1Q91A

Crystal structure of human mitochondrial deoxyribonucleotidase in complex with the inhibitor dpb-t
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
194
structure length
194
Chain Sequence
RALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the mitochondrial deoxyribonucleotidase in complex with two specific inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords 5(3)-deoxyribonucleotidase
total genus 64
structure length 194
sequence length 194
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2003-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 1q91A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1q91A01
3R9KA 1EK2A 3U7GA 5AK4A 2I34A 5IT0A 3A1DA 4L6AA 2AGVA 3PGLA 1L7OA 3L1VA 2CFTA 3QLEA 2P27A 3ONNA 2WF7A 3FM9A 5AVSA 3U19A 2I33A 2YY6A 1QQ6A 3OCUA 1RKQA 1MH9A 4O8CA 5AIBA 4BX3A 3ZTWA 3W5BA 3I28A 2C9MA 1RLOA 3I1YA 3SLRA 1RLMA 3DAOA 1U2TA 2HSZA 3UMGA 5ALQA 4YCNA 1Z4MA 4ZEVA 5AVUA 1EK1A 3ET5A 4F72A 5ALFA 3E81A 1Z4PX 5AESA 4YCLA 4I9GA 4AP9A 2C8LA 1Q92A 1XVIA 4NV0A 4RETA 2EARA 4Y2VA 3B9BA 2GHTA 3L1UA 2YMPA 3U7EB 2O2XA 2YJ3A 1U7OA 2JAOA 3UMCA 3W5CA 5ALNA 4HAIA 3SHQA 3QUBA 1L7PA 2PR7A 2EATA 4B6JA 2I6XA 5AW8A 3WK8A 1U2SA 2RARA 1RQLA 2PKEA 2QLTA 2OA0A 5AK6A 4UASA 3A1EA 3EPRA 2PQ0A 3WK5A 3KC2A 5FP0A 2NO5A 1Z4IA 2G06A 3IJ5A 4UU1A 3PGVA 4BBJA 4QQFA 2W11A 2ZG6A 3L8EA 5ALTA 3AR2A 3BWVA 3NALA 3OCVA 2FEAA 4G9BA 3RFUA 2G0AA 3N1UA 4EX7A 3VAYA 3R4CA 1JUDA 2B1RA 2HCFA 2P11A 3DV9A 3KZXA 4BKMA 5AI8A 2ZBEA 3WKEA 2OM6A 5JJBA 1WZCA 1NNLA 2D2VA 2FDRA 5AKHA 3W5DA 2JGAA 3QUQA 3UMBA 1YDFA 4H1WA 2VKQA 4UMEA 3ZI4A 1U02A 2R8XA 2JAUA 1T5SA 1J97A 2NYVA 2WFAA 3SD7A 3SF0A 2B1QA 2X4DA 1RPZA 5AW9A 4F71A 1IWOA 3ZX4A 1TE2A 4UW9A 5AHXA 3NAMA 2YN4A 3WKCA 3NRJA 3CNHA 2ZXEA 2P69A 1RLTA 3D6JA 3U13A 4NAVA 3QYPA 2HDOA 2ZOSA 1XP5A 4CF5A 3KDPA 5AVWA 1TJ5A 3AR6A 4BEVA 4BX2A 5ALIA 1SWVA 2B30A 2G08A 5IT4A 3SKYA 4Y2QA 5T41A 2ODAA 4UAVA 5AKZA 3ZVMA 4UMDA 2C88A 3MC1A 4IG4A 5AM0A 3M1YA 4Y2SA 2FUEA 4C4SA 4HGQA 1Q91A 2YJ5A 2WM8A 3J7TA 3DDHA 4CF3A 5ALEA 5AW0A 3SMVA 2FPRA 2R8EA 5AKJA 2MSNA 1Z4OA 3WKDA 1SWWA 5AKKA 3NANA 5AM1A 1K1EA 4RESA 4BNDA 1T9ZA 3PDWA 2YFYA 5AW6A 3OPXA 5AVZA 3QGMA 1Y8AA 4ZEXA 3F9RA 3QNMA 1AQ6A 3MN1A 2WHEA 1VFPA 1YV9A 5ALHA 4Y2UA 5ALKA 4EX6A 5AI4A 3E8MA 4L6CA 2I55A 1F5SA 5AI9A 2IA5A 3IB6A 4KNWA 1N8NA 5ALXA 2ZBDA 1YNSA 4UM5A 2Q4TA 2YJ4A 5ALWA 5AICA 4EENA 3ZVLA 3ZW7A 5AW1A 1VJRA 1TA0A 5AI0A 3AR5A 2FI1A 2CFRA 1RKUA 1Z88A 2R8YA 2IOFA 2DQSA 4FFDA 5AM5A 4NFLA 5AW5A 1Z4JA 4KX5A 3ET4A 4J2TA 2GFHA 3EF1A 4Y2XA 3QU2A 4YGYA 4C4RA 3GYGA 3WK6A 1QQ7A 4UATA 2IYEA 5AKEA 3QU9A 3NUQA 2OYCA 2IOHA 2G09A 5ALRA 1RMQA 4Y3UA 5AW3A 4DWOA 5AK3A 3FPSA 3RF6A 4C4TA 4EEKA 3L8HA 1L8LA 5AKLA 3U7FB 1Z5GA 1XPJA 2HX1A 4G63A 2ZBGA 1ZD2P 1L7MA 2I7DA 2HI0A 3S6JA 3IRUA 4IFTA 2WF5A 3ZWKA 3ZU6A 4OD0A 1Z4QA 1L7NA 1TJ3A 2RBKA 2AH5A 3E84A 3ED5A 4OHFA 4GXTA 3NASA 1S2OA 2GO7A 5AKGA 3L8GA 5ALJA 5ALSA 2MU1A 3AR3A 3AR7A 3QUCA 5AVXA 3QU7A 5AW7A 4DFDA 5AKIA 2C8KA 3M9LA 3WK7A 3FGOA 2BY4A 1YMQA 1Z4NA 2FPUA 2WF9A 4Y2RA 1SU4A 3SKXA 4Y2YA 5ALZA 2G1AA 1ZJJA 1RMTA 3K1ZA 3N8GA 4HGPA 4DW8A 3WKAA 4BEWA 3BA6A 4ZEWA 1S8OA 4HYTA 4YH1A 4YCMA 3B8EA 1WPGA 4BYGA 3P96A 2BDUA 5AKXA 5ALOA 4KYTA 3ESRA 2IOFK 4GIBA 5E0OA 2JAWA 3L7YA 4UAUA 1NF2A 2B8JA 2AMYA 3L5KA 2EAUA 4CE6A 4XE5A 4Y2TA 1WVIA 3R09A 1Z5UA 4JDPA 1L8OA 5A3QA 2JARA 3A3YA 4OCZA 2WF8A 1ZD5A 2HHLA 2WF6A 4DCCA 3OTQA 1TJ4A 2FPSA 2FUCA 4NABA 3QUTA 2AUTA 4UARA 3ZX5A 3FVVA 1RRCA 4BNDB 4KNVA 4FE3A 4XQ0A 2BDEA 5AVQA 5AM2A 1PW5A 5ALDA 3E58A 3WK9A 1RQNA 3UM9A 3QX7A 2RB5A 3EF0A 3NIWA 3ZWDA 3N07A 2OBBA 1LTQA 2HEGA 3W5AA 4L57A 3QU4A 1LVHA 4EELA 1Z4KA 1N9KA 3B9RA 2ZBFA 3OCZA 4UMFA 3I6BA 2Q4RA 3AR9A 3QU5A 2CFSA 3DNPA 5AM3A 2R8ZA 2QYHA 1CR6A 3MPOA 1X42A 2YMQA 4QJBA 2C4NA 4CF4A 4KX3A 3KOOA 5AK5A 4PNHA 5AW4A 4FYPA 3AR4A 4UMVA 1RMYA 3KBBA 2HOQA 5AVYA 4XOUA 5AKYA 5ALPA 3TLMA 2NO4A 1ZD4A 4JB3A 5AVTA 4YIKA 1Z4LA 3PCTA 1FEZA 4CNQA 4YIHA 5AIAA 3WKBA 4AS2A 3I76A 4BX0A 4HGNA 2W43A 2FPWA 2HF2A 1VJ5A 3L0CA 3U7HB 4NWIA 1ZRMA 1NRWA 3L0YA 1QH9A 3WGUA 3HLTA 4UM7A 5AVVA 4J03A 3FZQA 1RC8A 2I54A 5A3SA 1ZD3A 1T5TA 3WGVA 1QYIA 5ALLA 3A1CA 3QXGA 3N5KA 1O03A 3ZTYA 1J8DA 1L6RA 1ZRNA 4I9FA 3L8FA 1WR8A 4HGRA 5AI5A 2G07A 3U26A 4UU0A 5AI6A 4AS3A 3OCWA 4MUMA 2YMMA 5ALGA 4OFZA 2CN1A 4XPZA 2P9JA 3EWIA 5A3RA 4Y2PA 1O08A 1ZOLA 3OCYA 5AW2A 2G80A 2B0CA 2YBDA 5ALMA 1U7PA 4EZEA 1RKVA 5IS2A 4Y2JA 1YJ5A 1KYTA 2O9JA 2YJ6A 3OCXA 5ALYA 2Q5EA 4E88A 2GMWA 3HYCA 3ZUPA 5AM4A 1QQ5A 3ZVNA 4MWOA 2FPXA 4HGOA 3AR8A 4KN8A 3ESQA 3CZ4A 2RAVA 2B8EA 1CQZA 2HO4A 2HF7A 2W4MA 3FPBA 3L0BA 2GHQA 1YS9A 1RDFA 5ALVA 3WK4A 5ALUA 1ZS9A 3KD3A 3N28A 3MMZA 2YMLA 2B82A 5AVRA
chains in the Genus database with same CATH superfamily
1K0FA 3A4MA 3ND7A 2HB6A 1NFFA 4H0CA 1OIVA 3WLLA 1BC5A 2FWAA 3H9EO 2V1UA 2UYOA 3M4ZA 4IP0A 4HQRA 3SYKA 2XBMA 1VPDA 4Y9DA 3ZIAD 3JARB 4R84A 4BIIA 1SVUA 2J5BA 3TQQA 5T3UA 4C5BA 2P27A 3GR6A 1ZONA 1T1RA 2GWRA 5JV5A 4BGUA 1NI4A 1RXYA 4QELA 2IUSA 1GKLA 3GEHA 3QFHA 5DLPA 1KARA 1FP6A 1LSOA 1ECLA 4HZUA 4ZHQA 1VMKA 1F17A 4JL8A 3C8TA 2NTVA 4U7HA 5LM3A 1O9GA 2QOEA 1R37A 3NT2A 2VK2A 5AH0A 4HNSA 4U6QA 2XTMA 5D5QA 4QYSA 2WJZB 4FYKA 4NZOA 1W36D 4QXQA 2QM8A 2UDPA 3OH8A 1A9PA 3TW4A 1XEXA 2H0AA 3N59A 1Y7LA 5HE8A 2WHRA 4W5JA 3SLRA 4DEVA 5IJ0A 1ZJ4A 4G4SO 3RR2A 2FX2A 3KYBA 3REFA 4QVIA 5DHUA 3DL2A 4IIJA 3ICOA 3N8HA 1T15A 1Y5NA 2QN8A 5AD1A 1PTJC 2F43A 4RGQA 3VR5D 2DSNA 3A11A 3VHRA 6Q21A 4FB4A 5ENVA 4OTZA 3ZTTA 4OIMA 1V1MB 4QEDA 4FNOA 3REGA 4Y2VA 4Z6KA 3DQZA 1A2OA 2E4VA 1JQLB 3L1UA 2V9CA 3SJAA 3LP8A 4OJNA 1WBDA 4ZZ1A 1N6OA 4CEIB 5CW1A 5ECDA 2NUAB 5KYUB 1VA5A 2D4AA 3ROKA 1P0IA 4I14A 1JBKA 2APJA 3QUBA 4A16A 5JT1A 2QRMA 5CTJA 3K5PA 1K06A 3GVCA 1BEEA 1GRRA 1IM5A 1C7QA 4S1PA 3RUCA 1CC1S 3E05A 1F4VA 2RARA 4G1BA 4K2HA 4O2BA 2AXPA 4YTEA 4BJ3A 2VJQA 2XVMA 3C6YA 1A9XB 1FMJA 2F64A 4JR0A 3DVAB 1RM3A 4GOND 2XTNA 2PX5A 3PNBA 3TMKA 1AKWA 3ETEA 4B17A 3OIFA 1OFTA 1S2GA 2I8AA 5FP0A 1XN1A 4BMXA 1XJCA 3A9WA 2CLIB 1U3UA 4TN1A 4P1ZA 4BMVA 1L5YA 4AMYA 5KOHB 1P0MA 1E9FA 1G7TA 2Y1DA 2DJ5A 1SU6A 2GJ8A 5DGTA 1LPOA 5B58C 1NSYA 1QRRA 1Z8HA 3AR2A 5DEOA 1M72A 2I7XA 4CV1A 3CCFA 3PNVA 3IE1A 1E2BA 3RFUA 1ZK4A 2FPOA 2ZYWX 2TMYA 2O06A 2X7XA 4TRNA 2BHTA 1JFSA 3U1BA 2QK4A 2YYYA 1TYDE 3I73A 4EYSA 2YDYA 2ZBEA 1MQAA 3KTFA 2OM6A 4MR7B 1ULBA 5SZIA 4TSRA 2ST1A 2O2YA 2XZOA 4YP7A 4KKVA 3ESDA 3BIXA 4P3KA 1ZVVA 2XOEA 3ZS9A 3NFRA 2VTVA 2W6ID 4WBSA 4ARAA 2JAUA 2XZDA 1MZPA 5H4GA 1FFCA 1G0NA 2CLSA 4XASA 4L73A 2E55A 1I5EA 2YCBA 2IZ6A 2F9LA 2AFRA 1XXLA 2W2LA 2YN0A 2LVBA 2GF2A 3FDFA 1RLTA 1GQYA 2JGFA 1FP7A 4JN6B 2W22A 3MAAC 4BFUA 2RHJA 2CSUA 3B12A 3DD1A 5EXSA 5AVJA 5C5IA 1WXEA 2OC4A 2VRNA 3CGGA 3HB7A 1FPMA 5CFMA 3KWMA 3RC8A 1ZXBA 3K0KA 5U4QA 4IIJB 2Y68A 3OM1A 1PZHA 2QVLA 4K6CA 5JZ9A 1NVEA 2VAMA 5AVWA 2YCLA 3RV4A 2B1GA 3FFTA 4BEVA 4BX2A 1QHNA 4U6SA 4ENPA 2RI6A 4C2BA 1SWVA 2YFQA 3UN1A 3NZEA 4OI2A 4DZTA 2JLZA 3AVWA 1U2GA 3BAZA 3EEOA 2YIVX 1KI9A 3PC6A 3NORA 4F4DA 2PSEA 4WJKB 4Y2QA 3T7SA 4YONB 2VRBA 3ZWCA 2OCYC 3HKBA 3QVKA 3K2QA 2IHNA 4IH9A 1OBCA 1YK0A 3QYJA 3RGWS 4BRUA 1GAXA 1TTQB 1YCGA 1I7SB 3LHDA 4PC7A 1J8MF 3GB9A 5JUWA 2QSUA 2WA1A 1SB8A 1T8PA 4OK3A 3T4EA 3ASVA 3TS1A 4D57A 4GP7A 1K27A 2PUWA 4YJKA 1VRCA 4X0EA 1K68A 2FA9A 3ZCXA 5JJIA 2RG7A 4PNPA 4YRQA 4ISBA 1AKQA 4HWPA 1EXWA 1X0XA 1J3UA 5AK0A 2YJGA 1Y48E 3DLCA 1QS0A 4E11A 4MMYB 5FT9A 2XMBA 4HUQB 3S2EA 1N6RA 4F5ZA 3EVGA 2XPCA 3RAJA 1SHKA 1UBLS 3HFJA 5F3DA 4BASA 1Y63A 3IBSA 5CPBA 4PO8A 3K0CA 2DUUA 3WYNA 3ENKA 3QOFA 4CZ2A 3RS4A 3AB8A 5DK6A 1NX6A 2P6NA 4FW8A 2FMFA 4EKIA 1NUTA 2QT1A 2WAMA 1AKNA 3VZCA 3TBHA 3WP1B 2Q3EA 1C81A 3GAMA 4KGXA 1ML3A 3R7AA 2Y9MB 3K0AA 1P9WA 4IHAA 4O4HF 1UMCB 4AS1A 2A9RA 1GKKA 3BWDD 3C6MA 1NONA 5ICCA 5C7OO 4LRXA 1EVZA 2NYAA 1GN9A 1RD4A 2RK6A 3ND6A 3W2FA 4EX6A 4X1YB 3PRJA 2X42A 2MHCA 3IIMA 1C8LA 5E3HA 4NU6A 1C9EA 1VJ1A 2GYUA 1LKZA 1L3IA 2P3OA 2YXEA 4GKAA 3SYTA 5IXSA 3JQ6A 3U7QA 3WG9A 3FHCB 1FQKA 3ELWA 3IVRA 1QIEA 4PGFA 4J4BA 1DCKA 4DZZA 1IUNA 2XE8A 1EUCB 1RLJA 1N3IA 2BBOA 2VT7A 3I42A 2RGBA 3MCVA 1B3RA 3PBKA 4RF5A 3W6ZA 5DU2A 1CZOA 2R44A 4U4AA 2V59A 1IBCA 2MIIA 2ZB7A 1Z18A 3EVCA 4BE4A 2WZCA 4EY6A 2P3SA 3M4YA 5AW1A 4XR4A 1J6UA 2P2CA 1M54A 4KXNA 2C4KA 2IPNA 3QSGA 4LBWA 2JFQA 4PZ9A 5F77A 3EYAA 3GP3A 4JYBA 4L07A 4X62B 1LS1A 3BGIA 3W6PA 2PXAA 5KAMA 3KTAB 2DH5A 4RGYA 1C3UA 4YP0A 5AOAA 1ZN9A 4XI9A 4IGFA 1DEKA 2X9NA 1AD2A 4I6JA 5DYYA 1CBUA 1XX6A 1BW9A 1JN0A 1JQ5A 1TUGA 2X23A 2ARKA 3TZKA 4R8VA 2BMVA 1L5NA 1XRQA 1I7NA 4B4KA 4ZREA 3GCGA 5GTDA 3DD5A 5I7HA 1OXKB 1H1LB 4RMHA 4TZ6A 4PM4A 4TMYA 3RYTC 3WK6A 1OAOC 2XOKA 3EJ6A 4CQMA 1Q1QA 3K0EA 5G0TA 4F46A 3QLUA 5GQSA 4DR1B 2QNBA 2ASVA 5EHGA 5FL3A 5IJZA 1WEHA 2B36A 3KAKA 1DAHA 2VYND 3QFTA 1OBVA 2C2WA 3AGQA 1MX1A 1NUQA 1XD2B 1UM8A 1GGEA 2UXDB 3BE4A 3DDZX 5H3LA 4UEQA 1HDCA 5K05A 4EA7A 3KT6A 3O3MB 3VHQA 5F3RA 5KC8A 4WKNA 1MB9A 4IZ6A 4HTFB 4FZ3A 1ZAYA 4GZ6A 1QO0A 2I4IA 1XRPA 2E4ZA 3CX7A 4EI9A 5CA1A 5K4HA 3EZ9A 4WZBA 1CW2B 2VDRB 4FGUA 3DVRX 5CLHA 2C0CA 7REQB 5HR5A 4O2AF 1GAJA 3C7AA 3L92A 1ODFA 4GQIA 3CEHA 5IBRA 2VBIA 2GLUA 2P67A 2X1MA 4WZBE 4QL3A 1LFDB 3K53A 1UEJA 1KJJA 3CX4A 4KVGA 4QO8A 1SXJB 4N5DA 1TW3A 1ENPA 4LZWA 1FNMA 5E4JA 1AQNA 1DAEA 5BSEA 4MDFA 2QRPA 1FZQA 4AJKA 1C9MA 1P1IA 1RFLA 2VYFA 3MYYA 2V6GA 4ZQGA 3TIGA 2F1RA 2C4TA 3M6LA 4O5AA 1PJSA 1C29B 3K9FC 4B8WA 3IGFA 3D7NA 3CNLA 1R8YA 3OOYA 4JA2A 4R2WA 3LQKA 3W0LB 3ZDZB 3ZCUA 3KSBC 5FPHA 3H2SA 2OGTA 4OU4A 5B36A 5IARA 1ZISA 5BSHA 5EP2A 3STHA 3U80A 3CUTA 2PVPA 3SKXA 4UNQA 3U7IA 4OLJA 1SQFA 3IAHA 5D7NA 1AB6A 1KQFA 4RVOA 3NHRA 1K8QA 2BOVA 3BC1A 1PR0A 4I55A 3NGLA 1JNXX 1SQSA 2I7CA 1TYEB 2WLSA 3EB9A 3QEJA 4IHJF 4OMFG 4P54A 1J2EA 4LVUA 2R5WA 4X8HA 2OTCA 4XDHA 2ZUTA 2PFGA 4L3OA 3CR3C 4R5HA 4M88A 4TKVB 4YREA 4WOJA 2KBFA 3JQ9A 4C4PA 1SVIA 5A7FA 5BN4A 2IFTA 5H4HA 4OJMX 3TQFA 4CCYB 1TU4A 1JHPA 1JTFA 3OY2A 1I3LA 1ODSA 3AZOA 2CV0A 1W9HA 3DBLB 1Z07A 1JKFA 1II8A 1ZK2A 2X86A 2R6AA 4XTCS 4RX1A 2H8KA 2EJBA 2WTXA 3WWEA 5JAIA 3KETA 1MO3A 4DCPA 4ZD6A 4G5GA 4LOJA 1GL6A 3L46A 4MVJH 3T5DA 3GPCA 2PXXA 2Q6VA 1N77A 4MS1A 2VT2A 1YU6A 3DM5A 3TE6A 3L5OA 4MVJP 3FB1A 4UULA 4JLUA 5CB4F 1A5ZA 1SELA 3OO1A 5F7ZA 1W6RA 1E0SA 1WDMA 2P75A 3PXAA 1OMOA 1JZTA 3O1IC 4RULA 2EGUA 2NYUA 1HZZA 1U1EA 1ZI9A 2JD1A 5HYVA 3AGPA 3MLAA 4TT3D 2XADA 5FBZA 4TTJA 3IELA 3UB3A 3GA5A 4DCUA 1TJVA 1VFNA 3QVUA 5CU7A 4JP1A 2B8NA 4ZIRB 1V3UA 2XKJE 3R3XA 5A7HA 3U1VA 5KB3A 1MAWA 4M7OA 3JZMA 3LV8A 4CM4A 5F1YA 1AV7A 4LHYA 3QVMA 5JFOA 1X7HA 2I6UA 3EARA 5EUQB 2PN1A 4CI9A 3B9RA 4JUDX 2FJ0A 1MPXA 3QLTA 3AKZA 1WG8A 4NI5A 1CXZA 4N76A 4ZK2A 3D1LA 4HADA 3KEOA 2CFSA 4MRAA 3DNPA 3M3DA 4XW2A 3LZ6A 4MS1B 2YOGA 4PZDA 3NHKA 4WE3A 3PHGA 4NBRA 5L3ZA 3NKVA 1P1JA 4D5GA 2BZSA 1IPEA 4H17A 5A1TA 3KBBA 3EBLA 4HLUA 1YVEI 1SG6A 2EKZA 2X5XA 2YDXA 1Y5MA 3KYDA 4ADMA 3JZDA 3LF2A 2P2LA 2QN6A 2VJMA 4NJOA 4G09A 4IQJM 5DNUA 4AUEA 2Q5JA 2YC4C 1AHHA 2Q4DA 2W58A 2XIJA 2C95A 4QGBA 1BEUB 5A3VA 1YNOA 1FEZA 3ML1A 3P0JA 3EZLA 4BOYA 3HWWA 4ML3A 5EAIA 9LDBA 2IP2A 2PRSA 7YASA 2EFDB 3N2IA 2K2WA 3IEPA 3REQA 2YWEA 1N8SA 5EHNA 3VISA 4QQ8A 3WQRA 2AOXA 3ZQ6A 5B7NA 3M6VA 1CUIA 2AXNA 3ZHZA 3LA8A 2XTAA 2RHMA 3HLTA 5AVVA 1T2CA 5FOQA 1WD5A 2QEQA 1X7YB 2QKYA 3C0KA 1GFIA 1KZYC 5AXDA 1XBTA 4WECA 2IW3A 1RC8A 5JJLA 1OZ0A 2I87A 1E4YA 1NL3A 4EMBA 5CCXA 1BJRE 2KMLA 4J0QA 3EGDB 4N7RA 1YZQA 2C8JA 2L42A 3AB3A 4C0XA 4G9EA 1DXQA 4RABA 5C52B 1FDTA 5LOVA 4LZLA 3TCNA 1AE1A 4INPA 3I8SA 5IP5A 3RRFA 3S4YA 1VYTA 4FHGA 1YA8A 5AI5A 2KYRA 1Y80A 3U26A 1H9AA 1Q1GA 2QQGA 3FFBA 2CNWA 5CIYA 4OX9Y 1DV1A 3M4JA 3IHKA 4ZOBA 2KHZA 1LBIA 2QIOA 1G5IA 2ZB3A 2ZSAA 2NUBA 2VCEA 4NV3A 1OSNA 3HWRA 4JEIA 4FE7A 4GXQA 1EEHA 3DZGA 1WKCA 3ZWXA 2PCLA 1O08A 2PX6A 1QOZA 3T0GA 1GZ3A 1XTZA 3HBMA 2O59A 3GZHA 1YI0A 1ODKA 5HXAA 3ZDDA 2IHBA 1O96B 5BYKA 3M70A 4LPKA 2H1SA 5EWJA 3QTTA 4Z1OA 4L5IA 2WJIA 4RIIA 2OO3A 2FUKA 2VUHB 3V8PA 2QLFA 5NULA 3G8AA 3OCXA 5IC4A 2K7ZA 5FH9A 1I4DD 2GMWA 2W7TA 1XSEA 1XRSB 1E1CA 1QXSA 4C5CA 2OLEA 4A91A 5BURA 5L8VA 3TIIA 1UJ4A 1DDGA 4J1QA 3ORSA 4O2BB 1OX6A 3AR8A 3DMNA 3T7AA 4EPYA 2FQ1A 1P0FA 3UMRA 1G8PA 1MENA 3QXXA 3SJBA 3PTAA 3P9ZA 2IYSA 2PHZA 1ISHA 1GQFA 2BP7A 2QR5A 3FLAA 2O14A 4EY7A 1MO4A 3N5CA 3VNAA 3ZW9A 5M2QA 4F3YA 1FW8A 1ZGZA 3DLIA 3FYSA 4RBNA 1TOAA 3FTFA 2ZJ1A 3EFOB 4WXHA 2VPQA 2BVNA 1JSWA 4F3NA 2IPLA 5I51A 1E5LA 3QI7A 3O92A 1J1UA 1FBNA 3UO8B 1XQ6A 2ZBVA 3CTMA 3MWGA 2DAPA 4CKWB 2B82A 2PFMA 1EK2A 2CCGA 5AK4A 3A05A 3EFBA 2Y4OA 3R6QA 3D81A 4BATA 3VTZA 4EUKA 2RHCA 2CXQA 2ES4A 1OFUX 1DEHA 1ECJA 2FLKA 3PXUA 2GCOB 3VJRA 4YRPA 3EAGA 1CVLA 4O4HB 2CFTA 4DLLA 1E3DA 3SEAA 1N6IA 1WPXA 5DTRA 1IN7A 5DX1A 2W2TA 2XMRA 3WWYA 1VSVA 1X7WA 1SCJA 2I33A 4JLOA 1DC5A 4IH1A 3RLIA 3A1WA 4NZNA 5TVKA 4ZVRA 1LPPA 3Q3JB 4EHBA 1ZIYA 2XSZA 2WPDA 1T2NA 3PT9A 3ZJ4A 3WGHA 3G8YA 1E66A 3MWLA 4FJ1A 2AXQA 2YBEA 2ZJ8A 5DNCA 3JQQA 2CL7X 3P1JA 2P4HX 4U8GA 5ADUS 2V7PA 1ZD1A 2B6NA 4B3JA 4PHTA 1EIZA 3GZNB 1I36A 4FI3F 4PYRA 1OLXA 5D51S 3RF7A 4U7PB 4PONA 3THRA 5A4JA 5ELMA 3S2UA 5DSTA 5BORA 3GLHA 3ZZUA 3JWEA 1SXPA 2DYKA 2EFCB 4P0QB 3NM6B 4I4CA 4ARZB 4CM1A 1H4VB 1DO8A 2XDQB 1WSWA 1R8QA 1LD3A 3LQYA 3DLHA 1C80A 3TPZA 4RL4A 5BQ5A 5C1OA 4O4JB 5K3FA 2NT4A 4A26A 2PJUA 3QENA 3H16A 5DNDA 2VF4X 1SM4A 1U0HC 1BXRB 4Z2YA 3BB4A 2PMCA 3GRZA 2ZR8A 3DHWC 4WERA 3ER9A 3L1JA 3S55A 2QJRA 3EE6A 3O8OA 1NVGA 4NE2A 3OJEA 5F51A 2LCQA 1E4EB 1JXQA 1F3LA 4JX8A 4RQBA 4QA9A 4WAUA 1V11A 4UCFA 3BYZA 3FHTA 1L1RA 1LFAA 3NKLA 4IMRA 1R00A 3PITA 1TF7A 2QXUA 3Q5EA 4WL0A 4Y0NA 3PYLA 1Z4IA 2AUNA 3IJ5A 4D9CA 8ADHA 4UTNA 1GZHB 1WO8A 1XU7A 1ZM7A 4HLQB 3RVOA 2P68A 4KN5A 1TD1A 1ZO8A 1GEGA 1KZGB 2KE5A 2WG2A 3FX2A 3GDOA 4HX2A 5EIAA 5JSKA 3TRHA 3U9SA 1QDLB 5DM1A 4H18A 4BVBA 4OQZA 2V6JA 3DE7X 5EHQA 2YWXA 4QPJC 1NVVQ 5T4EA 1SN7A 4FLEA 2V1XA 4KODA 3E9ZA 3N1UA 4EX7A 5K0EA 1Y1QA 3M6MD 2X5JO 4BKPA 4GUDA 4LV6A 3SQOA 1JUDA 4KAJA 2H5IA 6PFKA 2W2KB 1E1RA 1GRNA 4UUBA 4KR9A 2I8LA 5B1EA 4A5SA 3IVXA 1P4JA 1N2HA 3TFWA 1UP7A 2PCJA 3O8NA 3X0DA 4AKTA 3V1LA 5H59A 4K9OA 3E7DA 3CY6A 4TL7A 3TH5A 4CCSA 3GGGA 2XLBA 4E46A 1NY5A 1YRWA 1A1SA 1JQEA 2NYVA 3VPBA 1Z16A 4N8EA 3X1WA 1HQCA 4OL0A 2P9HA 2AJDA 5FDFA 1WOYA 2LIVA 4LXGA 3SEFA 4GZ5A 1MVNA 4GGPA 5BYJA 4CDNA 5KINB 3O31A 3L7AA 4P3NA 3RQIA 5FWYA 3R5KA 2GASA 3WL4A 3G0OA 4MLCA 3VH2A 1TKCA 2O7NA 3DCNA 3DFZA 4LZNA 4COOA 1ABBA 3UWDA 2RMKA 1U6IA 4MAAA 3O2QB 1FYDA 4BFYA 4QNNA 5BOSA 4JROA 4AX8A 3RARA 3H5TA 2ECOA 1K7SN 4QREA 3OOEA 4E5YA 4PG5A 3PE4A 2ZSHA 4QYIB 3E82A 4MCHA 4QM7A 1A77A 1JS1X 1TJ5A 5F9HA 4YS6A 5H5JA 4DOMA 1LDGA 1RIFA 1L4EA 1U2RA 4YDHB 1Q0QA 4NYJQ 3OWOA 3DVAA 5SICE 5HZHA 7MDHA 2VTKA 3SI7A 4JU9A 3ZK7A 4MV5A 2RGRA 1HFWA 4JSTA 4OQLA 2CHFA 3LU1A 3PFHA 3KLNA 5HS6A 5IBPA 5TPZD 3IA2A 2I62A 1UAAA 4MYHA 4IY1A 4PC2A 3IKVA 2ERXA 4JEMA 4JXKA 2AW5A 4LGYA 2BYTA 5KTYA 1I2CA 4NBUA 3P0EA 4IG4A 2W6PA 3SAJA 4EATA 1VL1A 1VL0A 4D92A 1DKMA 4MPTA 5C8VA 3F3YA 4KQWA 2RHOA 2AG5A 2FP4B 1SUCA 2GVZC 3MB5A 3PVZA 3QKSB 1NN3A 1CETA 3KPWA 4DT1B 2CLFB 1ZINA 3Q7IA 2HJ9A 1U0NA 3ACDA 4KIGA 4PCVA 4DR4B 4E1VA 4LX0A 4FP9A 4MS3A 1DU4A 3H65A 2GZHA 4XM2A 1JB1A 2HWKA 2XUZA 4CHTA 4JGIA 1KEUA 5IDWA 3SSNA 5C4IA 1D2CA 3JQFA 2CT8A 1FFHA 4ZTBA 4GMHA 3S44A 2CYCA 3WRVA 1Y6JA 4HDMA 1TPYA 1GNRA 1HORA 3ZBTA 1HF3A 2FE1A 1QFSA 2JAPA 3RFCA 3DZ8A 1VE5A 3F4RA 3FOBA 2HGZA 2JH9A 3I9V1 3CT6A 4F93B 2RC6A 3L49A 4TRJA 4RQTA 4EMUA 1RYYA 1AMOA 3G2OA 2AE1A 4MVYA 3FMVA 1EQUA 1L7DA 4HOYA 4BQFA 2VI5A 1FNDA 2A9VA 1BZYA 4RAOA 1MTZA 4D74A 2H2DA 2IS4A 2Z6QA 4NICA 1OHHD 2IHJA 3QLVC 4C0WA 5EWMA 3LL4A 3HVUA 2FWNA 3DKIA 5H70A 4D9EA 2QGNA 5I47A 3UY4A 4CKWA 1ZOOA 3VMFA 1QC5B 1N6LA 3K15A 1QTNA 1V1MA 2ZJZA 2HDNB 4MUJA 5IANA 3J80A 4HWTA 4AP5A 5HPYB 1WMEA 2XVZA 2Q9CA 3Q2IA 3MCWA 3AKYA 2Z5VA 2GZRA 3FLBA 4PZZA 1RT9A 2A86A 2IF0A 1D1SA 4G0PA 2Z2ZA 3DAHA 3E8MA 4HO1X 4QOHA 1TEXA 3F8TA 2YY7A 4JT2A 4U2KA 4CM4B 4IFBA 1PK7A 4A0SA 1QAMA 3GTDA 3O4JA 5JTTA 4NBTA 2IA5A 2NVUB 5ES4B 1J42A 2QYOA 2FPIB 5IFLA 3QUSA 1KYYA 4F60A 1Y7PA 1WABA 1UDXA 2GBIA 2P65A 4WVLA 5F76A 1HFJA 2NXCA 1G21A 4FDVA 2UAGA 3FRIA 2II6A 3QVSA 2W6CX 4HZUB 4MW1A 2O8CB 1UZUA 2Q62A 2OCKA 3OQJA 4U1RA 5LN1A 3WB0A 3GUVA 1B8NA 1UFQA 4FILA 5GY7A 1SPXA 1XC7A 4HPXB 4Z3DA 1TCCA 4FFDA 4EK9A 3VU1A 3O84A 1PG0A 4LC9A 1R12A 2Q9UA 1DJNA 2B2CA 1QC5A 3HBAA 4XLZA 4CTNA 1V16B 3HDGA 2Q3HA 2JLRA 4G0VA 4IUYA 4LKOA 2XGJA 2IL1A 3K6SB 2GYVA 1HKHA 4NU0A 4ZA2A 1EAYA 3V7WA 1G0OA 1P39A 1U1IA 2ENWA 1ZA1A 5IMBA 4AD8A 1UXKA 4DLUA 3C97A 4LDQA 4OXRA 4TMZA 5KMGA 5JCJA 1Y6FA 2BRUC 1NXVA 3BE8A 3SQNA 5B7PA 1MQ8B 1XUOA 3OQMA 3FYHA 2O5EA 3GOQA 3W2HA 1XV5A 2SKCA 2WAOA 3A2NA 3BG5A 4G85A 4LNAA 4DRXB 3AO0B 4V0NA 3TPFA 4Q0MA 2VPPA 3WTCA 2W6MA 3T1TA 4ZAVA 2KB0A 4ZVQA 3BEDA 2QX6A 2W6ZA 2FB9A 4BV8A 3N75A 3UJ3X 1YQXA 1CEYA 3L6BA 4MQ5A 4NCJA 4RJTA 2EX0A 2XWQA 2EZTA 2DY0A 2YVUA 4L22A 3AYXB 2HI0A 4JODA 4UOQA 1HLDA 3K5HA 1E6CA 1SRQA 3HP1A 2BMDA 5EIWA 1W4RA 4DB4A 5IYZB 1IOLA 1UBTS 5I9LA 1BD3A 1IRIA 4TYQA 5T4BA 2NAPA 1TJ3A 3W6OA 1P6UA 4O33A 5LR6A 4UVEA 4U5XA 3TGWA 3WQSB 4RZ3A 4H7KA 3GNQA 2H31A 5KTPA 2VDLB 3A58B 1QCZA 1HYHA 1IB6A 4OSPA 1U6KA 1RC1A 3GJ3A 2FW1A 2YZNA 4RD2A 4W5WA 1LPMA 2ODTX 1X80A 1PNRA 4LJLA 1EA5A 2FSPA 2RCYA 2XCUA 2AD1A 5FBHA 5IKXA 1NZJA 1E1LA 2X7HA 3ROXA 4QOSA 3NAQA 1CE8B 3NBXX 3OM8A 5HTKA 2VK1A 3DEKA 2TMKA 3L6RA 4D96A 4Q3NA 4HQ0A 3WQQA 5D6BA 3I6IA 3HCOA 3ESAA 4Y2RA 1OAAA 3PUVA 4FYXA 1BW9B 1RYDA 4GMFA 3ZEIA 4EG3A 2Q3MA 3KZ1E 1N4DA 2VJAA 2D1RA 4FFRA 4Y2YA 3G8DA 4DWJA 1D2EA 1QYVA 2OESA 2PMFA 5JI2E 4HGPA 4X1IB 2V0GA 4WOCA 3CJQA 3JD0A 4R1PA 1N36B 2ZR0A 4FYJA 3ECCA 4TL8A 3ZE9A 1DX6A 2WIFA 4YN3A 4DM3A 4F6LA 4JYAB 4K5QA 3R75A 1L9KA 2BDUA 2IYZA 1NBEA 1W8IA 2G67A 3G9UA 4P4TA 1GQRA 3RVRA 3TKLA 3PNMA 2X0JA 1WAMA 3R2JA 2E9FA 4F5DA 3MRTA 3NU1A 1Z15A 1QVVA 5DGHA 4B6EA 2PZFA 5ENZA 4D3FA 3AETA 4DCTA 2O8EB 5KSOA 3LKZA 4P34A 3CMCO 4WLVA 4JP3A 1ZJ6A 3A3YA 3C6BA 4PHHA 1Y5LA 4DJAA 2Y1LA 1DQZA 5IHPA 4JQOA 5KPDA 3EGEA 2JIRA 3OTQA 3WL5A 1H1DA 3ZIUA 3Q9SA 2FUCA 1JIIA 3QE2A 1PVDA 4AKSA 4EO7A 5D3MB 3EAFA 1L8QA 5D1NA 4DV6B 2HPHA 3ZE6A 3IO5A 4CMHA 1XVVA 1THTA 3EVNA 1VMDA 1YUMA 2WDZA 5B12A 1W4ZA 3DE0X 1IBRA 1CB7A 5K01A 5ALDA 2HQRA 3I8XA 4LQLA 3NIBA 1TAHA 5I48A 4R68A 3QLJA 3SNHA 4GDMA 1IXYA 1EUCA 1Q0HA 2F8MA 2XBUA 3NIWA 3ZWDA 2XVAA 2OCIA 3AHIA 4PFKA 4X8MA 4JI8B 2CDCA 4LZOA 5CBPB 4QUJA 1YBFA 3PQ2A 1F1JA 1AVTA 3FVRA 5CB0A 3BXXA 2HTFA 3IV6A 1N2SA 2H1HA 3Q0TA 2PUAA 1DQYA 5FQNA 5JS2A 4Q48A 3ZLVA 4WBNB 3KDSE 2OPBA 4CQJA 1ZNQO 4RD6A 5J4KA 4XPIB 2NSJA 1L7QA 5JMTA 4F5EA 4IOKA 1OYVA 1NJ8A 2H06A 2VWPA 4YUVA 4A36A 1RLUA 3O2JA 3QPUA 4JP8A 3NXKA 4FNGA 5EMLA 1RAHA 3G88A 4M9XA 1LF0A 3NC0C 4PBRA 1MVLA 1N6KA 1TYCA 5ALPA 1UFKA 1Z56C 1F06A 3AEUB 2LGJA 3U48A 1DS6A 3GDFA 1OA0A 5FOSA 2VK8A 1NW9B 2MR5A 2WWTA 4ZCMA 5JCJD 4DUYB 4YIKA 1B3BA 1LZKA 3P20A 2HJVA 2VYNA 5FEUA 1UKEA 2UVQA 2PXHA 2W93A 3HBFA 4MUXA 1K5GA 2ZWAA 5AIAA 4BX0A 5IVDA 1SIWA 3O4GA 4TSFD 5HGJA 4IIHA 1SFRA 5JZMA 4X1IA 1PJ4A 2FW8A 2H9AA 2WWXA 5HG0A 3FYUB 1MU0A 1R9GA 3QWFA 3SBXA 4DSAA 5CITA 3U44B 3K2IA 3MMNA 4QGFA 4I50B 1UUFA 1GTZA 4HTFA 5IBQA 1CYDA 2WSLA 2XB9A 1H2XA 4HL6A 1CQJB 1GQ2A 1K8RA 3KKOA 3JQ7B 1P7CA 4XD7A 1J20A 2XMQA 3AJRA 4M7RA 1YR9A 1YR2A 4QTXA 2Q0QA 2LKDA 5EUBA 1N9ZA 1U2DC 3L18A 4BQNA 3T3OA 1I5OA 5FTWA 1P7YA 2P3QA 2X2OA 4CIVA 2F8LA 4M8IA 3NVAA 3R44A 4C78A 3MCAA 2O1SA 1F9AA 2JF0A 3NDJA 1ZRNA 4HS9A 4J1NA 1KSGA 3RKSA 3UAZA 5JU6A 2OHIA 4ZCSA 5HRCA 4QYTA 2UZAA 3ZOKA 1JA0A 2B7LA 2O57A 1XALA 4WFJA 2V7EA 3PA8A 3MG9A 1T0HB 1WW2A 4FFBA 4B5KA 1GR0A 2GEUA 2JASA 1IFXA 2BBWA 1GEEA 4KXXA 2PBFA 1AA6A 4EJ6A 2P6MA 4RZQA 1Y98A 1MW8X 4KMMA 2NU8B 3M9WA 2C99A 4QXOA 1TUBB 5HW2A 2QA5A 3IPLA 4Q9AA 4FKMA 1K9SA 3E3LA 4QBTA 3GMDA 4N4AA 2X0DA 2FWRA 1QDUA 5LB4A 4INAA 1CU1A 3GRAA 2QAIA 3LY7A 5LVAA 1SG0A 5DGCA 4EZEA 1J09A 2GA9A 1JLLA 4XB6B 1ZUWA 2O9JA 2D7CA 5TGDA 4L51A 1IPHA 1GFZA 2POQX 3QEMA 3RS2A 2E1RA 3JWJA 4BDTA 5BW8A 1X1SA 1E20A 1DKOA 1ZXLA 3G49A 3GJ0A 4G0QA 3ZVNA 4DWWA 2NGRA 3DBRA 3Q85A 3ZV3A 1MJGA 4GR5A 5C31A 2IXDA 5LQMA 3U5TA 4QQKA 2XEDA 4PY2A 4JSYA 4MJXA 3BMOA 2FRDA 1EKXA 1JU9A 2VHEA 3OZEA 4X8LA 2WQ7A 4GQAA 3CF4G 3GDWA 4NYIQ 3WSVA 1PW7A 5F1PA 4R9VA 1BKDR 4IINA 1GT6A 1VHDA 2B7CA 4LV5B 4X20B 1ZLXA 2K7FA 3HCRA 421PA 4MVJM 1H2AS 1L7BA 3BILA 1MA0A 1GAQA 2HUNA 2NTYC 1VG0B 1QG2A 4BUCA 2AKYA 3NHBA 1H1TA 4YHBA 3PDCA 1O58A 1D7OA 2IGBA 4JZYA 2WYHA 4M60A 3W2GA 2AWNA 1W5EA 3NAGA 3RS7A 4L6AA 1N3BA 2AGVA 4I4TB 2ORVA 3IERA 1EIWA 3L7NA 3SIPA 4A9AA 1WNTA 2JLQA 3AUSA 4EQ6B 5IJ0B 1NVMB 1KAHA 3GAAA 2HSWA 2P7HA 5AVSA 1DT5A 3A06A 3UAGA 1J7KA 1ML4A 1Y3CE 2IQIA 2KSQA 2Q4BA 4HDSB 3COYA 4FN5A 4URVR 4GX2A 3QFFA 4KIJA 2G9VA 5U4XA 4ZJYA 1LQUA 2JAQA 2D5AA 4CFYA 4CM9A 1KK1A 4BNYA 4QVGA 3CR8A 1JWAB 3VBEA 3F9IA 5LIPA 2Z9CA 3HSKA 1IZ8A 2DKNA 1Y6GA 3DNMA 4URUR 4XM1A 4P38A 5ESXA 4QKQA 3GGDA 3H05A 2J3HA 4KMOA 3E81A 1BA3A 2IUUA 1Z4PX 1TMGE 4AY6A 1KETA 1VMIA 3DF7A 1GWNA 5C0OE 1Q92A 4KPGA 4I36A 2TS1A 3LYUA 1LK7A 2OLJA 3CZAA 3KQTA 5F7OA 2AR7A 2CL5A 3WSTA 4F8JA 1RM4A 1SVLA 4ZT7A 5YASA 4HBGA 1J8YF 3U7EB 2GD1O 4CV0A 4CKCB 2FSGA 1ZKMA 2IYLD 4E2WA 4RTMA 3CUKA 5H7XA 1F0KA 2QW0X 1T5DX 3B89A 1O8BA 4M6WA 1I3KA 3DMTC 1NFRA 4IHQA 1VBNA 1Z6GA 5HQ3A 2AEJA 1YH3A 2I6XA 2H7CA 4URHA 2OGZA 1B6RA 3QBDA 1D0SA 2RGCA 1RQLA 2QX4A 3ILVA 4NZZA 3WGGA 2VQ3A 3TOSA 1DX4A 3WJ7A 4JYCA 5ER6A 1EFRA 1TECE 4V2UA 2BFFA 4V02A 5ES3A 3UTCA 2IYWA 2PA3A 2DERA 4KQ2A 4LYJA 4ZDJA 4PYMA 2QI9C 4UEKA 1HDEA 2NPFA 5BV2P 4LF6B 3G7UA 2CHVA 3CEPB 3ZJTA 4J4HA 1VCIA 3BZWA 4ROTA 4AX4A 1NYRA 1U7UA 4E31A 4Q3DA 4Q47A 4U6NA 1ECFA 5MFZA 4XDZA 4YMSA 2ZYTX 4RD3A 5KYGA 5JANA 2BL4A 4FGSA 1G3MA 3H0EA 1FFEA 5E0KB 4AWXA 2BFBA 2G4VA 2BGRA 4K6FA 4BKMA 4ND8B 1KP2A 2PWPA 3HXLA 3JQPA 1APBA 3MZ0A 1SQ5A 5DBGA 1Y9DA 1ZOSA 2AX3A 3D6UA 3I2KA 2FN7A 2CNDA 3PNPA 4JIGA 5FD8A 3VSDA 4Z4CA 5HOEA 1VIDA 5AKHA 1N2CE 1FYXA 2V7WA 2WSSD 2ONKA 1Z0SA 3A4TA 2CLLB 3KJQA 4JASB 1TC1A 3B51X 1UMBA 1ONNA 1KTVA 4LCEA 1IJFA 4CMEC 5IHXA 4MAMA 4RLQA 1KFBB 1MC8A 4FMDF 2GN6A 5EEHA 4ZGWA 4B5LA 1PFWA 1HY0A 3QPBA 3DOEA 4G2NA 2WJ6A 3ZX4A 4MX2A 2NTJA 4EQZA 5TIIA 4DNOA 3BQNB 3I9LA 3KSUA 2WM3A 2GI4A 3DVSX 4JNKA 4GU5A 2G9UA 1BU5A 3MGKA 4A8PA 3AWDA 5J2UA 3KLBA 4G8CA 2O5VA 2W8BB 4EYGA 2GZ1A 2IUEA 3YASA 3BMCA 4EFCA 1TJYA 3ZHQA 3LNTA 5JAMA 4FTWA 5L40A 1ZWLA 3GP8A 2Z2IA 4L75A 3FUUA 2R7AA 4ZI2A 3VO1A 5JYBA 2LW7A 4HS4A 4LA4A 1NUPA 3LKVA 3L9WA 4XX0A 4FMCF 3LG2A 2ZANA 3R23A 2BEJA 1KJ9A 1MABB 2BEUB 3H1EA 3R5SA 4Y0VA 3WRWA 4EZBA 3HJFA 2CWDA 3C16C 4KAAA 2EFGA 4MWBA 4D3YA 1V3QE 3IEIA 1NR7A 2V8OA 4WHMA 1G5RA 2VN8A 1HWYA 2DBRA 4NCAA 7MHTA 1ADGA 2Q2WA 1U15A 1W46A 1M10A 3BF7A 3D64A 1J0DA 3GNLA 5AM0A 1ESDA 5DCLA 3ZXUB 1YIDA 2FUEA 3T7JA 5FOWA 3JRNA 2PMDA 2MYUA 1AGXA 1E3TA 3O94A 4CT4B 3WB1A 5EGSA 4DYHA 5BN5B 4A8JB 1SBYA 1EFPB 1WW3A 3K71B 3KSAC 4EHNA 1GCGA 4GKKB 4NCBA 2QNRA 1LPNA 2DH6A 2PSSA 4WLUA 1NJFA 2HEIA 2P30A 2ZP1A 4P4SA 4EBBA 4EGQA 5KMGB 4CF3A 2R6DA 2IBTA 3FYTA 2PQ6A 4BV2A 2O3RA 3ZJUA 1ZC4A 4GL2A 1JLRA 3UG6A 2SNIE 1W30A 1WCV1 3DE2X 4Z0TA 5G0UA 4YACA 4PYJA 3E22A 2XB6A 4X6XA 3TI9A 1EMDA 5KSWB 3IUNA 3MT9A 4TKMA 4RESA 4RGVA 1FQJA 1WCIB 1TZJA 4LIPD 1MABA 1WXXA 3IDSA 5FPPA 2YUIA 5CVJA 2V7GA 1XJWA 4RV9A 3D7SA 3EF3A 5LBIA 3FA2A 2H1RA 4BLSA 2X13A 4DBVO 5I8WA 1I14A 2RHHA 5HX7A 3CNEA 2RE8A 5EQJB 5DTEA 5JECA 3OQBA 2JHAA 2ZYIA 4FWBA 3SJ7A 1M8KA 2I4RA 1TQ2A 1UQTA 5KYYA 3EY4A 5F5XA 4C3OB 4HRVA 4RH1A 1GTG1 3ENZA 3H9UA 2B7BA 4MXDA 4Y2UA 2XE7A 2XX3A 4QEKA 4AO6A 4RTRA 1GSOA 2O54A 4I5DA 3VR1A 3HEMA 1NMEA 4YV0A 3V1MA 3A14A 3FGPA 3DGEC 4G07A 2WMYA 3OKPA 3O9VA 4KBGA 1XEWX 2O4UX 2IYTA 2W9XA 2RCNA 2CZCA 3L7MA 2Q5LA 1N7GA 4P83A 4CIXA 5EYPB 1M7GA 2A6PA 5HJEA 4OEHA 3CF6R 4QPZA 4RPGA 2NQTA 3LY5A 4FYMA 5BVHA 4MKXA 3ITEA 4LWQA 1NU6A 1Z13A 1M0EA 1U80A 1OUMA 2NU9A 2Q45A 2F3UA 5EJEA 3EQ6A 5AXBA 3KTOA 2AJCA 2I9PA 1CQIA 1Z88A 3OIDA 4RK4A 4RHFA 1U3DA 3ILXA 3DPIA 3UB4A 2JK1A 3FMGA 4N5HX 2PKXA 4X7MA 2QZZA 2RK3A 4C06A 4KJXA 5IG2A 1DJQA 4UCQA 2XD9A 4E5NA 4YP9A 5MN4A 5CMLA 1U0GA 2HTEA 1DWQA 2JFNA 2AD5A 3I9V6 4KXFB 4OQMA 1M2VB 1UKBA 1Z06A 4Z8XA 1AKRA 2PMEA 1DRKA 1FVHA 1VIYA 1RAFA 3MOIA 3PPWA 4R81A 3CE9A 2BFNA 3L8CA 2V65A 1G7SA 2IYAA 3DTVB 3GN1A 3OURA 3Q2KA 4IZIA 3GCZA 1HA3A 1TYBE 1PKXA 1SZPA 3FZEA 3RSCA 5LNK1 4H3SA 3DEJA 4KHZA 1TJ7A 2OXEA 1OT5A 2P5UA 4JLWA 3CVVA 2P9CA 1HMPA 3CRQA 5K0GA 2HA0A 2Z8YA 3WV4A 1J0XO 2X9QA 1WPQA 5DW0A 4C4TA 4LS3A 1SK8A 4MI3A 5IULC 2HNAA 5BQPA 4TVBA 1QE0A 2F8TA 1MJHA 2XNDD 3EIHA 4L0QA 3VPSA 5AKLA 4PGAA 5B3LA 2QV7A 5K8CA 4G37A 4WMLA 1FFDA 1KJIA 3PXBA 2OV1A 4PGMA 1XJQA 3T7TA 3V8EA 2EHDA 2O2DA 3DULA 1CUFA 4R0MA 3E8XA 2Q4EA 4RY8A 4NTZA 3ISJA 4P4NA 3X2FA 4E1BA 3VAZA 2FRDC 1Z3CA 1FBTA 4E2ZA 4CKEB 1AUPA 4LHEA 2BGLA 2E0IA 2Z4TA 3IRUA 1Z5NA 1JDBB 1YR7A 1QZXA 4A0RA 1ORTA 2JJ1A 2JVJA 1RE1A 4G25A 1LBSA 3IAEA 2VDWB 4FFBB 4MI1A 1IHUA 4Q1DA 4EYEA 4D56A 1XQ1A 4N18A 3HRHA 1PWZA 2EF1A 2PTGA 2ZW9A 3AY3A 3ZH2A 1EFAA 2QLBA 2CBZA 4WUVA 1V5IA 1VKHA 3N87A 5B64A 5ALSA 3QUCA 1Y42X 4QDTA 2ZRDA 1J0CA 1G8MA 1NULA 3FDIA 3NJ8A 2H5JA 2WQZA 4JKIA 5AVXA 1PD1A 3R6WA 5CYPA 2WLTA 3RIGA 5SY6A 1JU3A 2RAUA 4JENA 4U2EA 2R8OA 2XWSA 2LCIA 1NVVR 3CIFA 3DKRA 4I7EA 4M1QA 3PIIA 4RKFA 3JQ8B 4K3VA 4XYMA 3WSWA 2WP8J 5EMKA 4APBA 2IZ0A 2NO9A 1CIVA 1SO8A 4JU8A 5JXGA 2D6FA 2HBYA 3QVGA 4LAFA 1YK1A 3NHPA 4HG2A 5F73A 4WCVA 1JRLA 4NH4A 1Z7YA 1DRJA 3FDJA 3HP4A 3WYDA 5IU6A 2BCGY 3C5HA 1KYQA 1Z2PX 4X5OA 1H85A 4GOXA 1Q77A 1K6JA 1NQAO 1BN6A 1IHPA 1UP6A 2D62A 1XDGA 3B1XA 1VJDA 4F38A 6NULA 1S8OA 1T4DA 1TU3A 2BAGA 3GV0A 3OJLA 4MUIA 3TEMA 5JS1A 3EG9B 1E1QA 4DQXA 2I6GA 2MSKA 2YV4A 4AG5A 4EGSA 1E62A 2RJ3A 1RNLA 3R40A 1SVMA 4JC5A 3EZNA 4PZCA 5HA5A 3GLGA 1QVWA 5CFQA 1U7ZA 2KJQA 4H3HB 5HCNA 1I2ZA 4HJXA 3K7EA 2B5WA 2BEKA 1OZHA 1YDEA 1V41E 3L7YA 3N6RA 4HFJA 1SXIA 5JPIA 2XUHA 2CLOB 4MINA 1U2QA 1KY3A 2GKSA 1ZSVA 1M2VA 1JIKA 2Q3DA 3BHJA 3HCFA 3JQAD 1JP7A 4P5EA 4X8OA 3ZY3A 4BFSA 4D41A 1NBAA 1Z5UA 3G82C 4JDPA 2HU8A 1YHYA 2EF0A 3B85A 2PGDA 4HR7A 4LJYA 4G4IA 5EWMB 3G68A 2JARA 3IDQA 5F2KA 5A3QA 3R24A 1U81A 1PTKA 3LTNC 5EP4A 1HY1A 1RQGA 1XRRA 1YR3A 3V32A 1JG7A 1P3JA 2OG1A 1IN8A 3QVOA 4JQZA 5EZ6B 3GFFA 5GONF 2ZPTX 5IW8A 2A4KA 5AHKA 5TV2A 3ASUA 4J1SA 2QD4A 4RTLA 5LDDC 3EIQA 3HXTA 1Y1SA 3GMSA 1RWNA 2G7ZA 2REXB 4EFDA 5J5CA 2UUOA 2O20A 3NOXA 3ZGXA 2EEPA 5F9MA 3QX7A 1Z33A 3ABSB 3B3GA 1A8HA 3Q2OA 1PJZA 4HXEB 4X60A 1F8UA 3CBGA 2OBBA 1T4BA 4E6EA 2IS2A 4KE7A 2GRAA 3BK7A 1U1FA 4LVOA 1G19A 2BUCA 4PX5A 4X1OA 3NUGA 2QRVB 5A7GA 4DEXA 4GM0A 3K09C 1N9KA 5LDGA 2DEUA 4ESEA 2E5LB 2OV4A 3I6BA 4JT9A 1P18A 3VR5A 4XCQA 2EX1A 3G5MA 1S1MA 3M82A 4KFSA 2Z1NA 1ODTC 1RAGA 4UNIA 3V4PB 1AKMA 2QYHA 3EGIA 3M6IA 1UPAA 2PMWB 4FXOA 5TARA 3ONEA 4XGIA 3SZOA 4PTYA 3G0HA 3EQ8A 2YOFA 1ZCBA 2C92A 2O3TA 4BU0A 1KNQA 5B1YA 1UBEA 1OXUA 1UCFA 2R00A 3EFEA 1EE1A 1LA2A 3AHEA 5K0BA 3MIIA 1GT91 3RWBA 1ZD4A 3FWPA 3IIJA 3JTMA 3MBIA 4ND7A 3C6ZA 1CR1A 4P98A 3HYSA 1DRWA 1HG1A 3C8MA 4QOJA 4YMLA 1EDBA 3HQ4O 9MHTA 4GEKA 2IE8A 1T5IA 4JLVA 4LQDA 4N47A 1RVDA 1JDUA 3H5IA 1EUDB 4FDMA 1ZHFA 4ETNA 3TSOA 3M1LA 3EQ2A 1O9BA 5T6MA 4Z4FA 3RYFA 3LUHA 1N0VC 2Q9AA 3NHZA 4U7TB 1XAGA 3PC3A 5AMXA 5MGNA 1FS4A 4R41A 4QDOA 3T06B 3V1UA 4HFNA 1YS6A 4QYWA 2FK7A 3OE4A 1ECPA 2XCQA 4ENUA 4DMMA 2VP9A 1QYRA 3GWGA 3A1CA 1COWA 3I3SR 3UH0A 5BPFA 1U9CA 3P26A 4HAXA 3TW8B 1O03A 3I1IA 4OI1A 4DL9A 5BSMA 3A0RB 1FL9A 1SULA 2C9ZA 4FYWA 3BXZA 4UM9D 5CH5A 2I1LA 4DV2B 2DUMA 3UEOA 5LQCA 1S2LA 1L0BA 1PP4A 1XD2A 3IUYA 5LXTA 1GY8A 1OYOA 1U11A 3I8OA 3KQPA 3R3VA 4FMBB 4P4SB 5A2GA 3EWNA 4F85A 1XKTA 1EJ6A 1IEXA 4FDLA 1B93A 3NW9A 4YRLA 3MT0A 2CXOA 4RE6A 1S0UA 4LNHA 4M0DA 3I2JA 5LQDA 3GLFB 2FMTA 4EVQA 4Y2PA 2ABWA 4BFXA 2D8AA 4QPPA 1Q6YA 1TX4B 2GEBA 3O8LA 4X85A 4Y9SA 5A5FA 2FRVA 3SC2A 4L4ZA 5DHRA 2IHVA 2YBDA 3NS7A 4KH1A 3UT6A 4Q4HA 2NUPA 4Q3OA 4BBZA 2IELA 2ECQA 2F2TA 3MS2A 1OFUA 4BVFA 2FW0A 3SJUA 1OZFA 5K3EA 1DWPA 3FHJA 1LNZA 4GX1A 1JKIA 1MXFA 3VV3A 1KO4A 2Q27A 4MGHA 1KH1A 3M3HA 5HZMA 3ICEA 4N5MA 3E1KA 2CJFA 2EGGA 2YR0A 2VFAA 3N7UA 2D4HA 1U4SA 4EARA 4ZZ0A 1EZ4A 4PU0A 2LXNA 5HE9A 3F6SA 1UOOA 5LXTB 5JXJA 3CYFA 3KCNA 4W4TA 2X6RA 5C8XA 2GUGA 3DCJA 2FR1A 1ZNXA 4JWTA 4RHEA 2GPWA 3ZJYA 2GBFA 4NULA 4NZPA 3VSBA 1QANA 1IUKA 1FTSA 4KI0A 1RI3A 3PXEA 4N41A 3MILA 4HFMA 2HA7A 1LDNA 4KFRA 5LQKA 3PTLA 1XRLA 1NUSA 1VXRA 1U7TA 4OB7A 4CJXA 3JWGA 3NCHA 1YVUA 2I34A 2QVXX 2YXBA 4JUBA 3KD2A 4OFWA 4W6ZA 5TC4A 3VZDA 3BJIC 4E7OA 1Z25A 3D6HA 2TMDA 4UHJA 3ZD6A 2PUCA 2BHRA 3IYLW 4ZAGA 5FL7A 4BVJA 1ZEJA 4OATA 2P9ZA 4HGZA 1NRJB 2ZTLA 3B2NA 4K6MA 4RS4A 5DK4A 3UOAB 2JFUA 2VRCA 5FTNA 3WICA 1ADYA 3B1YA 4BQRA 3M5CA 1XCGB 2RI1A 4IEIA 5F1KA 5BYBA 4OYLA 3AF5A 4A27A 3BTOA 3EASA 4O1HA 5K3AA 1SXJD 4ZYLA 3L0OA 1E8NA 2F3PA 1X2EA 3QEOA 1YT5A 5H0IA 2NUTA 1UL1X 1RWWA 3HRKA 4XX1A 3SBOA 3WOHA 3OEEA 5K2OA 2P1ZA 4Z4EA 5A1JA 3HUUA 3PIRA 2XCSB 1VCHA 1B0PA 1VE7A 5HF6A 3K6JA 3V4ZA 5AESA 4O63O 5DV9A 3EDYA 2PEYA 4BKQA 2Q28A 1N0UA 1JLLB 3QV2A 1PFKA 1Z0DA 1XVIA 2HLPA 2W2LD 1U2GC 4E2YA 3ROTA 2BTOA 2AMVA 3GT3A 4GPZA 3H7IA 3VI3B 2QPTA 2YYAA 3IV7A 2R7NA 4WN9B 2VH2A 3EY9A 1K7FB 2EV9A 5I45A 2YV2A 2Q5FA 3OQIB 2YJ3A 3LCJA 4JBLA 5FOUA 1U7OA 2JHPA 3I34X 4BVAA 2YYZA 5ALNA 4C3ZA 5BV7A 4DY4A 4FHZA 3GA7A 4PBTA 1RKXA 3S28A 3LRPA 2ORED 4U2BA 5SZKB 4G4GA 4C4OA 4X20A 3WLTA 4ZICA 3TR5A 3PNOA 3QBVA 4YLEA 4P0TA 3VTAA 1GRVA 4EG7A 4LJAA 4B6QA 4WCDA 1WZIA 2JFGA 4BVKA 4QICA 4HI0E 3ZV7A 2RGAA 1E6LA 4W1RA 5DLDA 4QXMA 2F48A 3O75A 1FURA 1Z0FA 3KOYA 1VG8A 1M1UA 3IMKA 4F04A 4M1KA 2C83A 1GCUA 4H77A 4HEA1 1DOAA 3B7GA 2VYQA 2BHSA 3OBIA 4J9UE 4JHXA 5DRYA 4DS3A 3PR3A 2FEAA 5BVHB 2VUTA 4G9BA 5GJVC 5K2MA 4GSKA 1PLJA 3EOAI 1AUVA 1NZFA 4WFIA 2C7VA 2DWCA 2HCFA 2D13A 3NRBA 4GLJA 2OSBA 4JXXA 1FTGA 2CWWA 1TM4E 3NC4A 1U0LA 1J1IA 2W2MA 2X0EA 2VS1A 3PFIA 4B6PA 2F1JA 4B4UA 3AT1A 4DV1B 1MB3A 1QU3A 3C3DA 4TXMA 4IDPA 4YAGA 1WPRA 4M0UA 1YDFA 3U09A 1AKTA 2FHPA 1BMFA 4M1EA 4W82A 1SNYA 3MB8A 4H31A 1QGUA 4DT1A 4WLNA 2WFAA 1PS9A 4AJ9A 4ODIA 3C6QA 2I9KA 1M34A 4QVKA 2D7DA 2C84A 4UW9A 5KHLB 1KZ9A 1QRAA 2I67A 1P75A 1W8DA 1ZM9A 3CNHA 2VKTA 1F2TB 4K9NA 2OBYA 1AZWA 4UVDA 4EKGA 2XECA 5HBRA 3DCIA 4DKXA 3UFXB 3CQ9A 3MWDA 4BZQA 2F17A 1FVFA 1QNLA 3OZSA 4RHCA 3L4SO 3ZHBA 4RKYA 2YVLA 3PWZA 1KI6B 2XE6A 1P7WA 3DDUA 4NXMB 3ZXXA 1VCMA 1HDZA 4GPIB 4I2NA 3DDCA 4D45A 2CXUA 2IRWA 2Y2VA 2ZE8A 1LI7A 4QIHA 1GKIA 4EEXA 4R2MA 4KRFA 1DP4A 3OU6A 2DY1A 1ESNA 1R4NA 1GUAA 2DF8A 5KBYA 1YS4A 4CM7A 3WS7A 4MCIA 5DNYB 1MNAA 3TTUA 4UAVA 1YOVB 2XMZA 2EC5A 4RHXA 1VXOA 2FOLA 1HTWA 3GZTB 1U8ZA 4UMDA 4IQ0A 4YAFA 3H1PA 3TRKA 4F6CA 4INZA 1GGNA 1P2BA 4TZKA 4EWLA 1HT3A 1KO5A 3AOEA 1AHIA 1GFWA 2XF8A 3CH5A 3DDWA 3GZ4A 3PGA1 3ZZTA 4ER7A 4HV4A 4P0PB 4E0BA 4Q4HB 5E38A 1AKYA 3QKTA 1I2BA 5JC8A 5JNUA 3HNRA 5KU7A 4YUWA 1P81A 3DOFA 3GFQA 3FLMA 3KT3A 3H9GA 3PK0A 3IESA 5JS8A 4AO7A 1GZ5A 3KR2A 3NBUA 4LOKA 4LRYA 5K45A 4IHJA 3WZ2A 1J5EB 2OBFA 3BWEA 2HJWA 3O4VA 2ACEA 2IXFA 3GDHA 4Z2AA 1P5HA 4L9AA 3W5IA 1OIXA 5JVDB 3U1TA 2OKGA 1HYBA 1JV2B 5IN5A 1N5RA 2W6IA 3ICCA 4Y1FA 3V1NA 4C7OB 3F5QA 1THGA 3T3EA 3ZXSA 3M6UA 3FJ1A 2PK3A 3PDWA 4MMXB 4R83A 5ISMA 1GYPA 3NEPX 4UM8B 1BDHA 4DTCA 4WK6A 1FS6A 4ZRNA 1QLJA 3GGOA 4N3NA 3EDOA 1KMIY 1RYNA 1NWHA 4JJ8A 3TTYA 3GFVA 3UOWA 1GQSA 1Z2NX 3OTHA 2VPTA 4DLNA 5DE3A 2M9MA 3MN1A 4NLEA 2OENG 1MZVA 3D7KA 1UANA 3VUFA 1T8SA 4E6PA 2CBXA 4XARA 1I1NA 3H2HA 2EDCA 1D7AA 3M89A 1G5FA 5CM2Z 1C9JA 2VCYA 3AM1A 2PZJA 1J1ZA 1M2OA 3FAZA 4NYIR 4TYYA 1IH8A 2O8DB 4MROA 3OWHA 4ZVVA 1QU2A 3LKDA 3HJUA 3IUBA 2BSQA 3AEUA 4P08A 1WHTA 3SF8A 1YNSA 1E9RA 4H1TA 1U7DA 2HHJA 5A06A 1WZEA 3VBCA 2PD3A 2QRKA 1C0PA 5GJCA 3ZW7A 3C4JA 4TV9B 2I0FA 2BKUA 3AESB 2D27A 3I2IA 3IJRA 3K72B 3P97A 4NU8X 4HWSA 3AFNA 2A5DA 4KK3A 4WRRA 1VQ1A 3SN6A 3LBYA 3PKJA 5B1IA 4ZYXA 1ORWA 2PMKA 3UCEA 1A9TA 2PUTA 3NTXA 1AIPA 2OYSA 2G9QA 3K4QA 1QHIA 2OQIA 3LW7A 2Y0DA 3E1SA 1K3FA 5IT9A 1G98A 1Z4JA 1YHZA 4XIIA 1CY0A 2VRWA 2H2IA 5EIBD 1SEPA 1E94E 1NGSA 5COQA 3GAFA 1LC0A 1YOVA 3ND8A 3WIUA 4JBXA 3KUUA 1F51E 1XLWA 5BNTA 4A2QA 1Q0LA 5FB3A 3T4UA 1GSHA 5DGDA 1MW9X 4S35A 3GBPA 4GX0A 1KXZA 1YB1A 3D59A 2XZLA 2VNHA 3IR6A 3HG7A 3F8WA 4NCIA 3VR2D 1WXWA 1NC1A 3TKYA 2ECPA 3HLYA 4MPJA 1RADA 3ICQB 5KYNA 3LWDA 3E7XA 2A9PA 3I6ZA 3LP6A 3OZWA 3PL5A 3QVJA 3FPSA 4JJ7A 3R7LA 4FFVA 3UC9A 4MNTA 4BJHB 3C3JA 3AF3A 3LYLA 4MIKA 5IBCA 2B61A 2XODA 2DBYA 3A9VA 2C1ZA 3AF0A 2OCPA 5LWHA 4A92A 5HJ5A 3KUXA 4RDIA 4YJ2B 3WWCA 2C2MA 3S6JA 3HDVA 2HMUA 4CW7A 1L1EA 4HQOA 4FD2A 4WEOA 4WX2B 3ZHRA 4KIWA 1W76A 3V8NA 3EXFB 1YR6A 3RK0A 1L7NA 1PJ2A 1ADFA 4R7TA 3VJMA 4EDHA 4ZYZA 1IULA 2PUBA 4DLBA 2PY6A 4NOJA 2PXCA 2QTZA 5JVDF 5K8LA 3VR3D 3DJYA 3B3FA 4TT3A 1KFCB 2L19A 5GGYA 5TMEA 4C4YA 4RLHA 2VLIA 3AUUA 1SXHA 2X9GA 3AR3A 1W581 4M9CA 3PI7A 2K2QB 3CNNA 3E0XA 1GG2A 2QN9A 4BBPA 1Z6PA 4IXTA 1XMSA 1D4OA 4QBKA 1CJCA 3H2KA 1O6FA 3W2TA 3QXCA 3VHXA 4BRZA 1I7QB 1DJPA 2X6TA 3ANTA 2EBWA 3FSRA 3JQBA 4ZC1A 1DBVO 5KQPA 5ERXA 5E8RA 3K0BA 5JYEA 2RHBA 5L3RA 5CLIA 4B76A 1WTCA 1YMQA 3SGLA 3V8MA 5L6MB 4HWGA 4RH3A 4DUGD 1Q74A 3M0EA 4K0KB 2ZB8A 1ZR2A 4ZOQI 3SU8A 1VSUA 4UDOA 4BEJA 3P9CA 2NT3A 2P9FA 2Q1YA 1JEQA 3CU5A 3G9ZA 2IPMA 4MV6A 1SKAA 5J63A 3UICA 4BEWA 4JQCA 2W4QA 2HMYB 1A2QA 1ORHA 1XNJA 4UJ5A 3ORHA 3QKRA 4O2RA 4P3PA 5CT9A 3ZWWA 4R8SA 3P96A 4BYGA 4DJEC 1NPYA 3CLRC 1W52X 4MR8B 3UF0A 2W8ZA 2NSDA 4RFVA 3ESRA 2XVXA 4L76A 2JAWA 1E6MA 1T3SA 1MAAA 2J3JA 5I5GA 4AYTA 3R6GA 1CD5A 1LI4A 2C2HA 4IJQA 2DPYA 4KRGA 3R7NA 4UZSA 5K99A 5IRCD 2E6KA 3N2GB 3Q7RA 3INYA 3VXKA 4KSCA 4NPAA 5ILQA 4MGKR 4WKOA 5AUQA 5F4ZA 4H27A 1GCIA 4IGEA 4C20A 5HMMA 3P5BA 1I6WA 1U31A 3C3KA 3F6BX 4EUEA 4TUYF 2DLNA 3QUTA 2AUTA 2P0YA 1USVA 3F3SA 4JP5A 1UJBA 4HLUC 4PZYA 2BEWA 4Y1GA 3IVAA 2GN2A 2P5SA 4N7BA 3K31A 3TQIA 1Q7RA 2PT7A 3LDUA 1II9A 3A6GA 3EWAA 3KOXA 4IS3A 3OP4A 2I2AA 1KPIA 1GV0A 3OMWA 1NG9A 3EF0A 2EL7A 2XW6A 2VSYA 3FUCA 2EKLA 5ETJA 1J99A 3VPHA 2SKEA 1WP4A 2FFAA 3AUTA 5DF1A 3OX4A 3KK0A 1TLFA 1KK0A 1KOGA 4TKUB 5KDOA 1W5TA 5FTLA 2QX7A 3P2MA 2Z9BA 1PL7A 2JRLA 3LVFO 1E6EA 2NXWA 2O7SA 2Q1SA 2WU1A 1KMQA 3A6JA 3QVLA 5CYFA 3U7JA 4E5DA 1V7QA 3HDQA 1A5AB 2AFHB 3VV2A 2YMQA 1YHNA 2JFFA 3MPOA 4RIGA 4BZWA 1FOEB 2RJOA 4ND5A 3ZVKA 1O3YA 3PC8C 5L3VA 4DLXA 2NYRA 1P33A 4CLXA 4PLHA 1XWIA 5AVYA 1V6CA 3B6KA 4GWLA 4KIUA 4OGLA 4TLLB 4TVOA 4X91A 1NM5C 4WOPA 5LLSA 3FWNA 4BQIA 2OSVA 4RA9B 3NBMA 4L3VA 2D1YA 3AX6A 3SOZA 1T29A 5EWLA 1JJ7A 4ND4A 4R69A 621PA 2QD5A 1HE5A 4LGCA 1O8CA 5TR9A 1GL7A 3B1ZA 2JFVA 3M34A 4RYLA 1DPGA 4QX6A 4B3BA 1YQ9A 2R7MA 3F67A 1L4YA 1X87A 1DG3A 4MIEA 1NBIA 3OFKA 4BLUA 3ON5A 4CMKA 4EA9A 2P3LA 1ZRMA 3SWWA 1KYZA 2ZRPA 4DQLA 4I6EA 4B6RA 1NVFA 4Z3KA 4BP8A 4N3GA 4MRPA 4XVQA 4J03A 1JPJA 1D6SA 1KFKB 3V4SA 3LPMA 1WV1A 4ZZ3A 1HNNA 1C4KA 1YRHA 2A0FA 4ZV4A 4AWAA 3QMPA 1Q95A 3SMQA 1SB9A 1NNI1 2AOVA 2N9UA 3N2EA 4OJQA 3ITNA 3A6ZA 1CUBA 1J8DA 3U4QA 5EQDA 3RTAA 2QN1A 2ZWIA 3P94A 2JZOA 3V2GA 4B8YA 4RVUA 3P2EA 4UTPA 4UU0A 1DRUA 5JBNA 1P7ZA 1UC4B 4L8VA 1GM5A 4AZ3A 1NG1A 4RE5A 3SHWA 2YMMA 3RBAA 3P0IA 3U3RA 3QIVA 2BGIA 3Q7PA 4K6KA 1IZ0A 2WKRA 4H3KB 3FR7A 1MO2A 2P9JA 3I04A 4FDUA 5IF3A 4PICA 3EA0A 4TLBA 3WA6A 2BFPA 4QOEA 1BXGB 2VF5X 3DTYA 4WN9A 2FZ5A 1PEYA 1DO2A 2Q8QA 4JR2A 4PG4A 2J3KA 2VC2B 4RELA 3VTKA 5IAKA 2FZLA 2PT9A 5G1NA 3V5NA 4M36A 3MJFA 4YJ2A 1WVMA 5LJLA 1QV9A 3Q6MA 4F11A 1IM8A 3JQRA 3BWXA 1Z5WA 3IXMA 3NVMB 3KPYA 4BNIA 3WLHA 2OAQ1 2GKGA 4PLYA 4NCNA 3LVRE 5KAPA 3BN3A 1JDZA 1GG8A 3JR7A 4M0EA 4MS4A 4EECA 2GXSA 4H35A 4CLOB 1FUKA 2I4MA 5CLQA 3DTVD 3R5JA 2J07A 2W5UA 4LRQA 4UM9B 3CWCA 3IEUA 3PHCA 5EINA 2YV3A 4QDXA 3DR5A 1P9RA 1VI5A 3RVKA 1YZKA 2XVYA 2AOTA 1ISMA 3BTVA 4DUPA 2PLFA 3RGGA 4PX3A 3GLIB 1IDN1 1EX6A 2HWUA 2JBAB 4HH1A 1L5HB 1GVNB 2PRKA 3HO1A 3MUFA 2BR3A 2N1BA 1V1RB 1UH5A 2QN7A 3E23A 3IVCA 3OZFA 5AVRA 3SFTA 2ZETA 1CJKC 3ZNPA 3ER6A 4MLPA 1F48A 1UBCA 2AHOA 2C2ZA 2V5VA 2VP0A 3DQQA 4PAWA 4YJGA 5B7QA 4CEHA 5FO1A 1V8BA 1ZI8A 2VNSA 1QHHA 4MUHA 3N2YA 2ZI5A 1VDKA 2PT6A 4TWZA 3TB6A 3IIKA 4K26A 3ZY6A 5IKPA 3ZQ4A 3GN2A 3UFBA 5ITSA 3PS9A 2GVNA 4F8EA 1G291 4K6GA 3JATB 3W5BA 1D5WA 1D2MA 4ACBA 5MDHA 3AHHA 1P7VA 4WGFA 4EUNA 3F6RA 2XWPA 3DAOA 2VHUA 2V0CA 4ZEVA 2O0LA 1K89A 4J3JA 3MMSA 1P1KA 3PEUA 4AK9A 4BQEA 3C3WA 1E1CB 4ZODA 1E7MA 1DTSA 1XZIA 3FPHA 3LHIA 3SNKA 3UOGA 2C5SA 1AG9A 1J39A 3MWDB 3T1VA 5EE1A 3DZCA 5ARDA 2B5OA 2VQDA 4RETA 2V7UA 1XMVA 5KQGA 3PD1A 4G8DA 2MWMA 5AXAA 1L5ZA 3IILA 4YJ3F 3K0HA 3TRDA 1DC6A 3RD5A 3GX1A 2C77A 1QMGA 3H5AA 3TR0A 3RVQA 4K9MA 1WOMA 2JI7A 4J2HA 2JAOA 2Z8YM 3ZCSA 1PJAA 4L8FA 2FG7C 3GBVA 4JC0A 4TX1A 1AUOA 1VCOA 3A7EA 1X70A 1QVAA 2AA3A 1V3VA 2HA5A 3WO1A 3WLKX 4F3TA 1U0EA 3NHFA 4S12A 5GJBA 3F47A 5F7JA 2B99A 3K9WA 1V95A 4RVNA 4PLTA 1QTIA 2VP3A 1FX1A 4U9HS 5K8IA 2QNIA 2VXOA 3TX2A 5K0LA 3VKWA 5HCUA 2ZE5A 3HB1A 5D1HA 3A3NA 2GJ9A 1QE3A 3O95A 1U16A 2L82A 1Y3BE 4M49A 4ND2A 1TYZA 1IK4A 1CRPA 5JQGF 3G0GA 4KVFA 1YAHA 3DAPA 4TZ0A 4YJHA 5E6UA 5HIJA 1BHSA 4AZTA 3HL0A 4EEIA 3KZNA 4Y8VA 2WJPA 5FR1A 4BGEA 3CUEF 1N2IA 3RSQA 4EY8A 3R3YA 4P93A 3NALA 3SYNA 4EF6A 3TZEA 5K8TA 4YRJA 2Z2YA 1QTRA 2W2NA 4GRIA 3USZA 2VJYA 3QVXA 4URZR 5FL7D 4F4IA 2B3DA 1X7DA 2I6TA 1EX9A 3NGMA 2AOTB 2DB3A 2YQ5A 2ZIVB 1GP2A 4QXAA 4CTKA 2MDTA 2H8GA 3L41A 3TRFA 1W5BA 2PAFA 3G0IA 3AQ4A 3LCCA 1THZA 1E3WB 1NF3A 1ULHA 4NDZA 2QTWB 3PUYA 2NM0A 1KI4A 1M8FA 1LBEA 2R6CA 2QTMA 2C03A 2WUFA 1Z6YA 2I76A 2WE7A 1NXPA 4DXAA 1VCNA 1PHPA 1HDRA 1YCHA 2G5TA 4FONA 4RQAA 5ARCA 4JGBA 5T8KC 4ARZA 1UT6A 1FJHA 4FOOA 1Y34E 5EZSA 4KWIA 2ZRJA 5HJ2A 4HYQA 1IWOA 3I92A 5DBEX 3VYWA 1K2VN 3AC0A 3KVYA 1G8AA 3WISA 3IDZA 5FUVA 3UATA 4CMIA 2A9QA 4TRRA 3AJAA 4PFSA 1Q44A 1W25A 4IW3B 2XQVA 1ZVKA 3CZ5A 1KWKA 3RJMA 4DR5B 1W96A 4RHTA 1CE8A 2D5BA 1R6XA 3RS9A 3CB4A 1GRQA 1QK3A 5LC1A 3VR6H 4DQDA 3MRXA 1C0IA 3HBLA 2FMKA 1GUBA 2QGZA 1W19A 1UWKA 3IKLA 2F3QA 4QJIA 3IEXA 5KTRA 3QWIA 2DZDA 4P2BA 1JHZA 1GXSA 2VBCA 1TAGA 1QK4A 5BR7A 5KNCD 3DMGA 4ZVMA 4E94A 3WFIA 1QP7A 1XEFA 1SJ9A 1WMDA 2Q5HA 1VIMA 1W4AA 1NVDA 3BL8A 2FR8A 3O82A 4R8LA 3GGSA 3VKFA 1IDOA 2ZI9A 3O1JC 4OKSA 1I80A 4XQGA 3T3MB 1T1JA 3ITDA 5T64A 1OILA 4NDNE 1E2EA 3ZXYA 4B0OA 1PSWA 2WW8A 5K3DA 3PX7A 3K8ZA 3K92A 5A5EA 3K9LA 1OF1A 3GLVA 2O8BB 2VAXA 4RTQA 4UBOA 1C2TA 2B2NA 1CJUC 2H5LA 3C3XA 1ZHHA 3OIWA 4Y2SA 3B20A 3FAKA 1YDWA 4I50F 1HNXB 3MCTA 3OEWA 3KV1A 2LDXA 4L85A 7GPBA 1RLIA 5EZQA 2QTGA 5JI3E 2DVMA 4FZVA 1MO5A 2XDWA 1U0OC 3I9JA 3EXEA 1SCUB 2XOXA 1MCZA 4R2XA 1Z2DA 1OV6A 1HL7A 2INGX 4TKZA 5AW0A 3KKNA 1U1GA 4F45A 3HU3A 2YQZA 2CDBA 3FOCA 2FN8A 3MRVA 3OFJA 1LDEA 3E9DA 5GGXA 2BFCB 2YHUA 4WLFA 1DI0A 4DLRA 1T9ZA 1JG1A 4D6XA 3NCTA 3W3AD 5JD6A 1YGPA 1P6XA 5AW6A 5GV7A 4HWRA 4Z9XA 4AM8A 3CH6A 4IDCA 2Z5FA 4AYWA 4IQFA 3HCWA 3P9RA 1Z0AA 5G02A 1RJ9A 5IAJA 2PGOA 5BRNA 3CXRA 2MR6A 3T5CA 1NMZA 5EMMA 2IV3A 3X44A 3AUFA 3S99A 2RGNC 2IQ5A 1TRHA 2Z5LA 1A9YA 1VL6A 3Q15C 1G9SA 4I55F 4MWTA 4MA4A 2IITA 3BFJA 4MQUA 2W70A 4C7VA 4X1KA 4YMWA 3H04A 1ZR4A 4Q66C 5AI4A 5FPSA 2PTQA 2QZ9A 1IU9A 4WZAB 4CF6A 3G1UA 4P7JA 4JI7B 2O8FA 2ZT7A 4INOA 4KNWA 2BUBA 1C7ZA 1R0SA 3V8QA 2O2IA 1FFAA 2BKEA 1XVAA 1IVNA 4Z0PA 3RSZA 1X1RA 5ALWA 1PTJA 1A88A 1XCOA 1Z36A 2PGAA 2QWXA 2VUIB 1BCRB 3PQFA 4KZKA 3ANSA 2VNKA 4GBJA 1RBMA 4YRIA 2FI1A 4NCHA 5IVPA 3C74A 1L1FA 1ZIOA 1TT7A 2AJTA 4LXTA 1MEEA 4BDSA 4LDJA 2IOQA 3HDYA 1GUFA 4RXTA 1ADCA 4S1NA 2P2GA 5HFAA 4KX5A 2GFIA 1V9LA 4A03A 4DV0B 4EUHA 2M32A 4KR3A 3C3CA 2N42A 3KEQA 3GPIA 3R0XA 4I0WB 4AMGA 2E3JA 3O9MA 5CIQA 5E1OA 1NVTA 5UKDA 5DCUA 5C18A 3ADDA 4YUZA 3HU1A 3FNEA 2IYEA 4WY2A 1Y0BA 3QU9A 4KBYA 2HBQA 2JLUA 3G2MA 1WBBA 1JDBC 5FORA 1PZXA 4GXNA 5FTJA 3STWA 3B9QA 3ZU4A 3K70B 3RS8A 1C8VB 4J1TA 4PAGA 3LA6A 1G1MA 1YF3A 4C6TB 4OA5A 5GOZA 1U7WA 4U0KA 1U8AA 3KPJA 4H16A 1KR2A 2ANCA 3IOBA 1K4YA 2IBMA 3D2LA 4M8KA 4WQMA 4K8OA 1JBQA 1ZH2A 1T9AA 4QBGB 3UC5A 3M3PA 3SC2B 3TZ6A 3LT4A 3R77A 3BTSA 1YC5A 2HDHA 4Q82A 5DP2A 1X7GA 3RFTA 2RB4A 4LYHA 4TLCA 1FX0B 3N7AA 2GPBA 4LSGA 3RRXA 2WU8A 3T9BA 3ETJA 1W6UA 1DQRA 4B1FA 4AMBA 1A96A 3LCUA 2SCUB 2AH5A 3ED5A 2B4KA 4E4RA 1TI7A 2BF7A 4G0YA 4DUZB 3T1HB 1D09A 1P9OA 2YV1A 1D1QA 2BGMA 3NOVA 3NUZA 3PIDA 4Q1CA 2P1DA 4RV5A 4I5EA 4RVHA 4BGDA 2JH8A 2VSFA 1RWMA 1ITZA 2EX4A 4CUZA 3D6MA 3UPDA 4JI6B 4ID9A 2H0RA 2ZUVA 4OI4A 1G5HA 5CK4A 4A3SA 2IIBA 3L4KA 4U39A 4LF4B 1USWA 4K88A 3GHHA 3LOUA 4UOEA 3S2SA 3JATA 3C1AA 3D6NB 4TKLA 1G4AE 2R48A 2R68A 3Q3IA 4YQEA 1UPUA 4RJ2A 2YHSA 2WUWE 4EPVA 1G5PA 1HZJA 2IU3A 1RJFA 2BF4A 2BY4A 3BGVA 1OXBB 3IEVA 5DIZA 1DB3A 3KWFA 1UKVY 2G9NA 4ETWA 2Y93A 1L5GB 1U65A 1A2KC 2IDJA 3EOBI 4R71A 1MIOA 4UQPA 5JJKA 2W42A 3NPAA 5IEJA 5ALZA 3U61B 2HV9A 1R3UA 1WDLA 1SCDA 2C7RA 2DP4E 3RJZA 1DAMA 1JAIA 1F8FA 1ZSNA 4L28A 1JLKA 3S40A 1ZXXA 1HE1C 4RIFA 3IQHX 3QX9A 1FMFA 3CPEA 2J32A 4P7BA 4N0MA 3OEHD 4ENQA 1C8KA 2V5UA 1Y81A 4XDGA 4Q7QA 5BW4A 4NEHB 4S04A 1FRVA 1YB7A 2HRDA 3U4DA 1YQWA 4EW1A 2BGTA 4G86A 4PTLA 5CLLA 5E0OA 4M38A 2OZLB 4LDPA 3OX2A 5CX1A 1TQDA 5IDVA 1GVHA 4G5YA 5FR2A 4L8GA 1UK8A 4EABA 1VIAA 2E5WA 2CXHA 2KW5A 3FZYA 4K40A 3W9BA 3R5TA 3WYBA 2EERA 4ALMA 1JT2A 3KB6A 3MT7A 3OZ7A 2BI8A 1I0LA 3RUEA 3BM5A 3E4CA 3MBOA 3IP8A 2D7JA 3Q5DA 1QO9A 1IC6A 1SOVA