1Q90D

Structure of the cytochrome b6f (plastohydroquinone : plastocyanin oxidoreductase) from chlamydomonas reinhardtii
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
156
structure length
156
Chain Sequence
TKKPDLSDPVLKAKLAKGMGHNTYGEPAWPNDLLYMFPVVILGTFACVIGLSVLDPAAMGEPANPFATPLEILPEWYFYPVFQILRVVPNKLLGVLLMAAVPAGLITVPFIESINKFQNPYRRPIATILFLLGTLVAVWLGIGSTFPIDISLTLGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apocytochrome f
publication title An Atypical Haem in the Cytochrome B6F Complex
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Photosynthesis
total genus 44
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2003-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 1q90D02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1q90D01
2E74B 4KT0J 5KKZC 2YIUC 4PV1B 2E75B 2WSCJ 2WSEJ 4H44B 1S5LX 4H13B 1JB0J 2QJYC 2FYNC 5L8RJ 2E76B 3LW5J 1ZRTE 2O01J 2QJPC 2WPVB 4I7ZB 4OGQB 1Q90D 2D2CB 2K9YA 2ZT9B 3C8VA 2QIWA 2QJKC 4RKUJ 5KLIC 4Y28J 4H0LB 2WSFJ 4IL6X 2QSIA 1VF5B
chains in the Genus database with same CATH superfamily
1A32A 4X62O 1G4YB 1K5SA 3B5NA 2YIUC 2LW7A 3AE1C 4U3JB 3ABKB 3BCCJ 3OMIB 2JVDA 1SA0B 4JI0O 1NTMD 4GOEA 1XTCC 1M93A 1GRJA 1K92A 3UM7A 3G67A 2OWOA 5KLIB 5APWA 2AXTH 4DUZO 4X1KB 2RMKB 2C9LY 3L71E 1CP9A 1L0NG 4JI7B 1MABG 1P84D 3FYIB 2D3OW 4ZMDA 3STLC 4IGGA 1NZ6A 3LSQA 4ICGA 4MW3A 5KAIH 2HODB 2ZQMA 3OEEG 1SQXD 1N2DC 3Q1MA 1YVWA 2WA3A 1X4TA 4C7UA 1KP2A 3NXSA 4X1YB 2UUBO 2ETNA 4TUYB 1PV3A 2IDBA 1L0LH 1I94O 3KZIE 3N2GB 4YHHO 2QJYC 3KKYA 4NTWA 1AJPA 2BOBC 2YXHA 1LWUB 2N9BA 4K8ZA 1IFDA 3JASA 1MFZA 3L75J 1E79G 2R5BA 2OTLP 2WLJA 3AE8C 1WN7A 1EZVH 3TDKA 3CX5F 2IYOA 1FD9A 3CD6P 3L70G 4FLUA 2NPSB 3CX5H 4KT0J 4X65B 1Y66A 2Y0EA 4ZKPA 4P9PA 4XDLA 4O2AA 1YF2A 4ABMA 1KZUB 5KJ7D 1L0NJ 3CHXA 5AVVB 2WSCJ 4H44B 5KLVD 3CRRA 3WG7B 2OCCC 3IAOA 1D5AA 2E76B 1GH6A 3IJ4A 3KZIZ 3VYIA 1L4AA 1Q8IA 4LFBB 2ITDC 3IR9A 5JWPA 3AG3B 5KX5B 1MV8A 2WSFH 3K59A 4PV1D 3RK3C 4J7ZA 2QJKC 1B6QA 3KHUA 2MK3A 1RQVA 1WT6A 1XL4A 1S76D 2QM4A 4F6RB 2ZXWC 4PJ0H 2C0WA 3NR7A 4G28B 1QL2A 4CBCA 3E1IA 3BY6A 5E79H 1JMKC 2IM9A 4MVQA 3ZJZA 1JOYA 3M0AA 1S1CX 5AVXB 1BSNA 5EC1C 5K1XA 1XL6A 1RE4A 2Y9YA 3ABMC 3OTFA 5EZYB 2DOSA 3BRVB 1QEXA 5B1BC 3L70J 4IT5A 2M7WA 4TT3G 4GZRB 1U57A 1LUWA 2QM8A 1NOHA 2G38A 1RSOA 5BR8O 1FPOA 1L2PA 4Z1MH 2EULA 4X64B 3H1HD 5HFLA 4W80A 3MUDC 2Q9IA 1XQ8A 4B7EA 2G3AA 3ZN1A 3MTUE 2CK3G 3ML0A 3HD7C 2HLDG 4J9YB 1ROPA 4I4TA 1RE3A 3LSUA 1FDOA 4ASVA 1CXZB 3H1ID 1DD4A 2IZ0A 1J1EB 4U3FE 4B3SO 2KLUA 1W5CE 5L8RJ 2P22C 3N4XA 1NO4A 1SESA 1SQBG 1Y76A 2VS0A 1KUQA 4IHJA 3O6QA 5B1OA 2YXLA 2B88A 2QA4V 2E42A 4H44D 4LH7A 1KFMA 2AEFA 3BCCH 5KHGA 5JCOC 1FZEA 1Q7YW 4LP8A 4R7CA 2EIMC 1PNKA 1PGOA 1KMIZ 1RF1C 3GMAA 1EDKA 1VQ6V 1WJZA 4JI8O 1G2CA 3MP7B 2CGNA 4I1LA 2QWRB 2YO2A 5AW5B 5F2VO 1BE3G 1H8HG 2QTSA 2KP8A 2YMKA 2JGDA 2ZVNB 1PM9A 2ZE7A 1YHQV 3TGUD 3K06A 1FDMA 2F93B 4K8XA 4EYYQ 3GLMA 2B9ZA 4UVCA 3HKCB 1GN6A 4Y99C 1HNXB 5J2UB 1GL2C 1B3QA 3BABA 1ORQC 1PNMA 2HG5C 1SQBJ 4DR2B 1SKVA 4H0LC 4RO2A 3L75H 4W7YA 1V55C 3I5CA 2FKXA 1QCEA 2YUAA 4EOTA 2FFDC 3RK2B 3EXAA 3TXQA 4GX2A 4QJFB 2A06D 1AJYA 4BIUA 1HJ0A 3FD9A 4FJCC 4J10A 2P10A 4X1IB 1ZMEC 1AB3A 2P6JA 2XASA 4LBEC 3EHBB 1L0NH 1GTWA 2FB5A 1JY3P 5LHHA 3C3TA 4WBNB 1BE3J 3JALB 2D2CC 3A0HE 4K35A 1I08A 1Y74B 2PTMA 2X6AA 4HZ3A 4X88A 2B89A 4PDVA 3BVHA 4JV5B 2IJHA 3ASNB 3KQGA 3ETQA 1H8AA 3P3PA 3WB1A 3B71A 4LGDE 3AEFC 1AVYA 1VEWA 4LLHA 4FFBB 4QMAA 2QA4P 2BCCJ 3O8ZA 2HLOA 1AV1A 3ZRWA 4GKJB 2UU9B 1RPRA 3IFXA 1BGYG 4X1KA 5IY5C 1K8AQ 1F51A 1K04A 1VQ4V 1S72V 2W0XA 1E79H 1HNWO 1NU1G 1K34A 3RGBA 3H1KD 3QH9A 4X62B 1EZJA 2Z0AA 1IBKB 3CC2V 2HODA 3L70H 3ICXA 4O4HB 3A0HZ 3ZX6A 4KHXA 4O9BA 1EN4A 2A79B 4JI0B 2Y9ZA 3FKSG 1YHQP 2QJ1A 4FK5C 1NTMG 4X1YA 1MSDA 4TUYA 4JYYA 1WRGA 3N2GA 3U1CA 2XNDG 2ZE8A 2DYRB 2W83C 4JI4O 1M57B 2UXBO 2IBZE 4J7KA 1LWUA 3HPLC 1FZCB 2X6CA 4TSFG 1JJOA 3H01A 4MVMA 4GIFA 1GK9A 2WLMA 3ZHSA 4FLWA 1M1JC 3RK2D 1Z5WA 4BAYA 1L0NK 5DEDA 4LFCB 3UO3A 2KYVA 4N3YB 1SQXG 3H1LE 2AHYA 2NPSA 1V54C 1DD3A 2ZXXA 4PI2A 4D6TD 4JI5O 5GTHZ 1IBLO 4BWAA 2EINC 3T1HO 2Q7HA 2M3BA 1NU1J 2CTQA 3LDDA 1NJIQ 4GCZA 3CB2A 4MS2A 1I5XA 2QIWA 1NVOA 3I56V 3AG4C 1ZWIC 2M3EA 2CPSA 3SYCA 3E22B 2KSDA 4R4LA 2NLJC 1NTMJ 3DC5A 2AXTE 1G1IA 1MZFA 2CE4A 4LF9O 2Y0PA 2J59M 3V2RA 2Z3YA 4F6RA 2CK3H 2CAZC 2DYSC 3RGUA 2C9NY 4RUFA 1VQ8P 2QE7G 1K4DC 2R44A 5CJ4A 2JEXA 5AW0B 4JYCA 3ZDMA 5KLVG 1VF6A 1S72P 2E5LB 3SPIA 3W7SA 1AI4A 1UIIA 1V55B 1TAEA 2MKVA 2PP6A 4HNAB 2W6IG 2Z5IA 1SQBH 3G9RA 1SLQA 2RNBA 2KK7A 3HUSC 4K3AA 3WU2Z 3T4DA 5H5NA 4DK1A 2F66C 4O2BB 3U0ZA 3TXSA 1XHZA 2ZT9D 3RL0C 4DR7B 1NWQA 3SJAC 3L74D 2AXTZ 3ZHTA 3GF7A 1VQ7P 1I0HA 3LNMB 5CCGC 1RQUA 4FLXA 2XHBA 2QWOB 2WT7B 2D2CB 4JPRA 2N1TC 3PTZA 3CX5E 3G71V 1VQ5P 1BE3H 1BMFG 3WB0A 4OWFA 2ODMA 4JYAO 5IJ9A 3DSQA 2HHHO 3SR2C 1JY3N 4UFZA 5KKZC 4Q20A 2QWQB 3OTOO 3RK3E 1THZA 3I55V 4FVMA 5KLVJ 2Q7CA 1RY3A 2BCCH 3AE6C 3JSLA 3A2AA 3Q4HB 1LNQA 1ZW0A 2IFMA 1BCCD 3ABUA 1VL2A 1W0KG 4I7ZB 3I56P 2EILC 2XUMA 2ZXEB 3WUVA 4PJ0E 1PIXA 2OIGA 4OPHA 4GLXA 5E79E 3AEDC 5L3CA 3P3NA 1AVOA 1FOSE 4UB6H 2WSEJ 4HH2A 2NNUA 3A8TA 4U7JA 5L3BA 1R3IC 1GDTA 3CYOA 4I6MC 4J7JA 3HKCA 1SF9A 4J42A 1US6A 3CEIA 3CC7V 1XBLA 4JI8B 1K3EA 4TV9B 2YO3A 4BRYA 3LW5J 4I0XB 5IYZB 1OX3A 2JWAA 1EN5A 1AR4A 1OVRA 2E75C 3K57A 2F1MA 3T4ZA 3HB3B 3OMAB 3AG7A 1EZVI 3CMAP 2Q7EA 1KBHA 1WB7A 4PJ0Z 1NH2B 1N7SC 1ZXGA 2FYNB 5E79Z 3TJTA 1LTJC 4KP4A 2HJFC 4FPPA 5GONB 4IOIH 1H89A 4BIOA 5H6RA 1CSBA 1AI6A 5B1AB 2P67A 1M56D 1NU1H 1XDCA 1JMMA 4WBNA 3G6EV 3V4QA 2LP7A 3JALA 3Q2YA 3G71P 3VBBA 1XREA 1WPBA 5TJHA 1Q6HA 1DGSA 4N78E 4JQ0D 3D70A 4H33A 1R5SA 1NTMH 2WLLB 5AVYB 4FFBA 2EIKB 5IYDO 4FLZA 2A06G 2XAFA 4X65O 4GX5A 2N9YB 5AW2B 2JP3A 2M5AB 3HE5A 1GW3A 4J80A 4YPCA 1NKNA 2KQXA 1PL4A 1MSWD 1S5LX 3ZEDA 3PHLA 2XKMA 1RM1C 3M91A 5EC2C 2GSMB 1L8DA 3D36C 4CZZA 5BVZA 3MHSC 4O4HA 4CH5A 1HGZA 2OIEA 4HYTB 4TWKA 3WFVA 2BASA 3IC9A 4PA4A 3MUDA 4NTYA 3K5MA 3RL0B 1IURA 3ZCCA 2QKCA 4O2AB 3HD7A 1T6AA 2WVRA 4LF7O 4XDJA 1IK9A 2V7QG 2JR8A 1VQOV 5CA0A 3BFRA 3CRQA 3RYHA 3CC7P 2NZ2A 1BDCA 1FZCA 1LTGC 3MDSA 1L4AB 3NMDA 1XUQA 1S5JA 4RWUA 2ZFCA 3B5ND 1OMIA 1RFYA 3H1KG 3K0GA 3L36A 1NH2D 4BWNA 1NU1K 1XHXA 5AVSB 5L3DA 3APQA 5KKZB 2YIBA 4X64O 1L0NE 4FM1A 1EDIA 2K37A 1FS0G 1PD3A 3M9QA 2AZ2A 2QE7H 4JI4B 1N0JA 5JCOA 1P4RA 2UXBB 3K5NA 1G8MA 4DV6O 5KLVH 4ASUG 1VQ9V 1LT1A 1NTMK 1WPXA 1NTZJ 2Q69A 1RF1A 5L3FA 3BEHA 4UVAA 3OJAB 5CJ0A 1S5LH 5B66H 1K7DA 3G6EP 4YJ3A 3UT5B 5CB4A 1YJ9V 1WB8A 2N05A 2ZIMA 1KB9I 3E22A 4YY3O 1RSOB 4HBNA 1RF0C 2FXMA 2JDIG 3SPGA 1UFIA 1FE6A 3NTNA 2Q9LA 3HE4B 1IBLB 5EFWB 1GMJA 3T1HB 4D6TG 3G6BA 1SQVK 3KG2A 3M9BA 2V7QJ 1JQ0A 1P7BA 2IJIA 3OR7C 2WSEH 1AVMA 2LW1A 2Q4PA 4I4TB 5CBHA 1TUEB 2ZKOA 3JCUH 1J1DC 1WNSA 2W6AA 1JO5A 2IZ1A 4OGQC 3H1KJ 4HB1A 1T2KD 2H88C 1IJDB 1XEQA 4PA3A 3CXHD 3ABLC 3LW5H 4GODA 2YKPA 3FB5C 1NTKD 3LNNA 4LF9B 1S9KE 1PP9D 2BEZF 3O6QB 2QRXA 3A0BE 5KHKA 3HKDB 1SZTA 2GM4A 3A0RA 4F4LA 3SYPA 1L4AD 4DW0A 5IDJA 4Y28J 2WT7A 2HR3A 1HNXO 2E74B 3P32A 4IYHA 3FB8C 1QHTA 3SJCC 5LOVA 1U97A 4GOFA 1U7MA 3GW6A 2JGDB 4JF7A 5B5EH 2FYUH 2PGGA 3CLQA 2OTJP 2HFED 1IFIA 2LXBA 3L73D 1W2BO 3L74G 3N2KA 1NR1A 3A0BZ 3Q4HA 4P30A 1VQ9P 2AGAA 3AG1C 1H88A 5LP6B 2EIJC 2A45I 5DJUB 5CBNA 3IGAC 2OTLV 3A2FA 3FB6C 2W8ZA 2HPCB 3V5BA 4BIZA 4JYAB 3CD6V 3IAYA 2Z4EA 1K4CC 5C8YA 4DR5B 1MNGA 1NHLA 1AQ5A 4ASWA 4NKGB 3AEIA 2P90A 3X2QC 4GKJO 4NPEA 1M1KQ 1K73Q 3B8EB 2BSKB 4PD4I 1TU3F 1KORA 1OVUA 5DN6G 1JR9A 1URQB 1ZV8A 1IXBA 3M7MX 2Y48A 2W6BA 3ASOB 1GU5A 1QLED 4NR1A 1BCCG 1ZLLA 4I0XA 4XDKA 5IYZA 4X89A 1YEWA 3AE3C 1KECA 2IW5A 1SC5B 1YQ3C 1IBKO 2QJPB 3PLNA 4DV5B 1LR1A 1OCCC 4ZOLB 1QQCA 1Y8AA 3ZRWB 5LMUB 3JAWB 2QGNA 2IYPA 3ZRSA 3CWBE 1JA8A 1BE3E 5GONA 2E74D 2K3RA 5JVDB 2B1IA 4L76A 1YTZI 2FYUK 4R50A 2L5GB 2WLKA 2ZE6A 3ZHUA 2XAGA 1OZ0A 1QU7A 1NTZH 2P5OA 2XOKG 1Y6XA 1FAVA 5H9CA 1N34O 4XFJA 1N8RQ 2A3QA 5AW3B 5EBMC 2BCCE 4QE9A 5LXTA 1XTGB 4LFCO 2DWEC 1BZKA 2KG7B 1J95A 2WLLA 4WY4B 1M5IA 3V2QA 2B9BA 4OX9O 1HBWA 1YCIA 2GTSA 3AG2C 2Q0AA 2V7QH 2H8PD 2M5AA 2A45G 1WAZA 3QF7A 5E1AC 1K8AW 3B4SA 4P2ZA 4EDFA 2JIZG 4UCRA 2WSSG 4JI1B 2P4KA 1GAXA 3U11A 1JCDA 4UB6E 3H1KH 4LF4B 1X8YA 2BTQB 4U3FD 4TQDA 3HUSA 3VMXA 1OFCX 2PAJA 4PDLA 5CHXA 3T1YB 1S0VA 2Q8VA 1U7JA 3W7XA 3P8CD 3QWOC 1MKMA 4TLFA 5CCGA 3IF4A 2QM7A 3JATA 1SQPH 2E5LO 4JASA 2UXCO 1NI8A 2QWNB 1W2BU 2JDIH 4YIPA 3OW2O 4UB6Z 1SFCC 1NTZK 1OJHA 3TNUB 2CUGA 3M99B 4YIOA 4B3RO 1NU1E 2RDCA 1PGQA 2JO1A 5CCHC 3GWKC 4LF7B 1EBOA 2YC0A 3KCYA 1SQQD 4DR7O 3CE2A 1QL1A 1NJIW 3J81N 3MHVA 4QE7A 4YTPC 1VQMV 2Y0IA 1L0LK 1GTOA 1NVPB 1KKCA 1M4UA 3B8NA 3UT5A 4LWSB 1NTME 2R3CA 3V2PA 2WPSA 3JYCA 3M8AA 1NH4A 1X79B 2OYIC 2HVJC 3JSNA 5H2FH 4NXMO 4UUJC 4O4IA 3VQXA 2QTOA 3HE4A 3DC6A 4J9ZB 1CI6A 1WLEA 4DV6B 1NYHA 2YKOA 2OYHC 4I55B 3X2QB 1SS3A 1JFFA 2JEEA 3H1JH 3L72H 1SQVE 5AVUB 1VP7A 4WBAA 1KYOI 5EIBD 2H89C 4C7NB 1SQFA 4DT0A 3G3ZA 1BQ0A 5LL6Y 2NPSD 3F5HA 2EJ7A 4YY3B 2Q6AA 2DMXA 3R2PA 1CPYA 2PZSA 1GW4A 5IJ9B 5KHIA 2YIUB 3JCZA 2J58A 1SQPK 3E1RA 3HKDA 1IZNB 3AK2A 2ZYDA 4JAUA 2E76D 1KB9F 1SS1A 2LJ2A 3E8FA 4JI6O 3G4SV 5IT9N 2LO1A 2LFSA 1FXKC 1KB9H 1ZX3A 3OM3B 4UB8H 3K08A 1NTKG 3OFNG 1HJBA 1PP9G 3CCQP 3S3XA 1PPJG 1M90Q 4H13C 1S5LE 2Z5HA 2XAJA 5B66E 2QJYB 2DWDC 2CPBA 3OA7A 4R4MA 1NGMB 4GUNA 5LP6A 1VQMP 1NS1A 4BRYB 3C90A 4MTGA 1O9GA 4MSWC 2X6BA 1AP5A 3RYFB 1F4NA 3K03A 2HPCA 2P1JA 3ZMUA 3KYQA 2IBZD 1KILC 2PF4E 1P84I 1XNQO 4YJ2A 1R3LC 3JCUE 1KC8Q 4O4JB 1H2GA 5IE9A 2LFRA 1QNMA 3M06A 1JTHB 2PI5A 2RMZA 2CTPA 3B2EE 1PFIA 4AQYB 3H1LD 1QR8A 2YSUB 3L73G 1GM8A 1HTLC 2XV5A 1S5LZ 2BSKA 1AR1B 3OW2U 1NR7A 2OCCB 5KHJA 1VQKV 5B66Z 1QGKB 1URQA 2WSCH 5M1BA 1HDJA 1OCZC 3RK3B 3VQYA 3E86A 1MZ9A 2QJKB 1P7GA 2ZIOA 3HKBA 3OAAG 4I5SA 1ZR4A 1VIBA 1NKDA 2QVAA 4CH6A 2ZXWB 1KD1W 4ZOLA 4HKZH 4DR1B 4BW9A 3JAWA 3JCUZ 1VQ8V 5EBLC 2N04A 2A45H 3N7NA 2R9RB 3G4SP 5JVDA 3HE5B 2G8YA 2WSSH 5APVA 3AE2C 4GX0A 3ABMB 5B1BB 5B5EE 2FYUE 1N4CA 2WMMA 5KUMA 1B04A 2YKQA 1EDLA 4PD4F 1VARA 1OHHG 3OMNB 2KG7A 3L73J 1KN7A 2O01J 4WY4A 4PD4H 1Q3EA 5KAFH 3HD7B 1VQ7V 4CS2A 5CA0B 2JK5C 3RYHB 4FM2A 1R6KA 5FL7G 1N34B 3VMAA 4LCUC 2FMLA 3PRJA 4DO2A 3SFDC 1VQ5V 4ZKUA 1MA1A 1Y67A 2BOCC 2AHZA 3GB7C 1FFXB 2BTQA 1JY3O 3FWLA 1H2LA 1KQSO 3BATA 5B5EZ 3HKEB 3CX5D 1VF5C 4AHCA 4OX9B 1M9NA 4IFMA 1BGYJ 4GX1A 4WFAV 1MG1A 2AEJA 1D2DA 4JZGA 3RYIA 2EIMB 4L87A 4JGSA 2ARHA 5KHHA 4NXNO 3RK3D 1RF1B 1VQKP 2M6YA 4YJ3B 5CB4B 4TT3H 1QVGO 1D5NA 5JQGB 2UWJE 4QGPA 3RT3C 4DW1A 5IYCO 4RO0A 4U3FG 3B5NC 2FY8A 3DXRA 2OARA 3SYOA 3CSXA 3TNUA 5FPRA 1J5EB 4YXDC 3A5TA 1USDA 1NTZE 1R3KC 2ZYGA 1MUUA 3CC4P 4PI0A 1ZUQA 5KAIE 4Y99B 2Q1KA 2Q3EA 1GL2B 4DV0B 3CS5A 4WB4A 2UXCB 2YMYA 1JOCA 4H0LB 5DECA 4LWSA 1SQXJ 2Q6QA 3JD0A 1GZLA 1L0LE 3QVNA 4YXWG 2GA1A 4LF6B 1ZLZA 4B3RB 3HD7D 2ILMA 2FFDB 3CMAV 1FU1A 4J11A 4UXNA 1VQLP 1M57D 4X9QA 2QWPB 2QDOA 4MW8A 4MVOA 1AILA 4I55A 1G1JA 1EZVE 1SQQG 2K88A 4B86A 3CRAA 3AE9C 4RQEA 3R4YA 4C7NA 1ZSPA 2P06A 1RH5B 2WAMA 3OE7G 1W2EA 3SGIA 4U3FJ 3CCJV 5KAIZ 1LJ2A 4NXMB 2YIBD 4WFEA 5LOVB 1BQZA 1OCRC 1Q43A 1EQ7A 5CBOA 1PPJH 1DF5A 3H1HG 4QNHB 4J41A 3EQ2A 1H0TA 4DR5O 1OW7A 1Q7YQ 2ZINA 4N78D 3N2KB 5FLXN 1SQPE 3T97A 1COWG 4BW5A 5IY5B 4PHZA 2Q73A 3MIWA 3EWKA 1AR5A 1T3UA 2QR4A 1K5QA 2WPVB 3H1IG 5BU8B 1Q82W 3VOPA 1PGPA 4EKWA 1XMOB 5BMVB 2WTYA 4D7TA 1OW8A 1BSHA 3RL0g 1KYOF 2QEXP 2ZD9A 5C8YB 1VMGA 1JVMA 1SQQJ 4DV5O 4RUEA 1XOUA 1SQBK 3JSVC 1JM0A 3H25A 1P49A 4JI6B 3L73H 3VOUA 1GL2D 1KYOH 2O01H 2HG5D 5LMUO 2MJZA 3PP5A 4H0LD 1KQSU 5H2FE 4A5UB 3L9DA 4C7RA 1NKZB 1N0NA 4IIJA 4FM0A 2XU6A 3SWKA 3RYFA 1M1JB 1TGOA 2B1GA 3H1HJ 5B3SC 3T1CA 1OW6A 1X59A 1LTBC 2IU3A 3WUUA 3P8MC 3H1JE 3OT7A 3L72E 1V54B 4O4JA 2O3JA 2UUCB 4EEQA 1JTHA 3TGUG 3K5OA 2HP8A 3E83A 2EINB 2CTWA 5KMGA 3F7YC 4GKGA 1QVGU 3OUFA 3H1IJ 1BGYH 2D2CD 1FXHA 3FFQA 3CXCU 2P7JA 2JGUA 3SJQC 3CJHA 1M1KW 1L0ND 5AW4B 3AG4B 1M8OB 2V4HA 3AEEC 4JI1O 3CCJP 5H2FZ 4W4KA 1XNQB 3NFQA 3IC7A 3BCCE 1QLEC 4LF4O 2Y69C 1N32O 2IBZG 3GHGC 4MN4C 2ZVOB 5LXTB 2VQEO 2DW3A 1Q81Q 1BSMA 3CRCA 5CCHA 2DYSB 1KB9E 2KI7B 5IYBO 3D71A 3T1YO 5EK0A 2OYQA 2XNDH 1OXZA 4UB8E 1P84F 2ZYAA 4O4LA 2UXDB 3BA9A 5BZBA 3JAKB 2C2AA 1HW7A 1P84H 1YI2V 1HGVA 2ZE5A 4LC1A 1N36O 2YEVA 5CBFA 2OYIA 1SQXH 3GWOA 3MHHC 2XDJA 3HUSB 4W4LA 1N8RW 3TGUJ 2VWKA 2Q0OC 1LP1B 4DJGA 5LYJA 3B09A 1KILE 2OYHA 3RVZA 1WA8B 4DV1O 3W67A 1S9KD 3L75E 4B3MO 2RN9A 3EFGA 1GMGA 2IU0A 1R3JC 4RQFA 3JATB 4AI8A 3BRTB 3QTCA 2N1TB 4KUMA 1YTFB 1ZL8A 4U7OA 1PKXA 4UB8Z 1SVFA 1S3JA 1OZHA 3AE5C 1FJKA 1FFXA 1GN4A 2WLIB 4RAIA 3HKEA 1BS3A 3M0DC 1LTSC 5LGTA 1I7FA 4XE5B 2OTJV 4Q6GA 1LT9C 2N74A 1DTOA 3KCXA 5C93A 3APOA 1SRYA 1VDFA 3TK1A 3ZHQA 1XILA 1R6TA 5KJ7C 1FXKA 5B1NA 2EILB 5JQGA 2W6JG 3LUTB 3ZMTA 2ATKC 4O4IB 2KXPB 3K79A 4TV8B 3ABKC 1JEKA 3FXEA 4PV1C 5L3EA 3JD4A 1CI6B 1SQXK 3K0DA 4EIJA 2DE0X 4FLYA 5KLIC 1SQQH 1VQPV 5KTBA 1JFFB 4NXNB 3UQ8A 2BEQD 3L70E 1JPXA 3OAKA 4B08A 4WFFA 1GL2A 3V6IA 3AE4C 2WPQA 1TVKA 3ZBHA 2YI9A 1YI2P 5KA6A 2E75B 5APTA 1EC5A 5B3SB 4PD4E 4MTXA 3ZRVA 1B06A 1KILA 3RL0D 2VRZA 2FL4A 4DV3O 1KFNA 3H1HH 5JJNB 2R3SA 5DJTB 4MVRA 2FFDA 3CPWO 1N7SB 3II6A 5CCGD 1LTJB 1OVVA 3UCSC 4FZ0A 2N1TD 1YTFD 4X8AA 5AVQB 3H1IH 3EFFK 4DR4O 1LWUC 3CCUP 3O65A 3ETDA 4FIPC 1BHAA 4WWIA 3CWBD 1BE3D 5KLVK 2VQFB 4CH4A 4DV4O 4N6JA 3CMEP 3E8GA 1ZN5A 4D6TJ 3L71D 4Z1MG 4JAAA 3H9VA 3C9IA 3UKMA 3A0HH 2DQ3A 5LMNB 2RKLA 2ZM6O 4BR6A 3EVKA 3CL3D 2BCCD 3K9SA 4CC6A 4B3TO 1F7YA 4DRXB 4AQYO 4H44C 2IH3C 4UCSA 5FPOA 1K05A 3WG7C 1OCOC 1A02J 1FC2C 2E76C 1ZTEA 5CN0A 2WSFJ 5APXA 1FJGB 2KIKA 1RM1B 3AG3C 5BMVA 1MFTA 2W90A 4HJGH 4YJ2B 5LHIA 2PFXA 2NR5A 1T8ZA 2RN0A 3TGUH 3GF3A 3B77A 1DLBA 2YIDA 1M90W 5GTHH 1IX9A 3F89A 3VP8A 4RJTA 4DR1O 3RYCA 1VQPP 1GU4A 1HUCA 1X9VA 1DEEG 1SQBE 1VF6C 2E75D 2I8DA 2K9YA 4EFBA 4PA9A 2RH0A 1K33A 2XZRA 3RBXA 4I9WA 3MD0A 3IFMA 1Q86Q 1K9MQ 4UCTA 4L8JA 2ZJSE 5KA5A 2I1JA 1M1JA 1N7SD 4X66O 3RN4A 1FZBA 3HKBB 3OUSA 1FZAA 5EYPB 3ZMZA 3KDPB 4GYCB 1KV4A 1ENVA 3L74J 1EXIA 2A06H 4ZI7B 4K0KO 4OH8B 1JCHA 4KXRA 3SPHA 1IK7A 1LT9B 3JARA 4W7ZA 1GM9A 3MZWB 1J1EC 2AEMA 1NU1D 4DXWA 3PN1A 2VWJA 1BHBA 2P58A 2E5TA 1PPJE 2GHYA 2XAHA 5D5QA 2GDSA 5KUKA 2PRRA 2DN9A 4PDRA 4OVNF 3LDCA 4DV2O 4I50B 4GT1A 3TETA 3AECC 1KTMA 4QPJA 1FFTB 4I9QA 2K9JA 3WU2H 4PV1B 3CCEV 2L91A 2XT9A 3VQWA 2XTAA 5LA6B 1Y47A 1MZEA 5TISH 2ZDIC 2WPRA 1BDDA 1J1DB 5LBQA 4MTOA 4DYLA 1BCCJ 4UCOA 1ZRTE 1IZ3A 4U7NA 3K5BA 4OGQB 5D5PA 3TYYA 2K1EA 3JAKA 2M8RA 3BVOA 5J9PC 3CPWU 2B87B 2FKWB 2QG4A 1GKFA 3ABVC 1W0JG 1GK6A 2LQTA 1HR0O 1DK1A 2Y4UA 1UPGA 3ABLB 1N32B 2KS1A 1SQVD 3M9HA 5ITZB 2VQEB 4DR3O 1KYOE 3L73E 1IFMA 5AW1B 1FBMA 3OGIB 1GN2A 5K1PA 5CA1B 1LP1A 1IFJA 1H2NA 1S2EA 2AW9A 3OR6C 5IWAB 3JD1A 4QPKA 1NQTA 2W27A 4DUYO 1UIXA 1J5EO 1URQD 4TOIA 1WA8A 3D3IA 3W68A 3RYIB 1VQNP 1XNRO 4WVZA 1HWYA 2KZJA 3AEGC 2ADPA 3SWFA 1Y9BA 4MT8A 2N1TA 1N36B 4DV0O 3PJSK 2W6JH 1LTIC 2IFNA 2Y0DA 3B40A 3WB2A 1KP3A 1BGYE 3DXRB 2WLIA 2X0LA 4UV8A 5CMUA 3J80N 3CXHI 1CW5A 2WLNA 4LF6O 3CCQV 4D6TH 3RK2C 1X0TA 2JEUA 4DV1B 1IBMO 1URFA 4B3MB 3CRMA 4NPDA 1EDJA 4JI2B 1A02F 3AG1B 3MAQA 1OCOB 2EIJB 2Q5UA 3ZIAG 1JY2N 2KZIA 3LSSA 2DJVA 1FZFA 2W0FC 2KNCB 2Y4TA 3RW0A 1HVVA 4RESB 4WY4D 3ASNC 2EZPA 2ZR2A 3Q5SA 5JJJB 3AK3A 4TV8A 5FNVA 5BXZA 3BRCA 3CCMV 2XAQA 1FOSF 3CCEP 1H2KA 1QBZA 3QG5A 4KHPB 1D7MA 4XA4A 4X20B 2A9HA 4OGQD 1P84E 1QLNA 4WCEV 4NB5A 1JCCA 2YS8A 2A0LA 1SQXE 1R1BA 2P4VA 1ZP0C 1E1QG 2IJKA 2R72A 3TSIA 3F5TA 4R6ZA 2GUZB 4IFFA 4MVUA 2JRIA 1XMOO 1NBMG 1PV0A 3WUTA 1EM1A 1OCCB 1DH3A 1N7SA 3D8CA 1H0TB 1LTJA 2F43G 3L74H 3T97B 3SYAA 4CPGA 2DYRC 5GW7A 1M57C 2ZT9C 2YXRB 1TUBB 1FZCC 4GKKO 3AE7C 1OIPA 1JB0J 1FZGA 4GDOA 1YTZT 5AVZB 4NYKA 2PYJA 4DV3B 3P8CE 1FXVA 2JJ2G 2WPDG 3W7UA 1YZBA 1Q5OA 1PGJA 4EB6A 3GHGA 2CH7A 2Q7GA 4LF8B 5KLVE 1N73C 2FYUD 2GUSA 1OV9A 5L3GA 2DQ0A 2ZR3A 3BPZA 2UUCO 2HYNA 3AG2B 2ZNIA 1S4XA 5IJ0B 4DR4B 2WZ7A 1NVPD 4DRXA 4AQRD 2PUSA 4LNUA 3SJBC 3E8BA 2YXYA 1BT8A 1BCCH 2ADQB 4IIJB 4CH3A 3G80A 4DV7B 1N33B 4DV4B 2QKAA 2IH1C 3CWBG 3D36A 5JH7A 2KKWA 1AJNA 1SQQE 3K9AA 3RVYA 2UUAO 2KSJA 3L71G 3LIEA 2WQYC 2ZM6B 3CCMP 5DM6V 1R73A 3BASA 5KMGB 4B3TB 3H32B 3FGAD 4LFAB 3C3SA 2BCCG 2YI8A 1YDXA 2Q68A 2QSAA 3CJHB 3STZC 2LXCB 3IN6A 1YBKA 4PA6A 3H1HE 2KLVA 3OD4A 2UXDO 3BHPA 5HFMA 1LUVA 2KUBA 1NTKJ 3PH0A 2KB1A 3ITKA 1PP9J 3E7KA 1QR9A 3AEBC 4L73A 2J5UA 1SFCB 4ZBMA 3E2EA 3HR0A 3CCSV 5EYPA 3H1IE 2O57A 3M0DA 4ZI7A 3OGCC 4DR6O 4WFHA 3F7VC 1LT9A 2R9IA 2CGOA 4RKUJ 2H7HA 3CC4V 4HAMA 3VMYA 2WITA 4DOJA 4O4LB 4IL6X 4NTXA 2O1JA 3CWBJ 3B8MA 5KJ7A 4JYBA 1EXJA 1NTZD 4CS3A 2E43A 5AW8B 4TQFA 4X66B 3L71J 2NN4A 1M56C 1XMQB 5BY1A 2E3CA 2YDEA 1H8EG 2YEVB 5AW7B 4I50A 2PGDA 2OYIB 1RF0A 3HTKB 2EJRA 2R70A 4WFBV 2HVKC 4K0KB 2DW4A 4U3JA 1Q81W 2OTKE 1H38A 1HF9A 1SA0A 1LGHB 5LYJB 4Z2WA 1VQLV 2AZ0A 1L0LD 2OYHB 4AYCA 2R9AA 5LA6A 1IDSA 1BL8A 1IVSA 2PY5A 1HWTC 1X22A 1Y4MA 2ZCEA 3UO2A 4JTDB 3KXDA 1Z5VA 1VQ6P 4JI3B 2QSIA 4I7ZC 2B87A 2FTKA 1ZL8B 3K58A 4DV2B 3S1KA 4ZHQB 3TGUE 4G2KA 2QKSA 1EZVD 4UVBA 1DEBA 3TCUA 5GTHE 3D6YA 3VMZA 5ITZA 1YYCA 2R32A 4NPFX 4LR3A 5CA1A 2KSEA 3FX0A 1Z2GA 3SPCA 4DK0A 2WLHA 4DUZB 1SQGA 1HH0A 1NAFA 3GG2A 3T2MA 4N21A 3AK1A 4IL6H 2ZT9B 3A0BH 1QVFO 1TA8A 1FYJA 2PI4A 4CS4A 2F4VO 1AFOA 4ZNCA 1FXKB 5GTIH 4WF9V 3I5DA 1YJWV 1HR0B 1SFCD 4OXSA 1SQPD 2K9PA 4DR3B 2A06E 4UV9A 2LKMA 1VPCA 1SQVG 5CCHD 1UJWB 2QEXV 2UUBB 2WWWA 2GV9A 5J2TB 3CCSP 4DUYB 1N73B 1I94B 4H13B 3VP9A 3Q5PA 4YHHB 2FYNC 3FAVB 4H37A 2H43A 1XNRB 1WP8A 3CCRV 5K5GB 4AILC 5JJEB 2EX3A 2JWDA 5B1AC 1G6UA 4FLVA 3W7TA 3RBZA 2CDYA 3WU2E 1TVKB 1KQGB 2RCVA 3J7AU 3O9OA 2KNCA 3UIAA 2UXXA 3ZN0A 2OCHA 5KX5A 1KILB 1HP8A 3ZS8C 1JMBA 1LTTC 2KB7P 4L74A 2VQFO 4N23A 3S9OA 5TISE 4UCUA 1YXBA 1IBMB 2KOGA 2FBWC 2EIKC 2BTOA 1H2SB 2OGUA 1R6NA 4X20A 4R8CA 5LMNO 1PZQA 3H1KE 3H1JD 3L72D 4PDMA 3D6ZA 1HNZO 1Q90D 1T5EA 3CXHF 1VQ4P 5CBGA 3QO7A 1GK4A 5EZYA 1SQVJ 1OCZB 3U1AA 1FS0E 2GUZA 1EN6A 3CXHH 1FJGO 3CC2P 3JD3A 3MGNA 1YITV 3VN0A 1NTKH 1T2KC 2LGQA 3JC22 1PP9H 1AI7A 2IBZI 1U96A 1F4MA 3THOA 1AQTA 4OPAA 1R8EA 3TF5A 1YIJV 4G27B 3QO5A 2VRSA 3BCCD 5TISZ 2EBOA 4JBZA 4ZKIA 5EBWC 2E5YA 4ZIBA 1SERA 2B5UA 3SPJA 1TUBA 1KB9D 2YICA 1L4AC 1YJWP 2OQQA 2OT5A 4E4EA 3BA8A 3CWBH 4D6TE 5BR8B 1M56B 1NAYA 4H13D 1R5LA 2V1DA 3USSA 3L71H 2O01N 4KFMA 2RQ6A 2JJ1G 1KKDA 1K97A 3FXDA 4L75A 3SSUA 3V2NA 3DGEA 2O1KA 2SPZA 2JJLA 2L35A 3CCRP 3RYCB 2ZDIA 5IJ0A 3D3QA 4B3SB 1WMKA 3K04A 4GKKB 2HFEC 4LF5O 1RE4C 4FFKA 1PL0A 1JJ2U 1KILD 2M0BA 2LGWA 2MW2B 5AVWB 3KZIH 4MVZA 3L75D 1N7LA 3C8VA 2H94A 3BAAA 3E8HA 3CP1A 2JS3A 1AROP 2YIAA 3V4WA 1QVFU 1XI1A 1VF5B 2FYUG 1NTKK 2XNXA 3H32A 1IC2A 2Q5ZA 3JARB 1RE3C 3CCLV 3KPEA 3ZMVA 1ZR2A 1VF7A 1K73W 2L6LA 5J2UA 5AW6B 1KU9A 3ZHVA 3R66A 1K9MW 1Q86W 5APQA 3OEHG 3VTPC 1ZAUA 4JI7O 1LTAC 2UUAB 4I2LC 3L74E 1YITP 3B5NB 4PA7A 1YQ4C 1SFCA 1JX9A 2K9JB 1E1RG 1KD1Q 2HEPA 1RHZB 4QIWF 1YIJP 4JZ2A 2YXQB 5IWAO 4X1IA 3CX5I 2F95B 3H1LG 1Q6IA 2I1KA 4C46A 1GN3A 3VQVA 1CEZA 1GD2E 5LGNA 1AJQA 4CC5A 1Y74A 2E74C 3DTUB 3A7OA 3RWRD 2FXPA 2KS1B 3L70D 2LR2A 3JD2A 3HTKA 2FYUJ 3ETEA 2IJJA 2CTRA 2IPPA 3U59A 4DR6B 3S3WA 1Z56A 3Q3DA 1JNMA 1GO3F 3E35A 1CZQA 3I55P 4PD4D 1BCCE 1FJPA 2ZNJA 1E5WA 3RFRA 1F23A 5APYA 5LGUA 3FB7C 4F6EA 1S77D 5LP6C 3CCUV 3JASB 3R65A 2PYLA 3QO8A 4JI2O 1J2JB 5AVTB 1SZXA 2H8PC 1NTZG 4ZHQA 3W7WA 1MOFA 1SQVH 4LFBO 1USEA 1VF5D 3WMM0 3CMEV 4NVPA 4U3FH 4Z1VA 1OCRB 1W59A 3LIDA 2GBOA 2POHA 4D7SA 3H1LJ 5H6QA 4WFGA 3F5WC 1L0LG 2V4DA 3SYQA 4KHPO 3K5LA 3CCLP 1HNWB 5A2QN 2H3OA 1URQC 1AA0A 3C1LA 1S5HC 2X7RB 3ASOC 4B7KA 1DX7A 3K3WA 4PELA 3ZRXA 1AI5A 2BE3A 1EZVG 2K1AA 2ZAEB 4IFDK 4YXWH 5BU5A 2YNYA 1O9HA 3GVMA 3JAMN 5A9GA 2QJPC 3L37A 5AW9B 5FNVB 5J2TA 1KQLA 5AVRB 1N73A 1IFNA 3FAVA 4UCVA 1YJNV 1RP3B 4BXLA 3FYEB 2F4VB 3U10A 1SP4A 1IO4A 1ZOYC 4MVSA 1L1FA 2HKOA 4JTAB 1SQPG 1QX8A 1SQBD 4M3LA 1MMMA 5KAFE 4JI5B 4EFEA 5C39A 1L0LJ 2F23A 4WY4C 3E89A 4LF8O 2UXNA 3ETGA 3CCVV 1N86A 3CI9A 3L35A 3FWNA 5CA3A 4XBFA 2Y0CA 1OWAA 2AXCA 2JKVA 5CMZA 3ZHRA 4HYOA 1JUNA 4LH6A 1PNLA 2C0XA 4E2LA 3ABTA 4P9OA 3SDLA 1H2MA 1N33O 4HNAA 5EIBC 4DV7O 3S4RA 1NT2B 5APUA 1QLEB 1Y76B 2ITCC 2Y69B 4KL1A 4EB6B 3GHGB 2NPSC 4IHJB 2CH7B 4IL6E 1PPJD 2WA4A 4AUWA 3HRNA 1JY2P 3LDEA 4O2BA 1DIPA 2R5DA 4FZ1A 5KAFZ 5GTIE 2P2UA 4JPZB 1HNZB 4LFAO 2GUVA 3H1JG 1M7LA 4LNUB 3L72G 1EFRG 3AEAC 2OYOA 3P7KA 4EI2A 1VQOP 1G1XB 3L4FA 1Q82Q 1SQPJ 1G2CB 1SQQK 1Q2NA 2RJZA 4DR2O 1ZRTD 5JH7B 3N27A 1FAFA 1RPOA 1DF4A 1AP6A 5APSA 1SETA 1KQFB 4FMTA 2FXOA 4DCKA 4JTCB 1KYOD 3QNEA 3BCCG 1WP7A 4IL6Z 4IYIA 1YJNP 1VQNV 2NRGA 5GTIZ 2GTAA 3SFEC 5LHGA 1YJ9P 1FKAO 4JF3A 4MTFA 3A3YB 1YSCA 2IBZH 1V9PA 2Z5UA 3H6PA 2HHHB 1XMQO 4KJMA 4DZOA 4JV5O 2P7TC 3OTOB 1I5YA 4A7PA 1KC8W 2A7WA 3Q5RA 1T3JA 3H1JJ 2HJDA 3L72J 3CCVP 1FDIA 2IX7C 3H1LH 2ITAA 1BGYD 3ZMSA 2JS5A 2UU9O 4LF5B 3CXHE 4JAVA 2Q67A 4FLTA 1JY2O 5AG2A 2FYZA 1NTKE 4TV9A 3FX7A 1PP9E 3SWYA 1Q6UA 2EZOA 1IXMA 1PL5A 4JI3O 1IFPA 3P30A 3L75G 2Q3IA 1GM7A
chains in the Genus database with same CATH topology
5M1BA 2JO1A 3D71A 5KKZC 1ZOYC 2YIUC 1FDOA 3AE1C 1DD4A 3RK3E 2NZ2A 1UIXA 3AE6C 4YTPC 1OMIA 4H13B 3Q5PA 2FYNC 5L8RJ 3AEGC 3AE9C 3R4YA 1VL2A 4I7ZB 1Y9BA 2WQYC 1TU3F 1KORA 4H44C 3O6QA 1PIXA 1K05A 1YQ4C 4H44D 3FGAD 1KQGB 1KILE 2E76C 3AEDC 2G8YA 2WSFJ 3Q1MA 3AE2C 2WSEJ 3AE3C 4U7JA 3IN6A 1NYHA 1YQ3C 3S9OA 1KMIZ 1PV3A 3GMAA 2IDBA 2FBWC 2H89C 1OW7A 1DD3A 2QJYC 3GF3A 3AEBC 2E74C 2J5UA 3AE5C 2FXPA 3EWKA 2E74D 3LW5J 2O01J 2WPVB 1DIPA 2YMKA 3D6ZA 1GMJA 1Q90D 2E75C 2V7QJ 3AE8C 2E75D 2K9YA 2QIWA 4RKUJ 3Q3DA 3Q5SA 3AEAC 1OW8A 3GLMA 4XFJA 3RL0g 4IL6X 4OGQC 2E76D 3SFDC 4KT0J 1EXJA 4OGQD 4R4LA 2H88C 3H25A 1R8EA 4H0LC 1EXIA 2WSCJ 4H44B 4H0LD 1ZP0C 1VF5C 1IK7A 3IAOA 1KQFB 2BEZF 1HF9A 2E76B 1VF5D 3Q2YA 4PV1C 1AJYA 2OQQA 1HJ0A 4PV1D 1OW6A 4H13C 2QJKC 2P10A 5KLIC 3D70A 4Y28J 4H13D 1ZMEC 2MKVA 1RQVA 3SFEC 4TT3H 3G9RA 2BEQD 2QSIA 4I7ZC 4R4MA 2E74B 3AECC 1NGMB 2JP3A 3T97B 2D2CC 3AE4C 1KTMA 2ZT9C 4PV1B 2D2CD 3D6YA 2E75B 2ZT9D 1S1CX 3AE7C 4YXDC 1MKMA 1S5LX 3Q5RA 3GF7A 1JB0J 1WMKA 4GDOA 3B71A 1FDIA 3AEFC 3AEEC 1RQUA 1ZRTE 2QJPC 1U57A 4OGQB 2D2CB 3ABVC 4Z1MH 2ZT9B 3C8VA 1PL5A 4H0LB 2G3AA 1K04A 1VF5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E74 B;  4KT0 J;  5KKZ C;  2YIU C;  4PV1 B;  2E75 B;  2WSC J;  2WSE J;  4H44 B;  1S5L X;  4H13 B;  1JB0 J;  2QJY C;  2FYN C;  5L8R J;  2E76 B;  3LW5 J;  1ZRT E;  2O01 J;  2QJP C;  2WPV B;  4I7Z B;  4OGQ B;  1Q90 D;  2D2C B;  2K9Y A;  2ZT9 B;  3C8V A;  2QIW A;  2QJK C;  4RKU J;  5KLI C;  4Y28 J;  4H0L B;  2WSF J;  4IL6 X;  2QSI A;  1VF5 B; 
#chains in the Genus database with same CATH topology
 1A32 A;  4X62 O;  1G4Y B;  1K5S A;  3B5N A;  2YIU C;  2LW7 A;  3AE1 C;  4U3J B;  3ABK B;  3BCC J;  3OMI B;  2JVD A;  1SA0 B;  4JI0 O;  1NTM D;  4GOE A;  1XTC C;  1M93 A;  1GRJ A;  1K92 A;  3UM7 A;  3G67 A;  2OWO A;  5KLI B;  5APW A;  2AXT H;  4DUZ O;  4X1K B;  2RMK B;  2C9L Y;  3L71 E;  1CP9 A;  1L0N G;  4JI7 B;  1MAB G;  1P84 D;  3FYI B;  2D3O W;  4ZMD A;  3STL C;  4IGG A;  1NZ6 A;  3LSQ A;  4ICG A;  4MW3 A;  5KAI H;  2HOD B;  2ZQM A;  3OEE G;  1SQX D;  1N2D C;  3Q1M A;  1YVW A;  2WA3 A;  1X4T A;  4C7U A;  1KP2 A;  3NXS A;  4X1Y B;  2UUB O;  2ETN A;  4TUY B;  1PV3 A;  2IDB A;  1L0L H;  1I94 O;  3KZI E;  3N2G B;  4YHH O;  2QJY C;  3KKY A;  4NTW A;  1AJP A;  2BOB C;  2YXH A;  1LWU B;  2N9B A;  4K8Z A;  1IFD A;  3JAS A;  1MFZ A;  3L75 J;  1E79 G;  2R5B A;  2OTL P;  2WLJ A;  3AE8 C;  1WN7 A;  1EZV H;  3TDK A;  3CX5 F;  2IYO A;  1FD9 A;  3CD6 P;  3L70 G;  4FLU A;  2NPS B;  3CX5 H;  4KT0 J;  4X65 B;  1Y66 A;  2Y0E A;  4ZKP A;  4P9P A;  4XDL A;  4O2A A;  1YF2 A;  4ABM A;  1KZU B;  5KJ7 D;  1L0N J;  3CHX A;  5AVV B;  2WSC J;  4H44 B;  5KLV D;  3CRR A;  3WG7 B;  2OCC C;  3IAO A;  1D5A A;  2E76 B;  1GH6 A;  3IJ4 A;  3KZI Z;  3VYI A;  1L4A A;  1Q8I A;  4LFB B;  2ITD C;  3IR9 A;  5JWP A;  3AG3 B;  5KX5 B;  1MV8 A;  2WSF H;  3K59 A;  4PV1 D;  3RK3 C;  4J7Z A;  2QJK C;  1B6Q A;  3KHU A;  2MK3 A;  1RQV A;  1WT6 A;  1XL4 A;  1S76 D;  2QM4 A;  4F6R B;  2ZXW C;  4PJ0 H;  2C0W A;  3NR7 A;  4G28 B;  1QL2 A;  4CBC A;  3E1I A;  3BY6 A;  5E79 H;  1JMK C;  2IM9 A;  4MVQ A;  3ZJZ A;  1JOY A;  3M0A A;  1S1C X;  5AVX B;  1BSN A;  5EC1 C;  5K1X A;  1XL6 A;  1RE4 A;  2Y9Y A;  3ABM C;  3OTF A;  5EZY B;  2DOS A;  3BRV B;  1QEX A;  5B1B C;  3L70 J;  4IT5 A;  2M7W A;  4TT3 G;  4GZR B;  1U57 A;  1LUW A;  2QM8 A;  1NOH A;  2G38 A;  1RSO A;  5BR8 O;  1FPO A;  1L2P A;  4Z1M H;  2EUL A;  4X64 B;  3H1H D;  5HFL A;  4W80 A;  3MUD C;  2Q9I A;  1XQ8 A;  4B7E A;  2G3A A;  3ZN1 A;  3MTU E;  2CK3 G;  3ML0 A;  3HD7 C;  2HLD G;  4J9Y B;  1ROP A;  4I4T A;  1RE3 A;  3LSU A;  1FDO A;  4ASV A;  1CXZ B;  3H1I D;  1DD4 A;  2IZ0 A;  1J1E B;  4U3F E;  4B3S O;  2KLU A;  1W5C E;  5L8R J;  2P22 C;  3N4X A;  1NO4 A;  1SES A;  1SQB G;  1Y76 A;  2VS0 A;  1KUQ A;  4IHJ A;  3O6Q A;  5B1O A;  2YXL A;  2B88 A;  2QA4 V;  2E42 A;  4H44 D;  4LH7 A;  1KFM A;  2AEF A;  3BCC H;  5KHG A;  5JCO C;  1FZE A;  1Q7Y W;  4LP8 A;  4R7C A;  2EIM C;  1PNK A;  1PGO A;  1KMI Z;  1RF1 C;  3GMA A;  1EDK A;  1VQ6 V;  1WJZ A;  4JI8 O;  1G2C A;  3MP7 B;  2CGN A;  4I1L A;  2QWR B;  2YO2 A;  5AW5 B;  5F2V O;  1BE3 G;  1H8H G;  2QTS A;  2KP8 A;  2YMK A;  2JGD A;  2ZVN B;  1PM9 A;  2ZE7 A;  1YHQ V;  3TGU D;  3K06 A;  1FDM A;  2F93 B;  4K8X A;  4EYY Q;  3GLM A;  2B9Z A;  4UVC A;  3HKC B;  1GN6 A;  4Y99 C;  1HNX B;  5J2U B;  1GL2 C;  1B3Q A;  3BAB A;  1ORQ C;  1PNM A;  2HG5 C;  1SQB J;  4DR2 B;  1SKV A;  4H0L C;  4RO2 A;  3L75 H;  4W7Y A;  1V55 C;  3I5C A;  2FKX A;  1QCE A;  2YUA A;  4EOT A;  2FFD C;  3RK2 B;  3EXA A;  3TXQ A;  4GX2 A;  4QJF B;  2A06 D;  1AJY A;  4BIU A;  1HJ0 A;  3FD9 A;  4FJC C;  4J10 A;  2P10 A;  4X1I B;  1ZME C;  1AB3 A;  2P6J A;  2XAS A;  4LBE C;  3EHB B;  1L0N H;  1GTW A;  2FB5 A;  1JY3 P;  5LHH A;  3C3T A;  4WBN B;  1BE3 J;  3JAL B;  2D2C C;  3A0H E;  4K35 A;  1I08 A;  1Y74 B;  2PTM A;  2X6A A;  4HZ3 A;  4X88 A;  2B89 A;  4PDV A;  3BVH A;  4JV5 B;  2IJH A;  3ASN B;  3KQG A;  3ETQ A;  1H8A A;  3P3P A;  3WB1 A;  3B71 A;  4LGD E;  3AEF C;  1AVY A;  1VEW A;  4LLH A;  4FFB B;  4QMA A;  2QA4 P;  2BCC J;  3O8Z A;  2HLO A;  1AV1 A;  3ZRW A;  4GKJ B;  2UU9 B;  1RPR A;  3IFX A;  1BGY G;  4X1K A;  5IY5 C;  1K8A Q;  1F51 A;  1K04 A;  1VQ4 V;  1S72 V;  2W0X A;  1E79 H;  1HNW O;  1NU1 G;  1K34 A;  3RGB A;  3H1K D;  3QH9 A;  4X62 B;  1EZJ A;  2Z0A A;  1IBK B;  3CC2 V;  2HOD A;  3L70 H;  3ICX A;  4O4H B;  3A0H Z;  3ZX6 A;  4KHX A;  4O9B A;  1EN4 A;  2A79 B;  4JI0 B;  2Y9Z A;  3FKS G;  1YHQ P;  2QJ1 A;  4FK5 C;  1NTM G;  4X1Y A;  1MSD A;  4TUY A;  4JYY A;  1WRG A;  3N2G A;  3U1C A;  2XND G;  2ZE8 A;  2DYR B;  2W83 C;  4JI4 O;  1M57 B;  2UXB O;  2IBZ E;  4J7K A;  1LWU A;  3HPL C;  1FZC B;  2X6C A;  4TSF G;  1JJO A;  3H01 A;  4MVM A;  4GIF A;  1GK9 A;  2WLM A;  3ZHS A;  4FLW A;  1M1J C;  3RK2 D;  1Z5W A;  4BAY A;  1L0N K;  5DED A;  4LFC B;  3UO3 A;  2KYV A;  4N3Y B;  1SQX G;  3H1L E;  2AHY A;  2NPS A;  1V54 C;  1DD3 A;  2ZXX A;  4PI2 A;  4D6T D;  4JI5 O;  5GTH Z;  1IBL O;  4BWA A;  2EIN C;  3T1H O;  2Q7H A;  2M3B A;  1NU1 J;  2CTQ A;  3LDD A;  1NJI Q;  4GCZ A;  3CB2 A;  4MS2 A;  1I5X A;  2QIW A;  1NVO A;  3I56 V;  3AG4 C;  1ZWI C;  2M3E A;  2CPS A;  3SYC A;  3E22 B;  2KSD A;  4R4L A;  2NLJ C;  1NTM J;  3DC5 A;  2AXT E;  1G1I A;  1MZF A;  2CE4 A;  4LF9 O;  2Y0P A;  2J59 M;  3V2R A;  2Z3Y A;  4F6R A;  2CK3 H;  2CAZ C;  2DYS C;  3RGU A;  2C9N Y;  4RUF A;  1VQ8 P;  2QE7 G;  1K4D C;  2R44 A;  5CJ4 A;  2JEX A;  5AW0 B;  4JYC A;  3ZDM A;  5KLV G;  1VF6 A;  1S72 P;  2E5L B;  3SPI A;  3W7S A;  1AI4 A;  1UII A;  1V55 B;  1TAE A;  2MKV A;  2PP6 A;  4HNA B;  2W6I G;  2Z5I A;  1SQB H;  3G9R A;  1SLQ A;  2RNB A;  2KK7 A;  3HUS C;  4K3A A;  3WU2 Z;  3T4D A;  5H5N A;  4DK1 A;  2F66 C;  4O2B B;  3U0Z A;  3TXS A;  1XHZ A;  2ZT9 D;  3RL0 C;  4DR7 B;  1NWQ A;  3SJA C;  3L74 D;  2AXT Z;  3ZHT A;  3GF7 A;  1VQ7 P;  1I0H A;  3LNM B;  5CCG C;  1RQU A;  4FLX A;  2XHB A;  2QWO B;  2WT7 B;  2D2C B;  4JPR A;  2N1T C;  3PTZ A;  3CX5 E;  3G71 V;  1VQ5 P;  1BE3 H;  1BMF G;  3WB0 A;  4OWF A;  2ODM A;  4JYA O;  5IJ9 A;  3DSQ A;  2HHH O;  3SR2 C;  1JY3 N;  4UFZ A;  5KKZ C;  4Q20 A;  2QWQ B;  3OTO O;  3RK3 E;  1THZ A;  3I55 V;  4FVM A;  5KLV J;  2Q7C A;  1RY3 A;  2BCC H;  3AE6 C;  3JSL A;  3A2A A;  3Q4H B;  1LNQ A;  1ZW0 A;  2IFM A;  1BCC D;  3ABU A;  1VL2 A;  1W0K G;  4I7Z B;  3I56 P;  2EIL C;  2XUM A;  2ZXE B;  3WUV A;  4PJ0 E;  1PIX A;  2OIG A;  4OPH A;  4GLX A;  5E79 E;  3AED C;  5L3C A;  3P3N A;  1AVO A;  1FOS E;  4UB6 H;  2WSE J;  4HH2 A;  2NNU A;  3A8T A;  4U7J A;  5L3B A;  1R3I C;  1GDT A;  3CYO A;  4I6M C;  4J7J A;  3HKC A;  1SF9 A;  4J42 A;  1US6 A;  3CEI A;  3CC7 V;  1XBL A;  4JI8 B;  1K3E A;  4TV9 B;  2YO3 A;  4BRY A;  3LW5 J;  4I0X B;  5IYZ B;  1OX3 A;  2JWA A;  1EN5 A;  1AR4 A;  1OVR A;  2E75 C;  3K57 A;  2F1M A;  3T4Z A;  3HB3 B;  3OMA B;  3AG7 A;  1EZV I;  3CMA P;  2Q7E A;  1KBH A;  1WB7 A;  4PJ0 Z;  1NH2 B;  1N7S C;  1ZXG A;  2FYN B;  5E79 Z;  3TJT A;  1LTJ C;  4KP4 A;  2HJF C;  4FPP A;  5GON B;  4IOI H;  1H89 A;  4BIO A;  5H6R A;  1CSB A;  1AI6 A;  5B1A B;  2P67 A;  1M56 D;  1NU1 H;  1XDC A;  1JMM A;  4WBN A;  3G6E V;  3V4Q A;  2LP7 A;  3JAL A;  3Q2Y A;  3G71 P;  3VBB A;  1XRE A;  1WPB A;  5TJH A;  1Q6H A;  1DGS A;  4N78 E;  4JQ0 D;  3D70 A;  4H33 A;  1R5S A;  1NTM H;  2WLL B;  5AVY B;  4FFB A;  2EIK B;  5IYD O;  4FLZ A;  2A06 G;  2XAF A;  4X65 O;  4GX5 A;  2N9Y B;  5AW2 B;  2JP3 A;  2M5A B;  3HE5 A;  1GW3 A;  4J80 A;  4YPC A;  1NKN A;  2KQX A;  1PL4 A;  1MSW D;  1S5L X;  3ZED A;  3PHL A;  2XKM A;  1RM1 C;  3M91 A;  5EC2 C;  2GSM B;  1L8D A;  3D36 C;  4CZZ A;  5BVZ A;  3MHS C;  4O4H A;  4CH5 A;  1HGZ A;  2OIE A;  4HYT B;  4TWK A;  3WFV A;  2BAS A;  3IC9 A;  4PA4 A;  3MUD A;  4NTY A;  3K5M A;  3RL0 B;  1IUR A;  3ZCC A;  2QKC A;  4O2A B;  3HD7 A;  1T6A A;  2WVR A;  4LF7 O;  4XDJ A;  1IK9 A;  2V7Q G;  2JR8 A;  1VQO V;  5CA0 A;  3BFR A;  3CRQ A;  3RYH A;  3CC7 P;  2NZ2 A;  1BDC A;  1FZC A;  1LTG C;  3MDS A;  1L4A B;  3NMD A;  1XUQ A;  1S5J A;  4RWU A;  2ZFC A;  3B5N D;  1OMI A;  1RFY A;  3H1K G;  3K0G A;  3L36 A;  1NH2 D;  4BWN A;  1NU1 K;  1XHX A;  5AVS B;  5L3D A;  3APQ A;  5KKZ B;  2YIB A;  4X64 O;  1L0N E;  4FM1 A;  1EDI A;  2K37 A;  1FS0 G;  1PD3 A;  3M9Q A;  2AZ2 A;  2QE7 H;  4JI4 B;  1N0J A;  5JCO A;  1P4R A;  2UXB B;  3K5N A;  1G8M A;  4DV6 O;  5KLV H;  4ASU G;  1VQ9 V;  1LT1 A;  1NTM K;  1WPX A;  1NTZ J;  2Q69 A;  1RF1 A;  5L3F A;  3BEH A;  4UVA A;  3OJA B;  5CJ0 A;  1S5L H;  5B66 H;  1K7D A;  3G6E P;  4YJ3 A;  3UT5 B;  5CB4 A;  1YJ9 V;  1WB8 A;  2N05 A;  2ZIM A;  1KB9 I;  3E22 A;  4YY3 O;  1RSO B;  4HBN A;  1RF0 C;  2FXM A;  2JDI G;  3SPG A;  1UFI A;  1FE6 A;  3NTN A;  2Q9L A;  3HE4 B;  1IBL B;  5EFW B;  1GMJ A;  3T1H B;  4D6T G;  3G6B A;  1SQV K;  3KG2 A;  3M9B A;  2V7Q J;  1JQ0 A;  1P7B A;  2IJI A;  3OR7 C;  2WSE H;  1AVM A;  2LW1 A;  2Q4P A;  4I4T B;  5CBH A;  1TUE B;  2ZKO A;  3JCU H;  1J1D C;  1WNS A;  2W6A A;  1JO5 A;  2IZ1 A;  4OGQ C;  3H1K J;  4HB1 A;  1T2K D;  2H88 C;  1IJD B;  1XEQ A;  4PA3 A;  3CXH D;  3ABL C;  3LW5 H;  4GOD A;  2YKP A;  3FB5 C;  1NTK D;  3LNN A;  4LF9 B;  1S9K E;  1PP9 D;  2BEZ F;  3O6Q B;  2QRX A;  3A0B E;  5KHK A;  3HKD B;  1SZT A;  2GM4 A;  3A0R A;  4F4L A;  3SYP A;  1L4A D;  4DW0 A;  5IDJ A;  4Y28 J;  2WT7 A;  2HR3 A;  1HNX O;  2E74 B;  3P32 A;  4IYH A;  3FB8 C;  1QHT A;  3SJC C;  5LOV A;  1U97 A;  4GOF A;  1U7M A;  3GW6 A;  2JGD B;  4JF7 A;  5B5E H;  2FYU H;  2PGG A;  3CLQ A;  2OTJ P;  2HFE D;  1IFI A;  2LXB A;  3L73 D;  1W2B O;  3L74 G;  3N2K A;  1NR1 A;  3A0B Z;  3Q4H A;  4P30 A;  1VQ9 P;  2AGA A;  3AG1 C;  1H88 A;  5LP6 B;  2EIJ C;  2A45 I;  5DJU B;  5CBN A;  3IGA C;  2OTL V;  3A2F A;  3FB6 C;  2W8Z A;  2HPC B;  3V5B A;  4BIZ A;  4JYA B;  3CD6 V;  3IAY A;  2Z4E A;  1K4C C;  5C8Y A;  4DR5 B;  1MNG A;  1NHL A;  1AQ5 A;  4ASW A;  4NKG B;  3AEI A;  2P90 A;  3X2Q C;  4GKJ O;  4NPE A;  1M1K Q;  1K73 Q;  3B8E B;  2BSK B;  4PD4 I;  1TU3 F;  1KOR A;  1OVU A;  5DN6 G;  1JR9 A;  1URQ B;  1ZV8 A;  1IXB A;  3M7M X;  2Y48 A;  2W6B A;  3ASO B;  1GU5 A;  1QLE D;  4NR1 A;  1BCC G;  1ZLL A;  4I0X A;  4XDK A;  5IYZ A;  4X89 A;  1YEW A;  3AE3 C;  1KEC A;  2IW5 A;  1SC5 B;  1YQ3 C;  1IBK O;  2QJP B;  3PLN A;  4DV5 B;  1LR1 A;  1OCC C;  4ZOL B;  1QQC A;  1Y8A A;  3ZRW B;  5LMU B;  3JAW B;  2QGN A;  2IYP A;  3ZRS A;  3CWB E;  1JA8 A;  1BE3 E;  5GON A;  2E74 D;  2K3R A;  5JVD B;  2B1I A;  4L76 A;  1YTZ I;  2FYU K;  4R50 A;  2L5G B;  2WLK A;  2ZE6 A;  3ZHU A;  2XAG A;  1OZ0 A;  1QU7 A;  1NTZ H;  2P5O A;  2XOK G;  1Y6X A;  1FAV A;  5H9C A;  1N34 O;  4XFJ A;  1N8R Q;  2A3Q A;  5AW3 B;  5EBM C;  2BCC E;  4QE9 A;  5LXT A;  1XTG B;  4LFC O;  2DWE C;  1BZK A;  2KG7 B;  1J95 A;  2WLL A;  4WY4 B;  1M5I A;  3V2Q A;  2B9B A;  4OX9 O;  1HBW A;  1YCI A;  2GTS A;  3AG2 C;  2Q0A A;  2V7Q H;  2H8P D;  2M5A A;  2A45 G;  1WAZ A;  3QF7 A;  5E1A C;  1K8A W;  3B4S A;  4P2Z A;  4EDF A;  2JIZ G;  4UCR A;  2WSS G;  4JI1 B;  2P4K A;  1GAX A;  3U11 A;  1JCD A;  4UB6 E;  3H1K H;  4LF4 B;  1X8Y A;  2BTQ B;  4U3F D;  4TQD A;  3HUS A;  3VMX A;  1OFC X;  2PAJ A;  4PDL A;  5CHX A;  3T1Y B;  1S0V A;  2Q8V A;  1U7J A;  3W7X A;  3P8C D;  3QWO C;  1MKM A;  4TLF A;  5CCG A;  3IF4 A;  2QM7 A;  3JAT A;  1SQP H;  2E5L O;  4JAS A;  2UXC O;  1NI8 A;  2QWN B;  1W2B U;  2JDI H;  4YIP A;  3OW2 O;  4UB6 Z;  1SFC C;  1NTZ K;  1OJH A;  3TNU B;  2CUG A;  3M99 B;  4YIO A;  4B3R O;  1NU1 E;  2RDC A;  1PGQ A;  2JO1 A;  5CCH C;  3GWK C;  4LF7 B;  1EBO A;  2YC0 A;  3KCY A;  1SQQ D;  4DR7 O;  3CE2 A;  1QL1 A;  1NJI W;  3J81 N;  3MHV A;  4QE7 A;  4YTP C;  1VQM V;  2Y0I A;  1L0L K;  1GTO A;  1NVP B;  1KKC A;  1M4U A;  3B8N A;  3UT5 A;  4LWS B;  1NTM E;  2R3C A;  3V2P A;  2WPS A;  3JYC A;  3M8A A;  1NH4 A;  1X79 B;  2OYI C;  2HVJ C;  3JSN A;  5H2F H;  4NXM O;  4UUJ C;  4O4I A;  3VQX A;  2QTO A;  3HE4 A;  3DC6 A;  4J9Z B;  1CI6 A;  1WLE A;  4DV6 B;  1NYH A;  2YKO A;  2OYH C;  4I55 B;  3X2Q B;  1SS3 A;  1JFF A;  2JEE A;  3H1J H;  3L72 H;  1SQV E;  5AVU B;  1VP7 A;  4WBA A;  1KYO I;  5EIB D;  2H89 C;  4C7N B;  1SQF A;  4DT0 A;  3G3Z A;  1BQ0 A;  5LL6 Y;  2NPS D;  3F5H A;  2EJ7 A;  4YY3 B;  2Q6A A;  2DMX A;  3R2P A;  1CPY A;  2PZS A;  1GW4 A;  5IJ9 B;  5KHI A;  2YIU B;  3JCZ A;  2J58 A;  1SQP K;  3E1R A;  3HKD A;  1IZN B;  3AK2 A;  2ZYD A;  4JAU A;  2E76 D;  1KB9 F;  1SS1 A;  2LJ2 A;  3E8F A;  4JI6 O;  3G4S V;  5IT9 N;  2LO1 A;  2LFS A;  1FXK C;  1KB9 H;  1ZX3 A;  3OM3 B;  4UB8 H;  3K08 A;  1NTK G;  3OFN G;  1HJB A;  1PP9 G;  3CCQ P;  3S3X A;  1PPJ G;  1M90 Q;  4H13 C;  1S5L E;  2Z5H A;  2XAJ A;  5B66 E;  2QJY B;  2DWD C;  2CPB A;  3OA7 A;  4R4M A;  1NGM B;  4GUN A;  5LP6 A;  1VQM P;  1NS1 A;  4BRY B;  3C90 A;  4MTG A;  1O9G A;  4MSW C;  2X6B A;  1AP5 A;  3RYF B;  1F4N A;  3K03 A;  2HPC A;  2P1J A;  3ZMU A;  3KYQ A;  2IBZ D;  1KIL C;  2PF4 E;  1P84 I;  1XNQ O;  4YJ2 A;  1R3L C;  3JCU E;  1KC8 Q;  4O4J B;  1H2G A;  5IE9 A;  2LFR A;  1QNM A;  3M06 A;  1JTH B;  2PI5 A;  2RMZ A;  2CTP A;  3B2E E;  1PFI A;  4AQY B;  3H1L D;  1QR8 A;  2YSU B;  3L73 G;  1GM8 A;  1HTL C;  2XV5 A;  1S5L Z;  2BSK A;  1AR1 B;  3OW2 U;  1NR7 A;  2OCC B;  5KHJ A;  1VQK V;  5B66 Z;  1QGK B;  1URQ A;  2WSC H;  5M1B A;  1HDJ A;  1OCZ C;  3RK3 B;  3VQY A;  3E86 A;  1MZ9 A;  2QJK B;  1P7G A;  2ZIO A;  3HKB A;  3OAA G;  4I5S A;  1ZR4 A;  1VIB A;  1NKD A;  2QVA A;  4CH6 A;  2ZXW B;  1KD1 W;  4ZOL A;  4HKZ H;  4DR1 B;  4BW9 A;  3JAW A;  3JCU Z;  1VQ8 V;  5EBL C;  2N04 A;  2A45 H;  3N7N A;  2R9R B;  3G4S P;  5JVD A;  3HE5 B;  2G8Y A;  2WSS H;  5APV A;  3AE2 C;  4GX0 A;  3ABM B;  5B1B B;  5B5E E;  2FYU E;  1N4C A;  2WMM A;  5KUM A;  1B04 A;  2YKQ A;  1EDL A;  4PD4 F;  1VAR A;  1OHH G;  3OMN B;  2KG7 A;  3L73 J;  1KN7 A;  2O01 J;  4WY4 A;  4PD4 H;  1Q3E A;  5KAF H;  3HD7 B;  1VQ7 V;  4CS2 A;  5CA0 B;  2JK5 C;  3RYH B;  4FM2 A;  1R6K A;  5FL7 G;  1N34 B;  3VMA A;  4LCU C;  2FML A;  3PRJ A;  4DO2 A;  3SFD C;  1VQ5 V;  4ZKU A;  1MA1 A;  1Y67 A;  2BOC C;  2AHZ A;  3GB7 C;  1FFX B;  2BTQ A;  1JY3 O;  3FWL A;  1H2L A;  1KQS O;  3BAT A;  5B5E Z;  3HKE B;  3CX5 D;  1VF5 C;  4AHC A;  4OX9 B;  1M9N A;  4IFM A;  1BGY J;  4GX1 A;  4WFA V;  1MG1 A;  2AEJ A;  1D2D A;  4JZG A;  3RYI A;  2EIM B;  4L87 A;  4JGS A;  2ARH A;  5KHH A;  4NXN O;  3RK3 D;  1RF1 B;  1VQK P;  2M6Y A;  4YJ3 B;  5CB4 B;  4TT3 H;  1QVG O;  1D5N A;  5JQG B;  2UWJ E;  4QGP A;  3RT3 C;  4DW1 A;  5IYC O;  4RO0 A;  4U3F G;  3B5N C;  2FY8 A;  3DXR A;  2OAR A;  3SYO A;  3CSX A;  3TNU A;  5FPR A;  1J5E B;  4YXD C;  3A5T A;  1USD A;  1NTZ E;  1R3K C;  2ZYG A;  1MUU A;  3CC4 P;  4PI0 A;  1ZUQ A;  5KAI E;  4Y99 B;  2Q1K A;  2Q3E A;  1GL2 B;  4DV0 B;  3CS5 A;  4WB4 A;  2UXC B;  2YMY A;  1JOC A;  4H0L B;  5DEC A;  4LWS A;  1SQX J;  2Q6Q A;  3JD0 A;  1GZL A;  1L0L E;  3QVN A;  4YXW G;  2GA1 A;  4LF6 B;  1ZLZ A;  4B3R B;  3HD7 D;  2ILM A;  2FFD B;  3CMA V;  1FU1 A;  4J11 A;  4UXN A;  1VQL P;  1M57 D;  4X9Q A;  2QWP B;  2QDO A;  4MW8 A;  4MVO A;  1AIL A;  4I55 A;  1G1J A;  1EZV E;  1SQQ G;  2K88 A;  4B86 A;  3CRA A;  3AE9 C;  4RQE A;  3R4Y A;  4C7N A;  1ZSP A;  2P06 A;  1RH5 B;  2WAM A;  3OE7 G;  1W2E A;  3SGI A;  4U3F J;  3CCJ V;  5KAI Z;  1LJ2 A;  4NXM B;  2YIB D;  4WFE A;  5LOV B;  1BQZ A;  1OCR C;  1Q43 A;  1EQ7 A;  5CBO A;  1PPJ H;  1DF5 A;  3H1H G;  4QNH B;  4J41 A;  3EQ2 A;  1H0T A;  4DR5 O;  1OW7 A;  1Q7Y Q;  2ZIN A;  4N78 D;  3N2K B;  5FLX N;  1SQP E;  3T97 A;  1COW G;  4BW5 A;  5IY5 B;  4PHZ A;  2Q73 A;  3MIW A;  3EWK A;  1AR5 A;  1T3U A;  2QR4 A;  1K5Q A;  2WPV B;  3H1I G;  5BU8 B;  1Q82 W;  3VOP A;  1PGP A;  4EKW A;  1XMO B;  5BMV B;  2WTY A;  4D7T A;  1OW8 A;  1BSH A;  3RL0 g;  1KYO F;  2QEX P;  2ZD9 A;  5C8Y B;  1VMG A;  1JVM A;  1SQQ J;  4DV5 O;  4RUE A;  1XOU A;  1SQB K;  3JSV C;  1JM0 A;  3H25 A;  1P49 A;  4JI6 B;  3L73 H;  3VOU A;  1GL2 D;  1KYO H;  2O01 H;  2HG5 D;  5LMU O;  2MJZ A;  3PP5 A;  4H0L D;  1KQS U;  5H2F E;  4A5U B;  3L9D A;  4C7R A;  1NKZ B;  1N0N A;  4IIJ A;  4FM0 A;  2XU6 A;  3SWK A;  3RYF A;  1M1J B;  1TGO A;  2B1G A;  3H1H J;  5B3S C;  3T1C A;  1OW6 A;  1X59 A;  1LTB C;  2IU3 A;  3WUU A;  3P8M C;  3H1J E;  3OT7 A;  3L72 E;  1V54 B;  4O4J A;  2O3J A;  2UUC B;  4EEQ A;  1JTH A;  3TGU G;  3K5O A;  2HP8 A;  3E83 A;  2EIN B;  2CTW A;  5KMG A;  3F7Y C;  4GKG A;  1QVG U;  3OUF A;  3H1I J;  1BGY H;  2D2C D;  1FXH A;  3FFQ A;  3CXC U;  2P7J A;  2JGU A;  3SJQ C;  3CJH A;  1M1K W;  1L0N D;  5AW4 B;  3AG4 B;  1M8O B;  2V4H A;  3AEE C;  4JI1 O;  3CCJ P;  5H2F Z;  4W4K A;  1XNQ B;  3NFQ A;  3IC7 A;  3BCC E;  1QLE C;  4LF4 O;  2Y69 C;  1N32 O;  2IBZ G;  3GHG C;  4MN4 C;  2ZVO B;  5LXT B;  2VQE O;  2DW3 A;  1Q81 Q;  1BSM A;  3CRC A;  5CCH A;  2DYS B;  1KB9 E;  2KI7 B;  5IYB O;  3D71 A;  3T1Y O;  5EK0 A;  2OYQ A;  2XND H;  1OXZ A;  4UB8 E;  1P84 F;  2ZYA A;  4O4L A;  2UXD B;  3BA9 A;  5BZB A;  3JAK B;  2C2A A;  1HW7 A;  1P84 H;  1YI2 V;  1HGV A;  2ZE5 A;  4LC1 A;  1N36 O;  2YEV A;  5CBF A;  2OYI A;  1SQX H;  3GWO A;  3MHH C;  2XDJ A;  3HUS B;  4W4L A;  1N8R W;  3TGU J;  2VWK A;  2Q0O C;  1LP1 B;  4DJG A;  5LYJ A;  3B09 A;  1KIL E;  2OYH A;  3RVZ A;  1WA8 B;  4DV1 O;  3W67 A;  1S9K D;  3L75 E;  4B3M O;  2RN9 A;  3EFG A;  1GMG A;  2IU0 A;  1R3J C;  4RQF A;  3JAT B;  4AI8 A;  3BRT B;  3QTC A;  2N1T B;  4KUM A;  1YTF B;  1ZL8 A;  4U7O A;  1PKX A;  4UB8 Z;  1SVF A;  1S3J A;  1OZH A;  3AE5 C;  1FJK A;  1FFX A;  1GN4 A;  2WLI B;  4RAI A;  3HKE A;  1BS3 A;  3M0D C;  1LTS C;  5LGT A;  1I7F A;  4XE5 B;  2OTJ V;  4Q6G A;  1LT9 C;  2N74 A;  1DTO A;  3KCX A;  5C93 A;  3APO A;  1SRY A;  1VDF A;  3TK1 A;  3ZHQ A;  1XIL A;  1R6T A;  5KJ7 C;  1FXK A;  5B1N A;  2EIL B;  5JQG A;  2W6J G;  3LUT B;  3ZMT A;  2ATK C;  4O4I B;  2KXP B;  3K79 A;  4TV8 B;  3ABK C;  1JEK A;  3FXE A;  4PV1 C;  5L3E A;  3JD4 A;  1CI6 B;  1SQX K;  3K0D A;  4EIJ A;  2DE0 X;  4FLY A;  5KLI C;  1SQQ H;  1VQP V;  5KTB A;  1JFF B;  4NXN B;  3UQ8 A;  2BEQ D;  3L70 E;  1JPX A;  3OAK A;  4B08 A;  4WFF A;  1GL2 A;  3V6I A;  3AE4 C;  2WPQ A;  1TVK A;  3ZBH A;  2YI9 A;  1YI2 P;  5KA6 A;  2E75 B;  5APT A;  1EC5 A;  5B3S B;  4PD4 E;  4MTX A;  3ZRV A;  1B06 A;  1KIL A;  3RL0 D;  2VRZ A;  2FL4 A;  4DV3 O;  1KFN A;  3H1H H;  5JJN B;  2R3S A;  5DJT B;  4MVR A;  2FFD A;  3CPW O;  1N7S B;  3II6 A;  5CCG D;  1LTJ B;  1OVV A;  3UCS C;  4FZ0 A;  2N1T D;  1YTF D;  4X8A A;  5AVQ B;  3H1I H;  3EFF K;  4DR4 O;  1LWU C;  3CCU P;  3O65 A;  3ETD A;  4FIP C;  1BHA A;  4WWI A;  3CWB D;  1BE3 D;  5KLV K;  2VQF B;  4CH4 A;  4DV4 O;  4N6J A;  3CME P;  3E8G A;  1ZN5 A;  4D6T J;  3L71 D;  4Z1M G;  4JAA A;  3H9V A;  3C9I A;  3UKM A;  3A0H H;  2DQ3 A;  5LMN B;  2RKL A;  2ZM6 O;  4BR6 A;  3EVK A;  3CL3 D;  2BCC D;  3K9S A;  4CC6 A;  4B3T O;  1F7Y A;  4DRX B;  4AQY O;  4H44 C;  2IH3 C;  4UCS A;  5FPO A;  1K05 A;  3WG7 C;  1OCO C;  1A02 J;  1FC2 C;  2E76 C;  1ZTE A;  5CN0 A;  2WSF J;  5APX A;  1FJG B;  2KIK A;  1RM1 B;  3AG3 C;  5BMV A;  1MFT A;  2W90 A;  4HJG H;  4YJ2 B;  5LHI A;  2PFX A;  2NR5 A;  1T8Z A;  2RN0 A;  3TGU H;  3GF3 A;  3B77 A;  1DLB A;  2YID A;  1M90 W;  5GTH H;  1IX9 A;  3F89 A;  3VP8 A;  4RJT A;  4DR1 O;  3RYC A;  1VQP P;  1GU4 A;  1HUC A;  1X9V A;  1DEE G;  1SQB E;  1VF6 C;  2E75 D;  2I8D A;  2K9Y A;  4EFB A;  4PA9 A;  2RH0 A;  1K33 A;  2XZR A;  3RBX A;  4I9W A;  3MD0 A;  3IFM A;  1Q86 Q;  1K9M Q;  4UCT A;  4L8J A;  2ZJS E;  5KA5 A;  2I1J A;  1M1J A;  1N7S D;  4X66 O;  3RN4 A;  1FZB A;  3HKB B;  3OUS A;  1FZA A;  5EYP B;  3ZMZ A;  3KDP B;  4GYC B;  1KV4 A;  1ENV A;  3L74 J;  1EXI A;  2A06 H;  4ZI7 B;  4K0K O;  4OH8 B;  1JCH A;  4KXR A;  3SPH A;  1IK7 A;  1LT9 B;  3JAR A;  4W7Z A;  1GM9 A;  3MZW B;  1J1E C;  2AEM A;  1NU1 D;  4DXW A;  3PN1 A;  2VWJ A;  1BHB A;  2P58 A;  2E5T A;  1PPJ E;  2GHY A;  2XAH A;  5D5Q A;  2GDS A;  5KUK A;  2PRR A;  2DN9 A;  4PDR A;  4OVN F;  3LDC A;  4DV2 O;  4I50 B;  4GT1 A;  3TET A;  3AEC C;  1KTM A;  4QPJ A;  1FFT B;  4I9Q A;  2K9J A;  3WU2 H;  4PV1 B;  3CCE V;  2L91 A;  2XT9 A;  3VQW A;  2XTA A;  5LA6 B;  1Y47 A;  1MZE A;  5TIS H;  2ZDI C;  2WPR A;  1BDD A;  1J1D B;  5LBQ A;  4MTO A;  4DYL A;  1BCC J;  4UCO A;  1ZRT E;  1IZ3 A;  4U7N A;  3K5B A;  4OGQ B;  5D5P A;  3TYY A;  2K1E A;  3JAK A;  2M8R A;  3BVO A;  5J9P C;  3CPW U;  2B87 B;  2FKW B;  2QG4 A;  1GKF A;  3ABV C;  1W0J G;  1GK6 A;  2LQT A;  1HR0 O;  1DK1 A;  2Y4U A;  1UPG A;  3ABL B;  1N32 B;  2KS1 A;  1SQV D;  3M9H A;  5ITZ B;  2VQE B;  4DR3 O;  1KYO E;  3L73 E;  1IFM A;  5AW1 B;  1FBM A;  3OGI B;  1GN2 A;  5K1P A;  5CA1 B;  1LP1 A;  1IFJ A;  1H2N A;  1S2E A;  2AW9 A;  3OR6 C;  5IWA B;  3JD1 A;  4QPK A;  1NQT A;  2W27 A;  4DUY O;  1UIX A;  1J5E O;  1URQ D;  4TOI A;  1WA8 A;  3D3I A;  3W68 A;  3RYI B;  1VQN P;  1XNR O;  4WVZ A;  1HWY A;  2KZJ A;  3AEG C;  2ADP A;  3SWF A;  1Y9B A;  4MT8 A;  2N1T A;  1N36 B;  4DV0 O;  3PJS K;  2W6J H;  1LTI C;  2IFN A;  2Y0D A;  3B40 A;  3WB2 A;  1KP3 A;  1BGY E;  3DXR B;  2WLI A;  2X0L A;  4UV8 A;  5CMU A;  3J80 N;  3CXH I;  1CW5 A;  2WLN A;  4LF6 O;  3CCQ V;  4D6T H;  3RK2 C;  1X0T A;  2JEU A;  4DV1 B;  1IBM O;  1URF A;  4B3M B;  3CRM A;  4NPD A;  1EDJ A;  4JI2 B;  1A02 F;  3AG1 B;  3MAQ A;  1OCO B;  2EIJ B;  2Q5U A;  3ZIA G;  1JY2 N;  2KZI A;  3LSS A;  2DJV A;  1FZF A;  2W0F C;  2KNC B;  2Y4T A;  3RW0 A;  1HVV A;  4RES B;  4WY4 D;  3ASN C;  2EZP A;  2ZR2 A;  3Q5S A;  5JJJ B;  3AK3 A;  4TV8 A;  5FNV A;  5BXZ A;  3BRC A;  3CCM V;  2XAQ A;  1FOS F;  3CCE P;  1H2K A;  1QBZ A;  3QG5 A;  4KHP B;  1D7M A;  4XA4 A;  4X20 B;  2A9H A;  4OGQ D;  1P84 E;  1QLN A;  4WCE V;  4NB5 A;  1JCC A;  2YS8 A;  2A0L A;  1SQX E;  1R1B A;  2P4V A;  1ZP0 C;  1E1Q G;  2IJK A;  2R72 A;  3TSI A;  3F5T A;  4R6Z A;  2GUZ B;  4IFF A;  4MVU A;  2JRI A;  1XMO O;  1NBM G;  1PV0 A;  3WUT A;  1EM1 A;  1OCC B;  1DH3 A;  1N7S A;  3D8C A;  1H0T B;  1LTJ A;  2F43 G;  3L74 H;  3T97 B;  3SYA A;  4CPG A;  2DYR C;  5GW7 A;  1M57 C;  2ZT9 C;  2YXR B;  1TUB B;  1FZC C;  4GKK O;  3AE7 C;  1OIP A;  1JB0 J;  1FZG A;  4GDO A;  1YTZ T;  5AVZ B;  4NYK A;  2PYJ A;  4DV3 B;  3P8C E;  1FXV A;  2JJ2 G;  2WPD G;  3W7U A;  1YZB A;  1Q5O A;  1PGJ A;  4EB6 A;  3GHG A;  2CH7 A;  2Q7G A;  4LF8 B;  5KLV E;  1N73 C;  2FYU D;  2GUS A;  1OV9 A;  5L3G A;  2DQ0 A;  2ZR3 A;  3BPZ A;  2UUC O;  2HYN A;  3AG2 B;  2ZNI A;  1S4X A;  5IJ0 B;  4DR4 B;  2WZ7 A;  1NVP D;  4DRX A;  4AQR D;  2PUS A;  4LNU A;  3SJB C;  3E8B A;  2YXY A;  1BT8 A;  1BCC H;  2ADQ B;  4IIJ B;  4CH3 A;  3G80 A;  4DV7 B;  1N33 B;  4DV4 B;  2QKA A;  2IH1 C;  3CWB G;  3D36 A;  5JH7 A;  2KKW A;  1AJN A;  1SQQ E;  3K9A A;  3RVY A;  2UUA O;  2KSJ A;  3L71 G;  3LIE A;  2WQY C;  2ZM6 B;  3CCM P;  5DM6 V;  1R73 A;  3BAS A;  5KMG B;  4B3T B;  3H32 B;  3FGA D;  4LFA B;  3C3S A;  2BCC G;  2YI8 A;  1YDX A;  2Q68 A;  2QSA A;  3CJH B;  3STZ C;  2LXC B;  3IN6 A;  1YBK A;  4PA6 A;  3H1H E;  2KLV A;  3OD4 A;  2UXD O;  3BHP A;  5HFM A;  1LUV A;  2KUB A;  1NTK J;  3PH0 A;  2KB1 A;  3ITK A;  1PP9 J;  3E7K A;  1QR9 A;  3AEB C;  4L73 A;  2J5U A;  1SFC B;  4ZBM A;  3E2E A;  3HR0 A;  3CCS V;  5EYP A;  3H1I E;  2O57 A;  3M0D A;  4ZI7 A;  3OGC C;  4DR6 O;  4WFH A;  3F7V C;  1LT9 A;  2R9I A;  2CGO A;  4RKU J;  2H7H A;  3CC4 V;  4HAM A;  3VMY A;  2WIT A;  4DOJ A;  4O4L B;  4IL6 X;  4NTX A;  2O1J A;  3CWB J;  3B8M A;  5KJ7 A;  4JYB A;  1EXJ A;  1NTZ D;  4CS3 A;  2E43 A;  5AW8 B;  4TQF A;  4X66 B;  3L71 J;  2NN4 A;  1M56 C;  1XMQ B;  5BY1 A;  2E3C A;  2YDE A;  1H8E G;  2YEV B;  5AW7 B;  4I50 A;  2PGD A;  2OYI B;  1RF0 A;  3HTK B;  2EJR A;  2R70 A;  4WFB V;  2HVK C;  4K0K B;  2DW4 A;  4U3J A;  1Q81 W;  2OTK E;  1H38 A;  1HF9 A;  1SA0 A;  1LGH B;  5LYJ B;  4Z2W A;  1VQL V;  2AZ0 A;  1L0L D;  2OYH B;  4AYC A;  2R9A A;  5LA6 A;  1IDS A;  1BL8 A;  1IVS A;  2PY5 A;  1HWT C;  1X22 A;  1Y4M A;  2ZCE A;  3UO2 A;  4JTD B;  3KXD A;  1Z5V A;  1VQ6 P;  4JI3 B;  2QSI A;  4I7Z C;  2B87 A;  2FTK A;  1ZL8 B;  3K58 A;  4DV2 B;  3S1K A;  4ZHQ B;  3TGU E;  4G2K A;  2QKS A;  1EZV D;  4UVB A;  1DEB A;  3TCU A;  5GTH E;  3D6Y A;  3VMZ A;  5ITZ A;  1YYC A;  2R32 A;  4NPF X;  4LR3 A;  5CA1 A;  2KSE A;  3FX0 A;  1Z2G A;  3SPC A;  4DK0 A;  2WLH A;  4DUZ B;  1SQG A;  1HH0 A;  1NAF A;  3GG2 A;  3T2M A;  4N21 A;  3AK1 A;  4IL6 H;  2ZT9 B;  3A0B H;  1QVF O;  1TA8 A;  1FYJ A;  2PI4 A;  4CS4 A;  2F4V O;  1AFO A;  4ZNC A;  1FXK B;  5GTI H;  4WF9 V;  3I5D A;  1YJW V;  1HR0 B;  1SFC D;  4OXS A;  1SQP D;  2K9P A;  4DR3 B;  2A06 E;  4UV9 A;  2LKM A;  1VPC A;  1SQV G;  5CCH D;  1UJW B;  2QEX V;  2UUB B;  2WWW A;  2GV9 A;  5J2T B;  3CCS P;  4DUY B;  1N73 B;  1I94 B;  4H13 B;  3VP9 A;  3Q5P A;  4YHH B;  2FYN C;  3FAV B;  4H37 A;  2H43 A;  1XNR B;  1WP8 A;  3CCR V;  5K5G B;  4AIL C;  5JJE B;  2EX3 A;  2JWD A;  5B1A C;  1G6U A;  4FLV A;  3W7T A;  3RBZ A;  2CDY A;  3WU2 E;  1TVK B;  1KQG B;  2RCV A;  3J7A U;  3O9O A;  2KNC A;  3UIA A;  2UXX A;  3ZN0 A;  2OCH A;  5KX5 A;  1KIL B;  1HP8 A;  3ZS8 C;  1JMB A;  1LTT C;  2KB7 P;  4L74 A;  2VQF O;  4N23 A;  3S9O A;  5TIS E;  4UCU A;  1YXB A;  1IBM B;  2KOG A;  2FBW C;  2EIK C;  2BTO A;  1H2S B;  2OGU A;  1R6N A;  4X20 A;  4R8C A;  5LMN O;  1PZQ A;  3H1K E;  3H1J D;  3L72 D;  4PDM A;  3D6Z A;  1HNZ O;  1Q90 D;  1T5E A;  3CXH F;  1VQ4 P;  5CBG A;  3QO7 A;  1GK4 A;  5EZY A;  1SQV J;  1OCZ B;  3U1A A;  1FS0 E;  2GUZ A;  1EN6 A;  3CXH H;  1FJG O;  3CC2 P;  3JD3 A;  3MGN A;  1YIT V;  3VN0 A;  1NTK H;  1T2K C;  2LGQ A;  3JC2 2;  1PP9 H;  1AI7 A;  2IBZ I;  1U96 A;  1F4M A;  3THO A;  1AQT A;  4OPA A;  1R8E A;  3TF5 A;  1YIJ V;  4G27 B;  3QO5 A;  2VRS A;  3BCC D;  5TIS Z;  2EBO A;  4JBZ A;  4ZKI A;  5EBW C;  2E5Y A;  4ZIB A;  1SER A;  2B5U A;  3SPJ A;  1TUB A;  1KB9 D;  2YIC A;  1L4A C;  1YJW P;  2OQQ A;  2OT5 A;  4E4E A;  3BA8 A;  3CWB H;  4D6T E;  5BR8 B;  1M56 B;  1NAY A;  4H13 D;  1R5L A;  2V1D A;  3USS A;  3L71 H;  2O01 N;  4KFM A;  2RQ6 A;  2JJ1 G;  1KKD A;  1K97 A;  3FXD A;  4L75 A;  3SSU A;  3V2N A;  3DGE A;  2O1K A;  2SPZ A;  2JJL A;  2L35 A;  3CCR P;  3RYC B;  2ZDI A;  5IJ0 A;  3D3Q A;  4B3S B;  1WMK A;  3K04 A;  4GKK B;  2HFE C;  4LF5 O;  1RE4 C;  4FFK A;  1PL0 A;  1JJ2 U;  1KIL D;  2M0B A;  2LGW A;  2MW2 B;  5AVW B;  3KZI H;  4MVZ A;  3L75 D;  1N7L A;  3C8V A;  2H94 A;  3BAA A;  3E8H A;  3CP1 A;  2JS3 A;  1ARO P;  2YIA A;  3V4W A;  1QVF U;  1XI1 A;  1VF5 B;  2FYU G;  1NTK K;  2XNX A;  3H32 A;  1IC2 A;  2Q5Z A;  3JAR B;  1RE3 C;  3CCL V;  3KPE A;  3ZMV A;  1ZR2 A;  1VF7 A;  1K73 W;  2L6L A;  5J2U A;  5AW6 B;  1KU9 A;  3ZHV A;  3R66 A;  1K9M W;  1Q86 W;  5APQ A;  3OEH G;  3VTP C;  1ZAU A;  4JI7 O;  1LTA C;  2UUA B;  4I2L C;  3L74 E;  1YIT P;  3B5N B;  4PA7 A;  1YQ4 C;  1SFC A;  1JX9 A;  2K9J B;  1E1R G;  1KD1 Q;  2HEP A;  1RHZ B;  4QIW F;  1YIJ P;  4JZ2 A;  2YXQ B;  5IWA O;  4X1I A;  3CX5 I;  2F95 B;  3H1L G;  1Q6I A;  2I1K A;  4C46 A;  1GN3 A;  3VQV A;  1CEZ A;  1GD2 E;  5LGN A;  1AJQ A;  4CC5 A;  1Y74 A;  2E74 C;  3DTU B;  3A7O A;  3RWR D;  2FXP A;  2KS1 B;  3L70 D;  2LR2 A;  3JD2 A;  3HTK A;  2FYU J;  3ETE A;  2IJJ A;  2CTR A;  2IPP A;  3U59 A;  4DR6 B;  3S3W A;  1Z56 A;  3Q3D A;  1JNM A;  1GO3 F;  3E35 A;  1CZQ A;  3I55 P;  4PD4 D;  1BCC E;  1FJP A;  2ZNJ A;  1E5W A;  3RFR A;  1F23 A;  5APY A;  5LGU A;  3FB7 C;  4F6E A;  1S77 D;  5LP6 C;  3CCU V;  3JAS B;  3R65 A;  2PYL A;  3QO8 A;  4JI2 O;  1J2J B;  5AVT B;  1SZX A;  2H8P C;  1NTZ G;  4ZHQ A;  3W7W A;  1MOF A;  1SQV H;  4LFB O;  1USE A;  1VF5 D;  3WMM 0;  3CME V;  4NVP A;  4U3F H;  4Z1V A;  1OCR B;  1W59 A;  3LID A;  2GBO A;  2POH A;  4D7S A;  3H1L J;  5H6Q A;  4WFG A;  3F5W C;  1L0L G;  2V4D A;  3SYQ A;  4KHP O;  3K5L A;  3CCL P;  1HNW B;  5A2Q N;  2H3O A;  1URQ C;  1AA0 A;  3C1L A;  1S5H C;  2X7R B;  3ASO C;  4B7K A;  1DX7 A;  3K3W A;  4PEL A;  3ZRX A;  1AI5 A;  2BE3 A;  1EZV G;  2K1A A;  2ZAE B;  4IFD K;  4YXW H;  5BU5 A;  2YNY A;  1O9H A;  3GVM A;  3JAM N;  5A9G A;  2QJP C;  3L37 A;  5AW9 B;  5FNV B;  5J2T A;  1KQL A;  5AVR B;  1N73 A;  1IFN A;  3FAV A;  4UCV A;  1YJN V;  1RP3 B;  4BXL A;  3FYE B;  2F4V B;  3U10 A;  1SP4 A;  1IO4 A;  1ZOY C;  4MVS A;  1L1F A;  2HKO A;  4JTA B;  1SQP G;  1QX8 A;  1SQB D;  4M3L A;  1MMM A;  5KAF E;  4JI5 B;  4EFE A;  5C39 A;  1L0L J;  2F23 A;  4WY4 C;  3E89 A;  4LF8 O;  2UXN A;  3ETG A;  3CCV V;  1N86 A;  3CI9 A;  3L35 A;  3FWN A;  5CA3 A;  4XBF A;  2Y0C A;  1OWA A;  2AXC A;  2JKV A;  5CMZ A;  3ZHR A;  4HYO A;  1JUN A;  4LH6 A;  1PNL A;  2C0X A;  4E2L A;  3ABT A;  4P9O A;  3SDL A;  1H2M A;  1N33 O;  4HNA A;  5EIB C;  4DV7 O;  3S4R A;  1NT2 B;  5APU A;  1QLE B;  1Y76 B;  2ITC C;  2Y69 B;  4KL1 A;  4EB6 B;  3GHG B;  2NPS C;  4IHJ B;  2CH7 B;  4IL6 E;  1PPJ D;  2WA4 A;  4AUW A;  3HRN A;  1JY2 P;  3LDE A;  4O2B A;  1DIP A;  2R5D A;  4FZ1 A;  5KAF Z;  5GTI E;  2P2U A;  4JPZ B;  1HNZ B;  4LFA O;  2GUV A;  3H1J G;  1M7L A;  4LNU B;  3L72 G;  1EFR G;  3AEA C;  2OYO A;  3P7K A;  4EI2 A;  1VQO P;  1G1X B;  3L4F A;  1Q82 Q;  1SQP J;  1G2C B;  1SQQ K;  1Q2N A;  2RJZ A;  4DR2 O;  1ZRT D;  5JH7 B;  3N27 A;  1FAF A;  1RPO A;  1DF4 A;  1AP6 A;  5APS A;  1SET A;  1KQF B;  4FMT A;  2FXO A;  4DCK A;  4JTC B;  1KYO D;  3QNE A;  3BCC G;  1WP7 A;  4IL6 Z;  4IYI A;  1YJN P;  1VQN V;  2NRG A;  5GTI Z;  2GTA A;  3SFE C;  5LHG A;  1YJ9 P;  1FKA O;  4JF3 A;  4MTF A;  3A3Y B;  1YSC A;  2IBZ H;  1V9P A;  2Z5U A;  3H6P A;  2HHH B;  1XMQ O;  4KJM A;  4DZO A;  4JV5 O;  2P7T C;  3OTO B;  1I5Y A;  4A7P A;  1KC8 W;  2A7W A;  3Q5R A;  1T3J A;  3H1J J;  2HJD A;  3L72 J;  3CCV P;  1FDI A;  2IX7 C;  3H1L H;  2ITA A;  1BGY D;  3ZMS A;  2JS5 A;  2UU9 O;  4LF5 B;  3CXH E;  4JAV A;  2Q67 A;  4FLT A;  1JY2 O;  5AG2 A;  2FYZ A;  1NTK E;  4TV9 A;  3FX7 A;  1PP9 E;  3SWY A;  1Q6U A;  2EZO A;  1IXM A;  1PL5 A;  4JI3 O;  1IFP A;  3P30 A;  3L75 G;  2Q3I A;  1GM7 A; 
#chains in the Genus database with same CATH homology
 5M1B A;  2JO1 A;  3D71 A;  5KKZ C;  1ZOY C;  2YIU C;  1FDO A;  3AE1 C;  1DD4 A;  3RK3 E;  2NZ2 A;  1UIX A;  3AE6 C;  4YTP C;  1OMI A;  4H13 B;  3Q5P A;  2FYN C;  5L8R J;  3AEG C;  3AE9 C;  3R4Y A;  1VL2 A;  4I7Z B;  1Y9B A;  2WQY C;  1TU3 F;  1KOR A;  4H44 C;  3O6Q A;  1PIX A;  1K05 A;  1YQ4 C;  4H44 D;  3FGA D;  1KQG B;  1KIL E;  2E76 C;  3AED C;  2G8Y A;  2WSF J;  3Q1M A;  3AE2 C;  2WSE J;  3AE3 C;  4U7J A;  3IN6 A;  1NYH A;  1YQ3 C;  3S9O A;  1KMI Z;  1PV3 A;  3GMA A;  2IDB A;  2FBW C;  2H89 C;  1OW7 A;  1DD3 A;  2QJY C;  3GF3 A;  3AEB C;  2E74 C;  2J5U A;  3AE5 C;  2FXP A;  3EWK A;  2E74 D;  3LW5 J;  2O01 J;  2WPV B;  1DIP A;  2YMK A;  3D6Z A;  1GMJ A;  1Q90 D;  2E75 C;  2V7Q J;  3AE8 C;  2E75 D;  2K9Y A;  2QIW A;  4RKU J;  3Q3D A;  3Q5S A;  3AEA C;  1OW8 A;  3GLM A;  4XFJ A;  3RL0 g;  4IL6 X;  4OGQ C;  2E76 D;  3SFD C;  4KT0 J;  1EXJ A;  4OGQ D;  4R4L A;  2H88 C;  3H25 A;  1R8E A;  4H0L C;  1EXI A;  2WSC J;  4H44 B;  4H0L D;  1ZP0 C;  1VF5 C;  1IK7 A;  3IAO A;  1KQF B;  2BEZ F;  1HF9 A;  2E76 B;  1VF5 D;  3Q2Y A;  4PV1 C;  1AJY A;  2OQQ A;  1HJ0 A;  4PV1 D;  1OW6 A;  4H13 C;  2QJK C;  2P10 A;  5KLI C;  3D70 A;  4Y28 J;  4H13 D;  1ZME C;  2MKV A;  1RQV A;  3SFE C;  4TT3 H;  3G9R A;  2BEQ D;  2QSI A;  4I7Z C;  4R4M A;  2E74 B;  3AEC C;  1NGM B;  2JP3 A;  3T97 B;  2D2C C;  3AE4 C;  1KTM A;  2ZT9 C;  4PV1 B;  2D2C D;  3D6Y A;  2E75 B;  2ZT9 D;  1S1C X;  3AE7 C;  4YXD C;  1MKM A;  1S5L X;  3Q5R A;  3GF7 A;  1JB0 J;  1WMK A;  4GDO A;  3B71 A;  1FDI A;  3AEF C;  3AEE C;  1RQU A;  1ZRT E;  2QJP C;  1U57 A;  4OGQ B;  2D2C B;  3ABV C;  4Z1M H;  2ZT9 B;  3C8V A;  1PL5 A;  4H0L B;  2G3A A;  1K04 A;  1VF5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...