1Q91A

Crystal structure of human mitochondrial deoxyribonucleotidase in complex with the inhibitor dpb-t
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
194
structure length
194
Chain Sequence
b'RALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5(3)-deoxyribonucleotidase
publication title Crystal structures of the mitochondrial deoxyribonucleotidase in complex with two specific inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 64
structure length 194
sequence length 194
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2003-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 1q91A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1q91A01
2G09A 4UW9A 1SWWA 2Q4RA 3SLRA 1RMYA 1VFPA 4Y2SA 5AICA 3ZVNA 3U7EB 1EK1A 3QU7A 3CNHA 3UMBA 2ZBGA 2HF7A 3PCTA 3AR8A 3AR4A 3W5CA 4NFLA 2NYVA 2RB5A 1TJ3A 3KOOA 3SHQA 3ZWKA 4DCCA 4AS2A 4H1WA 1RPZA 1Q91A 3L5KA 2HDOA 5AM4A 4XPZA 3WKDA 5A3RA 2C8KA 3WKAA 4L57A 1Z4LA 1L7PA 4Y2JA 1Z4OA 2HX1A 4HGOA 1XVIA 4QJBA 1Z88A 4KX5A 2G08A 4Y2UA 2FUEA 4BYGA 2W11A 2P9JA 2JARA 2YMMA 3NRJA 2RBKA 3WGVA 3U7FB 3M1YA 2IOFA 3A3YA 2ZBEA 4EELA 3DAOA 1WVIA 3A1CA 1QQ6A 4UAUA 3PGLA 1F5SA 2MSNA 3ZWDA 3QYPA 1TJ5A 4BBJA 5IT0A 2C4NA 3WKEA 2FPUA 2IOFK 2B1QA 3E81A 3K1ZA 3N5KA 4KYTA 3ZI4A 3OPXA 1NRWA 2AGVA 3MN1A 5AM5A 3BWVA 1Z5UA 4DW8A 2IYEA 5AKHA 1Z4QA 2D2VA 2NO4A 5AW1A 3SKYA 4JDPA 2PKEA 3PDWA 4HGQA 4DWOA 3HYCA 3WK5A 5ALVA 1MH9A 3OCWA 5AM1A 5AKXA 2FPXA 1N8NA 2B8JA 2YJ6A 3WKCA 4UM5A 3FVVA 2G0AA 1VJRA 5AI5A 1SWVA 3ZTYA 3N8GA 2FPRA 4HAIA 5AW4A 3WGUA 2W4MA 5AI9A 5ALLA 5AKEA 3FPSA 1QQ7A 3WKBA 1XP5A 4UM7A 5ALXA 5AI8A 2FUCA 2YN4A 3RFUA 4UATA 4YIKA 3ET5A 3N07A 5AW2A 2HHLA 1ZD4A 3L0BA 3AR9A 4AP9A 4I9FA 5ALRA 2OM6A 1O08A 1L8LA 5AKYA 1TA0A 2B8EA 1ZOLA 1YJ5A 5T41A 4ZEXA 3KC2A 4OFZA 3EF0A 2OBBA 1NNLA 2EAUA 2HSZA 2R8ZA 2I6XA 3WK4A 2CFSA 1Z5GA 4Y2XA 1Y8AA 4XQ0A 4Y2QA 1S2OA 1U2TA 3NUQA 3AR3A 5AK5A 1S8OA 1T5TA 5ALGA 5AVTA 1Z4NA 4RETA 3AR2A 1RKQA 4UMDA 2O9JA 3QNMA 3TLMA 1YS9A 2G1AA 4G63A 2I55A 5E0OA 1FEZA 2PQ0A 3ONNA 4Y2PA 3I76A 4ZEVA 5AKJA 1LVHA 3MC1A 4YIHA 1L7MA 3QU5A 5AVUA 3L1VA 4F72A 3NAMA 1ZRMA 3P96A 2GMWA 1Z4MA 2AMYA 3OCXA 3NASA 3I28A 4OCZA 3ZW7A 4GIBA 1RKVA 3L0YA 3L8FA 4KN8A 1T5SA 4BX2A 3N1UA 4EZEA 4ZEWA 4BEVA 3W5AA 3OTQA 4HGPA 2WHEA 4UMFA 3NALA 1YV9A 5AI4A 3KDPA 5ALHA 5ALMA 3S6JA 2B1RA 2B30A 4IG4A 4JB3A 1RMTA 1NF2A 5A3SA 5AVQA 1U7PA 1QH9A 3A1DA 2R8EA 1YMQA 5AKKA 3WK7A 2YMQA 3AR5A 5AVRA 2R8XA 3J7TA 1WPGA 2G07A 3VAYA 2CFRA 2EATA 5ALDA 3QU9A 3ESRA 4YCMA 1U2SA 2JGAA 1T9ZA 2AH5A 4NWIA 1CQZA 2QYHA 3L8HA 1RLMA 2FI1A 1RKUA 3M9LA 2QLTA 2VKQA 3ZUPA 4HYTA 5AKIA 1ZJJA 2YJ3A 5AK4A 3WK6A 5AW9A 4F71A 3ZTWA 2JAUA 2C8LA 4KX3A 3MMZA 4KNWA 2P69A 3AR6A 3EWIA 5AM0A 1U7OA 1L7OA 2YBDA 3WK8A 1IWOA 2NO5A 2RARA 3A1EA 4DFDA 5ALJA 5AIBA 1ZD3A 2BDUA 3KD3A 3OCVA 2JAOA 2RAVA 4BNDA 5ALWA 1RQNA 2C88A 3MPOA 3R9KA 2GFHA 4UARA 3W5DA 1ZS9A 2BY4A 5AW5A 2GO7A 5ALFA 1O03A 5AESA 3QUCA 5AKZA 3FPBA 4NABA 2FDRA 4BKMA 4YCNA 4UU1A 1ZD5A 5AVYA 4KNVA 4RESA 4YH1A 3B9BA 5A3QA 2BDEA 5ALTA 4G9BA 3FGOA 2G80A 3E58A 5ALZA 3KZXA 4UMVA 2FPWA 1K1EA 1L8OA 3ZVLA 3CZ4A 2YMLA 3RF6A 4Y2YA 1L6RA 3DDHA 4J2TA 3SMVA 1ZD2P 3ZU6A 3QX7A 2EARA 2Q5EA 5AK6A 3L1UA 4EX6A 1Z4KA 4FE3A 3HLTA 3FZQA 4MUMA 1TJ4A 3SF0A 3QU2A 4NV0A 3E84A 5AVVA 5AVZA 3QGMA 4QQFA 2YMPA 2WF6A 3QUTA 4UASA 1RC8A 1EK2A 5AVXA 2ZXEA 1SU4A 4EENA 3KBBA 2B82A 2DQSA 2AUTA 4UAVA 2W43A 2GHTA 3UMGA 3DNPA 1N9KA 3QLEA 1J8DA 5IS2A 2I7DA 5ALUA 1RQLA 3B8EA 3OCUA 4Y3UA 1Z4PX 4BNDB 3I1YA 3L8EA 3W5BA 5ALQA 1U02A 2HO4A 3AR7A 4E88A 5AI0A 3QU4A 3WK9A 2IA5A 1JUDA 4CF5A 1RLOA 1XPJA 2HF2A 3EPRA 4CF3A 5AW8A 4UU0A 4J03A 3IRUA 2ZOSA 4BEWA 5AW3A 5AVSA 2G06A 1CR6A 4YGYA 3ESQA 5ALYA 3SKXA 3E8MA 3FM9A 4XOUA 4OHFA 4CF4A 3ED5A 4CE6A 3N28A 3DV9A 3EF1A 1RLTA 5ALNA 1AQ6A 2GHQA 5ALKA 1RMQA 1LTQA 4HGRA 3D6JA 1YNSA 5ALIA 4IFTA 5AKGA 3PGVA 5ALSA 1WR8A 2HCFA 3QUBA 4L6AA 3QXGA 5AW7A 2ZG6A 2JAWA 3OCZA 2YJ4A 4UMEA 4Y2RA 1VJ5A 5AW0A 2OYCA 4B6JA 2WF8A 2WF5A 5FP0A 2C9MA 2HOQA 3L7YA 1Z4IA 3U19A 1J97A 4PNHA 5ALOA 4EEKA 2ZBDA 4CNQA 5AIAA 3UMCA 4MWOA 2P11A 3ZX4A 4Y2TA 2IOHA 2X4DA 2YFYA 3ET4A 1Z4JA 1RRCA 2I34A 3L8GA 4L6CA 3BA6A 4YCLA 4FYPA 5AHXA 2YY6A 2OA0A 1ZRNA 3ZVMA 3L0CA 2FPSA 2WM8A 3GYGA 3IB6A 4HGNA 3UM9A 2WF7A 1TE2A 2WF9A 4O8CA 4Y2VA 2I54A 5AK3A 2ODAA 4C4RA 5IT4A 2B0CA 3NIWA 3OCYA 3QUQA 1X42A 2MU1A 3IJ5A 3U7GA 2CN1A 5AM2A 3U7HB 5AKLA 3F9RA 2R8YA 4FFDA 2HI0A 1L7NA 5AVWA 3U13A 3ZX5A 2Q4TA 1Q92A 5JJBA 4BX0A 3I6BA 3R4CA 4EX7A 2O2XA 4AS3A 4I9GA 1QQ5A 4C4TA 2I33A 5AM3A 4GXTA 2CFTA 5AI6A 2P27A 5ALPA 4C4SA 5AW6A 3B9RA 2FEAA 2WFAA 5ALEA 4NAVA 3R09A 4OD0A 2PR7A 1YDFA 3SD7A 1WZCA 2ZBFA 4XE5A 4BX3A 1QYIA 1KYTA 3NANA 2HEGA 2YJ5A 1RDFA 3U26A 1PW5A
chains in the Genus database with same CATH superfamily
2A88A 4G0VA 4HMPA 5IN5A 4XH9B 4KFRA 2RHHA 2VXYA 1JTFA 3T3HA 3USZA 1Y33E 3C6ZA 1I33A 2VUTA 4PCLA 5E7QA 3RGWS 4B6OA 4BHTA 3V4RA 2C7OA 2J6IA 3R2JA 1I14A 1PO7A 2JH3A 4CRWB 1U2GC 2FSFA 5A7FA 4LHEA 3Q7EA 4KQCA 1GPBA 2VP6A 2YH2A 1JX6A 4D26A 1RAEA 2BRUA 2GVDC 5CITA 5L40A 1IN4A 3IPXA 4AAYA 4PBSA 2V7GA 4MV3A 2AZDA 4MWDA 4RH1A 1XZHA 1G8JA 1TJ3A 1A8UA 3OQHA 3QMVA 2PBRA 4DCCA 3UB3A 5B3JC 2IBTA 4H1WA 3LO8A 3B1WA 3IUEA 4ZO6A 4LXXA 4WVFA 4CMIA 4LXYA 4BVFA 1ODCA 5LA6B 2QM0A 1J0DA 1KL7A 5DTEA 3WYDA 4BLSA 4YPVA 3UV7A 2OD2A 1P45A 2NSDA 1J7KA 3OPYA 4G65A 2J5QA 2JCSA 2HCJB 2V65A 3E3MA 4OJMX 4WLNA 5K3BA 2QLFA 4AN1A 3QTBA 2Y1GA 2P9YA 4J76A 3KPJA 4R1PA 2BHLA 3WQQA 4TWJA 1Q0PA 3A36A 5JS7A 4TV8F 1YB4A 4JY7A 3ZK8A 5DLPA 1SCIA 3A1UA 2FF5A 1Z5VA 4MUGA 5E9AA 1X87A 2D13A 2J3EA 2V59A 3SFZA 3THWB 3PGLA 1OX6A 1I10A 4HTFB 4L8YA 2Q0HA 3LW7A 2WSLA 3V6MA 4DB2A 4MUEA 3ZZMA 1LTHR 1IH8A 3SJZA 3WMGA 3HMQA 1E4EA 4ZRNA 2P5SA 4LJRA 4YRKA 2VTDA 3H5RA 1HFWA 3A7EA 2Z08A 2NZYA 3SVZA 2BF4A 2GNOA 4ZO9A 5JNRA 2OC9A 3RSGA 4CEJB 1JG4A 1EU1A 2C4UA 4ETNA 2R00C 1YR6A 4EUNA 1U0BB 2V6MA 1XIVA 2QTGA 1NYTA 2GNPA 3QVSA 3ZHRA 3TF5A 4W9NA 5AKHA 3M6MD 1OVGA 1CZRA 3EEFA 1P1BA 4OL0A 4J3NA 2FV8A 3CUVA 4HK4A 3D8UA 4BNMA 3I6MA 2AN4A 1TZCA 1JJVA 2FSGA 3HUEA 2VA9A 3LKVA 3SX4A 2HHHB 1OT3A 2O8FB 1E9VA 2DUMA 2GCEA 1SHTX 4UNQA 2DPHA 2LIPA 3OBBA 4WK4B 5TQJA 4YP5A 4AECA 1TQDA 5D85A 2Z5FA 3OUUA 5JD5A 1X9GA 2AFHE 2WKSA 1U28C 16PKA 5BP7A 1D8AA 1JKFA 1OVMA 2WYIA 1ISJA 3LDAA 1A71A 3G2HA 5H7XA 3K09A 3LG2A 4E3WA 4XUGB 1O4WA 1QV6A 2D1YA 5DSZA 4BC0A 3G8YA 2JA1A 4MWTA 1QVRA 1GAWA 2NPOA 1Q1AA 3G3EA 2P90A 3O6VA 3LVBA 2W2TA 4R2XA 2OAQ1 2OHFA 4FGKA 3DLHA 2D3TA 2VBGA 4EMBA 4LJ7A 4XIJA 3T35A 3SBXA 1FFAA 1L8XA 1Y9DA 4A4DA 2I2WA 4OK5A 4OQFA 4FFPA 5BR7A 3REGA 5K6AA 4WHMA 4MGYR 5BVGA 1RQPA 1QZXA 1W47A 2E5LB 5AJZA 2XVZA 3ANXA 3C1OA 1ACLA 1IK4A 3R9XB 4UEOA 3RYCA 1H94A 1IHDA 3GLFB 3X1MA 3ND6A 4KUGA 3ENZA 1TMGE 2DU8A 1W36B 1BA3A 3ZDBA 5KU7A 1G21A 4NCBA 1P7WA 5J47A 2Q99A 4FFRA 4A8JB 4OFZA 2QM3A 5KKAA 2CY0A 1KSFX 4CIYA 1T8TA 1UXOA 4IINA 4KC0A 4UBNA 1IRIA 5CM9C 3EXAA 4LVUA 3K2QA 3KQQA 1DSSG 4ZTUB 4EKIA 2JFQA 1E2UA 4UOQA 3UJAA 2I65A 3KS9A 4BO0A 1ZH0A 5I9SA 3G6WA 1XTRA 2Q5QA 3NUQA 2EJTA 2DFLA 2ID8A 5T4HA 4M9XA 3WL7A 1Y89A 2FOIA 4DIDA 1KEEB 3HBLA 3SEFA 1BJTA 4HQKA 2GETA 4OXNA 4H6PA 5AMXA 1JDVA 2D59A 4CI0B 2HLPA 1H6DA 2SHKA 4DQXA 5GOZA 2I99A 4WXMA 2HREA 3CZCA 3P2EA 3LPAA 3MINB 2PKYX 4U0KA 1YL7A 3NDRA 4BVHA 5IFKA 1GUBA 4K26A 4EEZA 1DC6A 1R0LA 4E3ZA 3V34A 1DWQA 3FOAA 3VR2A 4ZEVA 2YXBA 4RKFA 4WXHA 4RW0A 4PPGA 4ZO4A 1G8YA 1B41A 1V71A 3GO4A 3WNBA 3NGLA 4KWHA 1DO8A 1VL0A 1I2CA 3HM9A 1OBFO 1SQ5A 1T5HX 1WY7A 1R4AA 1K7XB 2YNMA 3NTVA 4TTAA 4CXMA 4KPFC 2QVGA 5BVHA 2GRUA 2WBLC 3NHUA 5CFZA 3PQ4A 3M9XA 4YXWA 1VCOA 3M6VA 4TV8A 4ENPA 2ZCUA 2BKVA 1C8KA 3LC1O 4OXIA 1U9IC 1T5SA 3SEAA 2GJ8A 3CXUA 4W4TA 1EX7A 1O94D 2JCVA 5GMOA 3IP6A 3TLEA 1VXOA 3GIDA 3ORFA 1RJDA 2UVPA 1SA0A 3CBQA 4S1NA 2Y4OA 4EKNB 1UZUA 3RG8A 5JFTA 2IZ7A 1NF2A 1DIOB 3BHJA 1WJGA 4HXGA 4GMXA 4AJHA 4BP9A 4MV1A 3E9QA 5ELMA 2YIDA 2NVWA 5I3ZA 2O2CA 3FDZA 1UDRA 2R1TB 3I73A 4ZVVA 3AR5A 3KKNA 1DADA 3NBAA 3BDVA 4N0EA 4TSRA 4WZAB 2PRYA 5JPIA 4DCNA 5GINE 1FVOA 4LBZA 2VAVA 1UBKS 3NNDA 1FCJA 3NHAA 2BBTA 2YOHA 4FWIB 4HH1A 1ABBA 3JQGA 4JJIA 1L5KA 3QU9A 4BNUA 4WCFC 2PNJA 2ZR8A 3ZJYA 5GAJA 2ORYA 4PICA 2MT9A 4LXIA 4ZDWA 1DFHA 4FYVA 3OZDA 2QY9A 1O3YA 4M36A 1LPMA 2I76A 5AXAA 4EZBA 1P5HA 1UT6A 2VP9A 4L8VA 1BXKA 2FI1A 4CTNA 4F38A 1KRHA 1EYZA 1FXWF 3ZBQA 5TQVA 4FW9A 1NJ8A 3X0DA 2QMUA 4RJJA 1SZPA 1KHTA 2ZRIA 3E9DA 3H5LA 3ZCQA 4FYKA 3RHTA 3BIXA 3EE6A 1ID8A 1RQRA 3EVZA 3AP2A 4GH5A 4A6DA 4LRXA 2QMOA 2I2BA 3EQ9A 3Q2OA 4NECA 2BFFB 3ZOKA 2JLSA 2FVXA 2VF8A 3VTFA 1E4OA 5JPCA 3PITA 3LQ1A 3HBAA 3IDFA 2WWIA 3JARB 3VR6H 5IAGA 3VSEA 1POXA 3QELA 3PX2A 4J7AA 5FI0B 3N75A 3T0FA 1I4TD 5EWLB 3HDQA 2O5CA 4FMCF 4L8FA 2H1IA 2C88A 2XLCA 3OT4A 3AHIA 4H7IA 4LWZA 1U04A 5EVCA 3RK0A 3TLBA 4B1FA 4D3YA 4B3IA 2ZT5A 2CV0A 4ZDJA 1U5BB 2O3QA 3AEYA 1WXEA 2AQ8A 4GPTA 3QKRA 4AURA 1IQPA 1YZNA 5D6BA 1VG0B 3T8YA 1U7ZA 4HL6A 2XMQA 4H9GA 4Q4HA 1VJDA 2JLYA 1TKCA 5DNAA 4JLPA 3TZLA 1A3CA 5LIRA 1VLMA 5FUMA 2I4TA 3ASUA 3NIBA 5KWEA 1Z62A 2Y1KA 3MGKA 5AVJA 4LRQA 4FEYA 4NLLA 3IIKA 5EKUA 5JSKA 2ONCA 4NENA 1B6TA 3GJZA 4BIMA 3R7BA 3AUAA 3GJSA 1RACA 2QW0X 3DBLA 1OLUA 3J81k 3L18A 5ICFA 3VDMA 3IILA 1L5OA 2JCYA 4O0LA 4PC7A 1NJFA 2FSIA 3SYTA 3AF1A 1S3IA 1VMIA 1F20A 2PJZA 5NULA 2B7LA 3KL2A 3WOVA 3MOGA 3N74A 4HWTA 1M2FA 4XJXA 4J43A 4HDKA 1CERA 2EVWX 3CH4B 3O2SB 1GP2A 3LBNA 4IGEA 4RIIA 5G1PA 1UM9B 1EVIA 1ZK0A 4EUFA 4O2BB 1HT0A 1AGYA 5JAHA 1Z83A 5IVHA 5KSPA 5DHUA 3AEKA 4FE4A 1GRNA 1TUBB 2J6BA 1T0JB 2NP6A 5IRCD 3SF0A 3QLTA 1VP9A 2O48X 4CKBB 4N47A 4L8GA 2M32A 2C7PA 3MWYW 4Y9DA 3F71A 1JSWA 1PJBA 1U8FO 3EGCA 3HU3A 2AG1A 1QDLB 4ZD6A 4ZCRA 1N6NA 1TFRA 4YMSA 1NUQA 1K4KA 3QXXA 4YRCA 1A4UA 2JIMA 3ORHA 5L3QA 4OK3A 3L0IB 2ECOA 4RADA 2JFXA 5I01A 1E62A 1WCXA 2F3UA 3FHLA 4IO1A 4MW4A 3I62A 1YH3A 4PGAA 2XUKA 1VSUA 1N6HA 9LDTA 5HWSA 1I3CA 4RZ2A 5K45A 5IS2A 3IX7A 4TYWA 4FB5A 5F5NA 3Q1KA 1C0EA 3UW1A 2QLLA 1MB2A 3GLFE 5JYDA 4LY9A 4RYLA 1XZEA 3W8EA 1RIFA 3WISA 2C92A 3AEXA 1L5HB 3AQ4A 3O74A 4YRPA 4TS1A 2E4YA 2I67A 1NKVA 1BHJA 2XECA 4BQPA 5JWOA 1F8YA 4ZJPA 4F96A 3A4IA 1HXHA 2GN1A 4CQNA 2HMSA 2X8JA 3HV0A 1GVNB 1FS5A 1YIOA 2UXBB 3H5TA 3PGMA 1ND6A 1Y3AA 2ZAOA 4HPJB 1PQWA 1XF1A 1Z6XA 2OV3A 3Q6IA 4HDQB 3MBIA 4ASUD 1CRPA 1GPJA 4HXFB 4ODIA 3TRDA 2XY4A 1DQNA 2AWOA 2V97A 4GNRA 2WLTA 3GJ5A 4NZPA 4EABA 1VECA 3STVA 1MD9A 1MFZA 2OV6A 1KO8A 4JI1B 1IM2A 1JSRA 1FXWA 4Y1RB 2A6PA 3T9FA 1JDPA 2UYQA 3UYKA 3KLMX 4NK4A 1J49A 1P39A 2Z4TA 4RVCA 4ND8B 1J09A 2E9FA 3MBKA 1V1MA 1WZUA 2PLFA 4AWAA 2ZZNA 1O6ZA 1J1ZA 4TV9F 3GFOA 3D6JA 2IWHA 1A9XA 4RD1A 2P78A 5SZHB 3I4FA 2JEOA 3F5FA 5JS2A 2PS1A 5IT9A 1XMOB 1EE1A 1WR8A 3P0JA 4WK0B 3O8OB 3GXBA 4M0KA 2NO7A 5IJ9A 3VPHA 5DHTA 4G0PA 3NIFB 3FOEC 3V4SA 5KQPA 1GXSA 2QE6A 2J3JA 5GGYA 1G9SA 3TDKA 4RY9A 3I5YA 1NF3A 1WAMA 1Y8QA 4WLFA 3CINA 2Q3EA 1VJ5A 2DJ5A 3JQFC 3JD4A 4PYKA 1AZWA 1SRQA 3RS0A 5GVRA 4G85A 4LKOA 3BWYA 2HH9A 1F51E 1NVFA 4CM5A 4P86A 1VQ1A 1QHEA 4LTMA 2ZM5A 3L7YA 1M10A 1YR3A 2DH6A 2F9LA 1ZKMA 2Q1WA 2QM8A 4M7PA 3RUDA 5JO9A 3FSJX 4H7EA 4JNCA 5GJWC 4YY3B 1IHYA 5H3HA 2CXRA 1V5WA 4E5NA 3W5HA 4MUBA 3VZSA 3HY6A 2J5XA 2NX2A 5DTRA 2WAOA 3K2BA 2IUUA 4URHA 3ZZ0A 1JQBA 2RHTA 1TC1A 4IOMA 4DJ5X 4BCCA 1FLAA 3N8IA 4PLWA 4L4SA 3SYKA 4FZRA 3QLJA 2ZITA 3DL0A 4IG9A 1NLFA 2J8ZA 1P2UA 2H59A 4WZAE 5DTJA 2B4AA 4W7SA 2Y2VA 3P0RA 2PFMA 3IMEA 2VJDA 4PAWA 4U7FA 1JHUA 2PMFA 3GYGA 2VT7A 1LLDA 1U3TA 3AGQA 4RA6B 1UZNA 3H5VA 4P53A 4C4RA 4JR2A 3ZNPA 4NBWA 5IAJA 1PL7A 3A3NA 3TB4A 1HSOA 2ZT7A 3E8SA 1Q7GA 2ZYIA 5I7AA 4BCDA 3N0WA 5AOVA 4X64B 1QFMA 5C7LO 3H3JA 3U56A 4OLJA 4R1SA 5BN1A 2DOKA 1CJVC 2G5CA 3WA6A 1DAHA 3E82A 3K9GA 3EGXB 3ND9A 4YT5A 5KIAA 1X7WA 3OPQA 3ZTTA 2OT3B 4ZOBA 2JJ2D 2LVBA 5DOZA 4ALIA 1IC6A 1E1CB 2INGX 1I7PA 4ZCTA 2PUHA 3GGCA 3OOSA 1UPCA 1Q92A 1ZYUA 4Q82A 1T5DX 3LHIA 3LDUA 1YFMA 1NNSA 5CVEA 1M2VA 3AYXB 4CW7A 1CUFA 4H60A 2YV5A 3IB3A 1NM5A 1QLHA 4JLNA 1IMOA 1SO8A 2NUTA 1X8JA 4YR7A 3VZCA 2ASEA 2AYYA 2JI4A 5BY2A 4IFIA 4JU8A 2WNIA 4DNPA 3CVYA 4KVGA 2DHEA 4KKVA 3T7TA 3KE8A 1OYWA 2HU5A 4FLEA 3EFBA 1LBQA 2IEIA 2PV7A 1NA5A 2IXEA 4Q7EA 1JWBB 1DIRA 1Q84A 2X3UA 4UUOA 2G9NA 2OZLB 2GTPA 5KO2A 1Z7EA 5DNCA 1ONSA 3PA6A 1H8HD 1B8UA 1K92A 1L2TA 2FN3A 2VRNA 1N0UA 1CT9A 1GVHA 2A2ZA 2W6OA 2XKBA 1T36A 2NM0A 1ZR4A 4HJRA 4NICA 3RTGA 4JIMA 4YH1A 3AVTA 3PQEA 2EJWA 1O4VA 2OMEA 3JQQA 4MUYA 3VKWA 4QVKA 1VFPA 1CVLA 2GF9A 2O0MA 2Q07A 2H1HA 2TMYA 4IY1A 2LKDA 4KWTA 5AQ1A 2VTBA 4OI0A 1XTSA 1HT2E 1OCEA 2A35A 2HF7A 5ITZA 3DMDA 4PX3A 3F73A 4YONB 2FQQA 3FZYA 3I2IA 2AKAB 2Z8XA 4OQMA 5HQ3A 4IJ6A 4BFLA 2VJMB 1J22A 1BDBA 1HE2A 3VTAA 1SCBA 4ACBA 5C5EA 4TV9A 2YN2A 4AKTA 3Q11A 4CIVA 2WIJA 3QNWA 1QH1A 3I5MA 4OKIA 2P5UA 4UD6A 1N6LA 1LFDB 1M7GA 3KZ1E 1WXFA 2JJYA 5C8YB 1LJ8A 2AOXA 3B13B 4URWR 5HUHA 3RAFC 2C57A 3WDSA 1YFJA 5JE8A 1SG9A 3EVNA 1P6UA 2R85A 1B8VA 1Y3BE 4ZDKA 3L77A 4S24A 4A73A 5E4FA 2FUEA 4RLHA 2W11A 1GGKA 2OLEA 2AXQA 1XB2A 2PFSA 1THTA 2CF6A 4JITA 2ZYHA 3TK1A 1QIMA 1WVIA 2W2PA 4CQMB 4L0CA 3HWSA 5K0LA 2ZWIA 3MELA 4Z7NB 3TZQA 3QYPA 1W34A 5MFPA 3S29A 2C4NA 4QULA 5F3WB 1BTOA 4TTSA 4BLUA 4M46A 5F7XA 2ACVA 3ICEA 4LRWA 3HCOA 2QW1A 5KDLA 3RC9A 3U4IA 4F04A 2QX8A 4IILA 1IUOA 3REQA 5BSGA 2HC9A 4KG7A 1JEYA 1FFBA 2B2XA 5FUVA 1E1MA 3EEYA 3MN1A 5KTNA 5HILA 1Z0JA 3L6CA 3RVJA 3H6HA 4NJEA 2PFKA 2X5KO 2JJ1A 1RWNA 5EZSA 4L3WA 1TFUA 1IWBB 2ECKA 4O0MA 4RHTA 1B7GO 1XQYA 4JC0A 5DZSA 5LQSA 3FYUA 3VU9A 3ZWMA 2FKAA 4UCFA 4M9SA 4XDZA 1JG7A 4PY2A 1AXGA 5SZKB 4A7PA 3FUVA 3B6ZA 2UXDB 5LBUA 1LLQA 3A1WA 3LIIA 4PNPA 3HXLA 3SGLA 5KX5A 1M0EA 2ZSJA 3NTRA 4HWRA 3T1YB 4NMWA 2O0JA 4MA0A 4PAOA 2ZU6A 1BIFA 2ZJ1A 1HFKA 2ZRBA 4HDSA 1TO6A 5KHOC 4M86A 4GPZA 2IK8A 3I6YA 5AXBA 4JLWA 3DOIA 3DZDA 4P81A 5CXXA 3U9TA 2QRQA 3F74A 3CLVA 5ECWA 1YUBA 3HXMA 1W44A 1PFKA 2CEKA 1TVKA 1XMIA 2J9XB 1GT6A 2OB1A 2OZVA 2P2GA 1TQ4A 4MRMA 2NQ2C 3N8GA 4OB7A 5TVGA 3E53A 1HY3A 1Y5RA 4P7FA 4QXPA 4BB5A 3R0VA 3Q2IA 1W35A 3ROEA 1A76A 4NTZA 2DXIA 1KNXA 1XWWA 3A1SA 1VYUA 5FOWA 3AKZA 3ZGZA 3TW6A 1OZGA 3L7DA 1DMRA 1EGMB 1NZJA 1U8EA 3AILA 5AI8A 2XNDA 5ALXA 3DNMA 2F1IA 2OE2A 1XMSA 5I5EA 4QDOA 3LLCA 4DV5B 2GRJA 4CG3A 4BFXA 4FFMA 1QYRA 1RYHA 4IFEA 1I32A 4CTJA 4ZKDA 5B5SA 3P0HA 5B37A 5HS4A 3PTAA 1P0PA 3NTXA 4UU8A 1JBEA 1VGQA 1NXQA 5BPHA 2ID9A 4FDMA 3FFBA 1P81A 4L4RA 2BRUC 2RGUA 5JCZA 4JUDX 5G0SA 2XVYA 4FGLA 1UOOA 4QPDA 3V1YA 4Z0PA 1YR7A 3EF3A 4KLRA 5TQ0B 1B0AA 2OOSA 4D9EA 2G82A 2D6FA 4BZZA 3OI7A 4E07A 4KQEA 4IVNA 3WK4A 1EX1A 3JYLA 1T2CA 2FWBA 4D46A 1L4KA 2XCUA 1U63A 1NXTA 1T0UA 3GDGA 2RHJA 4BMOB 6GPBA 5JDCC 4CIWA 3Q41A 4UXJA 2Y8EA 3BN3A 1K6EA 1NW4A 3QQ5A 5E1MA 3PX7A 1R8SA 4Y6QA 1W8IA 2PLNA 2HM7A 2IRWA 2QTHA 3WTCA 3WRXA 1F8UA 1QFJA 4RPIA 1GPH1 4EUHA 2XLBA 3NBUA 4CQMA 1I1OA 3DUWA 3A32A 4HDNA 4CGYA 3GVPA 1EDBA 2ISCA 3QFRA 5GJVC 4RPLA 3CLSC 3O4GA 3GLGB 2Y1DA 4DSZA 2ROQA 4KU4A 1P29A 1EVJA 1NKTA 4INAA 1VLZA 2BVNA 1XRQA 2CK3A 2DT5A 4Y67A 4MYHA 5E6SB 5E0OA 4RGQA 5C18A 4Y2PA 5BQPA 1N5JA 1JMKC 1Q95A 2IE8A 4KWEA 3DLPX 3FCAA 3LYUA 4BQIA 5K4GA 1NP3A 2COUA 3C3PA 2Y0CA 4PPFA 4C0QC 2NGRA 2R86A 2Z3ZA 5C1OA 2QD4A 1DBRA 1Z6GA 2CKMA 5BR8B 4WQMA 2I5PO 3HU1A 5AP9A 3PENA 3VMMA 3HS3A 3JZMA 2XZDA 3RYHA 4FXPA 4OY3A 3LY9A 2YZMA 3DLAA 3OQBA 1HYEA 2XTZA 3RUCA 3QE2A 2IHBA 4NOLA 3G2NA 1QLWA 2ZSAA 4X8OA 4UU7A 3W5AA 1FF9A 4N65A 3KR0A 5E8RA 1DELA 4EHHA 3IKLA 3QP9A 4BNJA 1LD3A 2R2GA 3AH8A 3I01M 4I1VA 4M9ZA 4UZEA 4IXDA 1RMTA 4U6SA 4B43A 2B5OA 2BZ1A 5EXTA 3TL2A 2OP1A 3F1LA 2FF7A 1T43A 3WYAA 1U0LA 1KIFA 1MIHA 1U8YA 4OL9A 4UJ3A 3WLMA 4BQNA 4RJKA 5CFNA 1M6VB 3TUZC 4IDEA 4PYRA 1Y3HA 5K0NA 2EZ4A 4A2CA 1ZMTA 2XYQA 1R12A 3NJ4A 2ZI3A 3A05A 3K1TA 1BE1A 2YYZA 1PT6A 1T1EA 2AG5A 2YJZA 3IUPA 3K09C 4UC0A 4HDOB 3VAYA 1C7QA 3STTA 3W2FA 2K4MA 1VL8A 2GCIA 3PV0A 3U4QA 4MCJA 4NF2A 5DT2A 3ESRA 5JV5A 3IYLW 4JJFA 5DN6D 5EMLA 4QVGA 4EW3A 1I2ZA 4MR9B 5EFZA 4B3TB 1MJHA 3EFOA 1XEAA 2J59A 3AHDA 3K0EA 4EA8A 4Q7KA 4ML3A 5K6AC 1EX9A 1GAQA 2ZTHA 2PTGA 4DNOA 3I1FA 4E51A 5JY6A 4PYQA 2ECFA 2NZ8A 3I8SA 1GSIA 1JJBA 3IA2A 4IHJB 5FTNA 4DMRA 1QTIA 3H17A 3O3NB 1BVRA 2XUDA 1GTRA 2R47A 5ADWA 3JQBA 3AIOA 1LXCA 3RS2A 4J3FA 3EWIA 4RF2A 4JC5A 2GS9A 4Q7LA 4UUAA 4G1BA 1WQ1R 1IIRA 1NJ2A 2ASVA 4QGAA 1N4AA 3SSAA 2I4RA 1ZN8A 4AUKA 4EB6B 4LGCA 3EAGA 4ZOLB 5A4IS 3OM9A 3MPOA 3TE6A 5IJAA 4OOFA 2GFHA 3NWJA 4GICA 4LFAB 1H0KA 2B6NA 1I3LA 3DC2A 2HBQA 5A02A 3QF4A 1ZQ9A 3ENQA 1MOSA 1JIUA 1RRGA 1W5FA 1MAWA 4LRSB 4M0MA 4Q9DA 3E04A 3DGFC 3O92A 4PYNA 1XLVA 4C4PA 3T9EA 2JLZA 2JI9A 4MW0A 1I0LA 1PJ8A 1A8PA 1V4BA 1WE2A 2Q3LA 3KSMA 4P6VF 1UKAA 3PPXA 4KNVA 4C3VA 4GI2A 4OAPA 3SN6A 4YRMA 4ACAA 5FI3A 1RLIA 2JGJA 1E63A 2QROA 3KEFA 2JRCA 2D4AA 2R4UA 4C6TB 2ZDGA 3IOEA 3FWKA 4FDTA 2P41A 1RXCA 4JBLA 3PCRB 3CF6R 1K66A 4QPJC 5DM70 2W6IA 3ODPA 1SHUX 3V4ZA 4PZZA 1Z8DA 3FTQA 2J0EA 2YNMC 3AO0B 3GB9A 4GGOA 4I9UA 4WK6A 3RRFA 3I58A 2WJZB 3IJPA 4PYIA 4V1CB 5F7ZA 1PEKE 2F1JA 3L1IA 4R83A 1NW8A 3IHWA 4B3FX 5DJ5A 4D45A 1UF9A 4FX2A 5IUNC 5BNWA 3GVXA 4LFCB 4UXHA 1OJ7A 4BGEA 3DZCA 3L1UA 1KZ6A 5A0FA 4RIGA 4YV2A 2IS2A 2Z8YA 1OI2A 4YAFA 4H16A 2ATEA 1XRNA 4QREA 2X5OA 4DUYB 2GAIA 1NQTA 4LHXA 1ETUA 4WBNB 4J4BA 5J43A 4CV0A 2BF7A 3C2QA 2CMGA 3MXTA 4MQEA 4WUTA 2AF3C 4AD8A 4RGVA 2Z9BA 4LC0A 3PCXA 3MOSA 1YE3A 3VYVA 3MYRA 3BL6A 3KWFA 4RF5A 5BUCA 4DJDC 1U7HA 3QKSB 1EBBA 3ZGLA 1E20A 3O1LA 2HDHA 1EA7A 2NSJA 3AEZA 2A7XA 1TPYA 1M8PA 3CKMA 4L76A 4PHHA 3S2ZA 2GHIA 1G5PA 2JIPA 3L41A 3TJZA 4RLQA 3FVRA 4JS0A 3VAZA 4Z1MD 3GNQA 1GAEO 4EFDA 2CLSA 4Q3LA 5D7BA 3OICA 3F3MA 3CV3A 4KO4S 1N5OX 1D2NA 1BZYA 2ZRPA 1KS2A 1KDPA 3FPGA 1NFFA 1QFXA 3C6QA 4YMHA 3FN4A 4EYSA 1UQTA 1H3EA 1MIOB 4MV6A 4WNAB 1VPDA 4BGDA 3PWSA 1RRVA 2FR0A 2O57A 2OO5C 4Z4QA 4QM6A 2A9PA 2KLBA 3QU4A 1MA3A 1V5IA 3KWMA 2E9SA 1W1UA 3FCEA 3ZHOA 3TAUA 1MXHA 1SU6A 5FV7A 2OMKA 4KDEA 2AI3A 3OIFA 5IARA 1O87A 1KOFA 4IQFA 3DF7A 4RVNA 2GK4A 4GPEA 3TLKA 1COZA 1PR2A 3G9QA 5E7IA 1YA8A 3Q88A 2BTEA 4A0RA 1U31A 3TQRA 4LZPA 4D0RA 1DINA 4MV4A 4EMTA 2DCUA 3FHOA 3H4MA 4KKXB 1JG3A 3HYTA 2OCGA 4RFSB 2JI7A 1GFWA 3D1JA 3VPSA 1XQ9A 3IEXA 4ZQGA 3MGCA 3ED5A 2HFKA 1H23A 2AJCA 2BFCA 1E6LA 3AFOA 4IRMA 4IV5A 4G1EB 1WS6A 3E03A 4W9RA 2CJPA 4DN6A 4UOEA 2A5GA 3WOHA 5F9HA 1PR1A 2WJ3A 3GLGE 1SQ6A 2YVLA 4N5LA 3B1ZA 4OH1A 3Q72A 3WLLA 3HN7A 3HB9A 3NW9A 4N6GA 3LQFA 1ELOA 3DXXA 3G0DA 4Z3KA 1C0PA 3WJAA 3N9IA 4WXPA 3RKSA 1GRRA 2XVMA 3KJQA 3PC6A 4LRUA 5HTOA 3C98A 3HJTA 3X1ZA 2QP9X 1N2CA 2CUTA 5E7JA 4UMEA 1Y6JA 4LUCA 4X24A 2R6CA 1LJUA 3EY4A 1U7WA 3V1NA 4PO8A 1GILA 1QP0A 4NU8X 3VDXA 2JD2A 2V74B 2JLBA 1IHOA 4YI3A 1JFSA 2I6FA 4KPEC 3NVDA 4YJ2F 2JATA 5IHXA 2ZBDA 3O8QA 5JD6A 5K03A 2BH9A 4JYCA 3UMCA 1UJ5A 3DFFA 5IULC 3K0FB 3ZIUA 3EUFA 4KE6A 3ZX4A 2H06A 4HYYA 1UBLS 2XNJA 2N3ZA 4ZU3A 5LZ7A 2QLJA 1JQ3A 1UEIA 2KSQA 2Z6VA 5IBCA 4GECA 2RGCA 4HI0E 1NI3A 2IT1A 4MP6A 4AF6A 1FS4A 3MJTA 5AUQA 2BAGA 3ACBA 3WY9A 2HIGA 1W4AA 3T5MA 3DXYA 4IQ4A 1YS2X 1KHHA 4IUCS 3RUEA 3IHTA 2KLHA 5I7SA 2VJNA 4MPRA 3E5MA 5BSHA 1WXGA 2HN9A 3BHIA 2XMDA 1ZRHA 2HCTA 3HSYA 5KNCA 5FI5A 5FTJA 1EFPA 1BFDA 1F6BA 2GLXA 2ZANA 1XCPA 4E21A 1QIKA 3GEMA 3UJ3X 2PO7A 3CG0A 2NQ8A 3IAXA 4IUYA 2C84A 3VHXA 2B0CA 2VH1A 2XUHA 1YJCA 2JIQA 2YYYA 3QUQA 1QF7A 3IJ5A 1RPJA 4IUBS 4DS3A 1EQUA 2PD3A 2ZVQX 4URVR 3Q87B 2JVKA 4AJNA 5KOYA 5AKLA 1V1RA 1QK5A 1WKBA 4GRIA 2EBHX 4OV6B 4YXWD 2B8TA 2GBFA 4I1IA 4XCQA 3BMNB 1V3TA 3G0CA 2KMLA 3M4ZA 1GYPA 5BOVA 2UUPA 1KJIA 1JQEA 2G8NA 3EJ6A 4IJMA 4K6GA 4NL4H 4WWHA 2CXHA 5EJIA 1BHO1 1HE1C 2MR6A 2Q8QA 5TR9A 2PK3A 2CHEA 2BFNA 3KPWA 1RXIA 3TJMA 1WCV1 4KYUA 2H63A 5EKXA 4KE8A 4J0QA 1M8JA 3OIDA 4C43A 2C4MA 2IKQA 4C4SA 5AW6A 2JB9A 3EGEA 5KTPA 3THYA 5BV2P 3GT0A 2BUBA 3DZKA 5A7GA 3R09A 1YK0A 2VUIB 4XI9A 1WHTA 4FS8A 1ECCA 1JYFA 1JU3A 2N0SA 2PKWA 3PNOA 3HNOA 2VSFA 2ZRDA 4RBNA 3IV6A 1J06A 4ZC8A 1S02A 3K5PA 2W0SA 4F0JA 2O2HA 3DZHA 4NNOA 4E5DA 1U90A 1XYVA 5KYKA 5L3SB 2PGAA 3DPIA 1VLQA 3LL4A 1IM8A 4KNYA 4II2A 1AA9A 1OD6A 4Q4LA 1VG1A 5FOSA 3UCFA 3F5SA 4INJA 3VI3B 3ZVNA 1RP7A 4CIXA 2O14A 2AFRA 3JVIA 3OZGA 2VPXA 1WV0A 1NNI1 2BMAA 3FNHA 5G0UA 5AUOB 3SBOA 4QYIB 4UKDA 3NV9A 1WUJS 2PSSA 2XWPA 5IJXA 4DLPA 4NFLA 1XSEA 2KM1A 5IAAA 3ZI0A 4ISBA 4PONA 4EITA 1SQSA 2O0LA 3EB9A 2GCNA 4NLEA 2FVYA 3TM5A 3ZHVA 2O8BB 2MYPA 3KOOA 4BVKA 3KQKA 5F91A 1YR1A 4ZK2A 2TMDA 3V48A 2XDQA 2IEYA 4LDPA 1J6UA 1ISGA 3AF6A 2YW9A 2ZI6A 5CDSA 3ETNA 4GR4A 3OLCX 2D0OB 3HACA 1ZC3A 4MA5A 3S7ZA 4F84A 1XHLA 2WFLA 1NNEA 4Q39A 4D4LA 1FFYA 2AIRA 1U8CB 2QTAA 4OU4A 5BO5A 4OLAA 1L7PA 2X8LA 4UTNA 3R6TA 2I2AA 2JHAA 2QNIA 1EDEA 3U48A 3ID6C 3KX2A 5ARCA 3U4CA 5B55A 1NAHA 3G23A 4E5KA 3PUWA 4KX5A 2G08A 3IP8A 3KO8A 2O20A 4BE9A 4PHCA 4K46A 1ZINA 3DDZX 4LYYA 1BXRA 1M83A 3MCZA 4TL7A 4U8GA 4WJKB 2P2DA 4Y6PA 4NCAA 4YJ2A 4EELA 5BXQC 3UCEA 3KCNA 3G8BA 5TF0A 3PFBA 5FBWB 3RK4A 1QP7A 1GU1A 1H6BA 1MJNA 2DEUA 1RAFA 5JZ9A 1U2QA 4Q48A 4AZWA 3UXYA 3DFIA 3KQSA 1Q1NA 3WKEA 3BDAA 3NUGA 4P5PA 4OJYA 2FN7A 2JIDA 2WMYA 1J8YF 3IFSA 3NNSA 2F43B 3NKFA 4GP7A 1J3UA 2GRAA 3H2JA 5FPPA 2XPCA 2HU2A 4NAUA 4P54A 4CLOB 1PNQA 2QD1A 5HTKA 4C7XA 1MVLA 5FWXB 3R7WB 4W9MC 3O4JA 1PWXA 2R2AA 4BV9A 1PEYA 3LUDA 3OCCA 4HQ6A 1EFRD 3EGWA 5HA5A 2ARKA 4BLWA 3GNSA 3W9UA 5TT1A 3WGHA 2J0VA 1JNXX 4GKJB 5G4KB 1A9ZA 1SEVA 5JANA 5KOHA 4JEIA 2PNFA 3LPMA 5DB4A 3ZHXA 1V35A 1UANA 4V0MA 4KQ2A 2NPFA 2BFDB 2X5NA 1UINA 4R1OA 1VE6A 2JGKA 3C4QA 3T5GA 4X65B 3EPLA 1MH9A 1HTBA 2G88A 4H6XA 4Z49A 2MYUA 1TEVA 1XVAA 2ZRNA 4ZVKA 3WR5A 3GLVA 1J1UA 3N2ZB 4NATA 2AZTA 2NUPB 2OXRA 3MUEA 2W2LA 2R48A 4D43A 4XPIB 1CZNA 2QR3A 3EULA 3JD3A 3VSCA 4HVLA 1ODJA 3DFUA 4NEQA 2DPXA 2IEZA 3AKCA 4FD3A 4FINA 4E6EA 2WUVA 1ILWA 1DQZA 2QUIA 3AESB 1PSDA 4IGFA 4M8IA 4YCBA 5ULLA 3HV2A 4I5DA 5IH7A 1KDYA 2JIRA 5EQFA 4CTMA 4F4DA 1DIGA 1HL3A 3EAFA 1JMVA 4HQFA 5KNDA 1HC7A 4BU1A 1ZIOA 3NHJA 3QVVA 2QKYA 1YVEI 3ZHSA 4OXQA 1CS0A 5JROA 3M7IA 4KFCA 4AKHA 2D28C 1YBMA 2AD1A 1XLWA 4RVFA 5EG5A 3R0ZA 2G1KA 2ORWA 1D6MA 3AOEA 3W8NA 3BXXA 1VBMA 2FR8A 3UHOA 2F3PA 1OGYA 4M7OA 3LDGA 4K05A 4WZZA 4PZEA 4H15A 1FW6A 3A2LA 3HDTA 4C4AA 1KYVA 3QH4A 1R4NA 4RK1A 3O3CA 5BT8A 3JAWB 1XTVA 2EAUA 1KDTA 1YU9A 2XQKA 2X7JA 3GLRA 4TL8A 2NU9B 4DDKA 1W36C 3OWHA 1XQVA 1Z5NA 4HPXB 1UZLA 1UBJS 4WESB 1U1FA 3O3OB 1SKYB 3ORYA 4UM9B 3DG9A 2FWIA 1BC5A 3TM4A 2CNBA 4I9HA 3F4LA 5FORA 1K9SA 2PR2A 3S8EA 1EMDA 1I7NA 2X9LA 3CX8A 4K88A 1AKYA 4Q3EA 3S27A 3SC2B 5I7OA 3F5DA 1PJLA 2BKXA 2HRCA 3M0EA 2VNAA 3Q40A 2ZBUA 4BC1A 1IBMB 2NADA 4KAXA 1N1DA 2BP7B 3NG1A 4PYOA 3RQSA 4QAQA 3V1UA 5C1DA 2FH5B 1B8OA 4WASA 1BVHA 5HRAA 4RF4A 2O3UA 1S2LA 1P4HA 2X6TA 4I81A 4ZT3A 5E1BA 3SR3A 3W3AA 3W2TA 4MVJE 2UZ1A 1V25A 2Z30A 1LVHA 3BMOA 2PEZA 1R0BA 3MC1A 5B36A 2VR1A 3CF0A 1NVTA 2XX3A 4DA6A 1HEUA 4RY0A 2BGMA 3MCVA 4U2KA 5KREA 2F64A 4CCAA 4BWYA 3FAKA 4PIVA 1WD5A 1TLTA 2C0QA 2MYNA 2X2PA 3DMGA 1NVAA 3LFTA 3MTIA 3U7RA 4ERXA 1M0SA 4LX0A 3VC1A 4RKWA 4QQRA 2VNJA 4UNIA 1TD9A 2BR3A 5K3AA 3L8FA 3V7UA 1ZEMA 1VCIA 3FPHA 3LQQA 3R0QA 2WEKA 3LLMA 4FFVA 2PUWA 1RM3A 4I55B 3NOQA 4TTRA 3FYUC 3PPIA 4XLTA 1H05A 1SUBA 2VK1A 1YV9A 1E0SA 4WZBA 3KDPA 1T0HB 3AW9A 2ABWA 3I53A 2MIIA 3IP5A 1IW7D 4MS3A 3O95A 4C89A 4JB3A 5FTLA 4W6ZA 4DLZA 4B6QA 1LJLA 3OUZA 1B4DA 1KGDA 2QTLA 2Q2WA 3OLWA 3I8XA 4WH0A 1R3DA 1U4SA 2C54A 2J6HA 2JHGA 4OREX 1TYDE 4RD2A 3TZBA 2AFIE 3P2JA 4KP7A 4Y9TA 2BD0A 3FPKA 5CHEA 1JA9A 1BKDR 1SVSA 1NSYA 4IYJA 5CNJA 4DA8A 1A8QA 1YI8A 4QT4A 4YDRA 4MYRA 3RYIA 1UMBA 1QHIA 2XHZA 1A7UA 4TTQA 3EBOA 1I4LD 3AF2A 3F8SA 1AKQA 1TCVA 1PEDA 1V9LA 2RH4A 1Q20A 1H5UA 4P3XA 5LD2C 4XSHA 2RK6A 2HQOA 1FLVA 4AN0A 5KOJA 1P1HA 3TE7A 1AJEA 4QGGA 2V3WA 4YR9A 3E35A 2O3TA 2A30A 5REQA 3VKFA 5C1PA 2IY8A 3P9CA 2XE7A 2UZ3A 3C16C 4UUPA 1IVYA 3FWNA 3FFAA 3GZTB 4OKSA 1ZMBA 1BSVA 3KKKA 2WU1A 5FNVB 2V96A 2ZZMA 1HKUA 2VZLA 1JILA 2HQSA 1E61A 4HLDA 5BW5A 2P30A 5LOVB 3SF8B 3TVDA 2Q0QA 3P1JA 3CEJA 5EPOA 4F4HA 4KX3A 2IXGA 3AHEA 1PUIA 3D3EA 3VPBA 4RABA 1JIXA 1II9A 3BUSA 2XGGA 1QE3A 4US0R 2VDNB 3L49A 2PGXA 3LP6A 3S70A 4EJ6A 1KFCB 1SC3A 3JV7A 3V8QA 1SULA 2PU5A 2WPNA 1E5QA 1QPGA 3ZHCA 2E4UA 1JT2A 3ZGOA 1CY0A 2PX6A 4F4IA 3R3ZA 4E13A 5LR6A 4B4VA 3QY0A 2PTRA 1SXGA 3VR5H 4JYBA 2R6HA 5KSWB 2A5JA 4UARA 4KSBA 3OX3A 3W5DA 2BY4A 2J0UB 5DNVA 5JSHA 2XB6A 2XUIA 4JGGA 1O03A 3O90A 5ES4B 2PZMA 3AKYA 3R0IA 5GONB 1FRNA 3G7UA 3WRXC 1BQEA 1TW2A 2DH5A 3L4SO 3CEHA 4A0SA 1U5CA 3GCZA 5ED4A 4D82A 4NVRA 5F1OA 2DR3A 3C5CA 4YQYA 4E7PA 4RD0A 5C46F 1WXIA 3E8XA 2KS6A 4FGZA 1EG2A 3W0LB 2DKOA 4R54A 4J6FA 2BDEA 3QITA 3R3WA 2HK9A 3UXMA 3EPKA 2XDYA 2EDCA 1HZZC 3V2GA 5JIBA 1V26A 5ALZA 2CZQA 5K1ZA 4KQXA 2ZSEA 3WWPA 4P4LA 2EQ5A 2EP8A 3SQMA 4JKIA 1C1DA 1CY1A 1U3UA 3LL7A 3UJHA 2FW8A 4A2PA 3AHFA 1I7QB 1FDVA 4DCTA 4KQ1A 5IKPA 4J2TA 5K20A 3B78A 2MSKA 3M2TA 3THSA 1QAOA 2GXAA 3AB3A 1UWLA 1I8TA 1M67A 1N7JA 3WXMA 4IS3A 1I1NA 1RM5A 1XC7A 1WA5A 4ZT2A 2OV2A 4HTFA 1R0RE 1XVUA 3FZQA 3IE0A 4NU6A 4QFBA 4B3RB 4BVLA 1WBBA 2BCJQ 3DKIA 1A9RA 3F98A 4NMXB 1FA9A 2QN7A 2ZU0C 4MGIR 2NWQA 4CMHA 1GDDA 5IX8A 4JYPA 4KR3A 2RH8A 5BWCA 1M73E 4J90A 4K5QA 3PF8A 3EIOA 4F6LA 3GZNB 1SU4A 1SM4A 4CEJA 2GDJA 2I6UA 3F90A 5A05A 3U1VA 3G79A 4DYVA 3OE1A 2QL6A 4XTRA 3PTLA 1H8ED 3DVAB 3G59A 1QS0B 4EHBA 1P0IA 2H2DA 2OV8A 1CQWA 4NBRA 1E5LA 1EUYA 1XTQA 1PZXA 2H2FA 3LNCA 2XUAA 2WHPB 2ACEA 3WLFA 3W2EA 1Z13A 5LKAA 2QJTA 1NJGA 1QHHA 3B6MA 3OH8A 4PCUA 3TOCA 1ZW6A 3U2QA 4NZNA 5A71A 4C5CA 2O8FA 4RZHA 4S1PA 1EUQA 4NQRA 2XNHA 4M1QA 2OBMA 3TRFA 3K6SA 3OCJA 1SXJD 2Y1LA 2WG1A 4QDTA 5HDQA 5C80A 2JK1A 3NTLA 3MJDA 1DHRA 3GMDA 5G3ZA 1VOTA 1XTBA 2X9VA 1XPJA 4WXYB 3GROA 3QE4A 2Q2VA 2ZSIA 3B7PA 5KQGA 4XDHA 4E4RA 2Y2UA 1ICEA 3B60A 4RKYA 3ZU3A 5J4VA 4M9CA 2DY1A 1DKRA 2Z57A 4QBHA 2FRDA 2SCUA 5FFFA 3KEQA 3DEZA 4YGYA 1T1SA 4MCHA 2H2HA 1T34A 4YBRA 4PLPA 3VX4A 3R3VA 4F3RA 5MN5A 3JSXA 3C5VA 4EGFA 4NU5A 3JWEA 3AV3A 2PPLA 1CQJA 1G17A 3EF1A 3P27A 3PIRA 4M6WA 4MQ5A 2XYPA 4MVJH 3MB5A 5EINA 3RRBA 2X9QA 1XEFA 4TS4A 2OBYA 3TIIA 5L3VA 3UJNA 5AJHA 2VPTA 1OXSC 5CJ2A 5ABPA 3EVAA 4WGGA 2CL7X 1RMQA 2CJWA 2VC2B 1YA4A 2O3JA 5EYPB 5FBZA 4FIZA 5I7UA 2XNDD 4QASA 2JDID 3NBKA 1LFAA 2FWAA 1B76A 5AKGA 1DXYA 5ALIA 3PQ2A 2D2IA 4TLEA 4XFDA 3DC7A 1LF0A 1W5AA 1P5RA 4MAFA 4A8JA 4W1QA 4MSUA 4U7GA 3ZV5A 2RAUA 1VTKA 4A6XA 1H2ZA 4N7MA 5DU2A 1SAYA 1T2EA 3PL5A 3X1JA 1DCNA 2GYUA 3PC8A 4FLMA 1JSZA 5EXDA 4WZ6A 3WRWA 5EWMA 2WTUA 4JC4A 1Z28A 4N54A 4EEKA 1Q6YA 1VB5A 3DDNA 4CNQA 5CURA 2D5BA 2V1UA 1H0RA 2O3SA 3G1UA 3N3BC 2G3YA 4QSHA 2C00A 1BD3A 3N6RA 2PFGA 2BFAA 2O1SA 4LOAA 2DZDA 4DABA 3C8HA 4Y9SA 3L8ZA 2IXTA 2VK2A 2DY0A 5FYQA 4B6EA 2QRZA 3ICOA 5FBLB 4XIGS 5CA0F 1DC8A 4I4TF 3R8CA 5GVSA 3O4HA 3F6SA 2AI1A 2DVMA 4UCXA 1SELA 4HDRB 3RSQA 1Q12A 4ECEA 3TD2A 4EEXA 3Q3IA 1CUGA 1Z18A 2CK3D 3KPUA 4LNAA 2YR0A 4ARZB 5KNBH 4FTWA 2A14A 2HMWA 2YHBA 5K3DA 1ZVMA 5KC9A 3TQOA 3COVA 1EB9A 5I5GA 1KTVA 3EC1A 4OHYA 2SKCA 3HFGA 5JVDF 5DIFA 1AKUA 1QGED 4G2NA 4LJ8A 1FY2A 4P7KA 1UXGA 1IOZA 2Q9BA 1XKQA 4PBTA 4YNBA 1CDEA 2BUCA 2VSOA 2YCLA 1ZI6A 3M70A 2F9FA 4ZQBA 1HK7A 1XTUA 3HVHA 2Z6UA 1A4RA 3TH5A 3ZWVA 1IYZA 2AVNA 3QI2A 2PGNA 3LXMA 1EJBA 2P1ZA 4B0OA 2OGZA 3X1DA 1SIBE 2DWCA 3OWXA 4M0UA 2F3TA 4E94A 1GZSA 2YJGA 2I1WA 3ESYA 3NDIA 2UZ4A 3RIYA 1KYZA 2C78A 4FK8A 4NS4A 4C2TA 1FP6A 3PB3A 1GNRA 1GCGA 1A88A 1SOVA 3ELBA 3GAAA 4HUJA 4NYMR 5AHKA 1XD2A 2QG9A 3PTZA 4PLYA 4QUJA 4RX1A 4LDZA 5AOBA 3SQDA 1ZNZA 4IWXA 2H9YA 4AQDA 1ZI8A 1KYWA 5HP4A 3UAVA 4DTCA 3FY4A 3LC0A 5EKTA 2VJQA 4MB0A 3VO1A 3H2IA 3G8DA 3SIRA 1YDFA 5PNTA 3FPFA 2BGLA 1AO0A 4QXRA 3ML1A 1O5OA 2XUGA 3B1JA 4ZJYA 1OXBB 1TUEA 5BYKA 3HJRA 2P9GA 4DCSA 4RAQA 1E2MA 2QAJA 8ADHA 1WEHA 2ZM6B 1HT1E 3S81A 2J3IA 1DKPA 2CXXA 1P3Y1 4CHGA 5EHXA 2G09A 2VJPA 1F06A 4JC8A 4Q3CA 2Y67A 4RFVA 2QZSA 1UDWA 2VTVA 4XVHA 1YZUA 2AJDA 4X6LA 4S1WA 5T3YA 1NXVA 1KFEB 4YQFA 2G67A 4YAWA 1OGJA 3F9CA 1NVVR 2CMFA 2BFFA 3QPCA 1FP4A 3BE4A 4WSOA 4E31A 1JTVA 4MROA 2Q21A 3QWAA 5ES3A 2WDZA 2FWNA 3JARA 3D0QA 3LX5A 3G0GA 3KYCB 3RG2A 3B9PA 3ELWA 2PO5A 1UFVA 2UZAA 4K8OA 3OQ6A 5JMPA 3B1FA 4F21A 3RSOA 2UUBB 3A9UA 4JL5A 4NP6A 1YZVA 1A5ZA 1JALA 3EC2A 3EXG1 1OI3A 2AZMA 3LF2A 1IZ8A 2ZBQA 3DP9A 4FFBA 4LSMA 4PO3X 3Q7SA 2DQ4A 3TLJA 3I92A 1I01A 1ZH4A 3VDRA 4K6HA 4DVJA 2X3YA 3LY8A 2CL0X 2QW8A 2W2QA 1HR0B 5DBOA 4KZKA 4LDJA 2WZCA 4BE4A 4QJBA 4HFNA 2DERA 1VRCA 5MGBA 2NYUA 4MUXA 5A4KA 5L3RA 4E2WA 4CR7A 1NE7A 1R9MA 7REQB 3UFXB 1AY0A 2EFHB 2JGMA 3WGVA 2EJCA 1MAUA 1NL3A 3I23A 2AJLI 1DJOA 1K7FB 1L3BA 1O6BA 3QSYA 2JASA 1P2VA 2BWJA 4OJQA 4OQLA 4BNWA 1W73A 5LMNB 3T9AA 3CF2A 4QFDA 1Q3HA 3IPLA 4LYGA 1FFGA 1H22A 4RA9A 1RJEA 3GIWA 2IYAA 3ASYA 2IOFK 2VDVE 3AVUA 4PINA 1OROA 1P9LA 3VH4A 3OU7A 4RYDA 4V3CA 2ONZA 1NRWA 4HQOA 3ENNA 4GGPA 5CA0A 4I4TA 4UEJA 1MNQA 1FDWA 1U1EA 2GK7A 2OAGA 1TUBA 2X0EA 5I3CA 1OH6A 1M54A 2EQAA 3K0BA 5D84A 1YI1A 5DO9A 3T52A 4AROA 3U60B 3UK7A 5L3ZA 1E3SA 5BSRA 1KP2A 3F7MA 2FLVA 4GXNA 1A4IA 1HM5A 3GRCA 1JQLB 4NMLA 3IS3A 4BLPA 3O2JA 3DVQX 1KWGA 4AN4A 2IODA 2O2JA 3SS9X 2WA2A 3CUWA 4HBGA 5JVDA 1SG6A 4KN6A 1SZDA 3C8ZA 3DTVB 2O6HA 1YDMA 3MWKA 1P1KA 1G38A 2H8KA 2J3HA 2HT1A 4EFNA 3F78A 5EJGA 2ZYDA 3GLIB 1VPTA 4NSLA 4IJ5A 3VU0A 1JAXA 3AUJB 4CFYA 1SU8A 4K3VA 1WB5A 2CB9A 3B2NA 4R31A 3WYBA 1U6JA 4QOGA 4MX2A 2FSSA 3CRNA 3ROZA 3RVMA 3S2UA 5E1DA 3VDQA 5LWHA 3SJAA 4QATA 2HTFA 1SWVA 2JIZD 2ORED 1FX0A 1H85A 2Z8YM 3DOHA 4RL6A 9LDBA 1H3NA 5EIXA 4ZRMA 5KJ1A 4F60A 2PS9A 4MWEA 4L08A 5A4DA 1IN1A 4QOEA 4BNHA 2JKYA 3EYAA 1EH5A 5LU8A 4II3A 4GU5A 2C4KA 4I14A 3C6BA 5CT6A 2PZJA 4QUHA 3W9YA 3DO8A 2LTAA 3ETDA 4F1KA 1TKRA 2EYUA 1P44A 2RGNC 2WWXA 4W5NA 2CVPA 2BI7A 4UOZA 3ETEA 1VFNA 4PPQA 4H08A 1QWOA 2VRBA 2ZJ5A 1DAMA 5ALRA 3ZWNA 4KJZA 4YYEA 3SC4A 5IEJA 2XKKA 3JASA 2R1UA 4M0DA 4KR7A 3DTYA 3C3DA 4QUIA 4AFNA 2WOOA 3U37A 1FTYA 3WWCA 2O07A 4JCOA 1Z5WA 2BZGA 3OEEA 5CB6A 2H0AA 1J5XA 1X1BA 3F7NA 1DX9A 3P0FA 2X42A 3MTGA 1YVRA 1SR8A 3N6VA 4OXXA 3AZQA 1KSGA 4E5MA 2ZBRA 2DUWA 1S2OA 1G4AE 2V0NA 2X7XA 3V4OA 1XZGA 4C2BA 1M2JA 2Y1OA 5EC8A 3UAWA 2PLRA 2G1JA 1Z5OA 1FUYB 2OLKA 3FI0A 3QIVA 1XJQA 2Q1XA 5AK0A 2X4LA 3IMFA 4PFJA 1CUXA 2HNKA 2I8LA 2IYWA 1R6TA 2ZGVA 1HG1A 5CLHA 2ISQA 5F1KA 3ZE7A 2O3RA 4B9AA 1RKQA 3OQNA 2BR5A 4PZCA 1EK6A 4GYWA 5SICE 1KEPA 5ICCA 3R3YA 5AQEA 3P8ZA 3O3MB 4TRJA 4O2LA 3VFDA 3PNVA 1YS1X 2I55A 2RKOA 1T2UA 2YDYA 2MDTA 3DEAA 1JEAA 3L92A 4Q3NA 4Q7MB 3EXFA 1FNBA 1NQAO 3USCS 3ZBTA 4EO4A 2ACKA 2GA8A 3TZ6A 1JIJA 1K0FA 3H1EA 3WVNA 4PR0A 1WLYA 2BGNA 1L7MA 1ZC4A 2HXSA 5COBA 1MB9A 1CJSA 3PE4A 1TZJA 1CTQA 4RHEA 4C0HA 4C0SA 2VZ8A 2XCOA 1IU9A 4BNTA 3C6XA 4FPXA 3OCXA 5CH5A 3V6LA 3NASA 1W5EA 3GGGA 3AETA 2C2OA 3HGTA 4AO6A 5FH9A 5H9VA 2V7QA 5EGNA 5FB3A 2B69A 4GZ5A 4WCFB 5FKJA 4GFDA 4DV2B 3FOFC 4GO1A 1FFWA 1TW3A 1GZVA 1HEIA 4IIHA 1VGVA 5JXHA 1VJ0A 1I0IA 2IEAA 2V0CA 2WIGA 1C30A 1QPBA 3KQUA 3EX7C 2X0RA 1LK7A 2E2WA 4P0QB 4BTVA 2ZRAA 4MZXA 2NTJA 4Z4IA 2WVHA 1UBTS 3BZWA 3GRPA 3H2ZA 3OFND 4LY6A 4N7BA 4NPHA 1TO2E 3DOOA 3GRZA 3KUCA 4ND7A 3LU1A 3IQHX 2ZYVX 1NRIA 3VSDA 4G1FA 3ZGNA 2OKGA 1WPGA 3FIJA 1BX0A 1R6UA 1SOAA 1E3LA 1GU7A 3IV9A 3UPDA 1QGYA 3ZXIA 1YQXA 4JLKA 3VC7A 3D43A 5JNTA 1CJKC 1F8GA 4M9QA 2JKVA 3RSSA 1AKVA 1FYDA 4PLZA 3PRKE 4MWBA 1M5UA 3TQIA 1NVDA 1UMKA 4IEIA 1KFBB 3FIUA 3GNLA 4GVXA 1PFGA 1JL3A 2Z5VA 3BF7A 1TA9A 3WI7A 4WTOA 1ZONA 3LT0A 3QLUC 5JBNA 5C34B 4WN9B 8ATCA 1S8FA 2OHJA 1G2OA 2IYNA 2PL3A 3NJRA 4S12A 3NR2A 4Y2HA 4N5DA 1YZGA 4B45A 4HFMA 4WADA 4ZGGA 3CVUA 2GZDA 2XNCA 3GEHA 3AOEC 1V6CA 4Z5XA 2DLCX 5KYNA 1HKHA 2FR8C 5LDGA 5DHFA 2PANA 5GY7A 3O8RA 4G2TA 4XFJA 4B71A 1TB4A 3R3HA 4KN5A 3V42A 3EIHA 3X3HA 4WGFA 4DG9A 4PN3A 4S05A 1FUOA 2ZBVA 2ZAGA 3SMQA 1ENZA 1RRMA 1PQPA 1JH9A 3TV2A 1PLJA 3FPEA 2VVTA 3DVSX 2BDUA 3MWFA 3OCVA 1DKQA 1Q50A 2H92A 3K9QO 5KTOA 4NXMB 2ZRQA 1ZG3A 1J00A 3MLBA 2WT4A 3UN1A 4ND3A 2J3MA 3WRVA 2YRWA 3GFRA 3RYTC 4JJ4A 4DLWA 3CX7A 3HDGA 3TIXB 1QDEA 2BPOA 3UJ8A 1KI3A 1F0KA 3KXDA 2QMQA 1P75A 2PG3A 2GCOA 3P2YA 1Y1QA 3A6ZA 4BOYA 3PYXA 3WLHA 3C4VA 1MO6A 3R7AA 1YZHA 4YCNA 3C41J 1SB9A 3FKSD 2FN9A 4UREA 4U8HA 2O1EA 1OHHA 1E4VA 2HA2A 1XNGA 3BMXA 4KO3S 4B75A 5B4TA 7ABPA 2OZKA 2DPLA 3QVWA 1EHIA 2DLNA 4D0NA 5TB5A 4AP6A 4A8TA 1ZN2A 1WLSA 1XNJA 4LEIA 1C3VA 5A6SB 5KQLA 4M8SA 4ETMA 3C3AA 1FZTA 5L9AA 1ISPA 1OBHA 2DFTA 7MDHA 2QTTA 3ZIDA 5E4TA 1OH5A 2CDRA 2FX3A 3MWGA 1ACJA 1ML3A 3DDHA 2B1JA 3NUZA 3AFHA 4NZMA 1II8B 1VG9B 4HGYA 4UAJA 5LZ8A 2EARA 2ZE8A 5FFMA 5E3JA 4O4HF 1E98A 4U3JA 1WG8A 1KH3A 1T4MA 3P9IA 3P9RA 1VCNA 3QEMA 4FZVA 3T1VA 3UOWA 5BN4A 3F5QA 5CB4F 4LV6A 4RTNA 1X7HA 4ZAXA 2ZJ8A 3PXXA 4MVCA 3RUAA 3PRYA 4TTJA 1XZFA 3PPYA 2MSDB 3I45A 3OX1A 1UCFA 1X0VA 4YO8A 4DDMA 3DFKA 1MFPA 3VBCA 1JN0A 3LWNA 2PQ6A 2B5VA 4GQAA 1E1DA 1P7ZA 4A10A 4QM7A 1X8KA 1JAHA 2DBYA 3A9VA 3I1IA 2FPKA 4NPCA 5D51S 1KYXA 1AQJA 1C41A 3WIVA 4KWCA 1JJ7A 3JQEA 2XTAA 2Q41A 4MA4A 4IPTA 2QM7A 1EUCA 1EVEA 1N9KA 2DSTA 2Y93A 5JWRA 4M3NA 4EPWA 3BWDD 3GFSA 2NUAB 3SP1A 2HMTA 4F8EA 2XA1A 4UNRA 5J58A 3K70C 5JXIA 1P7CA 5J1SB 1C3JA 4QKQA 2OXTA 1M5RA 4AJ9A 1XDGA 2CFIA 1ST3A 2GEJA 4DG8A 1CC1S 4MV7A 4Z9XA 5BSWA 2PUFA 3DXZA 3O1IC 2FSPA 1U9YA 4RGYA 2NT3A 3PXGA 2BHRA 4YJGB 1NBMA 4AWBA 5LNK6 1Q83A 1SUPA 4X1KB 3ROFA 3EK2A 3HB4X 3TMKA 1FB5A 3H4VA 2AJTA 4M99A 3DE0X 1CIVA 3D4BA 2XADA 3VVMA 4ZIRB 4UU0A 2C94A 2YQZA 3C4JA 4LJKA 4YDHB 3ROPA 4CCYA 3S1LA 1GA4A 5CMLA 1YL5A 1I5OA 3DHYA 1YT5A 1J56A 1Y4UA 3UZUA 3VR6D 1DO2A 3DTNA 2IHYA 5JDIA 1IY2A 2WZDA 2GAFA 2OVBA 3FM9A 3LRPA 1BU8A 1XZJA 3PJEA 4FBGA 3FMPB 4I50B 3V7YA 2JH9A 1IZZA 4R68A 4ZI7B 3BD9A 1DI0A 3FZGA 4EA6A 2CLKB 3IQWA 3IELA 5JI3E 4IH4A 1J2EA 3ZJVA 4EY7A 4HEHA 3BH7A 5D3QA 1YRBA 1NX9A 2C77A 4P7JA 1RYYA 4S1VA 3V2HA 1F6DA 3AM3A 1PK9A 1G3QA 3NU1A 1KAEA 2GZ1A 2X6QA 1LTQA 3UEOA 4YMUA 5FHQA 2F3SA 2HPHA 3P94A 5KNDD 4OHZA 4H3KB 4Q47A 4M9RA 4UNNA 1TT5B 1KDZA 3QTTA 2CVHA 5EZ5A 1DRKA 3QKWA 1QDUA 3QXGA 3R3XA 1Z6AA 4L5YA 5TMDA 1HDXA 5TQ0A 5TQ2B 4DJJA 3JZIA 4ROSA 5CLFA 2O54A 3BGIA 1PWHA 3KVYA 4O4LB 1UDCA 1Z37A 3BTSA 3EQ6A 4FHCA 3VPCA 2FW9A 5IG2A 4TWIA 4BPRA 2XQJA 2AQKA 3OPMA 3N2YA 3DAHA 3TINA 1PG5A 3VR4H 2QUAA 2X0DA 3G5LA 4LHSA 6AT1A 2ZB3A 1ABFA 2P9QA 1XEWY 4FSXA 4ZN6A 2YXLA 5TT0A 2X4DA 3ET4A 3NWOA 4ZCLA 1Z4JA 4MKXA 3SX2A 3INYA 4F2HA 4DM7A 5ADUS 1NBWB 3DLTA 2AMJA 3ND7A 1ECFA 4TYQA 5A5FA 3QMMA 4TT3A 4MYTA 5TMPA 3GLHB 1FVXA 4BLTA 2X19A 2Z1MA 1JG2A 4OYHA 4WBNF 4M53A 6YASA 1FLDA 3P9NA 4XRGA 3AM1A 3EVDA 4C9BA 2ZUTA 1JDSA 4M2LA 4X44A 2ISSD 3OHSX 4I4CA 1FJ2A 2BFEA 4HEA1 4B79A 4KXUA 2VQFB 4MX8A 3ZK9A 2VDPB 2UUAB 1PT5A 2JCGA 2A94A 5K8CA 5LQUA 3FOZA 621PA 4O4HA 3AHCA 4PSCA 1PZGA 1TU3A 1N9GB 1X42A 1IEVA 1Y8RB 1ZZEA 2XMZA 1HDCA 5KCMA 3SYMA 1NBOA 4FJ1A 4CR8A 5CB4A 3FKQA 4J07A 3VRHA 3MJHA 4RH0A 2R4QA 2CNWD 4ND5A 5AOAA 3S2YA 5AWFC 4EQ6B 4LQ4A 1X80A 2EJUA 2VLBA 3M6LA 3BQNB 4LGMA 3ZBUA 1UC8A 2OHXA 1A7KA 3UAGA 4BBAA 5ERXA 2WYWA 2QAGA 1FSGA 3DEJA 4YT4A 3HR4A 3KXLA 2FUG6 3I6BA 4EAQA 1ZITA 4RZIA 4JDUA 1U3WA 2X0FA 2JHFA 2A0YA 1ZVQA 3I3OA 1VHWA 2BEWB 2BI8A 2Z8ZA 1D6SA 4ENSA 3I0NA 4AI6A 3VGPA 3TOSA 3WP1B 4X7BA 2Y6UA 1W25A 3DO6A 4JL8A 3SEQA 5BN3B 1H0SA 3WMWA 2FGKA 2I1VB 3H8JA 4DAEA 4DWVA 3GU3A 2FRDC 1N2BA 3INNA 3NHWA 2VKTA 3NYIA 4XGNA 2QR5A 3WWEA 1X7XA 1SQGA 2GPSA 2IH5A 1T9HA 1BYIA 2A5DA 1SUEA 4QJ4A 5AXCA 1DJMA 1QYIA 2AOUA 2ZTLA 2B3TA 1EUDB 3M5CA 4KFSA 1RDFA 3TCNA 3QW2A 2OB2A 5JNUA 4MDHA 4CTOA 1QYXA 2QU8A 2QVXX 1DEOA 1G8FA 3D7KA 3ZH2A 4ZAWA 4K8RB 1M0WA 2I3DA 1QF6A 1RYFA 5EIBD 5IDWA 3IAEA 2EW1A 6ABPA 2PXHA 3FE2A 1BMFD 2VQEB 1HOTA 2Z09A 3KB1A 3KVOA 3ENVA 3NGMA 1QGZA 4R01A 2W6PA 4EY4A 1PZEA 1DQSA 3G7SA 3FTEA 4JSYA 1PTJC 1ZBDA 4EA9A 1G20A 4P2GA 4JLSA 3CLKA 3T3PB 3NHBA 2D7DA 1SCUB 4PTLA 3DHEA 2C4VA 1V3UA 4NC9A 3HADA 2OVFA 3PGJA 1E2FA 1PJ3A 2LCFA 4EB6A 2WMDA 2QT1A 4K3UA 2H7YA 1EP1B 2PKXA 3QVKA 4BRSA 3QVJA 5JATA 4AKIA 3FZNA 1R8XA 2R97A 2HR1A 3V7NA 1T26A 3FMVA 2KW5A 1GYQA 4Z7QB 2VSQA 1IM5A 4GRDA 4R8SA 1KK3A 2R6R1 1JLMA 4H4DA 1L4LA 1IAQA 3G9XA 2OYRA 4H0NA 2X1LA 3DZ8A 1RXYA 4D42A 3N7TA 4N39A 3WE7A 2ZIXA 4DLBA 1PK8A 1EJ0A 1GPKA 5G1NA 1JHOA 3HRKA 4DEVA 1KMIY 3M6IA 1B6RA 3IIEA 3D7MA 2XWSA 2JVIA 1KMHA 3EPPA 3I2YX 3M5DA 3BXEA 4HUQA 4NBSA 4TZ6A 2ZBEA 2HNBA 3DAOA 1LUAA 3A1CA 5HM6A 1QBKC 5EHIA 1NI5A 2Q6KA 3O8NA 3OY7A 2FOXA 3MWJA 4M89A 2EQBA 2RB4A 1K97A 2XGOA 3BH6A 3LT1A 4NBUA 2PUJA 3U9LA 1ODKA 3KOWA 4REQB 3PLNA 3F2VA 3NAZA 3MWEA 3N5KA 1SOWA 4NDNE 3W7AA 3STUA 2W0MA 1P1RA 2E21A 3NXKA 4WDRA 4ARBA 5AM5A 3K0AB 1LA2A 4ILKA 4A0HA 4PU0A 2ZTSA 3OTOB 4C7JA 4WBNA 1BOOA 1CY2A 2WVAA 1D04A 3HKCB 1ZQ1A 5CDUA 1P1IA 3AEQA 4BQSA 2K6GA 1L5RA 1GV0A 3OTHA 1ZNWA 4R2LA 2WSYB 1NJ6A 4Q4CA 5HPYB 5L4SA 2P4QA 4ZYLA 2PN1A 2WMOB 4O2RA 3GXOA 4ITVA 2GFIA 4Q9NA 1KBQA 1IXZA 2JLQA 3K5HA 3Q3GE 4QYTA 3H3FA 2Y68A 4NYJR 3ZDCA 5MN4A 1RVV1 2CMDA 4V02A 4EYOA 1FYWA 2GF0A 4NONA 3Q2KA 2A1UA 1V5EA 3TZCA 3ABIA 5A9SA 3TDMA 1IIBA 3ZE6A 2EEZA 4F93B 1H42A 3IIIA 2OTCA 3JYOA 1UC9A 1Q14A 4K6FA 3TGPA 1M74A 3NWPA 1G64A 5L95A 2YWEA 2VT6A 4JI7B 3FLMA 3UENA 3T5PA 1ZMXA 1VKHA 3GLTA 3S2IA 1TYBE 1T15A 3LWZA 4PX2A 4XCVA 4HAWA 3T4EA 2W8BA 2K5UA 3LZ6A 5ALLA 3FPSA 1XVVA 1ULUA 1XUOA 1WOYA 2QN8A 3WTBA 4P93A 1ND5A 2AXPA 2PTHA 3ITEA 5D01A 5EIEA 1JMYA 5LQCA 3NHSA 5JS6A 3M8KA 3OPYB 3RAPR 4FW8A 5FOQA 3PG5A 1KVQA 1SVOA 1T0PA 4RSGA 4UD2A 1KKLA 1JQ5A 2WKWA 4G1CA 2I7XA 1Q2UA 4ISCA 3UWPA 2QV0A 3ZLTA 2DFDA 1COWD 5A62A 3IVXA 4R6WA 1ZD4A 4BJHB 4DNXA 1OB2A 3P26A 3Q4GA 4UQPA 5HK9A 4L1KA 5AKYA 2G17A 1CUVA 3EA0A 2C0CA 4CMEA 1ZCFA 3FXAA 2JKZA 1SU7A 4ZEXA 4GL2A 4R81A 5DLQC 5KI6A 1MX3A 2RKWA 2JGLA 3M49A 4JT4A 3TQSA 5JZBA 2ET6A 4MRPA 5CA1A 4DMUB 1E4EB 3R6GA 1SBCA 1D2AA 1I24A 2BEVA 4YROA 3ZCSA 3ZXUB 4Y1FA 3EIFA 2AKYA 4OJTA 4YALA 3OOJA 3U4GA 1IATA 4LXGA 5TJ9A 4FQ5A 1QKJA 1JKIA 1S8OA 1T5TA 1ZY2A 4OLHA 1Y9JA 3L7AA 4QDZA 5B53A 1Z4NA 3ZGVA 3ANMA 3A3KA 2O2GA 5C3MA 3FTDA 4KXXA 2J4FA 3H5AA 2P4EA 2CLOB 1SK8A 4CV3A 3PJRA 1XE3A 1YS9A 2IZOA 3PHGA 4M37A 4RKRA 1FSSA 1MO2A 2LDXA 1DCMA 2P4SA 4G63A 5E9WA 1YRAA 2NG1A 4G89A 1LPPA 2YV1A 1U9JA 2H1LA 5LB4A 2OXIA 2OCKA 3BM5A 2A0WA 3FUWA 3Q1LA 4KTVE 3T7CA 2AW3A 3G5AA 1N78A 3CPHA 2FRXA 3KK0A 3DDOA 3JD1A 1LSOA 4TKZA 4CMJA 5AVUA 2JFBA 1IEXA 3O91A 3IALA 1QK3A 3L1VA 3HYRA 1ZCBA 3USES 4O1IA 4Z0TA 3NAMA 4QDUA 4DMLA 1G42A 4DADA 3WC4A 4IQ0A 2YVUA 4UE2A 4DV4B 2RSLA 2OR3A 4TPKA 2IUSA 2HLDD 2G9ZA 1GCIA 1SQ0A 2Z3VA 4G81A 4OOEA 4YAOA 3TX2A 3AC0A 4DL9A 1RAGA 5JXWA 4KRFA 1QYVA 2VNKA 1MOQA 4MDYA 1XJCA 4PC6A 3TI9A 1ORVA 3N1UA 4F5ZA 4WOCA 4CEHA 1JA1A 4HEJA 4IMRA 2WHEA 2QR2A 1EUZA 2DFKB 3LSTA 2K2WA 4GOMD 3ZDAA 1HQKA 1K3UB 5L6MB 4EH1A 1WHSA 1H2BA 1PS0A 1XTIA 1S7GA 3CM0A 3QUSA 4MLDA 1JKJA 4AICA 4F8JA 2ATCA 3CBGA 5GP1A 1LEHA 3EJWA 4A0GA 5BVGB 2C99A 2A7QA 1E89A 3ESXA 1AMOA 4RD4A 4NPAA 4UTXA 1FNCA 4OYRA 3RYCB 1E6WA 2YMQA 3HJCA 3X44A 5JXGA 1QBGA 2C7GA 1G3IA 3EAQA 2GZAA 2W2KA 4JVSB 2CC2A 2GM5A 2R4TA 3AFGA 521PA 3T3DA 1HX7A 3RV3A 1G21B 3GD5A 3V3KA 3W7BA 5U4QA 3G89A 1R7RA 1VMDA 2VWPA 2COEA 3DEFA 4K9RA 1R64A 1LZLA 1W581 2ZB2A 2DFVA 1JT9A 4C6SA 4ZHSA 2O59A 1CY6A 3SE7A 2AX3A 5F2NA 2GZ2A 3C1AA 2IUFA 4FWTA 2AK2A 3ZY4A 4N3AA 4C4YA 1A0OA 1D1TA 5EXEA 3EIQA 2ADFA 2WWYA 1NQOA 1RKUA 3M9LA 3ADKA 1M34A 1CETA 2NZWA 4JGIA 4FNOA 5HSGA 1NN5A 2IUTA 1BG6A 1YZQA 1XA4A 2AHOA 2VS1A 3JR3A 1P5FA 2C20A 3G68A 5DIZA 5HBRA 4UUMA 1F2DA 4D92A 4BO2A 1T1JA 3UHFA 4CETA 3ADCA 1NSFA 1O95C 4KVFA 1VSBA 5DXAA 4KNWA 1MT0A 2P69A 2N1BA 3UT0A 5HXAA 5KCZA 5I8WA 2P6RA 3N59A 1Y3IA 5ICSA 2ZT6A 1JAYA 1GUYA 2CXTA 1A82A 2XCLA 3P71T 4PQRA 1FFDA 4HYEA 4XASA 4BKRA 2HSEA 3HWRA 1XRRA 1ESEA 2CXNA 4YRDA 1KAMA 2QXYA 3FROA 2AR9A 5LQKA 1G1MA 1E69A 4BJ5A 3VUFA 3WGQA 4D4JA 5CX4A 3MJ4A 2ZVPX 3B38A 1AQYA 1RQ7A 1MZVA 2G0TA 2OPBA 3LHSA 2ZSDA 2QVBA 4L2IB 1OFHA 1DAPA 4Q1FA 1DNPA 3LQ4A 3EUWA 1YAHA 1ZJ5A 4LMPA 5F5XA 4WY2A 2PMBA 1TTHA 1ZD5A 3O7WA 4UPEA 1Z0IA 1BCSA 1P8AA 1RXEA 2UVPB 1SA0B 3PNYA 1P2SA 4KDRA 4OBWA 4RESA 3S1AB 5LJIA 2IHNA 1BVUA 3FNEA 3R41A 2GLUA 1U94A 4BWFB 5EZYF 3L4KA 3CH5A 3RRNA 3KZXA 4KUHA 2GYWA 3F47A 3QXHA 1VZ3A 1ADGA 4XRRA 2J7KA 2L19A 3PGXA 3IUSA 1QR2A 2FZVA 1NUHA 1NTOA 4XEUA 3PQ6A 3E1KA 1RWWA 2D2FA 2H4ZA 3VYWA 1R74A 5F1YA 1K0UA 1L6RA 1INLA 1IZ9A 1SC6A 3OF5A 3RD8A 1DX4A 3COWA 3NC0C 2MSCB 5GIOE 3QX7A 1LX7A 1QCCA 3H7AA 4B48A 2UVDA 3N2KB 2E5WA 2GPNA 2IW1A 5E9JA 4V1CA 2XOKA 3DYVA 5CDGA 3L7KA 1A9YA 5CXSA 421PA 2VCHA 1CNMA 2OK7A 5IKOA 4QQFA 1JZTA 2VQSA 3R3UA 3NP7A 3PXDA 1NI4A 1DKLA 2R1ZA 4QECA 4II7A 3I72A 2H5LA 4IDOA 1F2UA 1BE0A 1TRHA 2B2CA 4EENA 5FWXA 3ZD6A 3INGA 1P7VA 5F76A 4DJTA 2JZOA 4EZIA 2DBZA 3GH1A 2Y1XA 5J59A 2XCTB 1QG4A 2VYQA 3DNPA 3K5IA 3BGVA 4P3PA 1J8DA 4CG2A 4EPTA 5U1PA 1ULTA 1GA1A 3C5WP 4POAA 2QTBA 2CGEA 4U2CA 4BFCA 2SBTA 4C0JA 2ZI9A 3NDJA 5FA8A 3QELB 5IDYA 1K3FA 2OUKA 3VPGA 3P4YA 5JRJA 4LYAA 5K0EA 2WD8A 4ENQA 2NOAA 3I1YA 5FHRA 4C4ZA 3W5BA 4N5NA 3UMFA 1H4QA 3UKOA 4GZLA 3QFSA 3C43A 1DUVG 1QKIA 1J2JA 4PPYA 3QKRB 1BDJA 3O8LA 2A58A 2XZPA 2PQ2A 4B33A 2QVYX 4XD2A 2H0QA 4PG6A 3BFKA 4Q4HB 1WDLA 3CEAA 1L8QA 4C0BA 3U5ZB 3LY7A 4ND2A 4OP1A 1WB9A 4Q3KA 2HK6A 1ECBA 4UHDA 4UVHA 5CGZA 2L0XA 5AW3A 4NENB 1GRVA 5LOVF 4X5OA 3L5OA 5DBIA 3HTXA 2WI8A 3IEKA 5F33A 3EY9A 1PP4A 2JAQA 2HIAA 3FWZA 1PV2A 2E4ZA 1OLUB 3AESA 1PS9A 3DBLB 3GMIA 3K8OE 4LW8A 4MR8A 2VDUE 2SKEA 1AM4D 2WE8A 4CF4A 4HAXA 2X2FA 3PKIA 2C42A 4B8WA 3HKBA 3Q8XB 3DV9A 1D4ZA