IXMA 2N04A 5EIBC 2FXMA 1A02J 1EDIA 3OMNB 2AXTH 5KA5A 2B87A 4H33A 2FBWC 1GN2A 1BCCJ 4B3MB 1PP9E 1ZRTE 3CLQA 1CI6A 2W27A 2YUAA 3P3PA 3H1IJ 1Y6XA 5AW3B 2XTAA 3K3WA 2CPBA 1IDSA 3F5TA 2WAMA 2DN9A 2IH3C 1N8RQ 3RFRA 4X1YA 2WA3A 5CCHA 4B7KA 3AG1C 1F51A 5KHKA 4FFBB 5DJUB 1N7SB 1DLBA 2R9IA 4YHHO 1PGQA 4CPGA 4I0XA 4XDLA 1S4XA 4QE9A 5CJ0A 2BE3A 3SR2C 5JH7B 3GF3A 3Q5SA 2N1TB 1DF5A 4X1KB 3CWBG 3CD6P 3E8BA 3OUFA 1WPXA 1GZLA 3X2QB 3AE8C 4DV7B 4KHPB 1YYCA 2G8YA 1HWYA 3V2PA 3A0RA 1H2SB 3FFQA 4CH3A 4D6TJ 5KJ7A 2YIAA 3AE5C 2EJRA 3ETEA 1JTHB 1RE3A 4KJMA 2ATKC 3AG2B 3K03A 3KYQA 4I50B 2WSFH 1S76D 2Z5IA 4MTGA 4DV0B 2VQEB 4WFHA 2LXCB 2GUSA 1GN3A 3OTOB 2E76D 1XTGB 3ZRVA 3B5NC 3B71A 4EFEA 5DJTB 1G2CB 1RF0A 2WSCH 2K9PA 3AE3C 2Y0DA 2A0LA 4PI0A 5JCOA 4X8AA 2BSKB 3L75J 2UXXA 4A5UB 4MVRA 4F6EA 5KKZC 2XU6A 4ZNCA 1L0ND 3Q2YA 3O65A 1S9KD 2WMMA 3PRJA 3SJBC 1JR9A 2NRGA 2CGNA 2HVJC 3CJHB 1Q90D 3JAMN 2JR8A 2JDIG 3H25A 3RVZA 2OYHB 2IZ0A 1WNSA 2ZT9C 1M7LA 3OE7G 3RBXA 3ZRWB 3H1LE 1F23A 1I94B 3F5HA 1K4CC 3FAVB 3JAWA 4KL1A 4HYTB 1FKAO 2HHHO 1QLED 4LR3A 1LUVA 1Q3EA 3HKCB 2LR2A 4W4KA 2N9BA 3UQ8A 2V4HA 5JQGB 1BDDA 1H0TA 2NPSD 1BQZA 4J80A 3JSLA 1Q6IA 2BEZF 4XE5B 1WP8A 3ZMVA 3FXDA 3MDSA 2W8ZA 3Q5PA 3ZHUA 2BASA 2KB1A 2DE0X 4BIOA 2QG4A 3UCSC 4HJGH 2XNDH 1XL6A 1Y74B 3N2GA 1XILA 2ILMA 3OGIB 4WF9V 5J9PC 3QWOC 4F4LA 2CTPA 1X4TA 4JPRA 4BWAA 4EB6B 4GZRB 3AEBC 2UUCO 2O1KA 2GTSA 4WFBV 5CJ4A 2H3OA 4DZOA 3KPEA 3WU2H 2Y4UA 4JI0B 1L2PA 3JD0A 1JY2O 3BY6A 1KB9I 4I1LA 1JY2N 1VQKV 1IK7A 2QWPB 1K5QA 2HP8A 2HLOA 2LW1A 3BRTB 5IJ0B 3TJTA 4DR6B 4DUYO 4QMAA 1BCCE 2PZSA 3A0BH 2Q5UA 1JJ2U 5KLVH 1JMBA 3QH9A 5B5EZ 3O9OA 3L73J 1NTKG 1YITP 5IJ9B 3VMXA 3P3NA 3GMAA 1BZKA 3SYCA 5CB4B 3G6EV 3K0GA 4IHJA 1SA0A 1ZLZA 2Q73A 4JI1O 1PPJE 1W2BU 3JD4A 4B3SB 3VN0A 3OW2O 1ZAUA 2HYNA 2B9ZA 4MW8A 3FB7C 2HFEC 3BA9A 5ITZB 1SQPE 3HRNA 1SQVE 2D2CB 1HGVA 1SESA 1U7MA 3L71E 4NPEA 3BRCA 2CTQA 3WFVA 3CC4V 4WCEV 3CXHI 3OEHG 1N4CA 2FYUH 2YMYA 1RE4C 1QR9A 4IL6H 1L0LH 5IYDO 1WAZA 3RW0A 4U3FD 3E83A 3MHSC 3AG3C 5B3SB 1M4UA 2Y0PA 1BE3H 1S72V 1FJGB 2BTQA 5JWPA 4LF6B 1GKFA 1URQA 1HR0O 2UXDO 4H44D 1Q7YQ 3JALB 1MFTA 4DO2A 4YIPA 1SF9A 4XDJA 5B5EE 4AUWA 1H88A 3OMIB 1P4RA 3LSQA 3PH0A 1MSDA 3P30A 2K9JB 3UIAA 1I7FA 4G28B 4YXDC 4TV9B 2I1KA 2FMLA 3TGUJ 3TGUE 3BEHA 2JK5C 5L3CA 2I1JA 3WUUA 3DC6A 2VRSA 3LDCA 5GONB 2OARA 1ZR4A 2QGNA 3CMEV 3JAWB 4DR7B 4DV4O 2FYUJ 4E4EA 1YJNV 5EC2C 1XDCA 3LDDA 1NTZJ 3RL0g 1EDLA 2W0FC 4BXLA 1AJPA 2W6AA 2MJZA 2AEMA 1LTBC 4EYYQ 2B89A 5E1AC 5AW6B 2A45G 3ZN1A 1HDJA 4YXWH 1RQUA 3WG7B 4N21A 4QPKA 1EXIA 1AP5A 3JALA 3K5BA 3MUDA 2VQEO 5B66H 1W2EA 3W7SA 4JI3O 5KX5B 3D70A 5LP6A 1XBLA 3U11A 1HNXB 3UO3A 5AVUB 5EIBD 5C39A 2Z3YA 3HKBB 1XNRO 2AW9A 3HD7D 2IFNA 3OGCC 5BU8B 2D2CC 2LW7A 3ABLC 1KILA 1OWAA 3CCLV 1VQ6V 2F4VB 1LNQA 2MW2B 2ZE8A 3LNNA 3P32A 4DR5O 1PFIA 4YY3B 4OX9O 2OYQA 1VF7A 3CX5F 2ITCC 4PV1B 4IIJB 3PLNA 2WSEH 3M7MX 3ZHTA 2ZM6B 1F4NA 2LGQA 1SQXD 1M57B 2P90A 4FZ1A 1X9VA 1N7SA 4BW5A 4R8CA 4FFBA 3L71G 5HFLA 1ZWIC 3A0HE 1US6A 2Q67A 1U7JA 1K7DA 4PD4H 3ZEDA 4WFGA 1E1QG 2WZ7A 1R1BA 2ZXWB 2RQ6A 1J5EB 1QL2A 1KECA 2N74A 2KLVA 2ZAEB 4PV1C 3RYIA 2QKSA 4L8JA 2YI9A 3FWLA 3O6QB 3OR7C 1LWUA 3LIDA 5BXZA 2YKPA 4UFZA 2QTOA 4JI6B 1PGJA 1AQTA 1ZSPA 1UIXA 5IJ0A 4X62O 4DV2O 3QG5A 1NJIW 3L71H 2Y0EA 4PD4D 1GO3F 5LHHA 3ZBHA 2HKOA 2WA4A 3VP9A 3AG2C 4I7ZB 1NQTA 3RK2C 4WVZA 3TGUG 4UVCA 4X20B 1AP6A 3B5NB 3CWBD 5H2FE 2F43G 2W83C 3RT3C 4DV5B 1VPCA 4JI5O 2EBOA 3LIEA 1EXJA 4GX5A 3MIWA 3VMZA 4FZ0A 3V2QA 4W7ZA 2F95B 3H1KJ 3LUTB 1IVSA 2QJYB 4I2LC 1JFFA 4N78E 3RL0D 1MZEA 3ZMUA 4IYIA 3AG4B 2WLHA 1SQVD 4DV6B 1GL2C 2OYHC 4NPDA 5DN6G 1KB9F 3AE9C 3TDKA 2EIJB 1MSWD 2EIKB 4NKGB 5AW7B 3FKSG 1NWQA 1UJWB 2YC0A 1QEXA 3H1JD 1MABG 4U3FJ 4KFMA 3CCJV 1SP4A 3D6ZA 3CXCU 1F4MA 4MTXA 3WB2A 1K04A 3KQGA 2HJFC 2JJ1G 2ZXEB 3CWBJ 1HJBA 4DR4O 1RM1C 2ODMA 1NTKE 3HUSC 1MKMA 3LW5H 1BSNA 2UU9B 1KKDA 2KXPB 4RO2A 4QJFB 2YNYA 5IY5C 3K04A 1PPJG 3BRVB 1N73B 5CMZA 5TISZ 3H1KD 1JFFB 3G67A 4QPJA 1M1JB 2CH7A 1Y47A 1KU9A 1XOUA 4JASA 4DXWA 4AQYO 4JV5B 1VF5D 1WN7A 3D8CA 1RE4A 2A7WA 4YJ3A 2ZDIA 2E75B 2EILB 1BHAA 1N7SC 3K08A 1S1CX 1Q5OA 4WB4A 2K9YA 3A8TA 4FVMA 1ZX3A 3DC5A 2OTLV 1NTMK 4OGQC 4WFFA 1S5LZ 1G8MA 5BU5A 3K57A 4U7OA 4JAAA 1FZFA 1TUBA 3Q5RA 3AK1A 5CCGD 4X62B 1BDCA 2XASA 2KQXA 4X1KA 1M56C 1N34O 1IBKO 5CCGA 1GK4A 3SJQC 1ZMEC 2LFRA 3ABLB 1ZXGA 3L4FA 5H2FH 1T2KC 1KQSU 3T1YB 2KS1B 1KN7A 3SDLA 4ASWA 1AR4A 4J41A 3DXRB 1GU5A 1SS1A 3H1LG 4CH5A 3O6QA 2WLNA 2JEXA 4UVBA 4LBEC 2WLIB 1IBMB 2UUBB 5FNVA 4IOIH 1CXZB 2L91A 1M9NA 2JEUA 1HUCA 1NTZD 4Y99C 5APTA 2IDBA 1EDJA 2QM4A 3T4DA 1VEWA 2RNBA 1EDKA 3II6A 2QWQB 1OCRC 4CBCA 4GYCB 2KSJA 3HTKB 1SETA 2FXPA 1W59A 1QLEC 1ZW0A 3ZMTA 1OZHA 1FZGA 3CMEP 4DCKA 3IGAC 1JVMA 1VQ9V 4GOFA 3HE5B 4DK1A 1BE3J 2QR4A 3ZX6A 4JZ2A 2UUAB 3K59A 1K92A 2RKLA 3HKBA 4JYYA 4LF7O 1MG1A 2M0BA 2GDSA 4OX9B 5APSA 1EN4A 3VQXA 1LGHB 5E79H 3EHBB 2QJKB 2OTKE 1S5LX 4Q6GA 1XI1A 2IJJA 2V7QJ 2F93B 1PP9H 4FPPA 3OW2U 5K1PA 3FYIB 1Y8AA 1NTMJ 1V9PA 3LSUA 3UKMA 4AQRD 1IFNA 4MVSA 2ZD9A 3AEEC 1FD9A 5E79Z 3M9HA 2QKCA 3VMYA 5A9GA 2DW3A 4PELA 3H1IE 2FYUG 5KX5A 5BY1A 2ADPA 2O01H 1YITV 4JI6O
chains in the Genus database with same CATH topology
1OW7A 3RK3E 1JB0J 5M1BA 4IL6X 1PV3A 4OGQB 3GMAA 3GF3A 3Q5SA 4TT3H 3AE8C 3AECC 2H89C 2D2CD 2G8YA 3C8VA 3SFEC 1VF5D 3AE5C 2E75B 4PV1B 2D2CB 2QSIA 1RQVA 1DD4A 1S1CX 3G9RA 2H88C 2K9YA 3ABVC 1GMJA 4I7ZC 3AEDC 2JO1A 4OGQC 2OQQA 1PIXA 1KMIZ 2E76D 3B71A 2MKVA 3D6YA 4Y28J 3AE3C 2ZT9B 4U7JA 5KLIC 3Q5RA 3AE7C 3T97B 1U57A 1ZP0C 1VL2A 2E76C 2E75C 4PV1C 5KKZC 4H0LC 3Q2YA 3Q3DA 2QJPC 1ZMEC 1WMKA 2QJYC 4H44D 1TU3F 2G3AA 2QJKC 1DD3A 2JP3A 3FGAD 2O01J 1NGMB 1Q90D 1UIXA 1NYHA 3H25A 2ZT9C 3O6QA 3S9OA 4R4MA 1KILE 4KT0J 2J5UA 4YXDC 3EWKA 2WSEJ 1FDOA 3AEGC 3GF7A 4H0LB 4R4LA 2IDBA 2P10A 2WSFJ 4GDOA 1OW6A 4I7ZB 4H44C 1VF5B 3GLMA 2YMKA 3AEAC 1OMIA 3AE2C 5L8RJ 2E75D 4PV1D 2WSCJ 4Z1MH 1KTMA 3D71A 2WQYC 3IAOA 3AE6C 2FXPA 3LW5J 2BEZF 2WPVB 3Q1MA 3Q5PA 4H13B 1KQGB 1ZOYC 2FYNC 4YTPC 3RL0g 4XFJA 1EXJA 2YIUC 2E76B 1KQFB 1DIPA 1R8EA 2E74B 1PL5A 4H13D 1FDIA 1AJYA 2E74D 1RQUA 3AEFC 1S5LX 2V7QJ 3IN6A 1EXIA 3AEBC 2BEQD 2ZT9D 3AE9C 2FBWC 4H13C 3R4YA 1Y9BA 1HF9A 1YQ3C 1ZRTE 2QIWA 3D70A 3AEEC 1KORA 2E74C 1IK7A 3D6ZA 1YQ4C 4RKUJ 1HJ0A 4H44B 1VF5C 3AE4C 1K04A 1K05A 3SFDC 1OW8A 3AE1C 4H0LD 1MKMA 4OGQD 2D2CC 2NZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSE J;  1JB0 J;  4Y28 J;  2ZT9 B;  4H0L B;  4IL6 X;  4OGQ B;  1S5L X;  5KLI C;  2WSF J;  4I7Z B;  1VF5 B;  5L8R J;  5KKZ C;  1ZRT E;  2QIW A;  2WSC J;  2QJP C;  3C8V A;  2QJY C;  3LW5 J;  2QJK C;  2WPV B;  2E75 B;  4PV1 B;  2D2C B;  4H13 B;  2O01 J;  2QSI A;  2FYN C;  4RKU J;  1Q90 D;  4H44 B;  2YIU C;  2E76 B;  2K9Y A;  2E74 B;  4KT0 J; 
#chains in the Genus database with same CATH topology
 4IL6 X;  1YI2 P;  4O9B A;  1H8H G;  1T5E A;  3D36 C;  4WFA V;  2IFM A;  3P8C E;  2PAJ A;  3MZW B;  2W6J G;  3UT5 B;  4DW0 A;  3K9S A;  2Q7G A;  2X6B A;  2X7R B;  2D2C D;  5LHG A;  1OIP A;  3B2E E;  1K73 W;  2K9J A;  3EFG A;  2CDY A;  1SQP J;  2HG5 C;  1VQ9 P;  3L73 D;  2FTK A;  5AW1 B;  4GKG A;  2Y0I A;  1V54 B;  5EZY B;  1Z56 A;  1RE3 C;  2HOD B;  1SQX K;  5GON A;  4LNU A;  1NTM H;  4TUY B;  4Y28 J;  2LFS A;  1BCC H;  2YID A;  1URF A;  3M06 A;  3C1L A;  1JY3 O;  4DJG A;  3OR6 C;  2FYN B;  1U57 A;  1SFC A;  5LOV A;  2QWN B;  2F66 C;  1AR1 B;  2Q4P A;  1RF1 A;  4TV8 A;  5GTH Z;  1Q8I A;  5BMV B;  1YIJ V;  2C2A A;  1KB9 H;  5EK0 A;  5B1A C;  1BMF G;  1LUW A;  1BGY E;  2O01 J;  4NXM B;  4I55 A;  3QO7 A;  1S77 D;  2Q68 A;  3WUT A;  1HGZ A;  1Y4M A;  1EZV I;  4J7Z A;  4IL6 Z;  4J7J A;  2QKA A;  2N1T D;  3SYA A;  4DV7 O;  2WLK A;  4HBN A;  2WSE J;  3CX5 D;  1WP7 A;  2ZCE A;  4B86 A;  4GDO A;  1OW6 A;  1YZB A;  4B08 A;  4IHJ B;  1M57 C;  5TIS H;  3OMA B;  1GM7 A;  2AEF A;  1OMI A;  5AVQ B;  2P7T C;  4UCU A;  2XAJ A;  1THZ A;  1KTM A;  5KAI H;  4O2A A;  4TT3 G;  1SVF A;  4LF8 O;  3S3X A;  1PKX A;  5EYP B;  4XDK A;  1FS0 E;  2R3S A;  1NH2 B;  5ITZ A;  1XMQ O;  4ICG A;  3L74 G;  1KQF B;  1SQQ D;  3ABM B;  3KZI H;  2A3Q A;  2JWA A;  3JAR B;  4DR3 B;  1WA8 A;  3NTN A;  5B5E H;  5BVZ A;  1LTS C;  3V5B A;  2QE7 G;  2H7H A;  1XNQ B;  2HG5 D;  3FB8 C;  3THO A;  3CRR A;  4LF8 B;  4X89 A;  2Q3E A;  3K5M A;  3U1A A;  1KD1 W;  1KP2 A;  2HFE D;  3HD7 B;  2QEX P;  1GMG A;  1GL2 D;  2ZIM A;  2HVK C;  3S1K A;  1AI6 A;  1CEZ A;  1E5W A;  3ABK B;  4EB6 A;  4JI1 B;  4JI4 O;  4LFC O;  1E1R G;  1XNQ O;  5KLV G;  1WT6 A;  3WU2 Z;  3L74 D;  2RCV A;  2NZ2 A;  3TNU A;  1VQO P;  1GD2 E;  1QLE B;  5BMV A;  2XT9 A;  4ZI7 A;  1OW7 A;  3GHG A;  1JB0 J;  3H1H D;  1H0T B;  5APQ A;  1VQ6 P;  2OCH A;  4LFB O;  1SFC C;  3SPC A;  1NHL A;  4BRY A;  1HNX O;  3PN1 A;  2CH7 B;  1M1J A;  2QM8 A;  5IT9 N;  4OXS A;  1D5N A;  2CTW A;  2K1A A;  5CN0 A;  1SS3 A;  4PD4 E;  3ZRW A;  4ZIB A;  3WU2 E;  2IJH A;  1URQ D;  4O4J B;  5L3G A;  2YI8 A;  4K8X A;  4QNH B;  2XZR A;  1YTZ T;  2YIB D;  2OYH A;  2B1I A;  4U3F G;  3CRQ A;  4JGS A;  5B1A B;  1XHX A;  2V7Q H;  3P7K A;  1PIX A;  4TQD A;  1E79 G;  2ADQ B;  4TLF A;  3H1L D;  1QX8 A;  3CCE P;  2YEV B;  1JPX A;  2O57 A;  1IBK B;  4JYB A;  4X1I A;  3SWK A;  3RBZ A;  1IFM A;  5AW4 B;  3CCV V;  5LGT A;  1LTJ B;  2E5L B;  3JAS A;  3ZHR A;  2ZFC A;  2BOC C;  4JTA B;  1N33 B;  5DM6 V;  3HKE A;  1GN6 A;  5LA6 B;  1TU3 F;  4BR6 A;  2QJK C;  1JA8 A;  1IFI A;  1EZV D;  1R3I C;  1P49 A;  4K8Z A;  4O4I B;  3A3Y B;  4GOE A;  5TIS E;  4A7P A;  4J11 A;  1R3L C;  5KLI B;  1K9M W;  1M5I A;  1KIL E;  1SQG A;  2R5B A;  1JQ0 A;  4X64 O;  3OAA G;  1FDO A;  2WPR A;  2AZ0 A;  2P2U A;  1OCO C;  1TGO A;  3PJS K;  1N7L A;  1CW5 A;  4UCS A;  3BAB A;  1MUU A;  4DRX A;  1ZN5 A;  4JYA O;  2CE4 A;  1RH5 B;  3AE2 C;  3L72 E;  3E1I A;  5L8R J;  1OX3 A;  1LTI C;  4TSF G;  3H1K G;  2HJD A;  3H1H E;  3ASO C;  1QVG O;  4OPA A;  1YBK A;  1JUN A;  1GK9 A;  4UUJ C;  2NPS B;  3BA8 A;  1M56 B;  2CAZ C;  2XUM A;  2F1M A;  2PUS A;  5K1X A;  1BS3 A;  1EZV G;  1LT9 C;  1VDF A;  5FLX N;  1NTM E;  1V55 B;  3MHH C;  4WBA A;  1K73 Q;  5D5P A;  1AJN A;  1CI6 B;  3M8A A;  4LGD E;  4HZ3 A;  1A02 F;  1KKC A;  4CZZ A;  2CPS A;  1S72 P;  1YEW A;  2Q69 A;  1SER A;  3CCV P;  3OEE G;  5CA1 B;  3R4Y A;  3CSX A;  4H13 C;  4I4T A;  1NU1 E;  2PGG A;  3TXS A;  2Q6Q A;  3SPJ A;  5FNV B;  3W68 A;  4QE7 A;  3RK3 C;  1JNM A;  1DX7 A;  4UB8 H;  2B87 B;  4NTX A;  4ABM A;  1QQC A;  2OCC C;  2YSU B;  3QNE A;  1ORQ C;  4HAM A;  3SFD C;  1L0L E;  4I4T B;  3AE1 C;  4UVA A;  1ZR2 A;  1TVK B;  4JF7 A;  2Y69 B;  4DV6 O;  1VQN V;  4DV4 B;  2Q9I A;  1GM9 A;  4LFC B;  3RK3 E;  2ARH A;  4KHX A;  2KSD A;  1FXV A;  1URQ C;  3DTU B;  3ZCC A;  1YTZ I;  5AVY B;  5KHH A;  1MOF A;  4JYA B;  3RK3 B;  1OFC X;  2FKW B;  2RN0 A;  4LF4 B;  3J7A U;  2BOB C;  3GG2 A;  4N78 D;  5LP6 C;  3KHU A;  1RM1 B;  1Q81 W;  1HWT C;  2QSI A;  3CCQ V;  3H1H J;  2WPS A;  3IFX A;  3ABT A;  2H88 C;  2OTL P;  1LR1 A;  1VIB A;  4FFK A;  4O2B B;  1NKN A;  4WY4 A;  2Y0C A;  2JDI H;  2DYR B;  3L74 H;  3L70 J;  4PJ0 Z;  1KYO H;  2K3R A;  4PJ0 H;  1HW7 A;  2HLD G;  1FZA A;  1XNR B;  2E42 A;  3SWF A;  2MK3 A;  5B66 E;  1N73 A;  1X79 B;  2A06 D;  2E76 C;  3SPH A;  4AQY B;  4F6R B;  2B88 A;  4FK5 C;  2LQT A;  3E89 A;  2K1E A;  4K35 A;  3RYH A;  3S3W A;  3E7K A;  2H8P D;  2G3A A;  2JKV A;  3EQ2 A;  2ZVO B;  1L0N H;  1OVU A;  4UXN A;  2JGU A;  3CCS P;  3EVK A;  1OCC C;  3T2M A;  5H6R A;  3FB6 C;  5B1O A;  4P9O A;  2M3E A;  5BR8 B;  4JI5 B;  3EWK A;  3PHL A;  3RK3 D;  2IM9 A;  2IBZ G;  2AZ2 A;  4X1I B;  3H1J E;  2P10 A;  2WSF J;  3JAK B;  2Q7C A;  1HNW O;  1NU1 K;  1EN6 A;  2W0X A;  1QU7 A;  4UB8 E;  2ZM6 O;  4RUF A;  5GW7 A;  1L0L J;  3E8G A;  2WSC J;  2YO2 A;  2O3J A;  2ZQM A;  1FZC C;  4B3R O;  2KP8 A;  5AW9 B;  1BE3 E;  1RSO A;  2DYS B;  4O4J A;  3TGU D;  4H37 A;  1KQL A;  1AQ5 A;  2FYN C;  4FM2 A;  3TF5 A;  3L70 H;  1S5H C;  1NT2 B;  4P2Z A;  3JAT A;  1YVW A;  3VP8 A;  1PL4 A;  4H13 D;  5KMG A;  1IXB A;  2IYO A;  2GV9 A;  3QF7 A;  2PI4 A;  3ZRX A;  1IZ3 A;  5KUM A;  3CCE V;  4K0K B;  2EJ7 A;  3OJA B;  1PM9 A;  5H9C A;  4ZHQ B;  5LMN B;  3BAT A;  1JY3 N;  2J58 A;  3SYO A;  3QVN A;  1N2D C;  1YIJ P;  4MN4 C;  1EFR G;  3L75 D;  5C8Y A;  3FYE B;  3K06 A;  2R5D A;  3P8M C;  1R73 A;  4N6J A;  3TSI A;  1IK9 A;  1PNK A;  1SZX A;  2XAQ A;  3L70 D;  1QBZ A;  1TA8 A;  2KB7 P;  3KZI E;  1XMO O;  4O2B A;  4WY4 B;  2M5A B;  3CX5 I;  2K37 A;  4DV1 O;  3CC2 V;  1KIL C;  4JI7 O;  5CBH A;  5KAF H;  1NTZ H;  1YJ9 V;  4NXN B;  5LMN O;  3TYY A;  3OD4 A;  4LH7 A;  2C0W A;  3SWY A;  2KNC B;  1K9M Q;  2E3C A;  4G27 B;  2WIT A;  2GA1 A;  4TQF A;  2N05 A;  1KYO E;  1NTZ E;  3H6P A;  1M1K W;  2O01 N;  1PD3 A;  1S2E A;  4HKZ H;  2OYI B;  1Z5V A;  2P4V A;  1L0L D;  2JO1 A;  3L37 A;  2BCC H;  3RYC A;  1GU4 A;  1P84 F;  1SQQ G;  3DGE A;  1S9K E;  3N4X A;  1QR8 A;  3EFF K;  5JVD A;  2YIC A;  2QRX A;  3M0A A;  3ITK A;  3RL0 C;  4O4L A;  2BTO A;  3M9Q A;  4EKW A;  4OWF A;  3B8M A;  2UXB O;  2EIL C;  1NTK J;  4Y99 B;  1GTO A;  4AI8 A;  5AW2 B;  4MVQ A;  3APO A;  2JP3 A;  1LJ2 A;  4DT0 A;  1PPJ H;  5L3D A;  4C7R A;  5LGN A;  2Q9L A;  5KJ7 D;  3TXQ A;  5IYZ B;  4JI8 O;  4KHP O;  3H32 B;  1NVP D;  2Q6A A;  3K5O A;  1NR7 A;  2BCC G;  5LP6 B;  2M7W A;  3N2K A;  4PA4 A;  1EQ7 A;  4GX1 A;  1S5L H;  1BGY D;  5KUK A;  1N8R W;  3MUD C;  3RGB A;  1AJQ A;  1VF5 B;  5CBG A;  4LF7 B;  4H44 C;  3CHX A;  1CZQ A;  2YMK A;  3H1K E;  5JQG A;  3CD6 V;  2E75 D;  3JCU Z;  1UII A;  5FPO A;  1VQM P;  4RWU A;  4K0K O;  5H5N A;  1SRY A;  2CTR A;  3L73 H;  1JM0 A;  2E5Y A;  1ZLL A;  1NAY A;  1AV1 A;  1P84 I;  1SFC B;  1I5X A;  2UWJ E;  2HPC B;  2OTJ P;  2E43 A;  3O8Z A;  4GIF A;  5L3F A;  1P7G A;  2LXB A;  3U10 A;  5KAF E;  1AJY A;  4LNU B;  1ZL8 A;  4YJ2 A;  5GTH E;  1KV4 A;  3KCX A;  1K4D C;  4TOI A;  3A0H H;  1W2B O;  2DOS A;  1FJG O;  2BEQ D;  1KC8 W;  4B3T O;  1N32 O;  4EIJ A;  2ZDI C;  2DJV A;  3KZI Z;  3T4Z A;  3A0B Z;  2QIW A;  3TGU H;  2VS0 A;  4IFM A;  1ZL8 B;  4L75 A;  1Y66 A;  5AVW B;  3FB5 C;  3N27 A;  3CI9 A;  2IU3 A;  4UB8 Z;  5CA3 A;  4D6T E;  3RK2 B;  3J81 N;  3QO8 A;  1NTK K;  4UV8 A;  1LP1 A;  1IFJ A;  2WSS H;  3KKY A;  3JD1 A;  1YI2 V;  1WB7 A;  3NXS A;  2Q5Z A;  1JTH A;  5EC1 C;  2P06 A;  3Q4H B;  3OM3 B;  4ZMD A;  4PHZ A;  4X65 O;  3CWB E;  2KZJ A;  4ZOL B;  1SFC D;  1IO4 A;  5CA0 B;  5AW8 B;  5JH7 A;  4U3F E;  3AG7 A;  3OT7 A;  3CB2 A;  4C7N B;  4UV9 A;  3ETD A;  1QNM A;  1F7Y A;  1JJO A;  5EBW C;  5GTI Z;  2EIK C;  2Y9Y A;  5E79 E;  4RJT A;  1HVV A;  1HNZ O;  5AVV B;  1VF6 C;  4PDL A;  5JVD B;  2JGD A;  1XEQ A;  4W7Y A;  5KA6 A;  1QHT A;  1ZV8 A;  3A2A A;  3EXA A;  3H1L J;  1P7B A;  4GX2 A;  2R9R B;  2P67 A;  2H43 A;  2OYO A;  2QTS A;  3CS5 A;  4H0L C;  3JC2 2;  1PP9 D;  5EBM C;  1ZRT D;  2FFD C;  1BSM A;  1RHZ B;  1BGY G;  4RQE A;  1D2D A;  4DR7 O;  2Q0A A;  2V1D A;  3QO5 A;  3VBB A;  2OT5 A;  5CBF A;  2O1J A;  3QTC A;  2A45 I;  2RH0 A;  1VMG A;  1TUE B;  3ICX A;  2XHB A;  3JAR A;  5BR8 O;  1R6N A;  4JZG A;  1CP9 A;  2ZE6 A;  1SQB K;  5IWA O;  2WWW A;  2FXO A;  1DEB A;  3CCU V;  3H1H H;  1N36 O;  3BVH A;  3ABM C;  2B5U A;  1LTA C;  4H0L B;  3NFQ A;  3K0D A;  4JPZ B;  2UUA O;  2W6B A;  3I55 V;  2ZVN B;  4CH4 A;  1FFX B;  3LDE A;  3N2G B;  4NYK A;  5EBL C;  2H94 A;  5CMU A;  4RQF A;  2Q0O C;  2UU9 O;  1RY3 A;  1FYJ A;  2XV5 A;  4U3J B;  2XDJ A;  2E76 B;  1N73 C;  1OZ0 A;  1HNW B;  2XND G;  3CPW O;  1OCO B;  4LCU C;  3CC4 P;  2ITA A;  4HNA B;  3G80 A;  4I9Q A;  4LFA O;  4I55 B;  1ZUQ A;  2XAG A;  2IX7 C;  1J1E C;  1AI7 A;  1QVG U;  3FAV A;  2KZI A;  1SQV H;  4MTF A;  2Z5U A;  4FLV A;  2DYR C;  2RDC A;  3DSQ A;  2ZKO A;  4D6T G;  5B1B C;  1N86 A;  1OHH G;  1NU1 G;  1RSO B;  3OTO O;  1MFZ A;  2UUC B;  1CSB A;  1FE6 A;  2Z0A A;  2HOD A;  3ASN B;  2LO1 A;  1OW8 A;  5AG2 A;  4H0L D;  4BIU A;  5IWA B;  4N23 A;  4IFF A;  2YIB A;  1FZC B;  3VOU A;  1GH6 A;  3R2P A;  2DMX A;  1WPB A;  2P1J A;  1QGK B;  3BCC E;  1FXK C;  4RES B;  2X6C A;  1NTZ K;  1H2M A;  3IC9 A;  4J9Z B;  1L8D A;  1SQB J;  2IYP A;  2L5G B;  3AG3 B;  3SFE C;  1JX9 A;  2VQF B;  5AVS B;  1HBW A;  2DW4 A;  1IBL O;  1M57 D;  2Q3I A;  2XNX A;  1NTZ G;  1EC5 A;  4I7Z C;  1I94 O;  3ABV C;  1GL2 A;  3M0D C;  1K8A Q;  1SQB E;  2XOK G;  1I5Y A;  1K34 A;  1KMI Z;  5KHG A;  4JI7 B;  1JCC A;  2SPZ A;  3D6Y A;  3RYH B;  3BCC J;  5L3B A;  4FLY A;  1G2C A;  2KI7 B;  2PI5 A;  1BT8 A;  2I8D A;  3T97 B;  2V4D A;  2YIU B;  1AFO A;  1ZP0 C;  4ZKU A;  4JI8 B;  1H8A A;  2F23 A;  2JS5 A;  4FLT A;  4QGP A;  4P30 A;  3WB0 A;  2C9N Y;  4OPH A;  1VQ7 P;  1KZU B;  2YS8 A;  2IJK A;  3CCS V;  3A5T A;  4OH8 B;  2V7Q G;  5HFM A;  5GTH H;  4NR1 A;  4UB6 Z;  1HH0 A;  3L70 G;  1RPO A;  1R3J C;  2VWJ A;  1U96 A;  4HYO A;  1TVK A;  3GLM A;  5APV A;  2IJI A;  1Y76 B;  1L4A D;  1H2L A;  3WG7 C;  1BE3 G;  4GKK O;  4X66 B;  3BFR A;  1W5C E;  2WPV B;  3L35 A;  3KDP B;  3Q1M A;  3L75 H;  4L87 A;  3MAQ A;  1IJD B;  1PL0 A;  1SQQ H;  2QA4 V;  1PZQ A;  1SQX E;  4FLU A;  1DIP A;  4CS3 A;  3BCC H;  5CA1 A;  3HD7 C;  1WB8 A;  1L0N E;  1PL5 A;  2KIK A;  1B3Q A;  4BW9 A;  1FDI A;  3BAA A;  1M90 Q;  2GUV A;  4GLX A;  3ZHV A;  3ASN C;  2BCC J;  3IN6 A;  4PDV A;  2A06 H;  4RAI A;  2P4K A;  3R65 A;  1N34 B;  1V54 C;  1QLN A;  1HNZ B;  1Y9B A;  1IX9 A;  4ZOL A;  2FB5 A;  5FL7 G;  1KOR A;  4W4L A;  2YXR B;  1TUB B;  1NTK H;  3JYC A;  2OWO A;  1YQ4 C;  2QE7 H;  2WLJ A;  4CC6 A;  4DV5 O;  1GL2 B;  2R32 A;  3L75 E;  1IFD A;  4G2K A;  5IYC O;  1RFY A;  1LP1 B;  5CA0 A;  2L6L A;  4NVP A;  5EFW B;  4DRX B;  2ZJS E;  1NJI Q;  2KG7 B;  1NOH A;  4DR1 B;  2EZO A;  3ETQ A;  2AHY A;  4B3R B;  2WLL B;  1U97 A;  4UCT A;  1AR5 A;  1MA1 A;  2EIM B;  3SPI A;  4DV3 O;  3B5N D;  3B8N A;  2OTJ V;  1SQB G;  4B3M O;  3C3T A;  2ZYG A;  2ZE5 A;  1K5S A;  1PPJ D;  3KG2 A;  3U1C A;  2OQQ A;  4J9Y B;  1FFT B;  4UCO A;  3TK1 A;  1IBM O;  2ZE7 A;  2UUB O;  1KB9 E;  2G38 A;  2FYU K;  3G71 V;  5IE9 A;  1VQ5 V;  3G71 P;  2JRI A;  4LF6 O;  2HPC A;  4O4I A;  3GVM A;  1BCC D;  2EIM C;  2EZP A;  5J2U A;  3G4S P;  1AI5 A;  4EI2 A;  4IL6 E;  1QCE A;  4X64 B;  1NAF A;  3F7V C;  2C9L Y;  3JAS B;  1J1E B;  4LP8 A;  5CBO A;  1YXB A;  5LYJ B;  4L76 A;  2AGA A;  1FPO A;  3ASO B;  4FLX A;  1L4A C;  1NKZ B;  3MTU E;  3CX5 H;  5JJN B;  3CCL P;  2DQ0 A;  2IU0 A;  1QVF O;  3H9V A;  4LF9 O;  2UXN A;  2X6A A;  1J1D C;  1Q86 W;  3L70 E;  3H32 A;  1NZ6 A;  1OVR A;  4CS4 A;  4DK0 A;  1G6U A;  4FMT A;  3D71 A;  2PFX A;  3AK3 A;  3RN4 A;  4ZI7 B;  3GHG B;  4AIL C;  4JYC A;  1S5L E;  4LF5 O;  3CCQ P;  4PA3 A;  1SQF A;  3HD7 A;  2VWK A;  1FXK B;  5JCO C;  3H1H G;  5BZB A;  1NTM G;  2E74 B;  1GRJ A;  3HKD B;  1SQB D;  5B66 Z;  1KIL D;  4PDM A;  4FM1 A;  1R5S A;  2P5O A;  3TNU B;  1N36 B;  1FOS E;  3FD9 A;  2QM7 A;  5AVX B;  3C9I A;  4PI2 A;  4LLH A;  1SQV K;  3HUS B;  4I6M C;  2GTA A;  4MW3 A;  3L73 E;  3CCM P;  4UCV A;  1MZ9 A;  1KP3 A;  4QIW F;  3W7U A;  1K8A W;  3RYI B;  1L0N J;  4DV1 B;  2UXC B;  1XTC C;  4Q20 A;  2PYJ A;  3OFN G;  2JWD A;  1VQ7 V;  2AXC A;  4ZKP A;  3CXH F;  3S4R A;  4LFA B;  3C3S A;  3A7O A;  1PP9 G;  3BCC D;  2FYU E;  2AXT Z;  2OIE A;  4NXM O;  1AB3 A;  2QEX V;  1NVO A;  1N7S D;  5KLV D;  2ETN A;  3U59 A;  2KNC A;  3F7Y C;  1FXK A;  2H8P C;  5CB4 A;  3JSN A;  1JEK A;  1K05 A;  3JD3 A;  1OVV A;  1Q6U A;  3IF4 A;  3UO2 A;  1LTT C;  4KP4 A;  1KFN A;  2YKQ A;  4OGQ B;  2RMK B;  2IZ1 A;  3FX0 A;  4UB6 H;  3E1R A;  4JAV A;  4DR4 B;  2UXB B;  2GUZ B;  1VF6 A;  3AEC C;  1FU1 A;  1RF0 C;  4DV0 O;  2WPQ A;  4CC5 A;  1SQQ J;  2C0X A;  4LH6 A;  2M8R A;  3IJ4 A;  3RYF B;  3L36 A;  1RQV A;  1KIL B;  2CK3 H;  1GN4 A;  3JD2 A;  1SQX H;  2PTM A;  2NLJ C;  1XL4 A;  3M91 A;  4EEQ A;  4C7N A;  1L1F A;  1YHQ P;  1PGO A;  2N1T C;  2WLM A;  2PGD A;  4EOT A;  4BAY A;  2R44 A;  1USD A;  1UFI A;  4DR6 O;  2A79 B;  3Q4H A;  3JAT B;  5LOV B;  1YTF B;  4FJC C;  2ZNJ A;  3VQY A;  2E75 C;  3HR0 A;  4DR5 B;  3ZS8 C;  1M90 W;  2ZIO A;  4J10 A;  2P58 A;  1V55 C;  4DV2 B;  1SQV J;  2JJL A;  3V4W A;  1WRG A;  3USS A;  3TET A;  5CCH C;  4YJ2 B;  1NGM B;  3HKC A;  5EZY A;  4IYH A;  4BIZ A;  1NYH A;  3OTF A;  3JAK A;  1VP7 A;  3CRM A;  1L0N K;  4L74 A;  4GUN A;  4IT5 A;  4MVZ A;  2XKM A;  1S0V A;  2IBZ E;  2P7J A;  2Q1K A;  3SJA C;  4X66 O;  3IR9 A;  2BCC E;  4E2L A;  3ABU A;  1DEE G;  4NB5 A;  3AEI A;  3VQW A;  4B7E A;  3B40 A;  4IGG A;  4DV3 B;  4LF9 B;  4FLZ A;  1H2N A;  1DTO A;  1AVY A;  1FS0 G;  3WB1 A;  4Z1M H;  3I55 P;  1DF4 A;  4YY3 O;  1SQX J;  4JAU A;  3A0H Z;  3B77 A;  4WBN B;  3L72 G;  2DWD C;  1LT9 A;  4C46 A;  2RN9 A;  3UT5 A;  4DR2 B;  1Y67 A;  2HHH B;  4F6R A;  3M99 B;  1E79 H;  5AW5 B;  3H1I D;  1KBH A;  2XAH A;  1SQQ K;  4Z1V A;  4AHC A;  4JI0 O;  1Q6H A;  1NTM D;  4HH2 A;  1YTF D;  4PD4 I;  4X88 A;  2E74 D;  1NBM G;  2N1T A;  1OCR B;  1GM8 A;  3AG1 B;  1WLE A;  3H01 A;  4LC1 A;  4I50 A;  3STL C;  3VTP C;  5LXT B;  3SYQ A;  4JI4 B;  2E5L O;  1FC2 C;  1FBM A;  1NR1 A;  4GKJ O;  4DR2 O;  1RP3 B;  1T6A A;  2ITD C;  4GOD A;  2WVR A;  1B06 A;  1ARO P;  1BCC G;  2IBZ I;  4YXW G;  1IFP A;  1AVM A;  2A45 H;  5IYZ A;  1QVF U;  2ZXW C;  3ML0 A;  2GBO A;  4GT1 A;  3RYC B;  1NI8 A;  3NR7 A;  2J59 M;  2RMZ A;  2PRR A;  3CL3 D;  4KUM A;  1SQP D;  3HTK A;  4JQ0 D;  1JY3 P;  2FFD A;  3CC7 P;  3V2N A;  3B09 A;  1NS1 A;  4O4L B;  1GAX A;  1USE A;  1JMK C;  3H1K H;  2WLI A;  3ZIA G;  1BGY H;  1IZN B;  1VQ4 V;  1BQ0 A;  2E5T A;  4C7U A;  1Z5W A;  3V2R A;  5LHI A;  3AG4 C;  1T3J A;  3CRA A;  1AIL A;  3L71 J;  5IYB O;  2KS1 A;  1NH4 A;  1EZJ A;  1Q86 Q;  1DD4 A;  2FFD B;  1BL8 A;  1K3E A;  3W7W A;  5FPR A;  1AI4 A;  3DXR A;  2QWO B;  4JI3 B;  5J2T A;  1A32 A;  2KSE A;  3AED C;  2XAF A;  3CPW U;  3SJC C;  2KKW A;  5JJJ B;  1NH2 D;  1NU1 D;  4YHH B;  2JIZ G;  2Q7E A;  1BSH A;  3A0B E;  3CCM V;  1JCD A;  4K3A A;  2OCC B;  1KYO F;  3D36 A;  5GTI H;  1VQL V;  3G6B A;  2NPS A;  3ZMZ A;  2Y69 C;  4GX0 A;  3TCU A;  3Q3D A;  2QJP C;  1WMK A;  3SGI A;  4X9Q A;  4O4H A;  1DD3 A;  3LSS A;  5IDJ A;  4ASV A;  3E86 A;  5C93 A;  1T3U A;  5JJE B;  3T97 A;  4L73 A;  3HE4 B;  1QL1 A;  5B3S C;  1HR0 B;  3JSV C;  3L72 D;  1YJ9 P;  2J5U A;  3WUV A;  4DUZ B;  2WT7 B;  2EUL A;  3JCU E;  5AW0 B;  1CPY A;  3CCR V;  3CC7 V;  3L74 J;  1UPG A;  3AEA C;  3CRC A;  4ZBM A;  4MTO A;  2KYV A;  5KTB A;  4JTD B;  1H38 A;  5LA6 A;  1N0J A;  3ZRS A;  1OXZ A;  2AEJ A;  5APY A;  1T2K D;  1EZV E;  3VOP A;  4YTP C;  1YHQ V;  3HB3 B;  1LTJ A;  3ZHQ A;  3E8F A;  1GW4 A;  2K88 A;  1DGS A;  3L72 J;  2IBZ D;  1VQ8 V;  2LKM A;  3GB7 C;  1SQX G;  1FZC A;  3H1L H;  2JJ2 G;  3CJH A;  1KYO I;  2R3C A;  3PP5 A;  1SQP K;  1K33 A;  2JEE A;  3CE2 A;  2JVD A;  1XMQ B;  2OGU A;  3P8C D;  4N3Y B;  3CP1 A;  4R50 A;  2ZT9 D;  2AHZ A;  4MVU A;  3H1J H;  5APW A;  2WT7 A;  5APX A;  3SSU A;  3OA7 A;  4KXR A;  2PF4 E;  2LGW A;  1IBL B;  1DH3 A;  4MVO A;  1J1D B;  1GDT A;  4MT8 A;  2YEV A;  4H44 B;  1VF5 C;  3NMD A;  3OUS A;  3D3Q A;  4OVN F;  3AE4 C;  4U3J A;  1D7M A;  3KXD A;  2ZXX A;  4X20 A;  4O4H B;  3H1I G;  2VQF O;  3CCU P;  3BAS A;  3GHG C;  5CCH D;  2P22 C;  3J80 N;  1FFX A;  1RF1 C;  3CXH E;  3CMA V;  4YIO A;  3N7N A;  3A2F A;  1OCC B;  4HNA A;  3L9D A;  1IC2 A;  2LP7 A;  1VQM V;  2QJ1 A;  1W0J G;  1SQV G;  2KUB A;  1B6Q A;  3SYP A;  3B8E B;  3B5N A;  1PNL A;  3GW6 A;  2L35 A;  4DW1 A;  3VMA A;  3M0D A;  5KKZ B;  4I0X B;  2YXY A;  1GMJ A;  2YXQ B;  1SLQ A;  4R6Z A;  3RGU A;  1JCH A;  4NXN O;  1SKV A;  4R7C A;  1NKD A;  1S5J A;  1YJW P;  1KD1 Q;  2VRZ A;  2DWE C;  2ZT9 B;  4GKJ B;  3F89 A;  2GSM B;  3H1J J;  4U7J A;  5AVZ B;  1XUQ A;  1VQP P;  1VQ5 P;  1VQL P;  5A2Q N;  1VQP V;  1B04 A;  2P6J A;  2GHY A;  4D7T A;  5J2T B;  4GCZ A;  3UM7 A;  4EFB A;  2QJY C;  1KB9 D;  1LWU B;  3CYO A;  4O2A B;  4JI2 B;  1H8E G;  4PA9 A;  2NN4 A;  3HUS A;  3GWO A;  3T1H O;  2Y9Z A;  2CGO A;  4ASU G;  4LF4 O;  1KFM A;  1PP9 J;  2ZR2 A;  2B9B A;  1JMM A;  3S9O A;  1VQO V;  1M8O B;  4R4M A;  4IFD K;  2D3O W;  2ZYA A;  2YDE A;  1VQN P;  1KQS O;  1SQB H;  1NU1 H;  1FDM A;  2JGD B;  3E22 A;  3K79 A;  1Q82 W;  2FY8 A;  1D5A A;  3K58 A;  5LXT A;  2A06 E;  1R5L A;  4IIJ A;  1MMM A;  4LWS A;  2ZIN A;  3CWB H;  3IAO A;  3MP7 B;  1YSC A;  2W6J H;  3LW5 J;  2LJ2 A;  2QDO A;  1I08 A;  4H13 B;  1ENV A;  1X0T A;  1ZOY C;  3RL0 B;  2QA4 P;  1FAF A;  2FYZ A;  4JBZ A;  4XFJ A;  1EBO A;  1H2K A;  4PD4 F;  4XBF A;  4RUE A;  3CXH H;  1R8E A;  1PNM A;  3CEI A;  4WBN A;  3L74 E;  4FIP C;  3T1Y O;  1Q81 Q;  1TAE A;  4PDR A;  5K5G B;  3G3Z A;  2PP6 A;  3SPG A;  3ETG A;  4D6T H;  1JOC A;  1OCZ B;  3E35 A;  4FM0 A;  1XMO B;  2OYI C;  1I0H A;  2DYS C;  1M93 A;  1N0N A;  1RF1 B;  5J2U B;  2PYL A;  4D7S A;  1YQ3 C;  5KAI E;  4CH6 A;  4BWN A;  1VQK P;  1LT1 A;  2WPD G;  2E74 C;  1LT9 B;  2YO3 A;  3T1H B;  1L0L G;  5KLV E;  1O9H A;  1O9G A;  1GW3 A;  1HJ0 A;  4RKU J;  1NU1 J;  1WJZ A;  1EZV H;  1MV8 A;  1EN5 A;  1R3K C;  4OGQ D;  3BCC G;  5LBQ A;  3HKE B;  2W6I G;  5LMU O;  1AA0 A;  1J95 A;  2QVA A;  5M1B A;  3G6E P;  4GKK B;  5KAI Z;  1PV3 A;  3L75 G;  4YPC A;  5AVT B;  5KLV K;  4W80 A;  4HB1 A;  5CCG C;  2R70 A;  5CBN A;  5LGU A;  3CCR P;  4NTY A;  1MZF A;  4BRY B;  2OIG A;  1ZTE A;  1SZT A;  4DYL A;  2Z4E A;  1VQ4 P;  4FLW A;  4JI2 O;  2UXD B;  2Z5H A;  3FWN A;  2X0L A;  1X8Y A;  1P84 H;  2ZYD A;  1URQ B;  4CS2 A;  2BTQ B;  3JCU H;  4LWS B;  4DR3 O;  4WFE A;  4TV9 A;  4LFB B;  2ZNI A;  5KJ7 C;  3N2K B;  5B1B B;  2CK3 G;  2B1G A;  2IW5 A;  3IFM A;  5KLI C;  5D5Q A;  3I5C A;  3E22 B;  2YKO A;  3V4Q A;  3ABK C;  1P84 E;  3FXE A;  3F5W C;  2AXT E;  3VQV A;  4UB6 E;  4Z2W A;  3MD0 A;  2HR3 A;  1FJP A;  1YDX A;  4PA7 A;  3ZHS A;  4JF3 A;  1NVP B;  3RYF A;  2PY5 A;  1SC5 B;  1JO5 A;  3CCJ P;  1OJH A;  1GK6 A;  2WSS G;  1G1J A;  3X2Q C;  1FOS F;  1J5E O;  4M3L A;  5CHX A;  2GUZ A;  3WMM 0;  1NTK D;  3OAK A;  2EIN C;  4U3F H;  2YXL A;  5DED A;  1G1X B;  4TWK A;  1H2G A;  1Q2N A;  4KT0 J;  1H89 A;  4LF5 B;  4DR1 O;  3CC2 P;  5AVR B;  3BHP A;  1BE3 D;  4RO0 A;  5IJ9 A;  2FYU D;  4R4L A;  1L4A A;  1LTG C;  4NTW A;  2FL4 A;  2F4V O;  2OYI A;  1N33 O;  3JCZ A;  1SA0 B;  1AVO A;  5GTI E;  5L3E A;  1MNG A;  4PJ0 E;  4PV1 D;  1Y76 A;  2GM4 A;  2WQY C;  3BPZ A;  1G4Y B;  1WA8 B;  3W67 A;  5KLV J;  2N9Y B;  1L4A B;  2Y4T A;  1BGY J;  2KLU A;  2RJZ A;  1S3J A;  1KQG B;  3APQ A;  1YJN P;  4DUY B;  1HTL C;  1EM1 A;  3RWR D;  2R72 A;  4JV5 O;  3R66 A;  2Q7H A;  3ZMS A;  2Y48 A;  2QSA A;  5EYP A;  2M3B A;  2QJP B;  1M56 D;  3IC7 A;  3L73 G;  5C8Y B;  5LMU B;  1M1K Q;  1L0N G;  3CX5 E;  1ROP A;  4PA6 A;  3IAY A;  3AEF C;  4WY4 C;  3C90 A;  5B1N A;  1COW G;  4J42 A;  5KHI A;  5KHJ A;  5TJH A;  1SQP H;  1Y74 A;  3G4S V;  1K97 A;  5KAF Z;  3HKD A;  3AK2 A;  1HF9 A;  3D3I A;  2M5A A;  4X65 B;  2M6Y A;  2Q8V A;  3K5N A;  1PGP A;  3PTZ A;  4J7K A;  4MVM A;  3K9A A;  4P9P A;  3CXH D;  2KOG A;  1GTW A;  4TUY A;  5LYJ A;  4ZHQ A;  3I5D A;  3M9B A;  4MS2 A;  4XA4 A;  2QWR B;  1PV0 A;  1KUQ A;  3BVO A;  5H6Q A;  1FJK A;  2ZR3 A;  1XQ8 A;  1LWU C;  5KMG B;  3B4S A;  1R6K A;  2DQ3 A;  4TV8 B;  1RPR A;  5APU A;  2EIJ C;  1BHB A;  4YJ3 B;  2NPS C;  4D6T D;  4UCR A;  4TT3 H;  3VYI A;  1HP8 A;  1T8Z A;  2IH1 C;  2A9H A;  2HEP A;  1SQP G;  2H89 C;  4U7N A;  3C8V A;  1X59 A;  4NPF X;  1NO4 A;  3LNM B;  2W90 A;  1Q82 Q;  2FKX A;  3W7T A;  1Q43 A;  3G9R A;  3E2E A;  3GWK C;  4WWI A;  1SQQ E;  4JTC B;  5IY5 B;  1L0L K;  2WLL A;  4I9W A;  3MHV A;  2NNU A;  2MKV A;  2UXC O;  1KYO D;  2POH A;  5H2F Z;  1X22 A;  1FAV A;  1M1J C;  3L72 H;  2CUG A;  4EDF A;  1XHZ A;  2EIN B;  3ZJZ A;  3AE7 C;  4ZKI A;  2BSK A;  4AYC A;  3RVY A;  2NR5 A;  4Z1M G;  1VL2 A;  1JOY A;  5F2V O;  3V6I A;  2R9A A;  3I56 P;  1FXH A;  3MGN A;  3K5L A;  3FGA D;  3I56 V;  4MSW C;  4WY4 D;  1Z2G A;  2IBZ H;  3ZDM A;  5LL6 Y;  3U0Z A;  1KC8 Q;  1OCZ C;  3STZ C;  3H1I H;  1P84 D;  2KK7 A;  3E8H A;  1YCI A;  3T1C A;  1JY2 P;  2KG7 A;  3RK2 D;  4B3S O;  1FZE A;  3AEG C;  3GF7 A;  3CMA P;  3HE5 A;  5DEC A;  3HE4 A;  1DK1 A;  1IUR A;  3H1J G;  1VAR A;  2YXH A;  2WTY A;  2A06 G;  3AE6 C;  1FZB A;  1W0K G;  1G1I A;  1OV9 A;  2IPP A;  4I5S A;  3L71 D;  1YF2 A;  2YIU C;  3HPL C;  4X1Y B;  3W7X A;  3KCY A;  1LTJ C;  4B3T B;  2JS3 A;  4DUZ O;  1YJW V;  1N32 B;  4DOJ A;  2EX3 A;  3FX7 A;  1J2J B;  1VQ8 P;  1Q7Y W;  1XRE A;  2BCC D;  1R6T A;  3ZN0 A;  1IXM A;  2N04 A;  5EIB C;  2FXM A;  1A02 J;  1EDI A;  3OMN B;  2AXT H;  5KA5 A;  2B87 A;  4H33 A;  2FBW C;  1GN2 A;  1BCC J;  4B3M B;  1PP9 E;  1ZRT E;  3CLQ A;  1CI6 A;  2W27 A;  2YUA A;  3P3P A;  3H1I J;  1Y6X A;  5AW3 B;  2XTA A;  3K3W A;  2CPB A;  1IDS A;  3F5T A;  2WAM A;  2DN9 A;  2IH3 C;  1N8R Q;  3RFR A;  4X1Y A;  2WA3 A;  5CCH A;  4B7K A;  3AG1 C;  1F51 A;  5KHK A;  4FFB B;  5DJU B;  1N7S B;  1DLB A;  2R9I A;  4YHH O;  1PGQ A;  4CPG A;  4I0X A;  4XDL A;  1S4X A;  4QE9 A;  5CJ0 A;  2BE3 A;  3SR2 C;  5JH7 B;  3GF3 A;  3Q5S A;  2N1T B;  1DF5 A;  4X1K B;  3CWB G;  3CD6 P;  3E8B A;  3OUF A;  1WPX A;  1GZL A;  3X2Q B;  3AE8 C;  4DV7 B;  4KHP B;  1YYC A;  2G8Y A;  1HWY A;  3V2P A;  3A0R A;  1H2S B;  3FFQ A;  4CH3 A;  4D6T J;  5KJ7 A;  2YIA A;  3AE5 C;  2EJR A;  3ETE A;  1JTH B;  1RE3 A;  4KJM A;  2ATK C;  3AG2 B;  3K03 A;  3KYQ A;  4I50 B;  2WSF H;  1S76 D;  2Z5I A;  4MTG A;  4DV0 B;  2VQE B;  4WFH A;  2LXC B;  2GUS A;  1GN3 A;  3OTO B;  2E76 D;  1XTG B;  3ZRV A;  3B5N C;  3B71 A;  4EFE A;  5DJT B;  1G2C B;  1RF0 A;  2WSC H;  2K9P A;  3AE3 C;  2Y0D A;  2A0L A;  4PI0 A;  5JCO A;  4X8A A;  2BSK B;  3L75 J;  2UXX A;  4A5U B;  4MVR A;  4F6E A;  5KKZ C;  2XU6 A;  4ZNC A;  1L0N D;  3Q2Y A;  3O65 A;  1S9K D;  2WMM A;  3PRJ A;  3SJB C;  1JR9 A;  2NRG A;  2CGN A;  2HVJ C;  3CJH B;  1Q90 D;  3JAM N;  2JR8 A;  2JDI G;  3H25 A;  3RVZ A;  2OYH B;  2IZ0 A;  1WNS A;  2ZT9 C;  1M7L A;  3OE7 G;  3RBX A;  3ZRW B;  3H1L E;  1F23 A;  1I94 B;  3F5H A;  1K4C C;  3FAV B;  3JAW A;  4KL1 A;  4HYT B;  1FKA O;  2HHH O;  1QLE D;  4LR3 A;  1LUV A;  1Q3E A;  3HKC B;  2LR2 A;  4W4K A;  2N9B A;  3UQ8 A;  2V4H A;  5JQG B;  1BDD A;  1H0T A;  2NPS D;  1BQZ A;  4J80 A;  3JSL A;  1Q6I A;  2BEZ F;  4XE5 B;  1WP8 A;  3ZMV A;  3FXD A;  3MDS A;  2W8Z A;  3Q5P A;  3ZHU A;  2BAS A;  2KB1 A;  2DE0 X;  4BIO A;  2QG4 A;  3UCS C;  4HJG H;  2XND H;  1XL6 A;  1Y74 B;  3N2G A;  1XIL A;  2ILM A;  3OGI B;  4WF9 V;  5J9P C;  3QWO C;  4F4L A;  2CTP A;  1X4T A;  4JPR A;  4BWA A;  4EB6 B;  4GZR B;  3AEB C;  2UUC O;  2O1K A;  2GTS A;  4WFB V;  5CJ4 A;  2H3O A;  4DZO A;  3KPE A;  3WU2 H;  2Y4U A;  4JI0 B;  1L2P A;  3JD0 A;  1JY2 O;  3BY6 A;  1KB9 I;  4I1L A;  1JY2 N;  1VQK V;  1IK7 A;  2QWP B;  1K5Q A;  2HP8 A;  2HLO A;  2LW1 A;  3BRT B;  5IJ0 B;  3TJT A;  4DR6 B;  4DUY O;  4QMA A;  1BCC E;  2PZS A;  3A0B H;  2Q5U A;  1JJ2 U;  5KLV H;  1JMB A;  3QH9 A;  5B5E Z;  3O9O A;  3L73 J;  1NTK G;  1YIT P;  5IJ9 B;  3VMX A;  3P3N A;  3GMA A;  1BZK A;  3SYC A;  5CB4 B;  3G6E V;  3K0G A;  4IHJ A;  1SA0 A;  1ZLZ A;  2Q73 A;  4JI1 O;  1PPJ E;  1W2B U;  3JD4 A;  4B3S B;  3VN0 A;  3OW2 O;  1ZAU A;  2HYN A;  2B9Z A;  4MW8 A;  3FB7 C;  2HFE C;  3BA9 A;  5ITZ B;  1SQP E;  3HRN A;  1SQV E;  2D2C B;  1HGV A;  1SES A;  1U7M A;  3L71 E;  4NPE A;  3BRC A;  2CTQ A;  3WFV A;  3CC4 V;  4WCE V;  3CXH I;  3OEH G;  1N4C A;  2FYU H;  2YMY A;  1RE4 C;  1QR9 A;  4IL6 H;  1L0L H;  5IYD O;  1WAZ A;  3RW0 A;  4U3F D;  3E83 A;  3MHS C;  3AG3 C;  5B3S B;  1M4U A;  2Y0P A;  1BE3 H;  1S72 V;  1FJG B;  2BTQ A;  5JWP A;  4LF6 B;  1GKF A;  1URQ A;  1HR0 O;  2UXD O;  4H44 D;  1Q7Y Q;  3JAL B;  1MFT A;  4DO2 A;  4YIP A;  1SF9 A;  4XDJ A;  5B5E E;  4AUW A;  1H88 A;  3OMI B;  1P4R A;  3LSQ A;  3PH0 A;  1MSD A;  3P30 A;  2K9J B;  3UIA A;  1I7F A;  4G28 B;  4YXD C;  4TV9 B;  2I1K A;  2FML A;  3TGU J;  3TGU E;  3BEH A;  2JK5 C;  5L3C A;  2I1J A;  3WUU A;  3DC6 A;  2VRS A;  3LDC A;  5GON B;  2OAR A;  1ZR4 A;  2QGN A;  3CME V;  3JAW B;  4DR7 B;  4DV4 O;  2FYU J;  4E4E A;  1YJN V;  5EC2 C;  1XDC A;  3LDD A;  1NTZ J;  3RL0 g;  1EDL A;  2W0F C;  4BXL A;  1AJP A;  2W6A A;  2MJZ A;  2AEM A;  1LTB C;  4EYY Q;  2B89 A;  5E1A C;  5AW6 B;  2A45 G;  3ZN1 A;  1HDJ A;  4YXW H;  1RQU A;  3WG7 B;  4N21 A;  4QPK A;  1EXI A;  1AP5 A;  3JAL A;  3K5B A;  3MUD A;  2VQE O;  5B66 H;  1W2E A;  3W7S A;  4JI3 O;  5KX5 B;  3D70 A;  5LP6 A;  1XBL A;  3U11 A;  1HNX B;  3UO3 A;  5AVU B;  5EIB D;  5C39 A;  2Z3Y A;  3HKB B;  1XNR O;  2AW9 A;  3HD7 D;  2IFN A;  3OGC C;  5BU8 B;  2D2C C;  2LW7 A;  3ABL C;  1KIL A;  1OWA A;  3CCL V;  1VQ6 V;  2F4V B;  1LNQ A;  2MW2 B;  2ZE8 A;  3LNN A;  3P32 A;  4DR5 O;  1PFI A;  4YY3 B;  4OX9 O;  2OYQ A;  1VF7 A;  3CX5 F;  2ITC C;  4PV1 B;  4IIJ B;  3PLN A;  2WSE H;  3M7M X;  3ZHT A;  2ZM6 B;  1F4N A;  2LGQ A;  1SQX D;  1M57 B;  2P90 A;  4FZ1 A;  1X9V A;  1N7S A;  4BW5 A;  4R8C A;  4FFB A;  3L71 G;  5HFL A;  1ZWI C;  3A0H E;  1US6 A;  2Q67 A;  1U7J A;  1K7D A;  4PD4 H;  3ZED A;  4WFG A;  1E1Q G;  2WZ7 A;  1R1B A;  2ZXW B;  2RQ6 A;  1J5E B;  1QL2 A;  1KEC A;  2N74 A;  2KLV A;  2ZAE B;  4PV1 C;  3RYI A;  2QKS A;  4L8J A;  2YI9 A;  3FWL A;  3O6Q B;  3OR7 C;  1LWU A;  3LID A;  5BXZ A;  2YKP A;  4UFZ A;  2QTO A;  4JI6 B;  1PGJ A;  1AQT A;  1ZSP A;  1UIX A;  5IJ0 A;  4X62 O;  4DV2 O;  3QG5 A;  1NJI W;  3L71 H;  2Y0E A;  4PD4 D;  1GO3 F;  5LHH A;  3ZBH A;  2HKO A;  2WA4 A;  3VP9 A;  3AG2 C;  4I7Z B;  1NQT A;  3RK2 C;  4WVZ A;  3TGU G;  4UVC A;  4X20 B;  1AP6 A;  3B5N B;  3CWB D;  5H2F E;  2F43 G;  2W83 C;  3RT3 C;  4DV5 B;  1VPC A;  4JI5 O;  2EBO A;  3LIE A;  1EXJ A;  4GX5 A;  3MIW A;  3VMZ A;  4FZ0 A;  3V2Q A;  4W7Z A;  2F95 B;  3H1K J;  3LUT B;  1IVS A;  2QJY B;  4I2L C;  1JFF A;  4N78 E;  3RL0 D;  1MZE A;  3ZMU A;  4IYI A;  3AG4 B;  2WLH A;  1SQV D;  4DV6 B;  1GL2 C;  2OYH C;  4NPD A;  5DN6 G;  1KB9 F;  3AE9 C;  3TDK A;  2EIJ B;  1MSW D;  2EIK B;  4NKG B;  5AW7 B;  3FKS G;  1NWQ A;  1UJW B;  2YC0 A;  1QEX A;  3H1J D;  1MAB G;  4U3F J;  4KFM A;  3CCJ V;  1SP4 A;  3D6Z A;  3CXC U;  1F4M A;  4MTX A;  3WB2 A;  1K04 A;  3KQG A;  2HJF C;  2JJ1 G;  2ZXE B;  3CWB J;  1HJB A;  4DR4 O;  1RM1 C;  2ODM A;  1NTK E;  3HUS C;  1MKM A;  3LW5 H;  1BSN A;  2UU9 B;  1KKD A;  2KXP B;  4RO2 A;  4QJF B;  2YNY A;  5IY5 C;  3K04 A;  1PPJ G;  3BRV B;  1N73 B;  5CMZ A;  5TIS Z;  3H1K D;  1JFF B;  3G67 A;  4QPJ A;  1M1J B;  2CH7 A;  1Y47 A;  1KU9 A;  1XOU A;  4JAS A;  4DXW A;  4AQY O;  4JV5 B;  1VF5 D;  1WN7 A;  3D8C A;  1RE4 A;  2A7W A;  4YJ3 A;  2ZDI A;  2E75 B;  2EIL B;  1BHA A;  1N7S C;  3K08 A;  1S1C X;  1Q5O A;  4WB4 A;  2K9Y A;  3A8T A;  4FVM A;  1ZX3 A;  3DC5 A;  2OTL V;  1NTM K;  4OGQ C;  4WFF A;  1S5L Z;  1G8M A;  5BU5 A;  3K57 A;  4U7O A;  4JAA A;  1FZF A;  1TUB A;  3Q5R A;  3AK1 A;  5CCG D;  4X62 B;  1BDC A;  2XAS A;  2KQX A;  4X1K A;  1M56 C;  1N34 O;  1IBK O;  5CCG A;  1GK4 A;  3SJQ C;  1ZME C;  2LFR A;  3ABL B;  1ZXG A;  3L4F A;  5H2F H;  1T2K C;  1KQS U;  3T1Y B;  2KS1 B;  1KN7 A;  3SDL A;  4ASW A;  1AR4 A;  4J41 A;  3DXR B;  1GU5 A;  1SS1 A;  3H1L G;  4CH5 A;  3O6Q A;  2WLN A;  2JEX A;  4UVB A;  4LBE C;  2WLI B;  1IBM B;  2UUB B;  5FNV A;  4IOI H;  1CXZ B;  2L91 A;  1M9N A;  2JEU A;  1HUC A;  1NTZ D;  4Y99 C;  5APT A;  2IDB A;  1EDJ A;  2QM4 A;  3T4D A;  1VEW A;  2RNB A;  1EDK A;  3II6 A;  2QWQ B;  1OCR C;  4CBC A;  4GYC B;  2KSJ A;  3HTK B;  1SET A;  2FXP A;  1W59 A;  1QLE C;  1ZW0 A;  3ZMT A;  1OZH A;  1FZG A;  3CME P;  4DCK A;  3IGA C;  1JVM A;  1VQ9 V;  4GOF A;  3HE5 B;  4DK1 A;  1BE3 J;  2QR4 A;  3ZX6 A;  4JZ2 A;  2UUA B;  3K59 A;  1K92 A;  2RKL A;  3HKB A;  4JYY A;  4LF7 O;  1MG1 A;  2M0B A;  2GDS A;  4OX9 B;  5APS A;  1EN4 A;  3VQX A;  1LGH B;  5E79 H;  3EHB B;  2QJK B;  2OTK E;  1S5L X;  4Q6G A;  1XI1 A;  2IJJ A;  2V7Q J;  2F93 B;  1PP9 H;  4FPP A;  3OW2 U;  5K1P A;  3FYI B;  1Y8A A;  1NTM J;  1V9P A;  3LSU A;  3UKM A;  4AQR D;  1IFN A;  4MVS A;  2ZD9 A;  3AEE C;  1FD9 A;  5E79 Z;  3M9H A;  2QKC A;  3VMY A;  5A9G A;  2DW3 A;  4PEL A;  3H1I E;  2FYU G;  5KX5 A;  5BY1 A;  2ADP A;  2O01 H;  1YIT V;  4JI6 O; 
#chains in the Genus database with same CATH homology
 1OW7 A;  3RK3 E;  1JB0 J;  5M1B A;  4IL6 X;  1PV3 A;  4OGQ B;  3GMA A;  3GF3 A;  3Q5S A;  4TT3 H;  3AE8 C;  3AEC C;  2H89 C;  2D2C D;  2G8Y A;  3C8V A;  3SFE C;  1VF5 D;  3AE5 C;  2E75 B;  4PV1 B;  2D2C B;  2QSI A;  1RQV A;  1DD4 A;  1S1C X;  3G9R A;  2H88 C;  2K9Y A;  3ABV C;  1GMJ A;  4I7Z C;  3AED C;  2JO1 A;  4OGQ C;  2OQQ A;  1PIX A;  1KMI Z;  2E76 D;  3B71 A;  2MKV A;  3D6Y A;  4Y28 J;  3AE3 C;  2ZT9 B;  4U7J A;  5KLI C;  3Q5R A;  3AE7 C;  3T97 B;  1U57 A;  1ZP0 C;  1VL2 A;  2E76 C;  2E75 C;  4PV1 C;  5KKZ C;  4H0L C;  3Q2Y A;  3Q3D A;  2QJP C;  1ZME C;  1WMK A;  2QJY C;  4H44 D;  1TU3 F;  2G3A A;  2QJK C;  1DD3 A;  2JP3 A;  3FGA D;  2O01 J;  1NGM B;  1Q90 D;  1UIX A;  1NYH A;  3H25 A;  2ZT9 C;  3O6Q A;  3S9O A;  4R4M A;  1KIL E;  4KT0 J;  2J5U A;  4YXD C;  3EWK A;  2WSE J;  1FDO A;  3AEG C;  3GF7 A;  4H0L B;  4R4L A;  2IDB A;  2P10 A;  2WSF J;  4GDO A;  1OW6 A;  4I7Z B;  4H44 C;  1VF5 B;  3GLM A;  2YMK A;  3AEA C;  1OMI A;  3AE2 C;  5L8R J;  2E75 D;  4PV1 D;  2WSC J;  4Z1M H;  1KTM A;  3D71 A;  2WQY C;  3IAO A;  3AE6 C;  2FXP A;  3LW5 J;  2BEZ F;  2WPV B;  3Q1M A;  3Q5P A;  4H13 B;  1KQG B;  1ZOY C;  2FYN C;  4YTP C;  3RL0 g;  4XFJ A;  1EXJ A;  2YIU C;  2E76 B;  1KQF B;  1DIP A;  1R8E A;  2E74 B;  1PL5 A;  4H13 D;  1FDI A;  1AJY A;  2E74 D;  1RQU A;  3AEF C;  1S5L X;  2V7Q J;  3IN6 A;  1EXI A;  3AEB C;  2BEQ D;  2ZT9 D;  3AE9 C;  2FBW C;  4H13 C;  3R4Y A;  1Y9B A;  1HF9 A;  1YQ3 C;  1ZRT E;  2QIW A;  3D70 A;  3AEE C;  1KOR A;  2E74 C;  1IK7 A;  3D6Z A;  1YQ4 C;  4RKU J;  1HJ0 A;  4H44 B;  1VF5 C;  3AE4 C;  1K04 A;  1K05 A;  3SFD C;  1OW8 A;  3AE1 C;  4H0L D;  1MKM A;  4OGQ D;  2D2C C;  2NZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...