1Q91A

Crystal structure of human mitochondrial deoxyribonucleotidase in complex with the inhibitor dpb-t
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
194
structure length
194
Chain Sequence
RALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the mitochondrial deoxyribonucleotidase in complex with two specific inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords 5(3)-deoxyribonucleotidase
total genus 64
structure length 194
sequence length 194
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2003-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 1q91A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1q91A01
3QU2A 5ALTA 3GYGA 4AP9A 4PNHA 1O03A 2YMMA 3A1CA 3IRUA 4RESA 2I55A 3E8MA 5AI9A 4NWIA 5AI5A 5AI4A 3A1EA 4UU1A 3QYPA 1YV9A 2AGVA 2FEAA 2B1RA 3WGVA 2ZG6A 3WK5A 1RMTA 2IOFK 4H1WA 3L0BA 5AVSA 3ZVLA 3I28A 3EF0A 2OA0A 1F5SA 4HGRA 3VAYA 1T9ZA 5AESA 2FDRA 1YJ5A 2I54A 3QX7A 4Y3UA 3OPXA 4HGPA 1KYTA 4EX7A 1L7NA 4CF5A 3L1VA 3SMVA 3UMBA 1J8DA 2GO7A 2PR7A 3NUQA 3FGOA 3E81A 4NFLA 3DAOA 1YMQA 3R9KA 3SLRA 3NIWA 1Z4PX 2R8YA 2ZBEA 1Z5GA 3UMGA 3QUCA 3AR6A 2C8LA 2B82A 4YGYA 2HSZA 1ZRMA 5JJBA 2IOFA 4MWOA 5AW4A 3U19A 2YJ6A 4Y2QA 3QUTA 2HX1A 5ALXA 3ZU6A 5AM2A 1U2TA 2HF7A 3QUBA 3QU4A 3BWVA 3QU9A 5AM5A 3ZX4A 3FZQA 4CF3A 3ZUPA 5FP0A 5AVUA 3W5AA 5ALHA 1Z4JA 2NO4A 5AW8A 3N07A 3ZTYA 5AVWA 3W5BA 3ZVMA 3WKCA 1L8LA 5AW5A 3U7HB 2RBKA 3SKYA 1N9KA 2PKEA 4UATA 2FPUA 5AKXA 1YS9A 2HHLA 3L7YA 5AVYA 4UMEA 1S2OA 3ONNA 2GHQA 1ZJJA 1QQ6A 3NALA 5AK4A 1VJ5A 1XPJA 2W4MA 3ET5A 5AM3A 1WR8A 3PDWA 5ALUA 2QYHA 1FEZA 2P27A 3SKXA 3L8HA 1MH9A 3M9LA 1N8NA 2CFSA 4Y2YA 4BEVA 1Q91A 4GIBA 1J97A 5AM4A 4BBJA 5AW6A 2G06A 4DFDA 1ZOLA 4C4TA 3WK9A 2ZBFA 4BNDA 1O08A 5ALOA 5IT0A 5ALRA 4YCLA 2PQ0A 3SD7A 2C4NA 3IB6A 2JARA 1TJ3A 1S8OA 4XQ0A 3AR3A 3WGUA 3QXGA 2IYEA 5ALPA 1LVHA 4KNVA 3AR9A 3PCTA 4IG4A 3WKBA 4RETA 2AH5A 2FUEA 3E58A 2R8XA 5AW2A 4EENA 1ZD3A 1CR6A 3ZWDA 1TJ4A 1X42A 2HDOA 2DQSA 4BNDB 3OCVA 1QQ7A 3ZI4A 4BX3A 4KX3A 3NRJA 4C4RA 3UM9A 3KDPA 2JAWA 3DDHA 4F72A 3L8EA 2B30A 1Z4LA 1VFPA 2FI1A 4FFDA 2BDUA 5ALWA 1RLMA 3L0CA 3ZTWA 4CNQA 3EPRA 2FPXA 3L1UA 3OTQA 5AKLA 2ZXEA 2YMPA 1WVIA 2WF6A 5AVQA 3WK8A 2ZBDA 2G0AA 2CFTA 3BA6A 1WPGA 3DV9A 3FPSA 5AICA 1RQLA 2OBBA 2CN1A 4UMDA 1Z4QA 1ZD5A 2I7DA 1SWVA 4BX0A 2OM6A 5AW9A 2YMQA 3B8EA 1U7OA 4EX6A 5AKJA 5ALZA 1RKQA 3ZX5A 2FPRA 2G08A 2WF9A 2P9JA 3I6BA 3KOOA 5ALKA 5AW3A 4NABA 3WKAA 2WF8A 5ALJA 3F9RA 2GMWA 2BY4A 3ESRA 3M1YA 3AR4A 1Z4IA 4BX2A 3WKEA 3KZXA 4JB3A 5AK3A 2D2VA 2HEGA 4UM5A 3QUQA 3L0YA 2RAVA 4DCCA 3J7TA 1L7PA 5AKEA 1Y8AA 3SF0A 1QQ5A 3ET4A 2NO5A 4QQFA 2WFAA 1IWOA 3EWIA 3N1UA 5ALVA 4YCNA 4BEWA 2FPWA 2G07A 2JGAA 2NYVA 4DW8A 4O8CA 1EK1A 3N8GA 3QU7A 2P69A 3OCWA 2B8EA 2WM8A 4KYTA 4E88A 3U7EB 3AR7A 3PGVA 1Z88A 5AVXA 1T5SA 1NRWA 2HF2A 3FVVA 2MSNA 2GFHA 2R8ZA 4KN8A 1Z5UA 4DWOA 5AIBA 3AR8A 2I34A 1Q92A 5IT4A 2EAUA 2BDEA 2HO4A 3TLMA 2RARA 1ZD2P 1RQNA 2WHEA 3ESQA 2ODAA 2FUCA 4B6JA 3I1YA 3WK4A 2YJ5A 1U02A 1YDFA 5A3QA 1RMQA 5AW0A 3MC1A 3KC2A 2G80A 3QNMA 3A3YA 3K1ZA 2G09A 4UMFA 1NF2A 2HOQA 3MN1A 5AKGA 4XPZA 4OD0A 4CE6A 2O9JA 2YBDA 4XOUA 1TJ5A 3N5KA 2C8KA 2C88A 4Y2JA 3IJ5A 2YJ4A 4F71A 5ALGA 3U7FB 4YIKA 1RDFA 3OCYA 4HAIA 2I6XA 4EZEA 2B0CA 3R4CA 5AKKA 4ZEXA 2ZOSA 1CQZA 1K1EA 4OHFA 1RLOA 4EEKA 1RC8A 1RPZA 4BYGA 4MUMA 2Q4TA 4JDPA 3AR5A 1U7PA 3NAMA 5AK6A 4AS2A 2C9MA 3EF1A 3OCXA 3NANA 3ZW7A 3U7GA 1PW5A 2YMLA 5ALFA 3ED5A 1RRCA 2WF7A 3B9BA 3WK6A 3I76A 5AVTA 2P11A 1Z4MA 5ALDA 1SU4A 5AKIA 4YH1A 1AQ6A 4OFZA 1VJRA 3W5CA 4HGNA 3FM9A 5AKHA 4Y2UA 4NAVA 1QYIA 4Y2SA 3D6JA 1U2SA 1XVIA 5A3RA 4UW9A 5T41A 1NNLA 2FPSA 4Y2TA 2YY6A 5E0OA 5ALLA 4L6CA 2WF5A 3L8GA 1Z4KA 5ALYA 2I33A 1RMYA 3MPOA 4UAVA 1ZS9A 2AUTA 3HYCA 2B1QA 3WKDA 1RLTA 5AHXA 3L8FA 3QGMA 2CFRA 1QH9A 4UU0A 5AM1A 5AK5A 2EARA 4Y2VA 2W43A 1LTQA 4UASA 4J03A 4UMVA 2X4DA 4UAUA 4G63A 2G1AA 5AKYA 5AM0A 4YCMA 1L6RA 5ALSA 2IOHA 3U26A 3S6JA 1T5TA 5AI8A 2EATA 3P96A 3OCUA 4HYTA 3KD3A 3QLEA 4C4SA 2B8JA 1EK2A 5AW1A 4Y2PA 3PGLA 4I9GA 1SWWA 2JAOA 5AIAA 2Q5EA 2GHTA 4OCZA 2VKQA 3QU5A 2IA5A 1JUDA 5ALEA 3RF6A 3ZVNA 3SHQA 1L7OA 2Q4RA 2YFYA 5AKZA 3DNPA 4BKMA 1YNSA 4QJBA 4EELA 1L7MA 3R09A 5ALQA 2YJ3A 3RFUA 3KBBA 1XP5A 4L57A 3W5DA 5ALNA 4CF4A 3A1DA 5ALIA 2R8EA 5AW7A 4UM7A 5ALMA 4GXTA 3HLTA 1RKUA 4FE3A 1TA0A 2YN4A 4I9FA 4HGOA 1TE2A 3E84A 2HCFA 3B9RA 4ZEWA 4YIHA 1Z4NA 5AVZA 2HI0A 1ZRNA 2JAUA 2RB5A 3FPBA 4XE5A 4Y2RA 4HGQA 3ZWKA 2MU1A 5AVVA 4J2TA 3CNHA 4IFTA 3UMCA 2AMYA 3MMZA 4KX5A 4UARA 4KNWA 2QLTA 1RKVA 1ZD4A 3CZ4A 3NASA 3WK7A 5AVRA 4Y2XA 1L8OA 4FYPA 3N28A 3L5KA 1WZCA 3U13A 3OCZA 1Z4OA 2W11A 4AS3A 4ZEVA 5IS2A 3AR2A 4G9BA 4NV0A 2ZBGA 4L6AA 5AI0A 2O2XA 5AI6A 5A3SA 2OYCA
chains in the Genus database with same CATH superfamily
3MTEA 1YK1A 4NE2A 3I6YA 4H7IA 4WBNF 1W46A 4X3CA 1PYOA 2QPLA 3ML1A 3ZY5A 3HY3A 2VHQA 1J2RA 3HGMA 1L4FA 5E9AA 4IJQA 4V0SA 1KQNA 4HDAA 4UPEA 3F4TA 2Y76A 3QFFA 2I6FA 2OAGA 4ZT6A 3LUFA 4KH1A 1I6LA 2I55A 2Q8PA 4OFBA 2MSCB 4EGQA 5DTJA 5AI5A 2PD3A 2R0QC 1UC9A 3PI6A 3NYRA 2GARA 5K6RA 2I3BA 1OVMA 3H6KA 3M6XA 4FFNA 5IVKA 4Z86A 2QKYA 1SZCA 3TLCA 2H1SA 2ORIA 3KUDA 1JLRA 1ML4A 4BFVA 5JI3E 3N86A 4AFNA 2VDJA 4DCVA 2EYUA 1Z73A 2ET6A 3IUEA 3RREA 4CEIA 3O31A 3ZVLA 5MDHA 1F5SA 5LZ4A 1II0A 4HGRA 1HNZB 3RVJA 3LBAA 3DPIA 2AYZA 2GZSA 4BLPA 5E7IA 2G9ZA 2Z0MA 4AWBA 2SICE 1ABBA 1UAYA 2IK8A 2PZLA 1H0SA 3CF6R 2E1RA 1FVFA 1RWXA 2P2LA 4JI6B 4DMRA 4TXLA 5MHTA 3AVOA 4EFKA 4Q9KA 4MMYB 1FRQA 2HIAA 3GHYA 1H5QA 3DEZA 1QHHB 2XUQA 4D80A 3PF8A 3SZGA 1NJ6A 3Q7PA 4X95A 2O3QA 4MWBA 1CUHA 1G2QA 4HEJA 5ES3A 3RSSA 4MR8B 5FTKA 1Z63A 1CB0A 2JFFA 3HFRA 4PX9A 3UXEA 2H0QA 1Z5PA 2JFNA 5CTJA 3WADA 2AC4A 1IBKB 2CMDA 4MUIA 1ABEA 1HLFA 1XD8A 3SR4A 2OXEA 3TNJA 1UKZA 4EVSA 1YHYA 1P77A 4TL7A 2ZM6B 5E8RA 3KV1A 3ZH9B 3GIDA 5F7XA 2PEZA 2WYVA 1CY1A 3DMPA 1ZP6A 1OLSA 3TAHA 3LPNA 5K8TA 1U2TA 4OBXA 4UVIA 2HF7A 1TJUA 3QU4A 2HU7A 2C4TA 4C43A 2IEYA 2P9BA 4ZWNA 2FSVA 4AKEA 4CF3A 3T38A 3S2UA 2IQ5A 3GWGA 3E9ZA 1TCVA 2PKRA 2E4YA 2REXB 2WKRA 1UJBA 4OQYA 1CZKA 2D0IA 1K7YA 3RS3A 3VR4D 4CI9A 1N3IA 4QUBA 2VWGA 3U62A 6AT1A 1F6WA 3HU5A 4OXIA 4APBA 3HJHA 4BO8A 4Q5IA 3SBEA 1QGUB 1R37A 4B81A 2PMCA 4DYHA 4WDQA 1QZUA 3H7AA 3MAJA 2QL5A 3HWX1 4M76B 4WLUA 4XTCS 4UCXA 5JAPA 3RUCA 2IWHA 5AVYA 1TI7A 5LLTA 4MICA 2JFUA 3SNHA 1XQYA 4AY6A 4RD2A 5F98A 4RHXA 1A1SA 4ZYUA 3HXTA 4UE6A 2QENA 5E4TA 4HZIA 2Q5HA 4B33A 4R9UC 5CHYA 5CEFA 2Q9UA 3TSYA 3JTMA 1MH9A 3NBZC 5EKTA 5B53A 4M83A 1G5IA 4J0FA 3TCXB 2WQ6A 2LIVA 3PUKA 4NY1A 2WJGA 4KSBA 3UW1A 2C3YA 4IDFA 1T2FA 4QC2A 4DKXA 1O9GA 4PC2A 4KODA 1QP4A 4ZZ2A 3ZOZA 5THQA 2PTHA 2CYBA 1PJBA 4LI3X 2IT1A 1ORIA 3EK2A 3UF0A 4ZU6X 4YNBA 1TMKA 3FKQA 1YA4A 4HEA1 4OU4A 4QLBA 1SVNA 2A35A 2ODTX 3A06A 4KK3A 2QTLA 2WICA 1BGXT 2WZCA 4NYMR 1XB2A 4HTFB 3VDQA 5I9LA 5K3EA 3RC1A 4NZYA 2Q21A 4FQ8A 1RE1A 1Y3HA 4DWVA 3KYCB 3LFHA 1AA6A 4G26A 1U2PA 1OZAA 2PGNA 2DWCA 1V41E 3B70A 4REMA 4B6GA 2GFIA 4WXRA 3TR0A 3JRXA 2KHZA 4GRAA 1JEJA 4B74A 4CQMD 4WFKA 1TPZA 2C57A 2CJPA 3QXGA 4D9HA 4CLRA 2PMWB 4XRRA 4X66B 1E3LA 1I01A 1LLCA 1F5NA 2R6JA 1LS6A 3R3YA 4IQGA 3UB3A 2Y1OA 1DC5A 1CE8A 5FUXA 4ARZB 4O2BA 4E5UA 4YRFA 3KVVA 5TE9A 3CE9A 3DKIA 2MMGA 2ES4A 4H3KB 3T3IA 3U7QB 4KE8A 5C53B 4AU1A 2DQSA 1T29A 1U7XA 4MQ6A 3ROFA 1RM5A 2NVBA 4LXQA 1IXKA 2ECFA 5BSUA 5KTRA 2HA6A 1A76A 1PJAA 4KXUA 4TL6A 3SEQA 5CG1A 2P9FA 5IUKC 4M6WA 3VO8A 4TTJA 3RS5A 1SUEA 2XRMA 1Z47A 5IX8A 4WN3A 1FXSA 1PS9A 1YVUA 4A16A 2FHPA 3KZ1E 3MB8A 4AIRA 3SQDA 1OASA 3L8EA 3EGCA 1FE8A 4BZXA 1RZUA 5CITA 3IQDB 5LBTA 4RKRA 5JZVA 2V0CA 5D6OA 4ARSA 4MGEA 5ITZB 1W5EA 2P68A 2Y1CA 1BAPA 2HJSA 2X0KA 1O94D 1TZKA 3PGJA 4CM5A 4KRFA 4RTLA 2BH2A 1SKUA 1XVUA 1IDOA 4FEAA 2X75A 3PUVA 4IS2A 4KWTA 3G5UA 4M22A 4W9NA 5DEIA 2AMJA 4GU5A 4QJ5A 2HLHA 1FZQA 4PG5A 5HDQA 4KQ2A 4BZWA 4H0CA 1F1BA 2XVXA 4GZLA 4EHDA 2CN1A 3JQ9C 1B76A 2I7DA 1SWVA 2CFOA 1NX9A 3NTLA 3PFBA 4YDHB 3UAVA 3L4BA 3RU7A 4E07A 5FAKA 3AVTA 1XR3A 3MBIA 1U7OA 1P60A 1AXGA 3FE2A 2J87A 1QK3A 5EEGA 1XCBA 1DQSA 3OLQA 3LPLA 3KZVA 2FPGB 3OVMA 5FI5A 1TCCA 3PNYA 1RXIA 4MKFA 4EL5A 1PI3A 1Z5WA 3F9RA 4A8PA 5C7YA 4KYVA 3DC2A 4HD8A 1UZLA 2AQHA 2PX0A 2VK2A 3DEAA 3L6EA 4GF5A 4J0HA 4RDXA 3WL6A 1V26A 3ABQB 2B0JA 1ZN2A 1LBTA 2AEFA 2XGGA 3BXFA 4PLYA 2QZJA 4UUMA 5TGTA 5JSZB 1N36B 1X1TA 4KXLA 4R68A 2WC1A 2FX5A 3DTVD 1ZH4A 5A6SA 4JB3A 1PCXA 4DXHA 3NAZA 3GPLA 4UM5A 1PAUA 4UDNA 3TLGB 2R6AA 3LJKA 4DV0B 2VJBA 2EZTA 5HUHA 1XJ0A 1M1UA 1Y9AA 2PX8A 3FHCB 3PPWA 4HNGA 2RAVA 2PV7A 1GSHA 4G1CA 2FLVA 2TMYA 1BO6A 1G7RA 1XZFA 1IZ7A 2GD6A 2P2SA 5AKEA 3DZHA 3G1UA 4QQFA 4TRRA 3BGOS 4JOCA 5KYYB 2H7VA 5K4AA 5LMCA 5JV5A 1U3VA 2JD0A 2BR4A 3PWSA 2GB4A 1ULBA 3AVQA 4FIDA 5D86A 5FPTA 2CZGA 4ZIRB 1GO2A 1DV2A 2G07A 3PPYA 5IJ0B 1IY2A 1R0SA 1KE2A 3G0OA 1E2NA 2FU5C 1CUAA 4ASUD 3VZSA 5LDDC 1SBYA 3IUJA 1JIQA 5BWNA 2D06A 4D5EA 1GNPA 2VUSA 2BJVA 3BM5A 3AETB 1NLMA 1E1RD 1UWKA 3GAAA 3QI7A 2Y1XA 2NYRA 2PSDA 3BFXA 2I4NA 3QUAA 3ZTTA 3U44A 2V7XA 3SHTA 1D04A 3KJIA 1F20A 4ITRC 4MR9B 4RV9A 1ZINA 4W8OA 1LU9A 1Q7TA 3RS7A 1XZIA 5JYEA 4G37A 1RWMA 1XZMA 2IPLA 3FOBA 1S9DA 3SDBA 1R0KA 4JBHA 2QSZA 3CH5A 3VV2A 3DOCA 5EC8A 3TMKA 2JAXA 3N0RA 2X40A 2ZTLA 4S1NA 2JJ8A 5LXTF 3WYEA 4KH0A 1VXOA 4B6JA 1LLDA 1PR6A 2ZRLA 3C5CA 1JNXX 2J0VA 1N5RA 3T5PA 2E4VA 1CLEA 1YDFA 3RIGA 1RT9A 1T6NA 1CCWA 1OFUX 3PIIA 3OESA 4C7JA 4KQ1A 4DUYB 4BKRA 1FQJA 2Z83A 3FUXA 3IDZA 3KC2A 4RF3A 1DUSA 1ZN8A 3DC7A 5K3SA 4CW7A 1H65A 1ZGJA 3GLKA 4B75A 1WHTA 5EIBC 1R3DA 5COAA 4LNUA 4E5DA 4UMFA 2ZIGA 2QYOA 3D4NA 1JHXA 3GYBA 4B6RA 3ZCQA 4NJOA 2VKTA 3LTNC 2Q6TA 3D2BA 5DNDA 2IU3A 3O8OB 3BMQB 2YBDA 1Q1BA 2VP3A 3K35A 4KK4A 1SHTX 1SN7A 3BHNA 2DBZA 1RHKA 1XD2B 3FTDA 5IH3A 3T0FA 3A14A 1NMYA 3R8FA 1BRMA 1UBCA 1M2OA 3TRJA 5IJ9A 4LDRA 3NHKA 3IOCA 2XKJE 3MXOA 5ERYA 2PZ8A 3N6RA 2R1TA 1GTRA 5JXWA 1WB5A 1IZ8A 4RKWA 3BD9A 2VF5X 3N70A 3L4KA 2Q5IA 4OQPA 2WKPA 1MXFA 1E4OA 3EYAA 4CQNA 2CNWD 4ZC8A 3B6ZA 3BWXA 4P3NA 4RLSA 5EGNA 3CNOA 4HQNA 3A3KA 2Q4TA 3K96A 4EZIA 2D74A 1F3LA 3AM5A 4Q1CA 4WGGA 1TJYA 2XUIA 4KWIA 5DLYA 3PEFA 1VE3A 4EKDA 3BMNA 1HY1A 1UC8A 4DMHA 3F49S 4IRUB 3E4DA 4OBBA 1QKJA 1TD1A 3AEUB 2F8SA 3OA0A 3ZS9A 4G56A 1FXWA 1DT3A 2OILA 3L02A 3PGXA 4MI1A 3HV0A 3KEMA 4TV8F 1U1DA 4LRUA 2IBMA 3MQ4A 4ZQGA 3ZS8A 4QT4A 4HAOA 3NHRA 4YH1A 1R4MB 1PT6A 1SVLA 4GICA 3BMCB 4BFXA 1IY0A 4UJ5A 2HRBA 3RUPA 4CM9A 5KWSA 4DLWA 3D3EA 3MCZA 4A0HA 3EVCA 2YJZA 2V3VA 3R3JA 3W5CA 2QE6A 3R6DA 1T8YA 4L4UA 4ZDWA 4QBHA 4E7OA 1HDZA 1JSWA 3SHWA 1QWOA 2NZJA 1CY6A 4MVJA 1XA0A 3PIRA 4FBMA 2OMKA 3RGWS 1SVOA 5M34A 1JG7A 1EBBA 1WDKA 1DG3A 5D8DA 5FWNA 1N2EA 2QN6A 4PNPA 5AVKA 5KOYA 3CKYA 3G2LA 4K9PA 1BMFD 3VR6D 1KY2A 3C6MA 2PYDA 2ZB3A 3DP7A 1ZEMA 1E3MA 1KJYA 3PHCA 5BW8A 2IZOA 4DUGA 3L9XA 4UHHA 4YUZA 4P3PA 1ECBA 2WU1A 4KPUB 1UJ5A 1XJCA 3M6FA 3NG1A 1VMKA 5B2EA 1ATIA 4DSTA 3GROA 4EITA 1M1YA 1J8MF 1XZQA 5C34B 5L7TA 3RM3A 2WSIA 4KLNA 2BEKA 1TK2A 4C4AA 1X77A 3FWYA 1MX3A 4E4YA 2IZ5A 3D6VA 3WLJA 2P4QA 2ZVDA 3WY9A 3PNLA 4Q4HB 3CT6A 5E6UA 3WL3A 9MHTA 2VP9A 5HNKA 1OTYA 2JGJA 1V4BA 2E3JA 2P79A 2RHLA 4GZ3A 4MEJA 3PXGA 2FW6A 4MWZA 5JY1A 1JVBA 3ZVRA 1G38A 1P19A 1PR1A 2NUAB 1GARA 1NI3A 4OQEA 2PFKA 4RZ3A 1XTVA 3W2GA 1G6OA 2NXJA 3RAFC 1XTPA 1PQWA 2ADFA 1FF9A 3NNSA 1TYBE 1ZICA 2CE7A 2JRCA 2WIAA 3UBMA 3ITDA 1H0HA 1NF9A 3NHUA 4D9FA 5IJXA 2O8NA 4LQLA 3U3OA 2EATA 4PPYA 3ZQ6A 2HSGA 1WCWA 3H17A 4HQRA 1GITA 2XDQA 2QG4A 2FZLA 2Y1EA 1VFNA 2JEYA 2Y3IA 3HKCB 4MTCA 5KVSA 1YDWA 3KVOA 4HYTA 4OSOA 5CB4F 4LHZA 2B8JA 2H16A 5AW1A 2WWTA 4BNWA 3MOGA 1SWWA 5D00A 1HDOA 2FF7A 2VK4A 5E6RA 5B36A 5LR6A 3NOXA 7MDHA 4DV6B 3K9BA 3ZWVA 4GFDA 5DYYA 3AYZB 3T7CA 1IQPA 2ZZKA 1R6DA 3NCTA 3WLMA 1TAHA 5CG2A 4R9RA 3NWEA 4XVHA 2YW9A 5DHQA 3VR5A 2D2IA 1RBQA 3RTEA 5JZMA 3HXOA 4D98A 2W4IA 4FUQA 5ALQA 3CHYA 1C3UA 4HLNA 1W35A 4TS1A 1B6RA 3IMEA 1CY2A 1T2UA 3V4ZA 3VH1A 4YC7A 4Z4CA 1PJ4A 3GAZA 1N0HA 1NQVA 1KZ4A 3B20A 1E61A 3HRHA 4QUIA 4F3CA 4Q19A 4R69A 1C3JA 1ZLYA 2ADOA 2DKNA 4UREA 2Q7OE 1UMBA 3MTDA 4KXVA 1Y7LA 4PPGA 2WSBA 1H3FA 1VGRA 1SUSA 2Q4DA 4P35A 1YCDA 2I3DA 2HI0A 2VYND 2JAUA 3TSZA 3KLOA 3OE7D 1MQSA 2OOKA 3OZBA 2QMZA 3R5XA 1SJ9A 2ZBRA 4GLFA 3VR6A 721PA 2IIPA 4XIYA 3FYTA 5T4HA 3IMGA 3DT9A 2C4WA 4MW5A 1SHZA 4IIJA 1AGNA 1RI1A 2GJKA 4TVBA 1AV6A 1L4UA 1GGEA 1Q6ZA 2HRQA 3FCOA 1TM4E 4PICA 2F2TA 3VOAA 1U2DC 1AKUA 1E4EB 2XYGA 4ZDJA 4TOIA 1ZEJA 3VYSB 2H92A 4RPLA 2DLCX 3KBOA 1KAMA 1Z16A 2OHOA 5C18A 5GVSA 2I4TA 4MWEA 3HJUA 3BHMA 3A05A 1OAOC 3BRWD 4Y9DA 3GLFB 2R48A 3GRYA 4WK0B 2ZB4A 4GMHA 4EYGA 3THYA 3K1AB 1QO9A 1M1XB 3EQ2A 1NLZA 4P34A 1SO8A 2Q5OA 4LRYA 4PZEA 5IAJA 3NVKI 4N76A 4PU0A 2VYQA 4BJ5A 2Z08A 1RYFA 1ISHA 1P7CA 3WSWA 3SS8A 1UKAA 1QNLA 1WXXA 4EJMA 2HHHB 2YRXA 4YV1A 1FMFA 3F78A 4N9WA 2Q7DA 1RPNA 3CEPB 1DX9A 2VDQB 2ATIA 2WV7A 4HAVA 3RNLA 3T15A 3A2LA 4H59A 1TAUA 4AQYB 3IRUA 4G0PA 4K6MA 1W0KA 4OP1A 2PT9A 2OGWA 4QBFA 3ZEAA 3T3MB 3PENA 1F2DA 1V8PA 3QSGA 4DNOA 3U5TA 3D6AA 3A1EA 3IODA 3DAYA 4FU0A 2X0NA 3QYPA 4M1EA 4M7OA 5D3MA 2QNRA 3M1IA 2A84A 3O21A 3WK5A 1ODKA 3W2EA 1KZYC 4OYHA 5H4GA 2IOFK 3NYQA 4IJUA 3PX3A 4OMUA 4PIVA 3M6MD 4ZFNA 5BN1A 4F5EA 1WY7A 3P9NA 3ENKA 3TVTA 1A0OA 2NQ2C 3CLRC 5K3BA 1NW5A 1T2NA 3U4HA 4J7CA 3CLVA 1E1KA 3OSUA 3QNUA 2M6KA 4C6HA 4B7UA 2C95A 5JNTA 5KTYA 1L5MA 4P5EA 1NRXA 1P1BA 3CX6A 3H2BA 4RD3A 4UCWA 5DBFA 3LXMA 2DERA 4Q05A 4W5JA 3Q8LA 2QUHA 5ER6A 2PS0A 2AX3A 2EWMA 5CGZA 1ZM3A 4MS1B 3GJ8A 4COOA 3J81k 3AF6A 1FURA 4ZCQA 2A7XA 3EUFA 3C6XA 3KB2A 4F3RA 4I1OA 3EUWA 1DTWB 4OH7A 1RLJA 5B58C 3HJRA 3LKZA 2QZSA 4DT1A 2ZRDA 1LK0A 2IYXA 4IF6A 3W8RA 1CS0A 1WNFA 3KZNA 3U3JA 4RK5A 3RVLA 5H83A 1FFWA 3TQQA 1OC2A 1USVA 4GWKA 4JQOA 4E33A 5HIIA 4F92B 2CCKA 2W2MA 1VIYA 2P0EA 4TVSA 5LUBA 2KS6A 5IBCA 1KE1A 3ESBA 3ROTA 4HWGA 2JHAA 3QUTA 5DEOA 4MYDA 4R83A 5KJ6A 5DHAA 3ZV3A 3RSQA 5FV7A 2H52A 1MBZA 2B98A 3WV4A 1KH2A 2CB9A 2F1JA 1UFRA 1T4BA 5IT9A 5EXSA 1T1GA 1X7XB 4QHYA 2DEUA 1IWBB 2O54A 4DQVA 2DZDA 3I52A 3SJCA 5IM4A 3EXAA 2XX3A 2W8ZA 3UA4A 3NWOA 3U48A 5JS7A 1W9HA 4L07A 4HBZA 4IHKA 1EINA 5FPYA 5TPZA 3A3OA 4CL0A 4ZHQA 2L2QA 1XE3A 3O74A 3KR2A 2WJPA 5AKXA 2QX6A 3EVEA 3GVIA 3UB4A 3QXHA 4M1ZA 4C9BA 1APBA 1PFYA 1ODLA 3AIMA 5CBPB 1WKVA 2HBYA 4EAAA 1YZKA 3HB7A 4TT3A 3UT5A 4Q3OA 4WGFA 1JT2A 4JUIA 5E7JA 5G40A 1WR8A 2L42A 3KG2A 1NP3A 4X84A 2G5TA 4L4XA 4GSLA 2XTNA 1E32A 1L7XA 2Y0DA 1NXXA 3TXYA 2P27A 1YVPA 2GM5A 4X71A 2W00A 3EGDA 1Q0PA 3AG5A 1JBEA 2IXTA 3GGGA 4KIFA 2IXFA 1Q91A 2GBLC 4GIBA 3TNDA 2HA7A 1ISPA 4ZHQF 2HHAA 1DCNA 3I37X 2RI1A 3GRZA 5AM4A 3WIBA 3IBCA 5IU6A 3KD2A 3GA5A 5FF9A 4KL8S 1C8VB 3HYRA 1E8MA 4M98A 4G41A 5EEHA 4ZU1X 3UKJA 5JD4A 2AZXA 3F3MA 5NLLA 2R97A 1EHCA 3AUTA 4Q4CA 1N6KA 3WLNA 1U90A 4F45A 5FL3A 4OH1A 3QNWA 2Q46A 4RTJA 2JK1A 2HFJA 3X1DA 4F7DA 4CKEA 4ZAFA 3FYDA 1NQWA 1OU4A 1L4EA 1W1IA 1GQYA 3WRXC 1QH8A 1T36A 3TNFA 4JJ6A 3SE0A 2PUWA 4RHTA 3WGTA 5CIYA 3DZCA 5DYGA 2IYEA 2RHCA 3I5AA 4AUNA 1E2IA 2Z5LA 1Z0ZA 3QXXA 1MX1A 1GKIA 5KWIA 4YCSA 1HM5A 3T9FA 1RW4A 3C6QA 3W2IA 2P9GA 3AF5A 3PRKE 4A6XA 4B34A 4C7OB 1C4OA 3LUBA 1XX6A 2GM9A 5KYWA 4F2PA 4U4AA 3AOGA 4MVCA 4HXFB 4P3YA 3RYIB 3DMRA 3U7IA 3ZWDA 1CR6A 4DRXB 2JHFA 4Q9LA 1Q5PA 4C5CA 1J23A 4JDUA 3LECA 3V8MA 1XDBA 4H4EA 3TW6A 4BMXA 2R60A 1FTYA 2GBGA 5B3KA 5AMXA 5FD8A 3QWFA 3IL2A 5K3OA 1JI3A 1ZI9A 3PYMA 2QDKA 3BF8A 3D7SA 3FYHA 3IPXA 3QLUC 4A6DA 4C4RA 1ABFA 5T3UA 5C5CA 2JCYA 3TLJA 3P2JA 3DDHA 3H97A 4OHOA 1F38A 4F72A 1V6AA 4KXFB 4P0QB 3TIVA 1KPIA 2VHXA 4B3IA 3L4SO 1F1JA 4HDSB 3R1IA 2QRHA 2ZI3A 3AETA 1B4DA 1NLFA 7AT1A 3Q3EA 2A9OA 2NADA 5HEKA 3A1TA 4P7FA 3I8SA 5L95A 3TGLA 4OHVA 1VDMA 1Z0FA 3DWFA 4NCJA 4QBGB 4QRIA 5KWEA 2IS4A 4I1SA 2HJ9A 1Y34E 2ENUA 1WMAA 2YWEA 1XDDA 4KMSA 2R62A 3OE4A 4WPGA 4P7BA 4RMIA 5C81A 2F1IA 4U5XA 4RPHA 5FOTA 1QIMA 5EE3A 4QJ3A 2IX3A 4X62B 2C7RA 4BX0A 1FSGA 1G16A 2BFBA 4HFMA 4WOCA 2RCYA 3JAKA 4YUVA 4UKDA 2M1ZA 2FOLA 4R7TA 3D7KA 1THZA 1RRKA 2AVNA 4AROA 3ER8A 2OFWA 1RQPA 1LVUA 1VLMA 3GQBA 4HWTA 4H6VA 4JC0A 3ZBUA 1R8YA 3ZCPA 4BO5A 4KOAA 3FOWA 1TQDA 2IUFA 3H2IA 3N9IA 3K0AA 1DPGA 5DHUA 4QFCA 1LPOA 3DMNA 1Y3CE 3UAGA 1R4MA 1V1RB 1XG5A 5A3JA 3TN7A 1AZSC 2WAYA 1N8SA 1GOTA 2I0FA 3SXJA 1E2JA 4DEVA 1LJUA 2WK1A 3OETA 5L40A 3ZK9A 5ADWA 1QONA 2NUBA 3AEUA 4OXRA 1FP6A 5KJEA 4TV9F 4B3GA 5AK3A 1I1QB 2O8VA 1DGQA 3L0YA 1VTKA 1Y1SA 2BEVA 2N47A 4HAYA 3ZHXA 5IMSA 2VRWA 4YXWA 2ZQYA 1MAWA 5G3YA 2FZKA 4PS1A 4BQOA 1RAIA 1LRJA 1NW3A 1RC1A 4IG9A 4OQQA 1WB4A 2BCJQ 3P0JA 3IIMA 4ALJA 5K7SA 5ALVA 1EFVB 2GD0A 4H4DA 3CZMA 3SC2A 3VKHA 3KRTA 1L5YA 3PVCA 4FDLA 1C9EA 2BFDA 1Z28A 5DF1A 3OQOA 3PWZA 4C01A 4Z1MD 3L8MA 1AUVA 3FH0A 3WB1A 3ZZNA 2WSYB 3L7LA 2XXAA 4D79A 1PWEA 2NZ2A 1K66A 2AG1A 1V39A 1NV8A 2JI9A 2C58A 2CVZA 2Y77A 3ZDXB 5BSVA 4RCVA 2CDBA 3RRYA 3T4UA 4J29A 3H7IA 5BR7A 2NQ8A 2QQ5A 3AR7A 3CUVA 1EJ6A 4BO2A 3JVEA 2I7CA 3COJA 1ORRA 1MTZA 2PKQO 4EGFA 2ECKA 5IKXA 5K05A 2RHHA 4YJFB 3G0BA 2BISA 3HJTA 5C1PA 3LHIA 3I9OA 3QPCA 5HA5A 1W59A 3BZUA 2D13A 5JVDF 3F4RA 4DE5A 3GH3A 4ZN6A 3EWSA 4R2MA 3DP9A 4ZKDA 2IP2A 3M6LA 1HPLA 3EEBA 1GAJA 3Q0IA 5JEEA 4F3TA 1KYYA 2YWRA 3K09C 1MC4A 1W49A 3KQTA 3MC1A 4OPMA 3I4FA 3E9RA 3LVQE 2FWAA 4PQFA 2WU3A 4JAVC 1MT3A 1NJSA 1U3CA 2FMTA 1E62A 4JYBA 3LY7A 5F91A 2QUKA 3AP3A 3RNOA 3UJCA 1KQ3A 3A3YA 1Z2AA 3MJSA 3FB1A 4GRDA 4UHCA 3R9XA 1NW9B 1OREA 3LGAA 1HLDA 4HYYA 1K7EB 5EQTA 3L7KA 1RE5A 1J8QA 2D54A 3R76A 3ZHSA 1W25A 4XPZA 1TUGA 2VXYA 4OD0A 3UVEA 3UJPA 4EIWA 2JBAB 2IH5A 1O4WA 1IEVA 1SD2A 2GN6A 4L08A 1BC5A 1J39A 1AQLA 2V5AA 1D2CA 2HH9A 2BLNA 2PJUA 3H2JA 1M6EX 4WZAA 5AP9A 3OQIA 3U3KA 3BGDA 1FJHA 2AVDA 2C5EA 1DO2A 2VTEA 2Z5GA 1IL0A 1I2AA 4J91A 4KAFA 4X6XA 5T4EA 1TTHA 4BHTA 1R6TA 3OZCA 5LOVA 1BX0A 1JA1A 1U1GA 3F98A 4GQAA 3M83A 2VHUA 4KDCA 4UFNA 1NNEA 3UXHA 1Q19A 1JDVA 3GEPA 3IIEA 2BMEA 2YHUA 4PZDA 4J4HA 3MD9A 5EZ6B 4F6CA 4I1UA 5F5XA 3KTAA 1F06A 4FYVA 4NCXA 1AE1A 1ZBQA 5AO9A 4BJ3A 5LQAA 4W9MC 2FUNB 2JI4A 3EF1A 3TRIA 1U0JA 4E0BA 1WZUA 1MP0A 1OIVA 2IHZA 5E2IA 1VB3A 4QLOA 4HATA 2BFFA 2DBVO 2UYGA 3LC7O 2JKVA 3UCFA 1I8TA 1Z4MA 1YTUA 5P21A 3HKDB 3RVKA 4N48A 1Z62A 3RI3A 4MVJD 1SU4A 3LQRA 4RDIA 4XX1A 2EDAA 3K53A 1CR4A 4N5LA 1RI5A 3TKAA 4KWCA 2BI4A 2JW5A 4AMUA 1G9XA 4HS9A 4YRMA 2Z6AA 4IILA 4HH0A 1ZSYA 2FW9A 4GS5A 4BNKA 2FEWB 2I29A 1KYQA 3A25A 2HMYB 1C7FA 2IJGX 4DYDA 2ZBVA 3R44A 4Y2SA 4HAXA 3F7MA 1UBTS 4AN4A 1ZI8A 5CFZA 2PWAA 2M6RA 1SZPA 1TYEB 4M4SA 1OKKD 4V1CB 3RJ5A 3EVTA 1NNLA 1KJWA 1BE0A 2P5UA 1JFFA 1R16A 4WXEA 4CHTA 2H59A 1IFXA 3C6BA 1NMZA 5H3CA 2DC1A 3K1AA 4RHYA 3CUYA 3SX4A 1ZUNA 3LPCA 2PU5A 1Q7BA 4GLOA 1FLVA 1LI4A 4QDOA 4WTOA 2DF8A 4AKIA 3BC1A 5PNTA 3UANA 1Z2OX 4OLJA 4HFNA 3CO5A 1GQFA 1I1OA 3LW7A 3FPEA 2Q41A 3QLJA 3OQBA 4MMZB 3WKDA 4LXGA 1MJ5A 3V1MA 4EFDA 5LP6A 3G89A 2EKPA 4Q4LA 3F6BX 4YBRA 5DM0A 1NXTA 1Y82A 4RY8A 1V8OA 5J2TA 1GKYA 4WLOA 3L7CA 1ZD1A 1PNRA 2FCAA 3WGYA 3DXXA 3JAWB 1AY0A 1M10A 4CM3A 5CVDA 5KC8A 5COQA 3RRFA 1TTTA 2HLPA 2V5UA 2R65A 4J03A 5EHIA 1G19A 1Q17A 4UMVA 4YO8A 4DPLA 5IMBA 4WZAB 4Z2YA 1YCFA 4X94A 3LKDA 1IIRA 4OJYA 1ISGA 4G1EB 3AFMA 1WD7A 4DOMA 2QSJA 1U2RA 3NWPA 2VQFB 5ALSA 3CJRA 5KSWB 4JX8A 3GJQA 5DP2A 1JTEA 3T7EA 2QMYA 3HDYA 1S6YA 1B2LA 5EHGA 2AFRA 3O3NB 3ZHQA 3OE5A 3RIYA 5JAZA 3O2SB 1GTSA 2BFOA 4C5BA 1XEXB 1L5VA 9ATCA 3DCNA 5CB0A 3QLEA 3KPYA 1PG2A 1U8TA 1NXQA 2HPVA 4J9VA 4IIFA 4I9GA 4JB8A 4G8BA 3B48A 2FPLA 2NOAA 4TQGA 4E51A 3DZGA 2EYQA 3RO7A 4WV3A 1ZM9A 1G66A 2F1KA 4EF5A 1KFKB 4F2WA 5K8JB 2MTBA 2IU0A 1M2HA 1PLKA 1WA5A 3C3XA 1P6QA 4RANA 3GO4A 5IKOA 3EIHA 1MFPA 2L0XA 1PR5A 1U0EA 3AZQA 3DEIA 4XIFA 3WYGA 1BWSA 1K8RA 4C30A 2QTRA 1ZNXA 3MWFA 1XVLA 3H8WA 4RIHA 1W36B 3D7LA 2EOAA 3R9XB 1QRDA 1YNOA 2FCRA 1P0QA 2ODWA 1L5QA 3PD0A 4PLZA 4QDTA 1ZJ6A 3QEMA 3HLTA 4F4DA 1M72A 1UBUS 4TQAA 2DJ5A 4M9ZA 3NAGA 3U37A 1LC3A 1YDMA 1EQUA 2WTMA 4LC0A 4LRWA 1LB1B 1QRAA 1M8JA 9LDTA 1SBTA 3B9RA 3LQQA 4NZZA 2DRIA 3SZOA 1NVEA 4D81A 3T7JA 2GCOB 3VTKA 1ZHFA 3WWYA 1MPXA 1EDDA 4KVFA 3IBFA 1SXJC 1YXMA 1THTA 1ES9A 2GZDA 2EP8A 3CRZA 2PGAA 4LK3A 4NZ9A 1OW3B 2PD4A 3GRKA 2I03A 2OE2A 3IJEB 5F52A 2OXIA 4D02A 4TKLA 1MW8X 1QAMA 4LUCA 3T7AA 3PEWA 2J5QA 1MOZA 3NNNA 4D46A 1GGVA 4BNNA 2QL7A 3I62A 5CBPA 2FQXA 2IHTA 4B84A 5J1TB 5B57C 5IM5A 3VNUA 5IDQA 3UT0A 2WSSA 3FF1A 1SU7A 1VHLA 1Y3FE 2CF5A 1D3AA 1XU7A 1I3MA 2HLDD 2WUDA 4FYPA 4TRNA 1O95A 3N28A 4PZAA 5KEIA 1U04A 3QY9A 5DE3A 3R24A 3QHPA 2UZ3A 4RYDA 1T0IA 1FBNA 3T9EA 1VI6A 1ZNQO 1DKRA 4MB0A 1N6HA 1ZR2A 2GN1A 3LHKA 4O5OA 1N8KA 3T4EA 3DE7X 3ZC3A 2X3FA 1I4TD 4XUGB 4RULA 2XCQA 1O58A 5LQRA 2HK7A 2JBWA 2AR7A 3STWA 1V7CA 3PXXA 2EIXA 4TLDA 1I2ZA 4IGFA 3NHLA 4ND2A 4ARBA 3KOXA 3LHSA 3SFTA 4IRXA 1AKMA 1N32B 1HRDA 3DCIA 1DQZA 4WUVA 4IMRA 4WINA 5JWRA 3QVUA 3UKOA 5B4TA 3S3TA 3NBQA 5AI9A 4NWIA 1UK6A 3OFVA 2W6NA 3EQ9A 4ZQEA 4TWIA 4CMCA 4YMWA 4QBIA 5I6DA 2PUFA 1MO2A 1JEQB 3UWPA 1UDBA 1S8NA 1VMIA 4UU1A 2BBWA 3I34X 4AVYA 4QYWA 4LW8A 2AWNA 1ECLA 3AEXA 3RS0A 4CCYA 4Q4DA 5A7HA 4K87A 4YRTA 2R3SA 1AO0A 4ZJZA 1CEQA 3ZWAA 1Y4AE 2Y1GA 3OKPA 1G1MA 1W5AA 2RGYA 5FLKA 2KSQA 3OKCA 1ZXXA 3OPNA 2MIIA 4HEQA 1P7VA 2PLNA 4KMOA 4L73A 3EXIB 1T9ZA 2XYHA 2IW3A 1WQ1R 4MA4A 4QT0A 4KJXA 1J33A 2GZRA 4H16A 4KMRA 5KYUB 4RC9A 1Q3HA 4NBRA 5CVCA 3QIAA 1KYTA 2PVPA 2HTEA 2WA1A 4CF5A 4O63O 3UMBA 5I7EA 1C3LA 3EA4A 1KAHA 1OH8A 3IUMA 1Z6XA 2B4QA 2OGZA 4MWSA 2UKDA 4H27A 5FCDA 1YMQA 2JAQA 1ZGAA 2RJOA 2RHBA 1LY1A 4FBGA 5DYIA 5DW3A 1PZEA 3R3WA 1VBKA 3JXEA 1SHJA 1TUBB 5FHQA 2V7QD 3IUBA 4HH1A 4ZHSA 3KAPA 5CB8A 2JD1A 1UFQA 1VLHA 2BFNA 3SC6A 2O1XA 2HSZA 5JNVA 1XYYA 2H48A 4I2VA 4LWPA 1CY7A 5HF5A 2OFFA 4I3FA 4C4XA 3EFOB 2AJ8A 5E6RB 1XF1A 4BWFB 3I30X 3ZV4A 1QIKA 2JGFA 2F64A 4KEAA 4R1UA 1XWFA 2DHCA 4UU8A 4MQBA 1B6GA 3VPGA 4EUFA 1WBDA 2J4FA 2X2PA 2C59A 2LRHA 3PJDA 4KP7A 1SBIA 1I9GA 2EHDA 3AC0A 4KSYA 4D41A 3A4LA 4X24A 1DO8A 5KYXA 4MDYA 1XP8A 3G6KA 1E94E 3DE1X 1NQTA 5KTKA 4IOJA 3WIOA 4ZOLA 4JI7B 5CYGA 1A8SA 2COKA 4TZ6A 3VYTB 5DN9A 5JSQA 3WKCA 2FFBA 1L8LA 1O54A 2NV6A 1U2QA 2OB1A 2XD4A 4HOYA 5AW5A 4YQFA 3C0KA 2FPUA 4PAQA 4TMTA 2SHKA 5KQLA 1I36A 1IMOA 1JRLA 1XDUA 1Z7EA 2M2IA 2ZROA 4MPJA 3ANMA 4YJKA 5JUWA 3L7YA 3DA8A 4HP8A 4MHSA 1LDNA 1LV8A 1V45E 1GPNA 1OLXA 3LQKA 1YQEA 3ONNA 4LJ9A 4EZBA 3KEQA 2O14A 4R1TA 1IIBA 4L8VA 3ET5A 1XTIA 3G9XA 1F17A 3MAAC 3MJCA 3M3DA 3FOCA 1RJFA 4MRVA 4IP0A 4BRUA 2YVQA 3ZGXA 3LRXA 1O1YA 3FNHA 1E0SA 1ZXBA 2BFCB 4DA4A 1IB0A 2NXEA 4EDFA 3R3VA 1R2QA 1W5BA 1AUWA 2PGIA 4CLHA 4G5FA 3OJLA 1FFEA 5BMVA 3G5LA 1L5NA 2A3RA 4N0MA 4I4NA 4EJ0A 2WAOA 3KB1A 4A0GA 1SNYA 2NZXA 5KYYA 2QB5A 2REQB 1FYFA 4R7GA 3SEAA 5JAMA 3UTCA 4LNAA 4MV9A 4D92A 4EB0A 4M1WA 3IT0A 5FOVA 2J0UA 5L3RA 2GN8A 3T3EA 4PYIA 4EA9A 2QBYB 1MJNA 2QTWB 3OZRA 4RH0A 2QN1A 5ALRA 4PBSA 5FPSA 4YCLA 1DG1G 3N76A 3CZRA 3KV3O 4X20B 1N0WA 4ZJUA 3MRVA 5CFNA 4HAZA 4E1AA 2C9CA 1W0JA 2J9GA 2JGDB 1HDGO 1CR0A 2FRXA 3IB6A 3PP8A 1GYQA 2J5BA 1TJ3A 1X39A 3C97A 4WBSA 5M2QA 2V0NA 4ZCPA 3HUDA 3HKBA 1E2EA 2JS7A 2O2DA 4L16A 3BB3A 4P80A 5EIHA 1LBQA 3RT1A 1SIWA 2A6PA 3U3ZA 2R6R1 3KOMA 4GSKA 2JLSA 1X19A 1KVTA 3KR1A 3NOVA 3H1PA 4N8EA 2B1JA 1VA5A 2XRFA 2AJLI 2GJAA 1KYZA 4K6CA 4MV6A 3TOVA 1E3SA 1TMOA 4CR8A 2WYHA 3EODA 1E96A 4ZPJA 4IJ6A 2GOYA 1XZAA 4ZEMA 4NSLA 1IB6A 4R01A 5CLJA 3A9TA 3HJFA 3OCVA 4YRCA 2Y1WA 4IDGA 2XTJA 1PL0A 3AERA 2Z8ZA 1Z2PX 4S1VA 3UK6A 4BMVA 4ZCSA 4EI9A 4GVLA 1DHTA 1P4SA 4KR6A 4C2UA 2L69A 3JAWA 3UJNA 2RSLA 1NUHA 1ZN9A 3RADC 3ELUA 4A27A 4ESOA 2YV2A 3ER9A 1O77A 1ST2A 5E6SB 1OYWA 3U44B 4RBNA 3NHBA 1QIDA 1T43A 1SUPA 1DX4A 1O9BA 4CNQA 5C2JB 1L8AA 2ID4A 4Z7OB 1IRIA 3N53A 4HN9A 3CH6A 3L6DA 2MYNA 3FIJA 2GESA 1Q50A 2YW2A 3DNFA 4CU5A 5EIXA 5C5DA 1QDUA 2PSHA 2QP4A 1MVNA 1P3JA 3H5AA 1MAAA 4KDFA 3NTQA 5LVAA 4RELA 5MGNA 2PWBA 2OV2A 1SA0B 1W96A 4AO7A 2PX5A 4BNLA 2PFGA 4JQCA 3ZY6A 2IX9A 2OM6A 2O5RA 2ZPUA 4C1BA 5IXYA 8ATCA 1L7AA 4LGVA 2FOIA 4NG4A 5JWHA 5E2BA 3ZK7A 2FPRA 1CZUA 2JBHA 2D59A 4UHEA 1DV1A 3E9YA 4JQSA 3LRTA 5KI6A 1D0VA 1HYGA 3X44A 1GRNA 2GMWA 3OT1A 2OBFA 5IC6A 3WWPA 1FDIA 4LF6B 4N6NA 3C4VA 4PCVA 4PRZA 4XUCA 4BX2A 3TJZA 4AF6A 5SZIA 2QAGA 1VRWA 1HXHA 4EPWA 4W6ZA 3DUFB 5DLEA 1E0AA 1HFJA 3JVDA 1YD7A 2DUWA 4QXOA 3PFHA 2I9KA 2V0GA 3LOUA 3E05A 3ICPA 4UTVA 3FOAA 4RL4A 2ZVPX 1PZMA 4HQKA 5TMEA 2WJYA 4YAFA 5K8IA 1RTTA 3Q5DA 3JQPA 1EP3B 1BCSA 1LNSA 5JROA 1J0CA 1GV1A 3ANLA 4P4TA 2CLHB 1E9EA 4Q9NA 2ZVJA 1BTOA 1FFXA 5CPBA 1C5KA 1FOEB 2H4XA 4YCNA 4IX9A 4X7PA 2BKUA 1EUCB 2IP1A 2YWCA 4CKCA 4MINA 3CUTA 4IHAA 4NDAA 5CIWA 5AHKA 2ZLBA 2HA0A 5ADVA 3WC4A 4Z0HO 1SZJG 5HSGA 3QMPA 3K0BA 1O3YA 1SBNE 4JI3B 3WGHA 3Q7TA 3D64A 3T5CA 3RYHA 4P2GA 5CT5A 3ZQJA 1TF2A 4PR3A 5IBPA 3TYXA 1M0TA 4AMBA 2BFEA 1I24A 2GRUA 4CDMA 3TINA 1NRWA 2NAPA 2HF2A 2YFHA 3F47A 2G72A 3FVVA 3P4UA 5T3YA 5CA0B 4KO1S 1T13A 2CJFA 2WIJA 3DLTA 5JVDB 5C4MA 5A03A 4JR0A 1NVFA 2V65A 4C08A 1W4AA 4Y2HA 5JNSA 2RARA 3RIXA 4Z3OA 2PUVA 5CAEB 1U3DA 3OUZA 4C20A 4ROSA 1JQBA 2X0DA 2XLBA 4JP1A 4X60A 3MGKA 1SBZA 1VYUA 1WTCA 1YAJA 1ZAKA 4KVGA 4G4SO 3EUEA 4MVJI 1MEJA 5H16A 3NHFA 3S2EA 3ZXUB 2P0YA 3NJRA 4XDHA 4EB3A 5LDHA 4ENSA 5I45A 2HBZA 2OEPA 5TR9A 1DNPA 3TCKA 5CX4A 5LN1A 1L2TA 2B3DA 3GLGE 1RNLA 3B13B 5EP1A 1F9EA 5L3SA 4ZT3A 5AWFC 3RTGA 4DLYA 1RM3A 2XA2A 2JIMA 3UPUA 2PSSA 1XJQA 3MN1A 1JN0A 1TQHA 2GF2A 2PZEA 3KQPA 4RVCA 3VHRA 1RXWA 1F2TB 2H7CA 4I55A 2EBFX 3C1AA 3I8OA 4KQ9A 4LZOA 1AZLA 2GCGA 4MOWA 3AXSA 2I7VA 4BMYA 3Q7SA 2CWDA 3HACA 1L3BA 3GN1A 4AJPA 1PL8A 2FSHA 5JNUA 4QREA 2GHIA 4EPVA 2VXOA 2Q49A 4NRDA 3REGA 3K0FA 2NUAA 1Z5VA 4KUHA 4YRSA 1FZTA 1L7RA 4XQEA 5A7FA 1QO0D 4HADA 2CXUA 4ALIA 1HG1A 2OYRA 1Y0BA 3G6WA 2ZOSA 3WAJA 1N0UA 1UK8A 1BXGB 1A7UA 2DWQA 1EP1B 2X9VA 1T4CB 2XSZD 3QWIA 1GPUA 5EE1A 2EGGA 1MRNA 2QRJA 4U0JA 2R8PA 3OM9A 2Q3LA 3WLPA 3EC1A 5IYZB 4MH0R 2XPCA 1RKXA 4X92A 1I3CA 2H07A 3UJ9A 3KSZO 3LDHA 1JKMA 3H84A 1I7QB 3JWIA 2AEEA 3E2PA 3FAKA 3OIYA 3V4PB 4HRAA 3TRKA 1PWYE 3SEFA 4DUZB 4I3HA 1KQPA 3CINA 3NIBA 3TQTA 2DCMA 3GPCA 3T0GA 4GPEA 2VJKA 3HL4A 3O84A 1NXOA 4Q1FA 2Y05A 3OC0A 5FWYB 5JE8A 5KDLA 5JAOA 3WK6A 2C2OA 4O4LB 3SOZA 3FLBA 3P71T 3E7DA 5DLQC 3R7LA 4C3ZA 4QGSA 1QV9A 2O4UX 3MK31 5K3FA 2BHSA 2B35A 2BH9A 1OT3A 2F43A 3G2JA 3IP3A 3QE4A 4DF3A 4BQIA 2XB6A 4US2R 4OJMX 4BP9A 2OB2A 4N0DA 2EW1A 2FX3A 5IN4A 4V2UA 1QHEA 3LLCA 4PGHA 3A9SA 4Y2GA 5BPHA 2IIVA 3AV0B 4G89A 3QOXA 1DBRA 2W7TA 5D3QA 3OZGA 4NONA 1J1ZA 2J07A 4G24A 4GPIB 3MTJA 4TXNA 4Z9FA 5BN4B 3MVEA 3IA7A 4MP3A 1ESEA 1LCIA 3BQMB 3PDUA 3QJ5A 2PIDA 1ZCFA 1DCTA 2GZ1A 4C29A 3BH7A 1PNOA 4PTLA 5CFPA 1C81A 3L8GA 4YHBA 1YJ8A 4FXPA 4RJJA 1J49A 1V1RA 3R9IA 3RVSA 3V8NA 2HIMA 4HYEA 3VO2A 2FUG1 2W6JD 3HO8A 4C0QC 1KP3A 1XUOA 3G8AA 1SCAA 3V8RA 1YB6A 3K9FC 5DT2A 2BM0A 3DMTA 4ERXA 3C4QA 3N2ZB 4MHTA 3CKKA 5TQ0B 3CPSA 3SQLA 4TV9B 2G28A 2VSYA 3CN9A 3RJTA 3H2ZA 4ZO9A 4JLOA 2VVTA 1VI5A 2NO0A 2PLWA 5ENVA 2QUAA 2O8FA 2C4KA 1GAWA 3KHTA 4WNYA 5CRIA 3BSSA 4ZV9A 3TLEA 2EGHA 4W1QA 4ZRMA 4QO7A 4ODIA 3SI7A 1RZVA 3IDSA 1SXGA 1C0LA 2NAFA 4ZK6A 2EJBA 4G67A 1RWVA 2JGLA 3GELA 3QYAA 2C4MA 4PYJA 3K7EA 5A9TA 2IXBA 3P96A 3VNBA 3Q7QA 4CLDA 2QN9A 5JDIC 3BICA 1SXPA 1V9CA 4ECEA 4LMRA 4RV4A 4ED9A 4F4JA 3CVWA 2HMWA 1J1IA 4MGZR 1QK4A 1A2KC 1X2EA 2C3UA 2W58A 2Z8YA 2Q5LA 3GFOA 3P26A 4FXOA 3T3PB 2NTYC 4ALNA 2JAOA 4TTAA 4NAUA 1IN7A 1U8XX 2VKQA 2H5JA 3BZBA 2VNKA 3ECCA 4Q7EA 4X65B 5I4KA 3OQ1A 1JQ3A 4KBGA 1Q1EA 1NXSA 3H1TA 2XUKA 3K0CC 2HUNA 1EH5A 4KXYA 4ID3A 4BN0A 4D9BA 3KAJA 2PTGA 1PG5A 3N8NA 2WA2A 4NK5A 2NTEA 2WVHA 3G0CA 4RDCA 3G2OA 2BGNA 3D4PA 4DLXA 4OI0A 3WGMA 3G0GA 4R2HA 4FKZA 2W0SA 4FZJA 5EJ5A 3T1HB 3F74A 1CUDA 2D1QA 3Q5EA 2R8EA 1WEKA 4TS9A 2QZZA 2DR2A 1BFUA 4CCWA 1YZGA 5FUBA 3ZDFA 5JSUA 1X70A 5C3UA 3ZJVA 5IABA 4V0ME 4P7KA 2X0RA 2HL6A 3RD5A 2C2HA 4YAKA 1D6NA 3IX7A 2XAUA 1EX1A 1FNBA 3QKUA 1ESCA 2HCFA 2VTDA 4ZEWA 1T9AA 2W37A 3LV8A 3R4VA 3ZU2A 5AVZA 4EL0A 1EFDN 2CWWA 2DUJA 3P5SA 4BVFA 4U8HA 1OQAA 1CTQA 3U6BA 3ZWKA 3EVBA 4KIUA 1YE3A 2I4OA 4AN0A 4BKUA 4ZGWA 1GZSA 3OLYA 4NKRA 4OTZA 1DKUA 2NU8B 4UTNA 1U31A 1MO6A 1YOVB 1RAHA 1T91A 5KNDD 4JSRA 4JYPA 2J6BA 1ID8A 4BLWA 4YRQA 4ND8A 3DEYX 1YZFA 3W5SA 1WL8A 1R5OA 3IPAA 1IBMB 3DT8A 4Z9YA 4M7WA 4GWGA 3CH4B 5BN3B 5TQ0A 2AV6A 3AFGA 4B45A 4BV9A 1K6XA 4EHKA 1JJBA 2WBLC 2NUTA 1QLWA 1YQDA 4JXJA 1TTQB 2VBFA 3FCCA 2UZIR 5TQVA 2ZR0A 3IJRA 5JDIA 3GBVA 1QAQA 1A27A 1QCYA 5B6IA 1C3OB 4CIAA 2FPIB 1A9PA 4RKFA 3MYYA 5AI0A 4BP3A 2WD7A 1VPEA 4IFEA 3A27A 4GQIA 4C03A 4NJMA 4JC4A 5AI6A 5A3SA 5KJ1A 1EQAA 3I42A 4CKBB 1LNQA 4YRPA 4ON9A 2JVIA 4PF1A 4E14A 2AEMA 5ITWA 3OUUA 3CX8A 4PNHA 4OMDA 1O03A 4YT8A 4ZODA 3KETA 5L53A 1PTKA 3DFZA 1Y6RA 1JLMA 2X8BA 2QVXX 2FNAA 2G9UA 3H05A 5TY0A 4MKIA 3E8MA 5C8DA 2QD5A 3KQUA 4RY0A 1LBSA 1TD9A 3WIUA 4WXYB 5SY4A 3SYLA 1PSZA 4AB1A 2ZE6A 3R0IA 5JWOA 4ENUA 2FEAA 1M9NA 3C45A 2Z3WA 3G79A 4PSKA 1QCCA 5EIOA 4I5GA 5G1PA 4YJGB 5IP5A 5EWJA 3UOWA 3F6YA 4JROA 4MJXA 1NONA 3SR3A 3T9AA 1MV8A 1UANA 1GPKA 4D43A 4D8WA 1Z29A 3TTWA 4J3JA 3MLEA 2P3SA 2FFHA 1ISFA 1P2GA 2NU7A 1EFPA 5LQNA 3ZXSA 1YJBA 3DM5A 1QF9A 3N0WA 3OPXA 3FI0A 4MZDA 2PCLA 5FQOA 5ECWA 5DM60 3SMVA 2Z3VA 1FUIA 2VCYA 3PDJA 3L49A 1JFSA 1HT2E 4LHYA 4CEJA 5J40A 1HE8B 2QXTA 2EW8A 5H3HA 1FFAA 1OSNA 2DQKA 2AC7A 2D62A 3E0QA 3OP1A 2FZCA 4LV8B 1P2UA 4YUYA 2BE7A 5LM3A 2ZSHA 3HFJA 3HS3A 3IXLA 4Q82A 1IN8A 2E9FA 1O7JA 4L4RA 4YREA 5CD9A 1WMBA 2ISCA 3IBSA 4Q9AA 1RC0A 1U9CA 4YECA 1V5WA 3U5ZB 2PKWA 4AJEA 2YWJA 1C7ZA 1LBIA 2CJXA 2SCUB 5TMDA 2XSZA 3HDVA 5K2MA 2XUAA 5CJJA 1DB3A 2IOFA 3B3GA 4G5XA 1CNMA 5DM1A 3TD2A 5JNRA 2WQ7A 1N7JA 2YJ6A 4KAAA 4D8UA 5ALXA 5AM2A 4B48A 1WU8A 4U7PB 1BU8A 2MWMA 2WHPB 3WBFA 3I04M 3QJYA 8OHMA 2JIRA 1YU9A 4MV8A 3UHPA 3ACBA 5HM6A 3JD2A 1G3QA 2FKAA 2ZUCA 3CSUA 3IEPA 4L5JA 3GT4A 4WL0A 5EGSA 1U15A 2XODA 2OBNA 3JRNA 1ONBA 3ANXA 2ZSFA 5AVUA 4FDVA 1ZCZA 3FBWA 1RM0A 3KYDB 1K5GA 2AJTA 4FZ3A 3GA7A 1ZL0A 1KSJA 2WP0A 4E30A 2F6RA 2DY0A 2ISQA 4IDBA 2OFOA 5FXMA 3BDIA 3WNBA 1RYBA 2GJ9A 3K9GA 1TUIA 2ZRBA 4G81A 1IM8A 1VHQA 2QUZA 3KUXA 3PSAA 1XTTA 4R2KA 1KY3A 3DCYA 4XJTA 3W3ZB 1BHJA 1NJ1A 4F9EA 3BREA 2ERCA 1PFWA 3MS2A 5DKFA 3U9TA 3MT9A 3B1VA 4QOHA 2A2ZA 2VA9A 3PDWA 2ZIVB 5LQUA 2BPOA 1KMHB 1FEZA 5EIFA 2V58A 4CG2A 4Q6WA 1PJTA 3U4QB 2R6GA 4H7PA 4Y2YA 2RG1A 4PRKA 5TJHA 3OQMA 1GM5A 1XN1A 5B2ZA 1ZY2A 4DV2B 3RVRA 1K6MA 2JZOA 4HX2A 4RVGA 5FI1B 3H6GA 2P3QA 1UBHS 2W2LD 4U3JA 5DJ5A 1AMOA 2R6HA 4B46A 4DFDA 1ZOLA 2RH4A 1DAFA 1IJKA 2ZYWX 4ICIA 1A82A 2QUJA 4ZVQA 3WJ7A 3N2GA 4KQFA 1DIRA 3FMIA 2PGDA 3R0XA 2IF0A 4LK2A 1RRVA 1TFUA 3OOWA 3V46A 1GYRA 4FKBA 4EHNA 3PA6A 5K4HA 4PN3A 2FN7A 2BMAA 2AUNA 4BFTA 2BTEA 2J46A 3IOEA 1NVXQ 3V8QA 1S8OA 5G02A 2GAAA 1P9OA 4KO2S 4TV8A 4YAIA 1PUXA 2XQGA 4FR5A 2KI5A 1P18A 3GUYA 4KQGA 1AMUA 2BJWA 4DCUA 5JS2A 3AR9A 1Z15A 4JUCA 1XEXA 3H9CA 3K6KA 4II7A 4XLLA 1T26A 4NEQA 1JHAA 1B0AA 1WKBA 4RETA 1OX5A 1I3NA 1XZEA 2BRUA 3F8WA 5FL7A 4RY9A 1KVSA 5CLGA 5AW2A 4ZU3A 4Q3NA 2OVBA 3T99A 3UMMA 4RTMA 1AIPA 2GCEA 3GDFA 4O6VA 4TL8A 3AU8A 2D0OB 3OPVA 1NVVR 2QT1A 2CUNA 2FWIA 3CZAA 2IS2A 3AP2A 3FYSA 3EXG2 2EU8A 1CK4A 3DVQX 3PX7A 4H35A 1DWOA 5BQFA 2PZJA 4X8LA 5GJCA 1SQ0A 3E04A 1NDUA 1VRCA 1LTHR 2HCRA 3DAGA 3P2YA 2R1ZA 3PHIA 3RRMA 5C4GB 4FWTA 3ODPA 4ZCTA 2Q29A 1XDZA 2E6KA 1JJVA 3TQOA 2FG5A 1UMKA 3BG5A 3H1EA 821PA 1A7KA 1A5ZA 1VFPA 2FI1A 2ILTA 2BDUA 3B3FA 3HZOA 1RLMA 3EE6A 3M5PA 3P52A 1AGXA 1QG4A 1C0EA 2OAQ1 3MIIA 4H18A 1D1PA 3IP1A 4ZK2A 5BW4A 4C06A 1JIXA 2O2GA 3T1QA 1CUCA 4G1FA 1ZJ4A 4RF4A 2J0QA 3MSXA 1QXSA 2OL4A 4UBOA 1EFKA 3O38A 4LKOA 4EAQA 2R1UA 3ESAA 3T9CA 1ZD5A 4GE0A 1RAGA 1GEEA 4E11A 2PL5A 5ADHA 3QKIA 1YI1A 2PS9A 2YMQA 3OQHA 4YJ2F 3F67A 5EVJA 1X8XA 4TWJA 3JWJA 3LRPA 3OZAA 2R96A 4IQ0A 4RFVA 2JGKA 2MINB 3SF8A 3ZX5A 4BFUA 5KNDH 1GR1A 3BGIA 1K6IA 1OLUB 1UBNA 1ZCAA 1PNQA 3FFTA 3G3EA 4A2WA 3K5PA 6Q21A 1ZITA 1NTRA 2C5SA 1HI9A 1ESNA 3GPDG 3MYRA 3O9ZA 1R4ZA 4HLCA 4BIIA 1Q77A 3NOQA 1WULS 4D8TA 4FB4A 2P1DA 1XRNA 3I2KA 3FW1A 2BR5A 3WJ1A 3ESRA 1O96A 4FMDF 4JJAA 4DAEA 1KJNA 3VKGA 2J3IA 2DHDA 1E0DA 1NJ5A 1ZAYA 2D8AA 3R0ZA 3A8TA 1QVWA 3M70A 2B4KA 2PSJA 5EQFA 4EDHA 2COEA 4J0EA 5KQMA 4YDSA 4JODA 1SXJE 2HA4A 2O59A 2HQSA 1WMDA 3ZE1B 1M76A 1ND6A 1IUKA 3BJZA 3BMOB 3OIWA 1Z07A 3R5KA 3C6YA 3D81A 4FN4A 4GKVA 5BV0A 4XQGA 5CLHA 1MFZA 4CQMA 4N7RA 5HWSA 3IHWA 2P5SA 2D4AA 4DEYA 5BWMA 2WIBA 3KQMA 2XCOA 1NBME 1XQ6A 2N42A 4N6GA 4ZA2A 2A5DA 5I48A 4OQ4A 2XUJA 3FNGA 3H2YA 2NGRA 2X7XA 4HNAB 3J7AC 1TO2E 5CEJA 5FPQA 1VBFA 2O8BB 2J85A 3FOEC 1HE1C 3ABIA 1EEHA 1J56A 1NNUA 2O7RA 5C32A 1XL0A 3EEIA 3LSTA 4TMKA 2PS1A 2JGAA 2BFCA 4Z8XA 1CKEA 3GFRA 1RM4A 4FE7A 2FE4A 1X7ZB 2B5OA 1Z17A 4AICA 2EX0A 4GAEA 1OAKA 2B2XA 2GBPA 2EFDB 5A04A 2QVGA 3U7EB 4NXNB 5T5QA 2ZJFA 1DUIA 1MVOA 2H8GA 1HK7A 3BWEA 3L7MA 2LNDA 3PRJA 4WZ6A 4D4JA 3DV0A 4NV3A 2I8AA 5BR4A 1ATZA 1PT5A 2ONZA 4AD8A 2I91A 4XIJA 4JI2B 2GTPA 2G40A 1XQ1A 3MGCA 3ZHOA 3KLMX 1KWKA 1ZIYA 2WHEA 3JQBC 3UJBA 3QKSA 1UQRA 4HC4A 1U63A 1S4MA 1WP4A 1N5KA 2J6HA 2RGCA 3D3WA 1ZW1A 3IKTA 3NXSA 4KTVE 5LQMA 1RRMA 2RG7A 2IV7A 1KERA 2OTCA 4QPPA 4ZT2A 2FWNA 4E12A 4BMZA 2VJMB 4BZQA 1XWOA 1RFLA 2GJ4A 2CUTA 3GJ0A 2PX2A 1VSBA 5REQA 1AK9A 1JYEA 3JSXA 4R98A 4XVCA 1R5NA 3ZE0B 5EZYF 1FUPA 2EKZA 4K8OA 4EY8A 2ATEA 1OH7A 4J4TA 2JFZA 3WLKX 3VDRA 3DHYA 4I0WB 4BNVA 3EHEA 1N2CA 4XOUA 1OB2A 2QRVB 4EW2A 5EJ9A 1BXRA 4MLDA 4Y2JA 5ECYA 2YJ4A 2G77B 2YOFA 4B2PA 4CN9A 5IPFA 1ZQ9A 3UWSA 3UJDA 1UEIA 1M1YE 2X14A 5JAUA 3NT5A 3R4CA 2POCA 1P8JA 2BFWA 2PBFA 2VYFA 3KTOA 1BJTA 1D1QA 2DX7A 3RC7A 4EEZA 5EJIA 3FGNA 1H2AS 5LMUB 4Q4HA 4B44A 2ZRKA 3AERB 2YRFA 2OBYA 3KPVA 1QHGA 4LZLA 4CLOA 1FBTA 2ZJ5A 2X9GA 3BSFA 3L9WA 3VKVA 4NMHA 5EKDA 1N6RA 1OU0A 3OX4A 3MMNA 2R7MA 4WY5A 2VP4A 3U7QA 2J9XB 3OM0A 4PGMA 4CDRA 1JLSA 2YIDA 4QLAA 1G9SA 1Z6GA 1WDLA 3ED5A 3C1UA 2WF7A 3LLVA 4RZQA 3RUIA 3ZJYA 4AIIA 5FT9A 3FYUA 1NYRA 2VPPA 4YQEA 2AOTB 1ZNWA 5AKIA 5ENDA 4M0DA 4OFZA 3REQA 1TEZA 2VDKB 2W6MA 2HWXA 4NBVA 5FPKA 1DZIA 3IILA 2GTIA 1HH4A 2AD5A 1V2GA 5DV9A 3VSDA 3QBTA 3DKVA 2EC5A 2HEIA 4JR2A 4AJ4A 1V8FA 5LYJA 3FM9A 2VBCA 5BSHA 3BMOA 5DT9A 2IS1A 1QYIA 2ZWMA 1GN9A 4DLUA 3IO3A 1UR5A 4RFSA 2D5BA 4WJLA 5IULC 4ARAA 2E4AA 3GJSA 3RRJA 3W5JA 2AOTA 2AR0A 1A77A 5T41A 4ZI3A 1LF0A 3ZEIA 3JV7A 1WHTB 3VKWA 1KIMA 2QTVA 4LGCA 2NWQA 3W6NA 3WMEA 4YP1A 3I39X 1GUFA 3FJ1A 4KR9A 5J5AA 4H1HA 4D0GA 2ZDQA 2I67A 4RACA 2VG8A 4YDQA 5EZYB 3ANYB 3W5VA 2FEKA 1RLTA 2VAXA 4HPWA 3ZY4A 1XHFA 5F9HA 1VP3A 3NBXX 5MFPA 4Q66C 1ZFNA 2QYSA 2XYQA 1RVV1 2K87A 2CFRA 3PUHA 3ZDCA 1JIJA 5D87A 3AVYA 4BVEA 4S1OA 4AP6A 2ZU6A 3BEOA 4NEGA 2R1TB 3BKXA 3VR3D 2HXSA 1FTGA 5IJAA 2BM9A 3DAFA 3TW8A 1U9YA 1TJPB 2ZJ8A 3GDHA 3GLQA 1YB7A 2OK8A 4RGBA 2EEZA 1EWVA 2BI7A 2O7QA 3BVPA 4Q3LA 5DCLA 2FTKE 2AEJA 1P7ZA 2J3LA 1BWPA 3DE6X 4ZT4A 1IY9A 3DBOB 1E2LA 4IH4A 4MUNA 3KWLA 3U26A 2J3HA 1C29B 3ZN2A 2XCTB 3F6PA 2WJVA 4A6PA 4JIGA 4WK6A 1SB8A 1Q83A 3R7DA 4F5WA 3HVRA 3Q3JB 3VO1A 2B21A 2VYCA 3S1LA 3WG9A 1M1NA 4I1IA 2HRCA 2OD9A 3T3HA 1IZZA 3JARA 4QVGA 5IVDA 3OT5A 2FB9A 2OY0A 2ZUVA 2D0PB 4D96A 3ETJA 2JJYA 2LKCA 3MFQA 4Q1BA 5CXXA 4RK7A 1XYVA 1U0OC 3BK1A 1LS1A 2UAGA 3FTNA 3LQ2A 4G4JA 4HFRA 1CQWA 1Z8DA 4X91A 2PH3A 5DXFA 3RTAA 2ZFUA 3UMSA 4CVNA 1DKLA 3H9JA 4IRMA 1A3CA 2EJUA 5BUZA 2GZ2A 3O7MA 1MV5A 4P4LA 1JQEA 2C2GA 1Q20A 3RK1A 2XWPA 4PZ9A 4B85A 3HXMA 1U0LA 1H94A 4C6TB 2QMUA 2A9FA 1YT5A 2IUEA 2FPOA 3EY4A 2Z2JA 5AJTA 1MNQA 2OP1A 1L5FA 4BVBA 4H0FA 2XQIA 3B3QA 1HFWA 4QRHA 1T0JB 4UNNA 3GRAA 5ESWA 3RC3A 4FR0A 1ZVVA 1Y6GA 1QYWA 1GZ5A 1YOBA 4K26A 4GP7A 3SJUA 4EG1A 1FS6A 1U0FA 3TPCA 4W9NC 4XE5A 2F8LA 4RABA 3KYJB 2BRUC 2H9AA 1CUGA 2BBOA 4RCZA 2F17A 3DB2A 4UVDA 2JLQA 3ZGLA 1L1RA 2VDNB 4QTTB 4QWMA 1KDVA 3EYWA 3ICEA 1WZIA 1FS4A 4QNRA 3CW2A 1YS1X 3HU1A 4QPCA 3IAAA 4XCQA 2XCSB 3AKEA 1D07A 1KL7A 3ADOA 5IAOA 5IT5A 1YH3A 4QOJA 3U16A 2ATVA 1U2ZA 1FFXB 4QYMA 4BWGA 1EAYA 1CDDA 2QD1A 4DJAA 2DFDA 3CF0A 2JLCA 1KRHA 2QROA 4YRJA 3UT6A 1TT7A 2IYNA 1DWUA 2DM6A 1T8TA 1QOQB 1M3SA 1NVMB 1NQOA 3OURA 4NATA 1WXQA 2J67A 4AUMA 3ZHRA 1A5SB 5CYOA 4L8FA 1EUYA 1EXMA 3NRBA 3WLHA 1N9GB 4HNHA 4N5MA 3OF3A 5JALA 2C1ZA 5IN5A 1Y3AA 4LJKA 4LPSA 3G2HA 3LYHA 2O2XA 5DIZA 2G4LA 2DU8A 1KEZA 2XYPA 1XMXA 1P74A 4FE4A 1KZHA 1JGTA 4KO3S 4ZAXA 4RTKA 1I6KA 4AP9A 1PBNA 3A6LA 4FNMA 3F4SA 3WQQA 2P1ZA 3VPCA 3Q3VA 3WISA 1PJQA 4NSNA 1IY8A 2QEQA 4QGFA 4BC0A 4L4YA 5C8YA 3WS7A 2AE2A 1PK9A 1GR0A 1E2UA 2J6IA 2A58A 2JJ2A 2CLCX 1GLNA 2OXCA 3HADA 1JEDA 2ZSIA 4HQLA 4NQRA 1W73A 1KOLA 4EI2A 1S7CA 6CHYA 1G291 1CUSA 3JPWA 5HKOA 1JHVA 1JWBB 2V8OA 3A31A 3NJ4A 2AGVA 3HLYA 5DNWA 4LRXA 3ZGNA 4EG4A 1AKNA 5CT4A 3D2AA 1G8FA 3MBKA 1XAJA 1M1ZA 2HMUA 4EQ6B 3HKBB 5H3LA 1P45A 1HUQA 1T0PA 3SE7A 3ANNA 1PZNA 4ZVKA 1VHTA 5L8VA 1RYDA 4XVRA 4B9EA 1M6VA 3DAPA 4LBWA 3TDKA 1N1DA 3QX7A 3TCNA 2R7NA 1ADYA 1KMMA 2Z6QA 2EBWA 4X8OA 1CRLA 5EHNA 3VQTA 5ARDA 3BKWA 2YS7A 4KPEC 5KINB 1R0XA 3IVMA 1GADO 3L1VA 1DMSA 4B4WA 1L7EA 3A1VA 3G8DA 4MXDA 3NUQA 2Q99A 3BE6A 3FGOA 1HYQA 4QXPA 4YAOA 1J22A 4CCYB 4ETWA 1IEXA 1QLHA 1XZLA 3N0TA 5CT6A 4LF7B 2DB3A 2OKCA 1Z38A 2O0JA 2RGUA 1GGJA 1Z4PX 5HQTA 3QX9A 3QX3A 2HKIA 4DV4B 2FMFA 4YWHA 3VM6A 3D6FA 3WHLA 4DNQA 4EG3A 1YKFA 1OMOA 2DBRA 3T4XA 2XMCA 4JI4B 1F8FA 1FP2A 1SXJB 3GCWA 1HDXA 2E7ZA 3I5MA 3B7GA 3N7AA 3KAKA 4K9OA 4YP0A 5D3KA 1QS0B 4UTPA 1HC7A 3OCCA 4FD3A 5E1MA 5T4BA 4B3FX 1XA4A 4DDKA 3HO1A 3HDQA 3GEHA 4K9SA 3IV9A 2VWPA 4EHLA 5F92A 2ZYVX 4TLEA 1YB5A 2C5HA 1XVVA 2AG5A 3QUBA 3KUKA 2YDXA 3ZD7A 5EJ2A 3Q7EA 1NVGA 4DM7A 4Y6LA 4V0QA 4DC0A 3LYAA 2GK3A 5KU1A 1YI8A 3W8FA 3KVYA 1H2YA 3VFDA 3W5AA 2WT4A 2XCUA 1H0RA 3WHIA 1C4XA 3MIZA 4Q7JB 1GZ3A 3ORRA 3AB8A 1SOMA 1UK7A 1DAIA 3DZIA 2GEDA 2RBKA 1G5HA 5F73A 4BBZA 5KPDA 5ILOA 3R75A 3BL6A 1CULC 3RWMB 4UEKA 3RWBA 1P5JA 3CUSA 4EG6A 4UQLA 2JFGA 2BSXA 3IGFA 4PFQA 4NYJQ 1JIKA 2W4MA 3GFTA 5G2OA 3SYTA 1H9CA 1E63A 2JI6A 3C1TA 1J5EB 3ZBPA 3Q0EA 4I99A 4MGKR 3LBIA 2C00A 1LWNA 2DHQA 4BUCA 4NBSA 5C35A 4MK4A 5JRZA 3I61A 4BGIA 4GSYA 1QGOA 3JQQA 4J7UA 4KWEA 1NY5A 1SCQA 4M49A 4RA9B 3S2GA 4PSDA 1GT91 3LCVB 4Z9BA 1B73A 4GMGA 5JSKA 2WM3A 2YQ5A 2ZT5A 3QV2A 3W1VA 2P67A 4EQZA 4ZHQB 4ZYXA 5K9ZA 2J3DA 1R6UA 1T1EA 2PO7A 1CEEA 3RKUA 4DJFC 2YYZA 1NMSA 1PJRA 5FBLB 2F43B 4LTMA 5ECDA 2FGKA 3ZD6A 1KS2A 3D2LA 1AN9A 4Q3KA 4HUTA 2YR0A 2NU6B 4FBLA 2E5LB 2H1VA 5HIAA 1OTHA 4WBXC 2CFCA 5EFOA 5L6MB 5BVGB 3HVKA 4YLGA 1N7IA 5K8VA 3OBIA 3GCGA 3GP5A 3HFSA 4P4GA 4UUQA 4AJ2A 4D0RA 2DJIA 9ABPA 4ZDKA 3RT7A 1KGSA 4QYIA 3RHZA 4TM8A 1IEWA 3L0OA 1A8QA 1PGPA 4HK4A 4TZTA 4ZYWA 2GS9A 1AT1A 3C3BA 4OJQA 4QE3A 1CUUA 3NDIA 3QKSB 4R8RA 5KX5F 2VQDA 3I12A 1YUNA 2DMRA 4FSDA 5FJJA 3FNEA 2O8FB 2WPDD 5KKCA 4W63A 1UP7A 3ZDQA 3Q72A 1ZX1A 2PIAA 3DOOA 4GKKB 1CVRA 4CMIA 1P39A 2BYTA 4DIFA 2A0YA 3H75A 1YJCA 1A7AA 1YQWA 3UV3A 1TKAA 5MN5A 1R10A 2FPPA 4RA6A 1KJ9A 3WLFA 5A4FS 5BMVB 3RU2A 1FTNA 3CUUA 5SICE 1ZK3A 4RXUA 1Z39A 2GF9A 3SNKA 2Q5JA 3FPCA 4XWWA 3COYA 2YNMA 2RGWA 4I55B 4J9UE 4BO1A 4ZCMA 5A2QA 3GLGB 4J43A 3Q3IA 1L3CA 521PA 3LGXA 3LPDA 1Y6ZA 2ZATA 3AB7A 3AVPA 1H05A 1CZOA 1Q11A 3PQ2A 4RFLA 5EKXA 3DV2A 3IAEA 5EOVA 4ZIRA 4IUDS 1FJ2A 1BVHA 2O57A 1D8TA 3CRW1 4PO9A 3EZYA 4PYQA 3PFFA 1N5LA 1X8LA 5AW9A 2NU8A 4DWJA 4YMUA 5BV8A 3BJMA 2XCLA 3ESZA 2IDKA 3I9KA 4CT0A 2FEOA 1PTJA 1C0KA 2VJQA 3FFWA 4JVMA 4QIHA 4UDOA 4AAYA 2WVGA 1TTPB 2XNJA 4BO7A 3M8KA 4O29A 2IYYA 4UZSA 4OI1A 1BKDR 2VF8A 3G5TA 2A5FA 4IINA 4DMGA 5BWCA 1M6WA 5ALJA 1WUTA 4HZGA 3WB0A 4M54A 2JNWA 3GCDA 5CDFE 3LF1A 4IQ4A 2LGJA 4NENA 1ZW6A 3TOCA 4MRMA 3VZPA 4EMBA 3S29A 2GXAA 3EGWA 4XYEA 2N46A 3HXQA 5TS3A 5G0VA 1PDOA 2Y6UA 2O19A 5KPJA 2C5LA 2K7FA 1T4GA 3Q3CA 5FLEX 2B20A 4WE3A 4UU7A 4TS4A 1ODIA 2BFMA 3LDFA 4IGEA 5JCZA 2J0SA 4MB2A 1PP4A 4ZVSA 3UPDA 3OHPA 4ISBA 2AC2A 1C9NA 2OESA 1WVGA 5IJZA 1R5JA 1L7PA 2CXOA 2PAAA 3SY8A 4H7FA 4ER5A 1U0SY 1YR3A 3R7WB 3OFNA 4JZYA 3EWIA 1CFJA 1RI4A 1CZNA 1KU6A 1R9NA 4MKZA 4OREX 1OXXK 3A11A 1S7GA 4JC5A 4QEKA 4PAWA 4WBNB 5CCBA 5LCXA 1ZWLA 2VAMA 3D54D 4RVDA 4WCDA 3GRCA 1J2JA 1HZZC 3HP7A 3QVSA 3T41A 3O93A 5HS4A 3LE8A 4UBLA 5K01A 3TGWA 2CFIA 2WYWA 4DR7B 4JP8A 4U7GA 3PWKA 4JYMA 1XDSA 1DAEA 4XM0A 1U8ZA 2BGWA 2QTAA 3JASB 3SVTA 1HQCA 4KYTA 2LCQA 3K16A 3TLGA 4BAZA 1KH3A 4GVXA 1GU7A 2YHSA 2R00C 4MQEB 4KQXA 2XJ9A 1A9QA 4QA9A 4KMMA 3I9NA 4Y1FA 5K0BA 3JQ9A 4RHFA 3ROGA 3U1TA 1P8AA 3FTQA 3GJ6A 3RVNA 4B3MB 1I1HA 5IW8A 3BJIC 4CODB 1Y8ZA 3ROEA 3TTYA 2YNMD 4L5BA 1PUJA 2K2WA 4DANA 2BMWA 1E1CA 5TC4A 4HUJA 1B8UA 1PJZA 3ESQA 3EXHA 4ZQCB 2FUCA 1PQYA 2PR2A 5K5EA 5K3DA 1PT7A 4ALMA 1Q0RA 1R0LA 2YJ5A 2YXLA 1UJ2A 2CLOB 3LXRA 5BRNA 3BAFA 2M32A 2EJWA 4CM4A 3IQGX 4W5RA 1AHHA 1J6UA 2MR5A 2ZS8A 2C5BA 4F04A 4XVUA 2ZIWB 3DVRX 2PHZA 3R41A 4FSHA 1N3YA 1Y6JA 3FNIA 1O8BA 2G80A 3ZE2B 3S2SA 2GAJA 4QG7A 1H6CA 2YHIA 4KZPA 5EYPA 3ZIUA 4CV3A 1VE5A 2VHTA 4IF4A 1P7PA 2B25A 5IASA 3N8KA 4X9XA 2HOQA 4IUYA 2CXXA 3C7AA 4FR2A 4XX0A 2H3HA 2I3ZA 5AKGA 3ZDYB 3OCJA 3NHWA 1RU3A 1TKRA 1QBKC 2Q27A 3AESB 3P7MA 1NFRA 4CE6A 2OCPA 4DC1A 2ZXUA 4MS4B 2C0PA 1LFAA 2IQIA 2PSEA 3ZNPA 5K51A 4HTFA 4J94A 3PEUA 3QE9Y 1BD3A 1LQTA 3IT2A 1IVNA 1U4OA 4BNGA 5ALGA 1NTOA 5CR9A 1Q3KA 4OXKA 4RD0A 4O4HA 5EIAA 1JNYA 1XD9A 2B0CA 3K4QA 3TGPA 1XLVA 2I8LA 2O07A 2D3WA 2BFDB 2Q6OA 2WFLA 3A4YA 2WMNB 4TTIA 1FTQA 4EGJA 1D9XA 1FNDA 1BDHA 1RXYA 3AJAA 3WAKA 2PCJA 3ESYA 4RPJA 1UOEA 4F1KA 4PYNA 1CR1A 4MYHA 3H86A 4HVTA 3TG8A 3RUDA