1Q92A

Crystal structure of human mitochondrial deoxyribonucleotidase in complex with the inhibitor pmcp-u
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
195
structure length
195
Chain Sequence
b'GRALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5(3)-deoxyribonucleotidase
publication title Crystal structures of the mitochondrial deoxyribonucleotidase in complex with two specific inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 63
structure length 195
sequence length 195
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2003-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 1q92A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1q92A01
1F5SA 3R9KA 2AH5A 4HAIA 2WFAA 2AGVA 4QJBA 3ZTWA 4UMDA 1NNLA 2GFHA 2B1QA 5ALGA 1Z5UA 4L6CA 3E8MA 4YCLA 3SMVA 2EARA 3WK4A 1QQ5A 1N8NA 2C4NA 1TJ5A 2B8JA 4G9BA 3U7HB 3U7EB 2JAOA 4L6AA 3QUBA 2R8XA 4F71A 3B9RA 5AKYA 2IOFA 1CQZA 1RDFA 4QQFA 2O2XA 2W11A 5AHXA 5ALIA 3L5KA 3U7FB 1RQNA 3W5DA 4BKMA 2HEGA 5AICA 2I33A 3IRUA 5AW5A 2CFTA 2CFRA 3ZWKA 1L8OA 1PW5A 1ZS9A 4OD0A 3UM9A 4Y2RA 2I54A 4BX3A 3QX7A 3A1CA 4CE6A 4NFLA 1O08A 3WK9A 2FI1A 1U2SA 2QLTA 2YN4A 3AR5A 3DDHA 5JJBA 2G08A 4IFTA 3A3YA 4UATA 4NV0A 2MU1A 5A3QA 2HHLA 2QYHA 3ZX4A 3KOOA 4O8CA 1YJ5A 2WHEA 3WKDA 5AW3A 5AKLA 5AKEA 5AKZA 4UM5A 1IWOA 2WM8A 2WF6A 3QU9A 5AVTA 5ALJA 5ALYA 3NUQA 1O03A 3ET4A 2ODAA 4UU0A 5AM0A 3QU4A 3ZX5A 1XP5A 5AK3A 5AVWA 2FEAA 3L8FA 3FZQA 2G09A 5A3SA 5AW2A 5AKGA 1YNSA 2JAWA 1VFPA 2AMYA 4HGOA 2I6XA 1EK2A 1K1EA 1TJ3A 1RC8A 5AW1A 1S8OA 2P27A 3DV9A 1L7OA 3WK5A 2HI0A 3K1ZA 2FPWA 1VJ5A 1L7PA 2YBDA 1QQ7A 3ZI4A 2MSNA 3E58A 2YJ4A 3ONNA 1EK1A 4OCZA 2YJ6A 5ALZA 4PNHA 1Z5GA 1Z4PX 2ZBGA 4IG4A 5AW9A 2Q4RA 3UMBA 4YCNA 1RRCA 1Z4QA 4C4SA 3BA6A 2FUCA 2ZBEA 3OCUA 4DCCA 2B8EA 2HF7A 2FPUA 1ZJJA 3N07A 3S6JA 3M1YA 3ZTYA 1WR8A 2NO5A 2Q4TA 1JUDA 3N8GA 1NRWA 2ZBFA 5FP0A 4GXTA 2FPSA 4CF5A 3EF0A 3M9LA 5ALKA 4JB3A 4H1WA 1RMTA 1Z4MA 2PR7A 3A1DA 5AW7A 1L7MA 1Z4JA 3KC2A 1YMQA 2YJ3A 2G1AA 3A1EA 5AI4A 5AKXA 3E81A 1Y8AA 4CF3A 3L0YA 5ALTA 5AIBA 2BDUA 1ZD2P 3AR9A 5AKKA 3OCYA 3GYGA 2IOHA 2HDOA 3I1YA 4Y2YA 2FPXA 2O9JA 4UMVA 5ALRA 2OA0A 3PGVA 1AQ6A 3KZXA 3AR8A 1Z4OA 3WK7A 4HGQA 2YMLA 2VKQA 1Q92A 1XVIA 2FPRA 2ZOSA 3NRJA 4AP9A 1SWWA 4XPZA 3WKBA 3N28A 3ZUPA 2CFSA 2GHQA 4HYTA 4FYPA 3UMCA 3ET5A 3D6JA 4CF4A 2HF2A 5AM1A 3SLRA 3BWVA 3FPSA 3WGUA 4UAUA 4Y2SA 3HYCA 5A3RA 4YCMA 3KD3A 2B82A 3L0BA 3W5BA 1RKVA 1WZCA 3WGVA 5AVXA 3OTQA 3WK8A 3L1UA 1YDFA 4Y2PA 3F9RA 3TLMA 3FGOA 1L8LA 5ALXA 1Z4IA 2IA5A 5AM4A 2R8ZA 5AKJA 4BNDA 1J8DA 1NF2A 1RLOA 5ALUA 3QU5A 5E0OA 3RFUA 2P11A 4UMFA 5AW6A 1WVIA 2RB5A 3NAMA 4CNQA 2WF5A 3QU2A 3FPBA 3WKAA 5AM3A 3U7GA 3EWIA 4I9GA 2PQ0A 2I7DA 1U2TA 3MN1A 1QH9A 3IB6A 2R8YA 1Z4LA 4EX7A 3PDWA 3R4CA 5ALDA 4GIBA 4KN8A 1WPGA 5AVQA 4UU1A 2HCFA 5AK6A 4JDPA 5AI6A 3PGLA 1YS9A 4EZEA 3DNPA 1J97A 5AVRA 4NWIA 2YJ5A 3ED5A 4AS3A 3RF6A 2HSZA 3SD7A 3L8HA 3QUCA 5ALLA 4YIKA 1XPJA 4EEKA 3WK6A 2G80A 2BDEA 3PCTA 4YIHA 4UW9A 2OYCA 2YMQA 3MMZA 5ALHA 4YH1A 4BBJA 2OM6A 1ZD4A 4Y3UA 1RKUA 4Y2VA 1RQLA 3MPOA 4XQ0A 1Z88A 4BNDB 2X4DA 4KNWA 4RESA 3L0CA 3B8EA 5ALQA 2C9MA 5IT4A 1TA0A 4DWOA 2ZG6A 2B1RA 4BX0A 5ALOA 2YFYA 2NO4A 3AR7A 3QLEA 3ZVLA 3P96A 4Y2TA 1LVHA 3CZ4A 4UAVA 4FE3A 3W5CA 5ALMA 5AI8A 2EATA 4ZEVA 3SKYA 3NALA 4HGNA 1U02A 4UMEA 2GO7A 4BYGA 4Y2UA 3NASA 4HGRA 4B6JA 3NANA 3EF1A 3J7TA 4Y2XA 4DW8A 5AESA 2WF9A 4G63A 2RARA 2W4MA 4KX3A 5AI9A 2IYEA 1SWVA 3QUQA 2P9JA 3OCXA 3N5KA 3ZVMA 5AK5A 1TJ4A 5ALWA 1L6RA 2W43A 2JAUA 5AW0A 4XE5A 2I55A 4EX6A 3EPRA 3E84A 3FM9A 3W5AA 1ZRMA 4C4TA 1KYTA 2IOFK 3B9BA 4C4RA 3ZU6A 4NAVA 3HLTA 2G0AA 4DFDA 3KDPA 4OFZA 1ZD5A 2EAUA 2GMWA 5T41A 3AR3A 4L57A 4Y2QA 4Y2JA 2JARA 2Q5EA 5AIAA 1RLTA 1RMYA 1QQ6A 2WF7A 3SHQA 1RLMA 1X42A 2PKEA 4HGPA 4UASA 2YMPA 2ZXEA 1TE2A 1YV9A 4YGYA 3WKEA 3WKCA 4J03A 3N1UA 2HOQA 2I34A 3SF0A 4KYTA 2WF8A 1MH9A 1FEZA 1VJRA 4OHFA 5ALVA 2HX1A 3KBBA 3L8GA 5AKIA 5AI5A 5AW4A 4J2TA 3ZWDA 3I6BA 1RKQA 5AVZA 2CN1A 3OPXA 2C88A 5ALFA 5AVUA 3ZW7A 3NIWA 5ALPA 3ESRA 4MWOA 2G07A 5ALSA 4EENA 5ALNA 2NYVA 3U19A 2DQSA 4UARA 1LTQA 1Z4KA 1S2OA 4KX5A 4NABA 2C8LA 1ZD3A 4F72A 3AR4A 3OCWA 1CR6A 1QYIA 2C8KA 4UM7A 1RPZA 2YY6A 2B30A 3QGMA 5AM5A 2D2VA 4I9FA 3AR6A 2JGAA 5AVVA 1Z4NA 3I76A 4RETA 3U13A 4BEVA 5ALEA 3I28A 5AM2A 5AW8A 3FVVA 5AVYA 3QXGA 1ZRNA 3SKXA 3ESQA 1RMQA 2BY4A 3DAOA 2RBKA 3QU7A 2OBBA 4KNVA 4MUMA 4BX2A 3MC1A 5AI0A 5AVSA 3L8EA 1T5TA 4ZEXA 4AS2A 3IJ5A 2ZBDA 2HO4A 2AUTA 5IS2A 1L7NA 3QYPA 2RAVA 3L7YA 5AKHA 4BEWA 2G06A 3AR2A 3UMGA 3R09A 1T5SA 3QUTA 2YMMA 3L1VA 2FDRA 3ZVNA 1U7PA 3QNMA 3OCVA 2B0CA 3CNHA 2FUEA 4FFDA 4XOUA 1N9KA 1ZOLA 2GHTA 2R8EA 4ZEWA 1T9ZA 3U26A 1U7OA 4EELA 3VAYA 5AK4A 2P69A 4E88A 3OCZA 5IT0A 1SU4A 1Q91A
chains in the Genus database with same CATH superfamily
4G5HA 3LTEA 1B2RA 3A4VA 4IOLA 4YRRA 1XEXB 1YT5A 4TV9F 4ZTBA 5EWLB 2M2IA 1P31A 4CCSA 2WAXA 4FQ7A 1P73A 3BAFA 5IF3A 1Q11A 1DVRA 2AEJA 1PYGA 1UBKS 4AUMA 1NF8A 4O4LB 2GN9A 1TVMA 2VHVA 1J8VA 2P40A 3UWDA 2Q1UA 3MWJA 2GKOA 4CZ2A 2BCJQ 2FB9A 2XJ9A 1RRFA 1UDCA 3BN3A 2WJYA 3KV1A 3OPMA 5K0LA 3WFIA 1JR4A 1GPJA 4J49A 4X8OA 2XE6A 3ZJTA 2XDWA 4IQ0A 3SLKA 3LXMA 5GONA 2PU7A 3EOAI 3HACA 4EY5A 1PD0A 2PD3A 3W2IA 3T4UA 4DGSA 3KFVA 4E03A 7ADHA 4IJWA 5KO2A 1R2QA 1Z18A 2CXQA 4W4TA 2I78A 2FLKA 4KLNA 5L9AA 3JQAD 1XO1A 2MR5A 5AW5A 2WU1A 5FOUA 5CT9A 3RS9A 3UMSA 4EQ6A 1ZS9A 3ANSA 3FDFA 3LY8A 4X3OA 2PVCA 4D9GA 1KJ9A 2JCSA 3ND9A 2GUGA 4IIUA 4CDGA 5EJMA 4ES6A 2REBA 2GPNA 2PV0A 5NULA 4I1RA 1U0SY 1M54A 4DCVA 2C2XA 3EVTA 2ZUSA 2RONA 3Q0IA 4PZYA 1QK3A 1QQTA 3V1KA 1RYEA 3U0BA 4IWYA 1DOHA 1ISGA 1JR3A 3ZV6A 5CBPB 3D6FA 3OHPA 3KK0A 1T5OA 1DAMA 3K92A 1ZISA 3WJ1A 3L7AA 3KQLA 3OE7A 3FYTA 2ORIA 3I01A 1F6DA 4FDLA 4GPD1 2XODA 1UADA 2FKNA 2JEYA 3HP1A 2H4HA 3OEWA 2G1UA 4PLCA 2Z1DA 3UO8B 1T8WA 4CTOA 1PSZA 4HEA1 4OREX 3TV2A 2XRZA 4W9NC 2PJDA 2RH5A 1P3JA 3DOUA 1PGPA 4GGMX 5ALYA 3SP1A 5TGDA 1O03A 2AFHA 2H8KA 2O4CA 3MAAC 4NIMA 4YJFB 5ECGC 3HSKA 2BFFA 2CDCA 3ROQA 4BO4A 1T9HA 1R8SA 2I62A 5CP8A 2D28C 2P79A 2FYTA 4JQZA 2XUAA 4R51A 3ZV7A 1XD2A 1X0XA 2RHRA 3H11B 4C7OB 1AE1A 1ONBA 2E4XA 4RJIA 3CN7A 4OVKA 3QMVA 4MQBA 2Q4BA 3I45A 3JARB 2GETA 3AG5A 3L84A 4K9LA 3RVKA 1TQ8A 4E5SA 3NTQA 4PYOA 2YWXA 3KSMA 4YWJA 3RAGA 3CVVA 2WUFA 1S8OA 3DV9A 1Q14A 2CDBA 1LEHA 1NE2A 3QVGB 1PQ4A 5DPMA 2EXXA 1OU4A 1SH7A 2QL7A 2YZMA 2W6ID 1ZC3A 1VMAA 3LUFA 1P4GA 3D4LA 4O0LA 2JD2A 2ZI3A 3PDUA 1QSGA 3P7MA 3OP4A 3OT5A 4OJTA 2CLEB 4ZU1X 1FU7A 4L5CA 3RBXA 5B3KA 1FNSA 2I7VA 3T7JA 3U81A 1QV6A 3AK4A 5LLSA 1Y33E 3TUJC 4ENWA 1K63A 3RFTA 4Q1EA 2BEKA 4GAEA 1VJCA 3QKTA 2GQ0A 1XBTA 2GOYA 2IP4A 2R6ZA 4FCTA 1ORTA 5EP1A 4PSAA 3T7SA 4LRYA 5J9FA 4DJ5X 4IDNA 2QRUA 1EFRD 5I4KA 4DOMA 3SQOA 1U2DC 2JJ1A 3S2FA 3L5OA 1MG0A 1A1SA 2H0AA 3KAJA 1ZJZA 2IP1A 3SZRA 4DSAA 3T0GA 3CO5A 1F38A 1NVAA 2HF7A 3OIGA 4V1CB 5JPDA 3ZD7A 3N8HA 4BNUA 2H16A 1AA6A 5BSUA 1DCKA 4RHCA 4PY2A 1VL2A 2C97A 3GGPA 1GQ2A 1JUDA 2GZ2A 2JGRA 3OFKA 3P19A 5JC1A 5CJJA 1KI4A 1B1CA 2HQSA 1HFJA 3JSXA 3L0DA 1Y4SA 3ELDA 1ISIA 3M9LA 3P9CA 1SKAA 1T9AA 4P3PA 4RE6A 1GCAA 1YB5A 2DSNA 2P41A 5G4KA 2O1SA 4CM5A 4D0NA 5I01A 1V43A 3A1VA 1QZUA 4GLBA 4KFUA 4RV5A 1N92A 1UL1X 1OHHD 1YVUA 3G1TA 5F9MA 1TX4B 4B2LA 4ENRA 1RZRA 5TMEA 2QXTA 1P1IA 4CG1A 3OX4A 4ZQEA 3RVPA 3AEQB 1J2EA 2Y6UA 1E58A 3AXSA 2TMDA 3ERCA 3G49A 5BR7A 4GVPA 2FEOA 4LJ6A 3KXIA 5AKKA 4G36A 3SDZA 5J59A 2ZU0C 4V39A 2QVLA 2I1VB 4URUR 1SFRA 3RIGA 5LU9A 1YMVA 1PKEA 2BHTA 1S7GA 1T1JA 4KXQA 3X1DA 2FUG6 3A6EA 2JJ2D 2NTVA 4HDQB 3ZGLA 4E07A 2F3TA 3HVJA 4ZO7A 1TEVA 2EL9A 1ORVA 4LS3A 3L4BC 1T0JB 4WN9A 4XYBA 1DBPA 3BGVA 5CGQB 2VAPA 3R7DA 4EHAA 1C2YA 3QE2A 1U0FA 4K6KA 3K20A 3SYTA 3MB8A 5K6AA 4C88A 1GAQA 1PG2A 4R2KA 1PR5A 1WQ3A 3UYKA 3V32A 2WE8A 2V5UA 4AN4A 3V4ZA 4YR9A 1W4AA 2KW5A 2PH5A 4YAWA 4W1SA 3U6BA 1I9GA 1QRUA 5TV2A 4P0PB 2O50A 1MVOA 2C03A 1N33B 2JA2A 4IH9A 3NTUA 3RU2A 1Q7GA 5IM4F 3GEHA 5CRIA 2C8JA 3D59A 5FNVF 4LRWA 4I1IA 4PHGA 1DSSG 2WILA 3K5HA 2RKOA 4FNAA 1EE2A 2QRGA 4BEJA 4L75A 4R5HA 1HZJA 4UAUA 1EVKA 2Z5VA 2XD9A 1U9CA 2JATA 3GRYA 1OD6A 3PC2A 2CXPA 1M34A 4BMZA 5A3RA 5HXAA 1OAAA 1NLMA 1U0HC 4DV6B 2XNKA 4FHCA 2X0KA 4FXPA 3FLMA 4Y8VA 5KX5F 2AQKA 4LHVA 2X23A 2QN6A 3ENKA 3USZA 3MOIA 1HDIA 5F91A 1JDSA 1YQUA 1UF9A 2J5BA 2O07A 5FD8A 5A06A 2HZ7A 4IIFA 2YV3A 2GBLA 2J3HA 1XYVA 1H93A 3PKZA 3UUGA 3GFQA 3HCFA 3M6WA 3GJRA 1DHRA 3W5VA 1H22A 2BCEA 4G37A 1NM5A 4A0FA 4BNDA 3OUZA 2BMEA 3M3PA 2QDXA 1VRVA 2YWRA 4R0NA 5EGSA 3VH4A 4F6RA 5KQSA 3DT6A 3KJXA 4JJAA 3OT4A 3W06A 2QF7A 1TZ2A 3FPAA 3QRWA 5LPNA 4D9KA 1P9OA 2XHEA 2Z2ZA 3G2KA 4FT4A 4E5KA 3O3MB 1RIIA 4RNDB 2NOAA 2VF8A 2V6FA 4QATA 1JU3A 4D3ZA 4B1FA 4K7JA 3TTSA 4X1IA 3ZDRA 3U37A 1RM0A 2PRYA 3G0IA 3OUUA 3WGJA 1UP4A 2YJZA 3FOWA 3UZUA 2YCBA 3QBEA 4FYMA 4Q02A 5EZYB 2Q3HA 2ZJOA 3KHSA 4N5DA 3IURA 5BQXA 3E22B 3R0XA 2IIQA 2IQIA 2A57A 3RF7A 3SGLA 3ZVRA 2O3QA 3F96A 3FCUB 4C1NA 3R3HA 2PUDA 4KE8A 2A59A 3ZNQA 5AYVA 4FK8A 3DZCA 5EUMA 1SCDA 1X7ZA 4BUJA 1NN5A 5T6BA 1FS4A 1CNFA 1QO7A 4E2WA 2ADFA 2VBCA 2A0WA 3YASA 1IEWA 4AJIA 1BQ3A 1XV5A 3LPDA 3TIIA 3OZIA 5JT1A 5LZ4A 1E8MA 5DSTA 1V16B 3NT5A 4G0YA 1BXGA 3OECA 4QPCA 2XMBA 2CKMA 1XDBA 4OLHA 5ALLA 3X3HA 4AMUA 3FSEA 4B81A 2WKRA 3DKIA 2FWMX 2BDEA 3I34X 4L16A 1GTSA 3TVTA 2X0IA 1RNLA 2WJVA 1T0IA 2XYGA 1IM2A 5FV4A 3KKNA 5A6SB 2XR1A 2JLCA 1SCUB 1TC2A 1NHGA 2XTMA 4DRXB 3UFBA 5FI3A 4E7PA 3JV7A 3N5CA 2G17A 3C5VA 4D9NA 1VIYA 4N1AA 5BQ5A 3MPOA 1LI5A 1Z5PA 1SXQA 2JZCA 1YIDA 5KVCA 3GJXC 3MTIA 4DARA 2Q5QA 4E2XA 3LPAA 4OOFA 3V2HA 4EJSB 5GJBA 3B8EA 1N34B 1IY0A 1I9CA 3WLRA 2QD2A 4ZVRA 3ZK9A 1ACMA 2IPNA 2ZG6A 1QIJA 4HQ6A 5LB4A 1U7UA 4X7PA 1K6XA 2O7VA 2C58A 3NONA 5GY7A 2OSBA 2Z56A 1TEXA 4B7XA 1SOWA 3JATB 4P36A 1SPBS 5D3QA 1M6VB 2ZM6B 3Q8MA 3P96A 4M36A 5CPFA 5FORA 1ADGA 4X44A 4NZNA 3E4DA 3UA4A 4BCBA 3UV7A 3LQKA 1TIKA 2YHSA 3VH1A 6GPBA 3ZHRA 2I80A 7REQA 3NALA 3C4VA 4NICA 5KIAA 2V1XA 3FYUC 3BK2A 4G84A 4LOKA 3K6SB 4CF6A 4Q3EA 5J4KA 4NF2A 2C4WA 4TRRA 2VN8A 4LV6A 2RG7A 1KK1A 1W5EA 4W5NA 2P4QA 3N0VA 2WFLA 4UKDA 5H3CA 2CNDA 4B45A 3PFNA 4JJIA 2FJUA 3I32A 1D9ZA 3LM8A 2AXQA 4G8BA 4MPTA 3H5RA 2DECA 4NATA 4A0HA 4C7XA 1FNCA 2CFOA 1Z35A 4ND5A 1TJ4A 3IODA 4GYKA 5DTIA 1PGQA 1TM4E 4OXKA 3WMFA 5KDOA 4DDTA 3NIFB 2OENG 1KYYA 5AW0A 3P27A 3TRFA 2QTCA 4UBNA 5JQGA 2J9ZB 1QKKA 2GN4A 3VZRA 5GIPE 4BL5A 4ICIA 2DXIA 3EXHC 3ESXA 4J0KA 3UV6A 2A14A 1QGDA 4C4RA 1MFPA 2GNOA 5JS8A 3OQIA 4TS1A 4UXIA 3IMCA 2Y2UA 5B30A 2AUMA 2DAPA 1T6XA 3LVQE 4OLFA 5IDVA 2B0JA 2AR0A 2CF6A 1NU8A 2CW5A 2Q2VA 3CEHA 3PYXA 1XZEA 4ZAXA 4OQNA 2UUPA 3EPJA 2A4KA 3FX2A 2AD1A 2BSXA 1ZD5A 2H57A 2QTGA 1XDDA 3K32A 4PPFA 2XVXA 2BN4A 2IS4A 2IODA 3ABOB 4RD4A 3F9IA 3C16C 3NBQA 1ZGBA 1RMYA 1XU4A 1PGOA 2ODEA 2HWWA 1C3XA 1SKUA 1YZNA 3NFYA 1RHMA 1CUHA 1GRVA 2EGGA 3HBNA 4HGPA 5FXMA 1JR6A 1A8HA 5F1YA 1USVA 3OLVA 1YV9A 4YGYA 1G8SA 5CJ2A 2PH7A 3M34A 4A0SA 3NRCA 4WINA 1GR0A 4J03A 5ADVA 4XARA 5A4DA 3F71A 2FSHA 1S1CA 4UBMA 1I1OA 1SCNE 4O4JB 1JLRA 3FPHA 3W9YA 1MENA 1MH9A 1QFZA 2ZZKA 4O5AA 5ALVA 4MV3A 5HZMA 2PNFA 3H8SA 3IO3A 3FNRA 1EFVB 1J0BA 2UVPA 3GNQA 1ZHFA 3QOFA 4TSKA 3EE6A 4C06A 3QM1A 4JSYA 4GC9A 4GOXA 2BFEA 2GEVA 2WJIA 1QJ4A 3IALA 2B94A 2ZUUA 3BDIA 4G4JA 1PL0A 4QUJA 4EGFA 4CKYA 3ESRA 4MWOA 3OPNA 5FOWA 2VZ0A 3NBKA 1AM4D 2A1TS 3JQEA 3NWJA 2M32A 5LD2C 1JU4A 1XELA 4JIMA 3UH0A 4XWOA 1XRMA 3E04A 1RJDA 2ZJ6A 1NVWQ 3F47A 4JC8A 4WZBB 3UEOA 4Z6KA 4GGPA 3V3KA 4NYMR 3UN1A 2RHDA 1XEXA 3K0KA 5EJ7A 4ND2A 1DFGA 5EWLA 1RJGA 4WLNA 1D8TA 3U7IA 4Q01A 4X60A 1PL8A 4RXUA 2O8VA 4CL0A 2B8TA 1NNUA 3IKLA 4NSLA 4O4LA 4R40A 5T8KC 1BKYA 4Y2HA 3OZBA 1VHLA 4IOMA 3PQCA 5G0WA 2GZHA 3V4FA 1DO0A 3F3YA 1K5PA 2ORYA 3CLRC 3KUXA 1HDZA 1R0LA 4JLSA 4TLDA 1I13A 3JAWB 2IHVA 4Y1EA 3RI3A 4IXTA 4EJ2A 4U9IS 3I28A 3EZ6A 3FVVA 4EIWA 1UFOA 4FWTA 3ITNA 2V65A 4HB2A 4LHZA 1U5CA 3T9BA 3ZWNA 2KYRA 4J8PA 4HGYA 4LV8B 3QU7A 4XASA 2AB0A 4DTCA 3EA4A 1UMDB 4PZ9A 1JDNA 1R8YA 4ABYA 5FA6A 3SX0A 1P2GA 1T1IA 3GXOA 4NESA 5AXAA 2PCLA 1CVLA 4HD8A 2XUGA 3BK7A 4K26A 1DWQA 2AOUB 3N0WA 1FVHA 1MZVA 1JPVA 1B26A 1SG0A 1KTVA 3K15A 2AJ8A 4IX1A 3VBCA 5HQTA 3NUZA 3OQHA 5CYOA 4XWGA 4F1KA 1NVKA 5CNKA 2ORWA 3QYPA 4KAJA 4F6CA 1FYDA 4ZV9A 3L2OB 4RZ2A 3MF4A 2G06A 1IEVA 1S3FA 3NKFA 2VP2A 1UK9A 3VH3A 3F6EX 4J9UE 2BFWA 3W5CA 1O89A 3T7IA 1A5AB 3SEFA 4AXBA 3IAUA 3Q85A 4H7EA 2AC4A 4NG4A 3WJAA 1U94A 3RIEA 3X2EA 5CDFE 1BD4A 1UKBA 2FRDC 2RC6A 2AZTA 3G0GA 5JUWA 1YRQA 2FGKA 2ON6A 3AUAA 3E82A 4HDRB 1R9MA 4RIHA 4BV3A 1AO0A 1AHPA 4QT0A 4GRAA 1VE6A 2NSLA 2BV3A 4ZEWA 2J0VA 2XXJA 4TQAA 2BJWA 4E33A 1UPCA 3H0KA 1EIWA 4E88A 1U04A 1V6SA 3OCZA 2LNDA 3ZQKA 1JBEA 3O2QB 5K2OA 1GG2A 2ZSBA 3DFFA 2AFIB 2WM2A 4J7AA 2MSLA 1O6GA 3S3TA 1ILEA 3IHKA 4HWKA 3Q88A 3WHIA 2D0OB 4MW5A 3BMCB 3CUKA 5A3VA 3KVRA 5JCOC 4YJFA 2O2EA 1QRDA 5AUPB 5DHFA 1QIIA 3FBWA 5CAEB 1X2BA 2ZB7A 5AHWA 1H9BA 2RGCA 4CEIB 1LSUA 3DLIA 3LKDA 3EZLA 3A4IA 1AN9A 4G56A 2GZMA 4FOOA 5EPEA 3H11A 4C7OA 3V8RA 1Y4DE 2P9HA 3W05A 1LXCA 1AXGA 1BWQA 1CDDA 3QFCA 1KYWA 2IDKA 2DCUA 3VI3B 3JARA 3T7EA 1MUUA 2I4RA 5KTNA 3ELWA 4D8VA 5CGZA 1BMDA 2Q3MA 1M2VB 5EXEA 1I2CA 3ZU5A 5AHXA 2JS7A 4DCPA 2FA9A 3ANLA 1YS7A 5HCIA 2VTVA 4X8HA 2H7CA 5JAPA 1U6KA 3W5DA 2H65A 1KJZA 2WW8A 5I8ZA 3QMMA 1W36B 2FUSA 2I33A 2JHAA 3QVGA 1K4KA 2GAJA 1U4OA 3D2BA 3KDAA 6REQB 4UHHA 1KQ7A 1GGKA 3QKIA 1IBLB 2O5CA 3RIXA 3HYRA 3LXXA 4RENA 1NURA 4PO9A 1KMQA 3HJHA 4AG3A 1RBMA 1D1QA 3PQDA 2YV1A 3AIMA 5I8WA 2XOXA 4BNZA 1A8PA 1IZ8A 1GUYA 4I1VA 4B2IA 2WA2A 1G98A 1V9LA 1YHZA 4QGAA 2RFLA 3O8LA 5AJWA 2EP7A 1Y3HA 1PT5A 3ETHA 3JZMA 2QP4A 4RW0A 4ND8B 1P1JA 4C76A 1FFYA 3HNOA 4UE6A 1TTPB 3P2KA 4Y2GA 4MQFB 1XZAA 1W4ZA 1BWRA 2HWKA 1D7AA 2L2QA 1H6CA 4B40A 2YW9A 4TS4A 3LHSA 4ARCA 3KEQA 1B0ZA 4NV1A 1JG1A 4PQGA 5DJ5A 3A6LA 1RSZA 4QYWA 3WKDA 4EH1A 3A3PA 2HU5A 4MB2A 4E5YA 4V1CA 1U8ZA 3VU8A 1JILA 1MX3A 2AN4A 2AA3A 4ZREA 1IY8A 2WYIA 3FDJA 1MO4A 1VL5A 1KA9H 3HPRA 3OE1A 4F56A 2VHZA 5I7EA 1F3LA 1JIXA 2Y0DA 5JS6A 2OB1A 5H4GA 4B7ZA 1TU4A 4WESA 3N7AA 1K7SN 4QL3A 3GLKA 5FTWA 4UU0A 4QTYA 1YS6A 4PYMA 1HY3A 2C5EA 2IU0A 3EFHA 4EARA 5IYZA 3QJGA 2C00A 1GNRA 2Z2IA 4AMZA 2BBTA 4NJOA 3WRYA 1ZJYA 3WLAA 1A4RA 3A36A 3DDWA 2G09A 2ZBUA 3AEQA 3HJUA 5JNTA 2LCFA 3H2YA 4RFLA 3LUBA 1ZC4A 5J1SB 4AC9A 3N7UA 3KSZO 4GX0A 4TT3D 3PTAA 2ATEA 4HADA 4O1HA 1TYCA 2AMYA 1RXUA 1X15A 1VI2A 4GYJA 4Y6PA 4DV1B 1EVIA 5I45A 2HA6A 3VR5D 4U2GA 3UT0A 2Z4TA 4U6SA 4Q12A 4OGKA 3WADA 1H3FA 3RVDA 2RBEA 2P7IA 3VO9A 1CV2A 5KS2A 4PR0A 1V8ZA 1EGVB 1ICIA 1J0CA 1X6VA 2R84A 3E58A 4CMIB 1SELA 4L08A 4R0MA 1C80A 1NU6A 1TYEB 2I2XB 2J5KA 3JQ6A 4J6FA 1RE1A 1VE7A 4C43A 4DR1B 3QITA 1Q1ZA 2A9JA 4LQDA 2ZRAA 5C4MA 2E87A 3IV6A 1Q5PA 3SR0A 1XZQA 1EJ6A 1UZMA 4Q7MB 3WLMA 4LDPA 2XWBF 2WOOA 4R1MA 2RH8A 4G09A 4YT5A 4IGKA 3V48A 5L7WA 1DV1A 1P7ZA 4PC2A 3JQCA 3UTDA 1ZZGA 5MN5A 1X8KA 4ZKEA 3HNPA 3M4YA 7MHTA 4R8VA 2C1EA 2OD7A 4WI1A 1OTHA 2XNDA 3G02A 4IMIB 4MAMA 5FB3A 4DCCA 3J80A 2AEFA 4EFMA 1A9ZA 4RKRA 3MJSA 4B0OA 1KZ4A 2HIAA 1TK3A 3UHJA 1WR8A 3HCWA 3ZJYA 1ORDA 3ZDFA 3HN2A 3GT7A 1NRWA 2NX2A 3DHWC 1QKIA 2VDWB 5C80A 5LDGA 1E4OA 4TQ9A 3D2LA 3MOSA 1CCWA 1ZH6A 3BWCA 2CLHB 3G8AA 2NVUB 5LOVF 3KXKA 3V34A 2F9FA 1FP7A 3P71T 4H3SA 5KJFA 1HFEL 4UNQA 1BXZA 3AJDA 1J70A 3NAQA 1K7FB 2XGMA 3CZRA 1QHFA 3ZNPA 4HFRA 3TI7A 4LMPA 3GZTB 4RMHA 3E2MA 5ALTA 4C0JA 1T9GR 3EXIB 4TMXA 1OBHA 5HM8A 1KEZA 1V95A 1OLSB 3U3JA 2GZDA 3KM0A 1N0UA 1Q0LA 3QMWA 2DF8A 2DJ5A 1NVBA 2E4WA 4KGDA 5DT2A 1J2TA 1FTGA 4KREA 2OV1A 1YZ3A 1Q84A 1Z6XA 1I2AA 2WJHA 4BKRA 3VTZA 2JKVA 3H9GA 3WMRA 1MIHA 4CQNA 1SHJA 2X58A 3AHHA 1U7HA 5DASA 3G3EA 1NZJA 2YBEA 3ZKAA 3ISJA 5CU7A 2QY6A 3JXEA 1NW8A 4K05A 2Q29A 2XUKA 3OOWA 2IZZA 4PLZA 3JD2A 5EZYA 3TD9A 4D8XA 3NRJA 3E22A 1KP3A 1Z47A 3MMSA 4LXQA 4ZYZA 3BE4A 3DE3X 4B3RB 1DLIA 1M0SA 1EZZA 4G0PA 1NAIA 1W1IA 5K3AA 4ROTA 3THRA 3TKYA 1KMHB 2EFYA 4MW2A 3HPQA 1LTHR 4FKZA 3NETA 3O91A 1R0YA 4M1OA 2EIHA 5AM1A 1AQUA 1GXSB 3V00A 3BWVA 5FUBA 3HHPA 1ST3A 4ARIA 4HQFA 2YV4A 1AUVA 1H8EA 2V9PA 3HEAA 1V16A 4RK1A 1J6UA 1MA3A 2JZNA 2Y1WA 2R4TA 4XSVA 3L0BA 3VH2A 2WHXA 1TAQA 3KJQA 3C5EA 3RU9A 4DSNA 1BVHA 3EQZA 2GVZC 4N0DA 4NNPA 5A6SA 3WL3A 3HZRA 4DRXA 3BTUA 4LFBB 1IBKB 3CMMA 4DJAA 3IGFA 4ZODA 5ARBA 1DAPA 5ALXA 1PBTA 5IW8A 4B6EA 4F04A 3PUYA 4AY6A 1HYEA 4N5LA 1JNYA 3LFTA 3CB2A 4Q7KA 4F9FA 3EG9B 1OAKA 2JIOA 1JALA 5DTRA 7AT1A 1BFUA 4EJSA 5IC6A 1B8NA 2O7SA 2P0YA 4P4TA 1DB3A 3GCGA 2RB5A 1EINA 3IAHA 3IHLA 1N6KA 4Q9KA 3D3JA 5DHSA 3DAFA 3TLJA 3UV3A 1AH2A 3MQFA 3JATA 3PQFA 5EHIA 2IHYA 1M6VA 1S2GA 3CPSA 1NLZA 3PQ4A 4ND6A 3RSGA 5KU1A 5K8TA 3GFFA 2BTOA 5IJ9B 3GLTA 4CU5A 3DHEA 3IBTA 4G5FA 3ZBQA 5IKEA 1XWIA 1Y3AA 2F67A 2GAIA 4FYKA 3U6KA 1ODLA 2KLHA 3R44A 2ZTUA 2EKLA 4NP6A 5CK4A 5LBTA 1CG6A 3CIFA 4OY3A 5TEWA 1WWKA 3C3PA 3V7UA 4JGIA 4ZYLA 3K6SA 2QLBA 1DG1G 3HUUA 3LUKA 1JXMA 1RD4A 1QBKC 1T35A 1XMIA 1HFWA 1KS9A 3K2IA 2QTTA 1QOPB 1RPAA 1SVMA 2QVGA 4MTLA 1F4LA 3RTAA 3T61A 4CT5A 1DOFA 4MPPA 5J4YA 1CUCA 1ESEA 3DWEX 3HO6A 3TAHA 5CVJA 3SJAA 1PHPA 5J3JA 4JI0B 3MMNA 3DMTA 1OXMA 1RM5A 4OV6B 4LPKA 1RWKA 1SULA 2VK4A 4RADA 3SOPA 3WOVA 3EFOB 4BJ1A 4CFZA 5JVDF 2HEIA 3B6JA 1MAHA 4YP7A 5CM8B 3V4PB 2ZBVA 5CVVA 3VVCA 3NO4A 3DBLB 1ZN2A 4TXJA 3LV8A 2YXBA 4RK5A 5I7AA 3G0HA 3M6XA 4KQKA 1TJUA 3C6QA 4E51A 4ZT3A 1DCFA 2GVDC 2IDJA 1RBYA 3EAFA 2PJUA 3GDFA 1N7JA 3D31A 5B1SA 1CEQA 4AKTA 3EPKA 1Z5WA 2JH3A 4XIGS 4Z9XA 4MWGA 4HUTA 5MFPA 1KZHA 1T6BY 2P6RA 2E37A 2BFOA 1IIBA 1VJDA 3L0CA 5JD6A 4JL8A 5C53B 1I4WA 1K8YB 3IJRA 3LLCA 4MROA 2HQOA 2W6JA 4QM7A 1L5MA 3TQHA 2ZUCA 1EUCB 2BRUC 2ZJ3A 2NU9B 2QP9X 1WVGA 4V0RA 3L8MA 4HQLA 2ZYAA 4UBJA 4BVFA 1H0KA 3SICE 3IV7A 1M1YE 3DDCA 2C29D 4DMUB 2NUAB 3KQMA 4EECA 5GIOE 4O4JA 4AF8A 3KLBA 1SVNA 4MGEA 5FIUA 4BGVA 1KKMA 2EBHX 1QCZA 1K0UA 2FZGA 3AEZA 3C97A 4HGNA 1R6VA 1FUQA 4N12A 4UXJA 4Q4DA 3T3PB 1EFVA 2BHNA 2J4DA 2AG5A 5IFLA 2D3WA 4ZJPA 1DI0A 2ZI5A 3ZOZA 1SG9A 4G0OA 1Z5ZA 1JLLB 4LW8A 5IXSA 1QMPA 2Q21A 2JD1A 4AKGA 5AOAA 3NBXX 1DEXA 4P34A 2MYUA 2HYIC 2O7QA 2PPVA 3OOEA 2C94A 4JA2A 2PUAA 1RYZA 4JJGA 3AUFA 3AUSA 4KFRA 4V0OA 3ZZ1A 4WZBA 2VXOA 4RWZA 3V1UA 2BGKA 3EVDA 4GOMD 2JJYA 2QUKA 5KYGA 3FJ1A 2ASVA 3VR6H 4BZQA 1MAWA 2OHHA 3EQ6A 3F6BX 4DBLC 2NTNA 3B1KA 1NBOA 3TK1A 3LC2O 1DC7A 3C39A 3B9BA 3EZ7A 1QGYA 3FUVA 4QBFA 3U16A 2ZJ8A 1WAMA 2P4UA 5IKMA 4AQ7A 2W42A 2BGMA 2QSJA 2DC1A 1LLDA 4FYIA 3JAWA 3T1NA 5LKRA 1UZNA 4LZOA 5DFAA 5F3RA 1CUUA 4TYYA 3ROTA 1C8KA 3EFEA 3WL6A 5CFPA 5DBIA 3DOHA 3JQFA 1DKQA 4C1BA 2G9ZA 5LQCA 2NZ8A 3LK6A 3O2JA 2BUAA 4B34A 1Z07A 1QO9A 3WHKA 4JVMA 3AR3A 3S99A 2FFHA 2DPLA 4Y2QA 1UMDA 3T34A 3BSWA 1ZA1A 2A1IA 1F1BA 2O2JA 4PRKA 3V6LA 1WDTA 3G6KA 1PX2A 4YPOA 4II3A 2O0HA 3WQQA 3ZWXA 1ZINA 4S1NA 2PDAA 2AOUA 5K2MA 2XY4A 3DO5A 1Q1AA 5C18A 1WD7A 4K2HA 3UK1A 4YRBA 5JCJD 2COEA 4EY3A 3OQVA 5BMOA 4ARSA 3F4RA 1LPAB 2E5FA 1E3JA 4YCCA 3BMXA 2EGUA 1W46A 3OQ6A 1G2IA 4FFNA 4CYMA 1Y3IA 2D59A 3QPCA 1FLNA 2WDZA 3UXHA 1U28A 2OHJA 4J2TA 1LLQA 1UP7A 1NF3A 4MO9A 1LUAA 4PS0A 5AJXA 3M4ZA 1ZW1A 2D74A 3EGVA 1DIRA 4PCUA 5DLEA 5CDSA 3ZQJA 4HDRA 3VOBA 4GHWA 1U8XX 1Y8RB 1KH1A 2A92A 2YQ4A 3IQIX 4PZAA 3PTZA 2ZJZA 5K3BA 5BW6B 3RFFA 4EENA 4Z4QA 2NYVA 1BD3A 1ENZA 1GOTA 2C9BA 4KCGA 1ZIOA 2Q46A 5LJLA 4B82A 3UHOA 2I67A 2ZKIA 2G9VA 4NABA 4Y0VA 4YCBA 1G1AA 4ZT7A 4L27A 3QE4A 2AFIA 5CW2A 2FW9A 3EVGA 3V4RA 2DP4E 1F2DA 1GRRA 4RPCA 3RC3A 2JFQA 1NC1A 2GSWA 5IM5A 4HMOA 3BMCA 3DZJA 3AF4A 3CVWA 1D5CA 3ANXA 4UPVA 5B2ZA 5FPPA 4XCQA 4CEIA 1HEYA 5CAEA 3UTCA 2LBPA 2G71A 3DTYA 2HNAA 2QPLA 2Y0BA 3QXXA 5HDQA 2GCNA 2CJWB 1D2CA 4JUIA 4F21A 4I1UA 4C4XA 4EVRA 4GO1A 1RWNA 1TI7A 2YVLA 3DYVA 1NW9B 3NOVA 3DAOA 1Z06A 3QELB 4JITA 3AP2A 4KFSA 1FK8A 3NBYC 3ZE8A 1OZGA 1PEKE 2QRVB 2FWAA 5CB4B 2A0FA 4AMVA 1GZSA 1WCYA 2P65A 4O6VA 3OA0A 1B6RA 1JHOA 4PC7A 3GHHA 2XCUA 4IV8A 1ESNA 1NSTA 2B4YA 4G01B 4JN6B 4PGFA 3SZGA 3WWYA 1XQ9A 1ZCJA 4B09A 1EZ4A 2Z2JA 1T5BA 1DC5A 3IAM1 3CS3A 1H65A 3RVMA 2Q7DA 2AF4C 5BWLA 2WP8J 2JVKA 2ZJBA 4BKOA 2VNKA 3GCZA 2RAVA 6REQA 3EBPA 2HWYA 3RWMB 1KO4A 4W9MC 2AXEA 2BGGA 1SUSA 1IY9A 2UV8A 2LWIA 2BPOA 1T5HX 2BLNA 2JGEA 5CFLA 1IL0A 3DEAA 3GG9A 1G5QA 2RG1A 3A2MA 1KEVA 1NYLA 3EVZA 2EL7A 3QNMA 1U2EA 4LWQA 2VT6A 2C7VA 4LISA 1Y80A 1TLLA 3I2KA 1H66A 4QFBA 4R1PA 4XDZA 2OILA 4XYGA 4ACBA 4FFDA 3TKAA 1NY6A 4FCWA 3QG1A 4ND8A 2M9MA 1T2CA 3FFXA 2OXCA 2R6DA 2XRYA 4HYYA 4KRYA 5JI2E 3FCOA 2GFQA 1OREA 4UUMA 3KJZA 4MQFA 1XEAA 2FEMA 5C8YB 4RL4A 1R8XA 1HYBA 2C3UA 1NV9A 1Y5IA 2MMGA 1Q57A 3BCRA 5A5DA 2QYSA 5H68A 3ZDDA 3ZD6A 4F3NA 4DLWA 2W2LD 2XTZA 3G5UA 3MFQA 3ELUA 4OKSA 2CUZA 3PE4A 2NTJA 4WUTA 4ESEA 2H1IA 2NZUG 2N0SA 1RAGA 3IPCA 2BFNA 2A5LA 2PZAA 5HG0A 5SYMA 1ZJWA 2V3CC 4FP9A 1ETUA 2BFBB 2EARA 4EUKA 2PLRA 4HEHA 1N57A 2WWFA 2EZ4A 3ZN2A 2VPYA 4IFEA 5C8ZA 2LV8A 3KQUA 4OQFA 1FRNA 2CLLB 5B7QA 3KQNA 3U7HB 2QI9F 3VNSA 1C9DB 4OEHA 2H08A 3IBFA 2GCPA 5HKKD 2GJSA 4LQ4A 1YR1A 5KPJA 3D6MA 4LY0A 1FSSA 3I6IA 3PKJA 4FZRA 2Y1OA 1AS3A 2O0JA 3W1EA 1Y1KE 2EFDB 2X9LA 4G4SO 2OXRA 5GV8A 3GY0A 3NWEA 4ZQBA 3RM3A 2HEGA 4BB6A 4YJKA 2QUAA 3VSAA 621PA 3L93A 2GAFA 1LSOA 2Q7OE 4RHFA 1GAWA 2P6NA 3TBFA 5IKPA 1P2UA 2WZDA 1YB1A 1A9QA 2EX1A 4CMIA 1TM3E 2JI7A 5DE3A 4C30A 3V4OA 3UNXA 1XVLA 5ER9A 1U2RA 2GD0A 4ASUD 3DKPA 5BVGB 1XP8A 3ND8A 3VAZA 1COZA 3VYUB 1AIPA 1YCHA 2XD4A 3CR7A 4MUKA 1EA5A 3EVBA 1C0IA 3MM4A 4N4AA 5TT0A 3HMKA 4HWSA 3WAJA 1YJ8A 4IUYA 4PCAA 3ETGA 2H59A 3NHAA 3BGSA 4DHWA 3A3YA 5TRTA 4MRAA 2F1JA 4ZCIA 2BUBA 1DKMA 4LCBA 4ATNA 1CHNA 1Z7WA 1H4SA 2BTQB 1N0WA 1TKAA 3I8SA 1Y98A 2EZ9A 4H27A 2AEEA 4MCIA 4X71A 4NQRA 4OMUA 2JLZA 4C6RA 2MTBA 2D2IA 5EL0A 1A8IA 1W0CA 1SD2A 4D7AA 1HF3A 2OBLA 1DIOB 3CR3C 2P68A 1PEYA 1IHUA 4DA0A 2JI8A 3QVVA 2C7BA 2VDWA 2XOKA 4G8JA 2E4UA 3G23A 3UA3A 5LWQA 2NVUA 4GF5A 3UK6A 1PDVA 2R48A 3BULA 1MRNA 2E48A 3QVLA 4Q1AA 4TN1A 3ZBUA 3ZX5A 2VYQA 2B3TA 2B61A 3EC7A 2PBFA 3B1YA 1VL8A 2YINC 4MB0A 4B48A 2QLJA 4XIFA 1VSVA 3T1TA 2Z3VA 2P1DA 2RGXA 1HE1C 3HU3A 4LGVA 2VPXA 1OLSA 1M8PA 1XYYA 3DC2A 3SYNA 3T99A 3ZHCA 1Q7EA 4BAGA 4E1AA 2OKCA 5HS6A 2JEZA 3BRCA 3W8FA 4TTSA 2C54A 2B4AA 1N0IA 2XB6A 4HRVA 2WD8A 1S2DA 2QT9A 3K1ZA 4X1KB 3WGLA 4CMEA 4DLRA 2BGTA 1R88A 2Q4EA 1L0BA 1NJSA 2VDPB 2JGLA 2ZIAA 3MRTA 3Q98A 2ZI4A 5BPHA 4C5CA 1A8QA 1Y5LA 2C1ZA 2DTXA 4DA6A 2IWHA 5KTKA 3HBJA 5CM2Z 4DDWA 3ZH2A 4XD7A 3GEBA 2GA8A 1Z4PX 1BEEA 2EEZA 1LRJA 2AZ4A 2HBQA 3OFNA 1M8JA 4ZOLB 5DNYB 3JTEA 2H18A 1QUEA 2I8CA 3HB7A 2I0FA 1KMHA 1FU4A 4HYEA 2OG2A 5BOVA 3NT4A 1CBUA 1FLVA 1Z29A 2BYTA 5CA1F 1FDWA 1YL5A 1A1VA 4ZT5A 1M2WA 1GXSA 1L5KA 2B8EA 4J9VA 1LBQA 4Z7QB 4K9OA 4PZCA 4CM9A 3QJ5A 5TMDA 4S1VA 4XUCA 1S6YA 4H16A 4OHVA 1T4BA 4P5EA 1WOYA 4IDEA 2X4GA 5F12A 3VZPA 2OY0A 5AUQA 6PFKA 3A1TA 1S4QA 3NKLA 2FPSA 1QUFA 3GJQA 2WMNB 3HM2A 3IR6A 1U3VA 4HPWA 4U7HA 4H1WA 2J08A 3I2JA 5BVHB 5JD3A 4YQZA 3DUFB 4MZDA 1OA1A 1G6HA 3ZIDA 4URVR 3EGWA 3VDQA 1E6CA 1IHDA 4B3JA 2BF4A 5THXA 1FIUA 3G2IA 4MARA 1NBWB 1ML3A 5EOVA 4GLLA 1U65A 3DBRB 1E6LA 4IJKA 4QU5A 4E4RA 4NFSA 4QGSA 2C78A 1SVSA 3EG9A 3N2EA 1G3UA 1MOQA 2WSYB 3PUXA 4FGSA 2XT0A 4RHXA 4KLZA 3NIGB 5JYBA 3T1VA 3FWZA 2AQHA 1Q0SA 5LBUA 2HDOA 2IEIA 1FURA 3FB1A 2FSPA 3UCFA 2H4FA 3OZWA 4M37A 4C3UA 4HAZA 1ETHA 4WLFA 5EG5A 4E31A 1RW4A 2YYYA 3AJEA 3NHPA 1MPXA 3WLPA 2G76A 3KZXA 5I47A 5JBIA 2Y67A 3KO8A 10MHA 1QHSA 1DEOA 2X5NA 2QG4A 1YE3A 1JKJB 1RHRA 1I2BA 5IJ9A 2Y9PB 3L9WA 4EA9A 5LQKA 3FHJA 4N0MA 1NW6A 2AG6A 2YHBA 4PM4A 2BEWB 3BE6A 4OOEA 3W9SA 3BGDA 5EIHA 4DDHA 2DQKA 5LUAA 3NAGA 2IDMA 3D4IA 1E98A 1N7IA 4AIRA 4OQEA 1V8OA 2ZBPA 1NVXQ 3ET5A 3D6JA 2PK3A 3TLGB 4WV3A 2J7PA 4WVLA 3VJRA 3CLHA 1R8QA 1Y7TA 3C3YA 4M54A 4S12A 1PUIA 1E4VA 4QULA 2J6BA 4Q9LA 2JH9A 1HDEA 3U5ZB 2MCFA 4DUGA 1YR8A 1T1EA 4PN3A 1FTNA 4YCMA 3V2GA 1Y1RA 1DRWA 1ZI9A 2H4YA 1W6RA 2I6FA 3EFOA 4PCLA 1X1DA 3HH8A 4H1UA 4KP7A 1Q7TA 3WGVA 4YRIA 2IDZA 5FH9A 3DBLA 3REGA 2W8BB 4BCCA 1FXWF 5EFOA 1JECA 4Y98A 3NU1A 2ODTX 1GKLA 1MNQA 2R65A 3GLGB 4OQDA 1VGQA 5FL7D 3X1WA 4PC6A 4KHPB 2WT9A 1W19A 1GCGA 1UMCB 2OC9A 1CY4A 1MTOA 3EUEA 4H7JA 2PY6A 4M1QA 5FOVA 1R5JA 4POOA 1IN7A 1CJKC 4IH4A 1XHLA 5KQLA 5L95A 2MSDB 4YS6A 1USIA 5U9CA 3AC0A 5CFQA 2PL5A 4DA9A 3U1BA 1ULAA 1EUCA 1T3LA 4RABA 4ITRC 2WTMA 3R41A 2NU9A 5LNK6 5CT8A 4BFSA 1H2EA 3T9DA 2ZSDA 3OLWA 4LZNA 4D8TA 3DV0B 1XCBA 3AHCA 3OBIA 5KJCA 1Z4LA 2NUAA 1VP9A 3RTEA 3GVHA 2Q1YA 2V9CA 2O8EA 2A0UA 2ZE8A 2E6UX 2Q5LA 4TKMA 2PAAA 4KPUB 1YOBA 4TPKA 4BV8A 2X3FA 1NBEA 3DD5A 3I9FA 4MR8B 3AWIA 4R1UA 3A7DA 5LB2A 5B4UA 1GYQA 2V58A 1JLLA 3ZJ4A 2G7ZA 4MQ4A 4IQFA 1NTOA 3O8OB 5JNUA 3FKSD 2WKSA 4KRFA 1FTQA 2C4MA 1J20A 3D0QA 4FDAA 4WBXC 2ZAIA 5E9QA 2V8OA 1DMSA 5JAQA 3T1YB 4FD3A 3ED5A 3ICEA 1L2TA 2E55A 1V5GA 2WZBA 4DBLE 2VH5R 3N2KB 3SD7A 3FD8A 3I8XA 1YRYE 2WG2A 3MCAA 1TT5B 2EIXA 2A6PA 3LT0A 1B6GA 1WPRA 1UBRS 3UOAB 2NXJA 4QUAA 3AX6A 4UW9A 5FJJA 3AI2A 3VR5H 3I04A 4DILA 4U7FA 3WHPA 5KNBA 5IJAA 1O1YA 2SICE 4D4LA 5LMUB 1KU0A 4N8EA 3SC2B 5JLJA 1GUFA 2B2NA 1SXIA 2OZVA 1ABBA 3CXRA 1UINA 1IEQA 4JYBA 3AHEA 2PT6A 2WWHA 4XEUA 1ODIA 1TF7A 4MS4B 3RE1A 4CIXA 4KG7A 1Z8HA 4PG4A 3TD6A 5TS3A 3ADDA 3R9XB 2GTPA 5KTMA 1V5WA 2CVFA 2HHCA 1I2MA 3DTVB 1Q3TA 1XROA 2GUWA 3R6LA 1J0DA 3BWYA 4RD0A 3ESCA 4KE9A 3KOMA 3SFTA 3MJEA 2FP4B 3KT3A 3VU0A 4BNFA 1J09A 1J00A 5FBKA 4ESVA 5D8DA 1Y1SA 4KXFB 3G2MA 4MJLA 4UNPA 4RSHA 3RS7A 1L4KA 2RHTA 4GZMA 5EJ9A 1X70A 4NCHA 5DM0A 3CSUA 1QPZA 3B1VA 2BKLA 4N5MA 2Q4OA 3FMIA 3HB9A 4Q9NA 3ZE2B 1FZTA 4M98A 1T10A 1YZUA 3A9RA 3HFJA 3MCWA 2WUVA 4G4SP 4HXEB 4MA4A 3AJRA 3IA2A 5SZHB 4OH7A 2JFPA 2Q62A 2G9NA 2VHYA 5CG2A 1JSRA 1E1MA 2WYWA 2CNOA 4UUNA 4HDAA 1B8VA 3P52A 3TQSA 4QJ4A 1WV0A 2GWHA 1Y8RA 3SZLA 1ZCBA 3OFJA 4OXXA 1DHTA 3WGMA 1TGYA 4P54A 3NBUA 5H59A 3LKZA 5I9MA 2C8VA 4J7UA 3ZVMA 4KYVA 4KH0A 3CX3A 1U11A 2FUG1 3C24A 3FYDA 3RANA 2QUZA 3ADPA 4ZFNA 3BQMB 3E84A 3ZZMA 1E2HA 1IBSA 3DE4X 1K5DA 5FR1A 4EPXA 3K1TA 1CNMA 5KTYA 1FNNA 1DELA 4OGLA 1Y37A 1W87A 2TMGA 3A9WA 4EYQA 2AEMA 2I91A 1YI8A 2F8SA 1I4TD 1XTPA 4UHJA 5KAMA 4ZKDA 4B46A 2D7DA 1C8LA 3ENVA 3TQQA 4Q6BA 4YALA 1RQ2A 2XE7A 4GBJA 4DSTA 2WVAA 3RBZA 1JA1A 1ZXLA 3QELA 2P0EA 4QYMA 1ENPA 4ZC8A 1NR1A 1NX6A 2QRVA 3H5WA 5CB4A 1KXJA 4NJMB 3GLRA 4L8YA 4MOWA 3ECSA 4UHEA 3PQ5A 1CF2O 2UYCA 3PPIA 2ABWA 5FWNA 1P7PA 4DKJA 2ZLBA 3I09A 4HLUA 4R2JA 1ZNQO 3USCS 3BJIC 2AW3A 3WKEA 1J4AA 3O7WA 4KPYA 2I3AA 4JL6A 1C8BA 3UQZA 1QFMA 4G65A 3C7AA 4RH1A 1MIOB 4KYTA 1MB2A 5F35A 4L4ZA 1NWHA 3KWLA 4RCZA 1E2EA 2VYFA 3MWEB 3SE7A 4E5DA 121PA 2JGDA 2KHZA 2ZJ7A 4RYDA 5EE0A 4W7IA 3V8BA 4XWYA 2C0PA 3E2IA 2P9CA 4CL3A 1D6JA 2EC5A 1L4BA 4I5EA 3UXYA 2WAYA 4D6XA 2IUTA 3MGBA 1XCLA 2RGAA 4IF6A 1UQUA 5C8YA 4B6QA 2ZIWB 2PR2A 2WYHA 3MCUA 4HJXA 3VDXA 4FX2A 3WDMA 1X19A 3V8VA 1L4EA 2FAXA 5DB4A 4D45A 4EDHA 4I55A 4F1JA 1YRWA 3U31A 2CNBA 3W7AA 2HAEA 1C9YA 4I8XA 4KXVA 3LPMA 3PUZA 1W9HA 2BELA 3AV0B 3LYLA 4UBKA 4ZT4A 4E13A 2HV8A 3F4KA 5AUOB 1CZKA 2OO5A 3PDHA 3B5EA 1P44A 2CBGA 2JIZA 1M0TA 1YNOA 3AFOA 5LZ7A 2BFBA 4YJHB 4DQKA 5ER6A 1O0BA 2JGAA 2P9YA 2QTLA 3FTDA 5K01A 2P0AA 1JVSA 1MV8A 1PO7A 1CZRA 1NXQA 3OTGA 4YREA 1A5SB 4NQZA 4MUJA 1SCBA 4WERA 3GJ6A 2C1XA 2OORA 2WK1A 3TSAA 4CQJA 1LDNA 3GGCA 3P0HA 4L6IA 3P2OA 1OXTA 1NPTO 3H2BA 4AUEA 4D9BA 2EFGA 2YNMD 1RIFA 2CLIB 3C8ZA 4BNNA 2RH9B 3HVHA 3S7TA 2AKYA 1J2UA 3H9JA 3UQYS 1ZESA 3IJ5A 1IOVA 3KQWA 3FVWA 3VTAA 1RPNA 5IS2A 1X7YB 3DONA 5G3YA 5HKOA 4AYTA 3DT8A 4QPNA 3A58B 2VL7A 3QKUA 4X0EA 4LF7B 4MWEA 1HT0A 1E9SA 1L7RA 1Y4UA 2OAEA 2VS1A 4G0XA 2FPKA 3JYNA 3OLZA 1SQ5A 3I64A 3W2HA 4F86A 5JJLA 3OEHA 3U3KA 2FDRA 4P7KA 5BVGA 2NT3A 1GV1A 2P6MA 1T1GA 1VLMA 4PYIA 4H18A 2W2MA 1GKKA 2B98A 1EBBA 2RGUA 3DJYA 3AG6A 3BB3A 3OTWA 4Q03A 4KR3A 2O6HA 1RYYA 3MRXA 1K7XB 4EHIA 3TFQA 1BMFA 1LBIA 2D0PB 2QW0X 4FM9A 3BILA 3N8IA 3TRIA 4OX9Y 3VU1A 4J2OA 4EHKA 3A3OA 1PS0A 2BTQA 2ZR0A 3BS4A 1HQCA 3DL2A 3Q7EA 4RL6A 2ZJ4A 1N6OA 1YA6A 4EHFA 4I9UA 1C1HA 2P2ZA 4OUDB 3WIVA 4JI4B 3T5CA 2KE5A 4ERXA 1DTWB 2HNKA 4GMGA 4PANA 5EPUA 2AGVA 1Z9BA 2ZJFA 1JIIA 2PX3A 2PT5A 3D1JA 2GCOB 4DSUA 1XWFA 1Z2EA 5ICFA 1SBYA 1FRQA 3TGPA 2YWHA 2GEBA 4QU8A 3W1VA 3DM5A 4NCAA 2A7XA 2UVDA 3NB0A 3NTOA 1TFUA 1TKRA 4FGJA 4O8ZA 4EJFA 4JYAB 3WK4A 2FHPA 4LZLA 1HDRA 3BSSA 2Q1XA 2WTAA 3JYLA 4E2ZA 3GA5A 3VX4A 1OILA 4FPXA 3MT7A 5DYNA 1DJLA 4PG8A 4L4UA 1YUBA 3MMPA 3I04M 2EQAA 4WFQA 1O97C 2FMFA 2FWJA 5BUQA 2HBYA 3GH1A 1CQZA 1P2TA 3G79A 1P1RA 3GNTA 3JR3A 5IARA 2QVCA 2Y3IA 1K2WA 2X2EA 4J6EA 4PSUA 4Z4FA 1HZZA 3D8RA 3DSRA 4A2WA 3JAMA 1HE8B 3A6HA 3NHMA 4BKMA 3IUPA 1CUZA 3EA0A 2YS6A 3IRUA 1VXRA 4GPEA 4KMOA 3BFVA 4X1KA 5L53A 4Q9JA 3PA8A 1N2GA 3MSXA 4L72A 1KDYA 5G53C 4RKWA 3W04A 5DNVA 3SS7X 2OCLA 5EQJB 1HQKA 1NP6A 1ESMA 1MXFA 4RPGA 1UKEA 3A1CA 4WXPA 5KQMA 3MEQA 4RGVA 4IVRA 3WK9A 2VWPA 3OZCA 3L8CA 1NNSA 2G9QA 3NHRA 1R5BA 4QUBA 4ZOLA 3WGNA 4DT1B 3FY4A 4CKZA 2X5KO 3SQWA 3O21A 1XHFA 3LHKA 4M8IA 4YDHB 5LWHA 4MCHA 4RTLA 1MVLA 1EHIA 3GA7A 1E0KA 3NGXA 3T3NA 4RS3A 4J75A 3ZWBA 5IK2A 3T5DA 3LO8A 3GRFA 4DIFA 5DM2A 4MIYA 1NY5A 1VHDA 1ZFNA 2VTDA 3OTIA 5H80A 2XUQA 3SSAA 1L5ZA 3SY8A 2XIJA 3P97A 4PAWA 5LP6F 4L3WA 3VR2D 4TV8B 1EGAA 5G0VA 3CVOA 4KBYA 1SKYB 4MV0A 1W2WB 3LFHA 4GOLD 4YV2A 3BM5A 3RV4A 3I1JA 5BVHA 1BOFA 1YTLA 3DUFA 2AW5A 4MEJA 1V2GA 2R6CA 2IS2A 2V7VA 1SXJB 1ENOA 3II6X 4RKYA 4QX6A 1W2GA 1PR1A 1Q0UA 2CUTA 3V7FA 2ZWAA 1BU5A 3DBRA 2FPIB 1YCGA 1A98A 4JB0A 5GWXA 1PQUA 5GGYA 2JZOA 2PIDA 3DVRX 3P4UA 4BMYA 3NM4A 1II0A 3FDZB 5FLYA 5THQA 3AEKB 2IW3A 1SEVA 3RGWS 3L6OO 5IMBA 5LCXA 4L2IB 3USES 4CGYA 4XQEA 3TXYA 1KOJA 3EX7C 1P81A 1L7OA 1H4VB 3CN9A 2IF0A 3FTEA 4MULA 4YDSA 3HFSA 1L7PA 1PZEA 4J3NA 3ZI4A 3TOSA 5A4KA 1NFQA 3GV0A 3F1LA 4ZWNA 1QR2A 1JKJA 1VCHA 4E6PA 2K2WA 4TYQA 3E6AA 4EYGA 1WE2A 4KBGA 3G89A 3A9UA 3FRIA 2W58A 2R96A 1TGVA 3GGDA 2QSUA 4CM1A 2PZ8A 2BEWA 5BN5B 1G20E 3QQPA 4Q1BA 3ND5A 4EJSC 1KY5A 2KJQA 2NAFA 4GSKA 2WLSA 2XCOA 2W2VA 3KLPX 4IG4A 5DV9A 2PH1A 4OP2A 3OAAA 3SAJA 4X65B 3CEAA 4IH1A 1RAHA 5CTJA 3WGZA 2Q41A 1WZ2A 3I6QA 3TLGA 2I2DA 2GF9A 2QZSA 1YBVA 2O8FB 1HKUA 4Q9IA 1Q3HA 3D1VA 4FR2A 4BE4A 3FKJA 3U2QA 3HKCB 5HSGA 4AJ4A 3S6JA 3HU5A 1JEOA 4QEDA 3A26A 1JL3A 3FFWA 3M3DA 3CW8X 2Y93A 4UQLA 4ZDWA 4D26A 2DB3A 1DBSA 3MCZA 5B37A 1KJIA 2B92A 4KSYA 4DEYA 1SVOA 4K6OA 2ECQA 1KEWA 1T2FA 1WMFA 2IX9A 2HSDA 3JVVA 3KG2A 4JB3A 4UZFA 5BW8A 2FY8A 1AX9A 2F3QA 1DU4A 2JFUA 1Z4MA 2W8BA 4WZZA 5FOSA 4G97A 3WZLA 3GRCA 5EQFA 1YMQA 2Q2OA 3GLGA 2HBRA 3AV3A 3FE2A 1IATA 2GEJA 2YRXA 3LC0A 1P91A 1Z5VA 1UMCA 5G2OA 4YP6A 3LQ4A 5TJHA 4QSMA 4C7JA 5A1TA 2Q7XA 3H1AA 2ZR7A 1XA4A 1JG2A 1Q0HA 4NYJR 3OVMA 3TI9A 5F92A 5HF9A 2PXAA 2FN9A 1RI4A 2A8YA 5KSZA 2Z2KA 1K6IA 1J9EA 2OXFA 3LAWA 1PTJA 1XG5A 2FEPA 1T36B 5TEVA 3RFXA 4TXNA 5F2KA 4M0EA 4AY4A 5JHGB 3VFDA 4QJIA 2X4LA 3PG5A 4G25A 2UAGA 4EZIA 3DV0A 5CVUA 2FMXA 3AR8A 3AHIA 3K8QA 3G7UA 3U4HA 3PLAE 2KX7A 4PQFA 4FONA 5EMJA 3KALA 1XIVA 4HMQA 5P21A 1R50A 1X7DA 3EISA 2BZ1A 4I4TF 3WIUA 1V8FA 4KPUA 3C4QA 3GQBB 5CD1A 2Z8ZA 4MR8A 1AT1A 4HB4A 2VP6A 5JD4A 2ZRDA 3ME5A 2GPYA 1CPYA 2PM8A 4LJLA 1P5RA 2H29A 1U1FA 2ENWA 3L8ZA 3Q3GE 2QRNA 2V4UA 4ND4A 4L1KA 4NCJA 3SXJA 2IF2A 4YBRA 3O8OA 4TSRA 3RK0A 4E5NA 4BJHB 2CFSA 1IHPA 4CF4A 1K88A 1Z2PX 1C29B 1I3LA 3CE6A 1TJNA 1UC8A 1W5AA 1H3NA 3N2KA 5BSFA 5SICE 4LF5B 2G5TA 1H8HA 3AJAA 4ABTA 2CSXA 1TT5A 3K9HA 1T6YA 5KQRA 3KOUA 3AUXA 3WYCA 1CFJA 1U1DA 3L0ZA 4YK7A 1QTQA 2ZIUB 2YOGA 4J0QA 3DYIA 1TIPA 2BIFA 2IELA 2EFEB 2ZSUA 2Z95A 3CSDA 4R2WA 1D7OA 3MAGA 1SGWA 5JCPA 4R8SA 3TLMA 4FILA 4UAJA 3DLHA 4ZO4A 5H83A 2O2HA 3SC2A 4PPNA 4CCAA 2HREA 1P74A 2IA5A 5LQRA 4ZTZB 4EHLA 4WOPA 4CETA 1KZ6A 2XDQB 3Q87B 2QS9A 4KQMA 4MS4A 4O5OA 3ZZUA 1LI7A 1G19A 3R9XA 3UG6A 2O06A 4QTZA 4I1PA 3DTVA 3DAYA 1XFAA 2XTJA 4GEKA 4MDEA 1YVEI 1IOLA 4IPTA 1YQXA 2JLBA 2DBQA 2QQFA 1KZ1A 2FP4A 1MJNA 1AF4A 3KE9A 2XUOA 3QU2A 4P92A 4EKIA 3FPBA 1M0EA 4R8KA 5CLGA 4I9GA 5ISMA 5HHTA 1J8YF 3LUHA 4IRUB 4KTTE 3BT7A 1QH9A 2IY8A 1BH2A 1OVGA 2HQ1A 3NJRA 1CUGA 1TEHA 4L74A 3VSEA 2Y92A 1GPLA 1RYBA 3IIMA 3NNDA 3PUJA 1L1QA 2ZVPX 3KQVA 4URWR 2O54A 1YRBA 1C4KA 1YK0A 1PJQA 1WUKS 4A6DA 4ENTA 2C4UA 1PT7A 5TS2A 3ROXA 4N65A 4B4DA 1O4WA 4Q4AB 2BKEA 2BMAA 4GZLA 3B2QA 3AVQA 3QY0A 4KN6A 3H2ZA 4AW9A 4ZYXA 1K27A 4H35A 3RUIA 3ORSA 2BKVA 1EP3B 2JJ1D 2VQDA 2FGJA 1J97A 2IEDA 2ZS9A 2E1PA 2XKBA 3WXMA 3GBSA 2VP0A 3M5CA 1SUBA 2XF8A 4MRNA 4GR5A 4R9NA 5EESA 2AOXA 2YN2A 4LMAA 3ZOKA 2ZRNA 4DAEA 1J8QA 1TJWA 3U4QB 5K20A 1XTUA 2J87A 1HO3A 3KCNA 5IMSA 1AMNA 3DFZA 3GC6A 3EDMA 5J4VA 3KS9A 4I4NA 4YIHA 3EEQA 3H3XA 4K3VA 5CH8A 5FOXA 3R5SA 2FE4A 3REQB 3MMZA 4LTNA 4Q3AA 2PUFA 3F4TA 1RZRD 4LJAA 1GA6A 4XGIA 1YHNA 1CK4A 1ZD4A 2C07A 2EW8A 3DT9A 2YOFA 2DHCA 4L0MA 4DUZB 2NU6B 1JEDA 3U3MA 4KOAA 1JV2B 2WYUA 1DQPA 1VCNA 2NUTB 2VJQA 3WGTA 1I7LA 2I7XA 4HBZA 4NJMA 3G0BA 1K3FA 5DK6A 2RBGA 3K0EA 4JLOA 4KIGA 3K71B 4Q47A 5D3ZA 3GRRA 3IUMA 2UYYA 3NHBA 3PUHA 5UKDA 2DM6A 3JQDA 2XBMA 1TO1E 1AKVA 3C43A 1QB8A 2FWIA 4JYMA 2B7CA 1UBLS 2CVPA 3TLEA 1Z5NA 1WHTB 3RROA 1O94A 1WCV1 3LIIA 3NKVA 1JQEA 2ZZMA 1V1MB 1FQWA 2HRRA 1LVHA 1QNLA 4RK0A 3TR6A 1MIOA 1Z7BA 3KUCA 4E32A 2O5EA 3PEFA 3FCEA 1KH3A 1LFDB 3ZDZB 4ZEVA 2JH8A 1NC3A 2PANA 1V41E 2II6A 3MWEA 4FGWA 1OWLA 4QBHA 1G3RA 3Q8XB 4TWBA 4C04A 4JGBA 1GSIA 3NASA 2WV7A 1J33A 2FJPA 3E8SA 1PZFA 5FNVB 3I23A 2FMUA 1F8GA 1KQPA 3GP8A 4G63A 4ZQFA 5A4MS 1SHZA 1ZLXA 2FW8A 1XZLA 4CMJA 4KX3A 4GE3A 1EXMA 1SUWA 5AOCA 1SKQA 4LDJA 1L7EA 2QPTA 2ZYWX 4L8GA 4ZJUA 2WJPA 1W36C 2B69A 3R8XA 3K6JA 1US8B 1UQTA 3RUHA 4MR7B 3DE6X 1Z82A 3BEOA 3HJAA 5KX5B 1DX6A 2ZWVA 4XOIA 3W34A 2D0IA 5KTSA 4M0KA 3QBTA 1NSYA 1ZD9A 3REOA 2WIKA 5FUQA 3FM9A 4YRSA 1M2FA 1Z45A 1G7RA 4LV5B 4NS1A 4F3YA 2NQ2C 1FQKA 4TMTA 3UUEA 4Z7NB 4YJHA 2IPXA 5CCEA 2VHTA 5F78A 1BN7A 4QLBA 2QGFA 4MX2A 3HLTA 4A26A 4K9KA 4WOCA 5KUTA 4CG3A 3C5HA 1TAUA 4UTZA 1OC2A 3HXPA 3I2IA 5DSZA 4OG2A 3UKJA 3G85A 3H4TA 2DY0A 4RD6A 3BWBA 4ZAWA 4AD8A 1DIGA 3AILA 3U61B 4PNPA 2C9CA 1CJMA 2IGTA 1EH5A 2BF7A 4URZR 2CFIA 1AZWA 5B58T 1FMLA 2HPVA 2PKEA 4OL9A 3LUPA 3T0IA 3LQQA 1VBNA 5F9HA 4NH0A 2ZRFA 3A32A 3RS4A 1IPEA 3WXBA 5FEUA 1S02A 1JTEA 1F0KA 1VG9B 4YT4A 1X7YA 2DQZA 2IPLA 2P78A 2R7MA 2RHCA 3CLUD 1DJMA 1NQTA 5CB6A 1SVUA 1SC9A 2VT7A 3BXGA 4HX9A 1C1YA 1F2VA 1GLNA 2YC2C 3GIWA 1JSXA 3JZDA 1FEZA 2N1MA 2X7JA 2Q6LA 5AW4A 3L8GA 1P0CA 5B1IA 3RIYA 3O3OB 4UHCA 5IVPA 2GZRA 1GDDA 1RKQA 5B57C 1PJ2A 3C1UA 4FE7A 3ZDCA 1JAYA 2ERCA 3OD1A 4ESHA 5AVUA 1GVHA 5FDFA 1T8RA 3MILA 4YYZA 5JJCA 2QU7A 3P0IA 1PLKA 4Z3OA 4MA5A 1WZEA 4UULA 1R0CA 8GPBA 1LZLA 4B6FA 1KVRA 4UARA 2Q2WA 3FROA 3DNFA 4B2PA 2XMCA 2J5XA 4Z2AA 4OUDA 4YQEA 3HY6A 2GRUA 4BMXA 1DTWA 3PHHA 3KV3O 2VJPA 5HUQA 3CEMA 4YP0A 2GCOA 2GR9A 3FOFC 4UM7A 3O9MA 4C2TA 1OX6A 2V0CA 1CF9A 2YY6A 2B30A 4GSYA 1QE5A 4KWTA 3SVZA 3VDNB 4ML3A 1ANKA 1OI4A 4I1SA 2VQFB 4V0KA 3B3JA 5B3JA 5AVVA 1OV6A 2WMDA 3OIFA 5SYNA 1XZJA 2XYRA 3FMFA 1QF9A 4MQEB 4O2RA 2GK7A 4OHCA 5ALEA 2PUJA 4ARVA 3BG5A 2I8LA 3O7MA 4LG1A 4B5KA 2IFTA 1KVUA 3GDOA 4F4CA 1G6KA 4OSEA 2OO7A 1E2FA 4HS4A 1A4UA 1QX4A 3W90A 4YMGA 4NZ9A 3F90A 4MS1B 2FQXA 5KQPA 4MI1A 4V2IA 1INLA 3FSGD 3L8EA 2PFMA 4YQYA 1ONOA 1B8UA 2YH2A 2FW0A 3EVCA 1XTVA 4WGGA 4NZPA 3CT4A 3UMJA 3KPJA 5IP5A 4FHZA 5L40A 2OMEA 4HFJA 1JKFA 3BFXA 4RV4A 1OWMA 3LGSA 4BWFB 5DYYA 4C5BA 2F62A 4YRCA 3UWSA 3L7YA 5AKHA 3VBEA 1B93A 2XVZA 1A9RA 4BNJA 2GXQA 4BTEA 2QTFA 1YTUA 3KWJA 1D2AA 5JATA 3HC7A 2JI4A 3IT2A 3M6MD 4M9ZA 1XJ5A 3LNTA 2IH4A 4IOJA 1I1NA 1U2QA 1FL9A 1E1RD 2ZUBA 4NR0A 5FTMA 4DT1A 4Y9RA 1VBMA 1DDIA 4M49A 3P9SA 3MCTA 1DBIA 1KAOA 4TVOA 1FX0A 1W34A 3KAPA 1U15A 3PQ6A 1CYDA 3ES9A 3GAZA 3MIIA 3BMNB 4B3BA 5IABA 4NLEA 5EXTA 1ZOIA 2DHRA 2PUGA 3AB3A 3RC7A 1TNDA 1QQBA 1XCGB 1Z2CA 1PK7A 5KVSA 1OUMA 4X45A 4CMEC 1ISFA 3REFA 1WUHS 1JSCA 1F5SA 1XX6A 2SKCA 2XWJI 1UH5A 3GJ4A 3IVCA 4MQ6A 5DTJA 5LXTB 2A3RA 2BFPA 2LPMA 1VECA 1BA2A 3E8XA 3ZGYA 4B3MB 4QJBA 4TV8A 1BJTA 2NACA 4BUZA 2E18A 2AXPA 4QDOA 4QYIB 2M1XA 3R5TA 1PI3A 1SU8A 1R18A 2HIMA 1MJHA 2JF0A 1H2AS 4LCJA 2CWDA 1XA0A 5GINE 1WUIS 4R2MA 5FBVB 3DBHB 1YU9A 2A94A 4ER5A 1SXJA 4A6XA 5LP1A 3ZJUA 5K6TA 4FMPA 1TJ5A 4V24A 2IHUA 4EA8A 1BHSA 1YR6A 5I8PA 2XA1A 2JAOA 2FPIA 3O47A 1K92A 1DT5A 1CZLA 1P2FA 1QG4A 2IKQA 2PWAA 4NYIQ 5GJVC 2Z4RA 2VEOA 2C42A 2A30A 5IVDA 4F46A 3FDZA 4RKQA 1EHCA 1RDFA 2O2YA 3AEKA 2CNKA 4M9SA 4QXRA 1YBMA 4L2IA 3GUVA 4Y9DA 3KB8A 2KI5A 1T3TA 1XD8A 4HLQB 2FEKA 4MUXA 1M9NA 3GTDA 2VH1A 4JT4A 1KI7A 3CH6A 3Q41A 2A0YA 2ASEA 1O54A 1R37A 3B8HA 3O75A 3VPFA 1TUGA 2I54A 3E1SA 4GZ5A 3QX7A 3B1ZA 3UAYA 3ZHXA 4B74A 3PEVA 3E9RA 5DXFA 1Q77A 3AF3A 5K3DA 2PUBA 1XGKA 2D54A 3M5WA 5BN5A 4UM8B 1ZEMA 3GFOA 1YFKA 4KFCA 2RGYA 3Q3IA 1L5LA 4MWTA 2TYSB 1FCJA 1QVZA 3G17A 1N4AA 5A3QA 1PZNA 3KELA 5A4JA 2O8FA 2J0EA 1AMOA 4M8LA 4LFAB 1FDRA 3EK2A 1YJ5A 4K9NA 3WVNA 5F3WB 4EP1A 5AKLA 3HKCA 4J91A 2YIJA 2F6RA 2I3ZA 2VUTA 2QQ5A 3WL5A 2XZOA 1ILWA 1E1YA 3QU9A 1T8UA 5JDIC 3KD2A 1D0IA 2H31A 3DHVA 1U5BB 2IHJA 4M9CA 1A2OA 2ODAA 1Q1BA 1TZKA 1NQ5A 4Z54A 2MWMA 3KIPA 4P83A 5CA0B 3EPLA 3BORA 1NDUA 2AE2A 1JG6A 1V6AA 1KY3A 4XLZA 3QU4A 2D3TA 1F5NA 4UZEA 1B73A 3STUA 5AVWA 4L5AA 3MT0A 2OB2A 1PEAA 2O1XA 2OSVA 4V0SA 5E2BA 3NR2A 3Q40A 1AA9A 2ZT7A 5A3SA 1N9GB 3K70B 4PTZA 4HDOB 3C4JA 2JJ8A 4C89A 3F6RA 4OPMA 4LJ7A 4F9EA 5L45A 1ZMRA 1BE8A 4D0GA 1VYUA 1JBQA 4GT1A 3SDBA 4REOA 1QVAA 1T36A 3LYUA 4H6PA 3TCNA 2OK7A 2O6LA 3WK5A 2FPWA 3QG5A 1RYDA 1I4DD 2CXRA 4J94A 1NW7A 4QUKA 3TW6A 1V26A 2VRNA 2G9UA 1FMFA 3SM3A 3U4CA 1HRKA 4XSHA 2ZUFA 2GPWA 4MW0A 2RGBA 4CLXA 4KMMA 1S2NA 5DWQA 4AJ9A 4F0JA 2F3PA 4P93A 4P6VF 3PHJA 3GFGA 3GQBA 1PS8A 5LSAA 2DYKA 1JFVA 3OLXA 3N53A 2W00A 2AOTB 1ORHA 1UJ5A 1DUVG 1LSJA 3ZGOA 1NA5A 2R0QC 1W25A 3EN0A 2BR3A 3G5AA 1QONA 2RSLA 1H9CA 2P7HA 3BD6A 1N6IA 3QHQA 2J07A 2CBXA 1NV8A 1B0AA 1IOZA 1M3SA 1S3SA 2ZRQA 1YRAA 1ZJJA 3EAQA 2HF8A 3MINB 1QZTA 4LNUB 4R8RA 2TS1A 1DCTA 1UCFA 2OHFA 1U4NA 4XCVA 3PL1A 1H6BA 2EFHB 1JHAA 3DL7A 4QDUA 4RUKA 1BVUA 1CP2A 2QMYA 5ALKA 1RMTA 3K31A 4JJ4A 1DC3A 4NPAA 3UXMA 2FEXA 1SU7A 3PUKA 3N8NA 4L5IA 4N7JA 3KVVA 1CUWA 2YJ3A 1NKTA 3DVAB 5AI4A 1AKQA 2IZOA 2XKKA 3PYLA 4X84A 4EJMA 3D7SA 1IEXA 3ICQB 1SAYA 3L0YA 2GZAA 4RC9A 3U4AA 1X13A 4DLTA 2XDQA 1UC4B 4R3WA 2V9ZA 4AJEA 3TINA 3IQWA 3T38A 3W3ZB 4PAGA 1M6NA 3DUWA 4UXHA 4CVNA 2XCTB 3U49A 4ZGWA 2DGDA 4ZV4A 1WSAA 2W2NA 4D8UA 3ZHYA 1AUOA 1FRZA 4DDUA 2YZNA 4AXXA 1R0ZA 1C9NA 1PTKA 1WUJS 2OA0A 1WTCA 1CIJA 4D9FA 2SECE 5B4TA 3OE4A 2ODQA 3V1MA 5BOSB 2CC2A 4EFDA 4X3CA 3WK7A 4PS1A 1ODJA 2HHAA 2PKQO 2XITA 3CF0A 3GDHA 1LDGA 3KPVA 2C31A 4GWLA 4WDQA 2VKQA 3ZIAA 3QIVA 1XVIA 1B3RA 1SC1A 2XSZA 4M9XA 3UAOA 2H06A 3BGIA 1B6SA 4JJ7A 1EDEA 3HRIA 1ZXXA 4Q4AA 3I53A 5DOZA 2IEGA 4F6LA 2ZRGA 2WYVA 1NWCA 2E4AA 3DMRA 3GCDA 3MK31 2B6HA 4J4BA 5DXJA 3MUFA 2MYNA 1R6BX 1UDWA 2OHGA 3DXXA 5HCNA 4ZIRB 2GHQA 2CDRA 5C5DA 1CY6A 4XB2A 2SBTA 1XEWY 1CB0A 4M1SA 1XB2A 3LOPA 3NGMA 1A88A 3U1TA 2JKYA 5CIYA 4W1QA 5FL3A 1JRLA 2XCSB 3U4QA 2V7EA 4N7MA 3KYBA 3OX1A 1I7SB 5KQGA 2RHMA 4CG2A 1XZIA 3KZKA 1E9AA 4QPPA 1ZNZA 3LUGA 4ZV7A 1X8JA 2JGJA 2L19A 3MG9A 5EKUA 5LN1A 2AT1A 3WYAA 5HOQA 1ZU5A 2X8BA 1NFFA 1YULA 2IS6A 4MV5A 1THGA 2CB0A 1WTAA 3REQA 3IJEB 1U3WA 3RQSA 1MORA 1P4AA 4LJ9A 3ZR4B 1FFGA 1OVMA 2H2WA 1DX9A 4WH0A 3UT6A 3AEUB 2NU6A 4ZYTA 1E3EA 1DG3A 1UZLA 1VLQA 2Y77A 3CCFA 3B3AA 3DOEA 2HDHA 3N59A 3L4SO 3NEJA 5AHKA 4ZC1A 2NUTA 5CEJA 4L8WB 4RHUA 3WISA 5M34A 1HM5A 2Z58A 2XRFA 2WKWA 2XLBA 1K0FA 3QWAA 4EJ0A 2PUTA 2XYQA 4TMZA 5F4ZA 4H4DA 4TTTS 2YJTD 4MTCA 5EXSA 4QEKA 4KYUA 3ZNOA 1QK4A 4BLOA 1SC6A 3DLCA 5ICGA 3DVLA 3IVXA 1WHTA 4BZPA 4L28A 1XL1A 4ND7A 1KAMA 1ZGCA 4BFUA 4RLSA 1V1MA 2HRZA 4JLWA 3TE7A 3HV2A 5EJ8A 1KQNA 3PS9A 4UQOA 1ZKMA 3TNYA 2DHEA 3VOAA 4MZXA 2YIMA 1WCXA 2HA7A 2YXLA 3PNBA 4ZOBA 4D92A 3RR2A 1ZOOA 1HQDA 1PKXA 1X77A 2IBMA 3FJYA 4RA9B 4AZWA 5FNVA 4IZOA 7ABPA 3A2LA 2RHJA 4M8NE 4L7QA 4RULA 4DKXA 3UMMA 4DR4B 3LT5A 4N41A 3PEEA 3DO6A 5DGXA 1Z34A 1N77A 4M9RA 3WZMA 1BRMA 4F8YA 4OX9B 2FSVA 1FBTA 4IKOA 1US8A 2QTHA 4MR7A 4QAJA 2HJRA 3P5SA 4QFCA 4I4IA 4Y18A 5KX5A 2QL6A 1CHDA 1F17A 4NAUA 4TRJA 4Z4IA 4XQGA 2Y4OA 1KTIA 3OEYA 3L82B 3PNVA 3LWBA 1DIHA 4KV7A 1A69A 2M6RA 2HGSA 3PNKA 4NI5A 4KN9S 5ESDA 3GQVA 1XLTC 1AGYA 1L7DA 2ZS7A 5LOVB 1U1GA 1E7SA 4FYJA 4RACA 3S1AB 2R66A 4GUDA 2YMQA 4PC3A 1ZK4A 1ADYA 1YB2A 3NP7A 5C8VA 1VP3A 4KO1S 3WLEA 4POAA 1EEHA 3PXEA 4WEOA 1GGNA 3GGOA 3W5HA 1IYZA 5LUBA 1CD5A 3E05A 2V6MA 1RRGA 2CXNA 3O4VA 4LOAA 3VZBA 1B2LA 4EFCA 2BGRA 3JYOA 3WP1B 4Z1MD 1RAEA 1IY1A 1Z2AA 3OM9A 4JA0A 5CVDA 5GOZA 4KNWA 2W5UA 1WCWA 3PHGA 2PBZA 2BISA 3VV2A 1GZ4A 1THZA 2QMQA 5B3LA 4I2NA 2AKEA 2IITA 3GJ3A 4F60A 1QHGA 2CBZA 4RIFA 1N1MA 5CX4A 1XZFA 3WLHA 3ZVKA 3K1YA 3N75A 4QNMA 4RJLA 3FMPB 2XWPA 5ED4A 3G82C 5JALA 3P4XA 1CUVA 3D81A 4U63A 2WUGA 4ZARA 1WSBA 3AR7A 3L7LA 1LW6E 2O7RA 4UQPA 4Y9UA 3TZEA 4DR5B 1CU1A 2AQIA 4FFWA 5BR4A 2ZRLA 1WNFA 1W1WA 4GBGA 4U2DA 1VKZA 3TRJA 4DIDA 1FS5A 1GRQA 2Y0CA 2PRZA 1H6DA 4FJ0A 4G1UC 3EEYA 3QW2A 2IYRA 1M2NA 2OORC 3RVRA 2R1TB 3C8DA 4HGRA 2W70A 1T8SA 4DW8A 3V1TC 3L02A 4RF5A 4X61A 3MTGA 1JQAA 3TZQA 5IJXA 4OI2A 2IYEA 2WHPB 3NVMB 3PP8A 5I5EA 3UATA 1KZYC 5KVVA 1E99A 3SS9X 5DOVA 4BX9A 4TOIA 2VHUA 2GASA 4I66A 3JQBA 5A6VA 3GCXA 3PV0A 1OIWA 1VPVA 2B34A 2HA3A 2R87A 3OO1A 3NWOA 4G07A 2N1BA 1DLJA 3CIOA 3KQTA 1P61B 1Y81A 1EAMA 2JFWA 4UBOA 3JQ9A 1ZIXA 2D62A 5CXUA 5I4CA 3C7DB