1Q92A

Crystal structure of human mitochondrial deoxyribonucleotidase in complex with the inhibitor pmcp-u
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
195
structure length
195
Chain Sequence
GRALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the mitochondrial deoxyribonucleotidase in complex with two specific inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords 5(3)-deoxyribonucleotidase
total genus 63
structure length 195
sequence length 195
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2003-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 1q92A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1q92A01
3E58A 4F71A 5AI0A 2G1AA 2YN4A 2W11A 1QQ5A 2WF5A 2Q5EA 5IT0A 4J2TA 2ZG6A 3OCVA 1RLTA 1T5SA 3W5AA 5AW0A 4UMEA 5AW1A 2YBDA 2PR7A 2P9JA 2HEGA 2I54A 5AVQA 2B0CA 4Y2TA 5JJBA 2HF2A 2G08A 1RKUA 3WK4A 1Z4PX 3TLMA 1SU4A 5ALXA 1XP5A 4NAVA 3PGLA 3L1VA 4IG4A 5ALLA 4Y2VA 1WPGA 4HGNA 4MUMA 4YGYA 1J8DA 2OBBA 3GYGA 4BEVA 4L6CA 1Z5UA 1F5SA 2Q4TA 2JAWA 1XPJA 2ZBEA 3QXGA 5ALHA 3R4CA 3AR2A 3NAMA 2R8YA 3NALA 1AQ6A 2IOFK 1ZD2P 1L7NA 2B30A 3ZW7A 4OCZA 2JGAA 3QU4A 3N28A 3PCTA 5AM1A 4Y3UA 3L8FA 1Z4NA 2AH5A 4KX5A 3D6JA 5ALWA 1Z4MA 1RPZA 4BX2A 4UATA 5AIBA 3KDPA 5AKHA 2JAOA 2R8EA 3CNHA 3L0CA 3EF1A 5AKYA 2P11A 3U7FB 1NRWA 1ZD5A 4FFDA 2C8LA 1LTQA 3EWIA 1TJ4A 1QQ6A 2YJ3A 3DNPA 4KX3A 4UU0A 1T5TA 2FI1A 4XOUA 3R09A 5AW2A 1IWOA 2WF8A 5AM3A 5IT4A 4UARA 4BBJA 3B9BA 1RLMA 3U13A 3ZX5A 4CF3A 1O03A 1VFPA 5AKXA 3B9RA 1N9KA 4J03A 4NFLA 3L8GA 3IRUA 1ZJJA 3KC2A 5T41A 3AR5A 5ALEA 2HO4A 2AMYA 1RRCA 3ZTYA 5AK6A 1Z4KA 5ALGA 2BDEA 2ZBDA 2AUTA 4L57A 1Z4QA 4YIHA 2GHTA 5AESA 2ZBGA 4NV0A 3QU2A 3S6JA 5A3RA 1L7OA 2B1QA 3QUCA 3AR6A 3HYCA 2B82A 2I7DA 3I6BA 2FUEA 2WFAA 4XE5A 5A3SA 4Y2YA 2FDRA 2BDUA 4UM5A 5ALZA 5FP0A 1O08A 4ZEXA 2RAVA 2I33A 2WF9A 2YMLA 4OD0A 2WF6A 4BYGA 3I1YA 3N8GA 5AHXA 2G80A 3L0YA 3U26A 1CR6A 1ZS9A 3NIWA 3U7GA 5AM2A 3A1CA 3WKCA 1S2OA 1JUDA 4KYTA 5AW7A 5AI5A 2GHQA 3ZVLA 3FPSA 4XQ0A 5ALDA 1LVHA 2R8XA 2W43A 3NRJA 1RKVA 3KBBA 3KOOA 4C4SA 3E84A 4B6JA 4Y2UA 1NF2A 5AW4A 4YCNA 3NUQA 4NABA 2B8JA 5ALIA 3R9KA 1RDFA 4BNDA 4L6AA 3QLEA 2BY4A 1L7PA 1U7PA 1ZD4A 2MU1A 2WF7A 3SF0A 3L8HA 5AM5A 1VJRA 2CFTA 2HF7A 2HSZA 2C8KA 4UM7A 3ZU6A 2EARA 4UMFA 1CQZA 2G06A 3ZI4A 4UASA 2EATA 2GO7A 3J7TA 3MC1A 3M9LA 4Y2QA 3QU7A 4H1WA 3W5DA 3ET4A 3NASA 4DCCA 3FZQA 4HGRA 2NYVA 3L8EA 1FEZA 2W4MA 1EK2A 4BX3A 2OA0A 5ALKA 1ZOLA 2C9MA 5AM0A 5AK5A 2YJ6A 3IB6A 5ALPA 3UM9A 3WGUA 4G63A 3FVVA 3UMCA 2X4DA 5AVVA 5AVYA 2C88A 4HGOA 3ZVNA 2HOQA 3OCUA 5ALJA 2WM8A 4UU1A 5AI9A 4CF4A 5AKGA 3ONNA 1QQ7A 4YIKA 3QU9A 5ALQA 3QGMA 3SKXA 1PW5A 2OYCA 2FPSA 1QYIA 2G0AA 4DFDA 3SMVA 1Q91A 5AKJA 5A3QA 4EX6A 3ZWKA 3ESQA 2FPUA 3CZ4A 2PQ0A 1Q92A 3E8MA 3VAYA 1ZD3A 4ZEWA 1TA0A 4FYPA 2P27A 4UAUA 5ALRA 5AVZA 1RMTA 3OCWA 5AW6A 3W5BA 3OPXA 3SLRA 2IOFA 4Y2XA 4EEKA 3ZVMA 4E88A 3U19A 3WK8A 2QLTA 4JDPA 4I9GA 1VJ5A 5IS2A 1RMQA 1SWVA 1Z4OA 4CNQA 2ODAA 2YMMA 3WGVA 1QH9A 3KD3A 2FPXA 2HDOA 1ZRNA 2IA5A 3I28A 4IFTA 1Z5GA 3MMZA 5ALOA 1TJ3A 2IYEA 2O2XA 1L8LA 2IOHA 3OCYA 3AR8A 3EPRA 3NANA 1U7OA 2P69A 2R8ZA 1Z88A 4QJBA 4MWOA 3ET5A 5AVTA 2ZXEA 3ZX4A 4KN8A 5AM4A 4EENA 4BX0A 4HYTA 3WK7A 3N5KA 1WVIA 3K1ZA 3PGVA 2YJ4A 4GIBA 2HI0A 2YFYA 1L8OA 4Y2SA 2MSNA 5ALSA 1RQLA 3A3YA 4UMVA 5AI6A 1YJ5A 3OCXA 2AGVA 4UMDA 3FM9A 4AS2A 4GXTA 1XVIA 2YMQA 5ALYA 1SWWA 1NNLA 5AKEA 4Y2PA 1U2SA 5AIAA 3FGOA 3AR4A 2CFRA 3IJ5A 4AP9A 4ZEVA 2I6XA 3L0BA 3B8EA 2C4NA 3DAOA 3RFUA 2RARA 1U2TA 2VKQA 2HX1A 5AVWA 4YCLA 5ALFA 1T9ZA 4XPZA 2CFSA 4F72A 2RB5A 3EF0A 1YDFA 1J97A 5AKLA 3ED5A 4Y2RA 3A1DA 3BWVA 4DW8A 2B8EA 4UW9A 3UMBA 4KNVA 4JB3A 5AVSA 4RESA 2YJ5A 5ALUA 2RBKA 3ESRA 4I9FA 1TJ5A 2Q4RA 4Y2JA 5AW5A 1S8OA 4BNDB 2O9JA 2YY6A 2FUCA 5AW3A 3U7EB 4HAIA 2G07A 3QNMA 1L7MA 3N1UA 5AKZA 2HHLA 2FPWA 2JAUA 2YMPA 5AVRA 4C4TA 4UAVA 5AICA 3FPBA 3SHQA 3QUBA 4RETA 4PNHA 5AKIA 3WKBA 3QX7A 3P96A 1EK1A 3N07A 3SKYA 3WKDA 1U02A 4BKMA 5AK4A 2I34A 1WZCA 2FPRA 4OFZA 5AW8A 2I55A 3QU5A 3M1YA 1KYTA 4QQFA 2B1RA 2WHEA 3L7YA 4AS3A 2CN1A 3UMGA 3WK9A 3A1EA 2HCFA 5AVXA 2FEAA 1ZRMA 4OHFA 2OM6A 5ALVA 1Y8AA 5ALMA 3L5KA 3PDWA 1WR8A 2ZOSA 1Z4LA 2JARA 1RQNA 3ZUPA 1RLOA 1YS9A 4HGQA 4EX7A 2PKEA 2G09A 3U7HB 2D2VA 1TE2A 3SD7A 4EZEA 3W5CA 3OCZA 1K1EA 3QUQA 5AKKA 3F9RA 2DQSA 4YCMA 1L6RA 2QYHA 5AK3A 2ZBFA 3ZWDA 3DDHA 3AR7A 4HGPA 4CF5A 1X42A 3AR9A 4EELA 3OTQA 1Z4IA 3HLTA 4BEWA 3DV9A 3ZTWA 5ALTA 4CE6A 2EAUA 5ALNA 5AVUA 3MN1A 3WK6A 4KNWA 5AI4A 3RF6A 3I76A 3KZXA 4G9BA 3AR3A 2GMWA 3WKEA 3QYPA 3WKAA 1RKQA 5AW9A 3BA6A 3E81A 1RMYA 3L1UA 3WK5A 1YV9A 4DWOA 4FE3A 1YMQA 2NO4A 3MPOA 1MH9A 4O8CA 5AI8A 1RC8A 1Z4JA 1N8NA 4YH1A 2NO5A 3QUTA 1YNSA 2GFHA 4C4RA 5E0OA 4NWIA
chains in the Genus database with same CATH superfamily
1CZNA 2JIRA 4A4DA 1GGVA 2R1TA 2VPXA 2BFBB 2YQ5A 3QLJA 5B7QA 1TFUA 3LC1O 4RH0A 1UINA 4XUEA 2B4RO 1C8VB 3FNEA 3INNA 4KDRA 1LDNA 1ZITA 3FG9A 3I6YA 4DZZA 4L9RA 1Q0SA 1QE0A 3ONVA 4JV5B 2H8GA 3PXBA 4E14A 3PUYA 3EDRA 2EX4A 4NC9A 4BMVA 5K0JA 2OVFA 5JCOC 3LX6A 3C6KA 4S1TA 1UZMA 1DX4A 3DT8A 4PRLA 1E64A 2FEPA 4M3NA 3VYUB 1WZIA 4AJOA 2P9HA 4E1VA 1Z4PX 4I50B 4QQNA 1SU4A 3BJEA 4Q4AA 2O2ZA 1ZD1A 3AKEA 1U0BB 5E4FA 3GC6A 3TR5A 2ZI5A 3Q0TA 5FPPA 3ZWXA 1T4BA 2G76A 1E20A 1JEEA 1H8HD 1OLUB 1Z37A 3I9OA 1Y7LA 2PKCA 3U0VA 4E07A 5B5SA 4MUMA 4Z4FA 1E9CA 2ECPA 4YGYA 2PL9A 2VSFA 4C0HA 3NMUF 1IOLA 4C78A 1DKLA 1ZQ9A 3EW7A 3UMVA 4FFVA 4O4IF 3B2QA 3DXYA 4NHEA 1GQ2A 1U28C 4TSKA 1GP2A 5B7GA 1W4RA 3BK2A 2G9QA 2JJ2A 3O3NB 3LS2A 2IGTA 5KI6A 2PT5A 1I2CA 4A6PA 4QYIA 1ICIA 1IN4A 3EVAA 4OQDA 2H1HA 2Z0MA 3KAKA 3P32A 4B40A 4ENQA 5JFOA 4MV1A 4IHQA 4FHZA 1BMQA 2TMKA 2IRWA 4QGAA 3RR2A 4QQKA 3NRCA 3WWYA 3QG1A 4F4HA 1XOIA 3L8FA 3Q0EA 2Z8ZA 1AKWA 4AU1A 1GT6A 3MFYA 4KL8S 16PKA 1H6BA 2YWCA 2OXCA 4H7IA 3FMPB 1L3BA 2QT9A 2VNJA 2IS1A 1NP7A 2IW1A 2VH2A 3JQ7B 1WW8A 1H69A 5CEJA 1H5NA 1KZ7B 2XNDA 3EVCA 4RK7A 2Q6TA 2NACA 2WE7A 4UATA 1W0KA 1PNQA 5TT1A 5AIBA 3NO9A 2GNOA 2PZMA 4U7DA 2VTEA 5BMVA 4LF5B 1A5ZA 3STWA 2GF2A 4GSKA 4YQFA 1C9MA 2F1KA 4ZOAA 1FF9A 3R5JA 2JGIA 4PG7A 2WTBA 5FEUA 3EGDB 3L07A 2JRLA 1KQGA 1YB1A 1T5TA 1WXFA 2PEYA 4EWLA 1ULUA 4CMBA 2H1VA 1AJEA 4JEMA 3CKYA 5IBRA 3PPYA 1MABA 2H5IA 1ESCA 1ZM4A 4B4UA 1TZ2A 4QDUA 2OV8A 2XWJI 2ZSHA 3CVYA 3ADOA 1WCIB 2Q7DA 1YCDA 2RGNA 1GRCA 1VTKA 1OIVA 3OCCA 1OOEA 1VG1A 1DKUA 1O4VA 3EVFA 1VCOA 3KK0A 2C3MA 5GGYA 1QKJA 4O25A 4RY9A 2VF5X 4G41A 3F4TA 5LDDC 1FXSA 4J2OA 3LL4A 4QTTB 3T5PA 4MV6A 2QB5A 2HFKA 5LMCA 3GF4A 5FB3A 3VZSA 3UBMA 3E5MA 4FONA 1FDWA 1AKVA 4TMFA 3K4HA 1ZZGA 1D8TA 5DISB 3SOZA 4ESVA 5L6LB 1DFIA 5A4MS 3REGA 1XVVA 2Z2XA 5B2EA 1RSZA 1C9NA 5INTA 3AHDA 2GJ8A 1Z4QA 3IX7A 2ZBGA 1OYVA 3L92A 1A97A 4I6GA 1QFSA 4XWYA 2E7ZA 1ZVJA 2CXXA 1DIOB 2WP0A 3DVSX 1CCWA 3LOQA 4R1TA 3UAYA 3FCCA 5L4SA 1C4OA 5EPUA 1PZHA 3AR6A 1JIJA 5EOVA 3D7KA 2I7DA 3M6IA 5BV2P 4OQFA 3FLBA 4A91A 3DP7A 3DZIA 3OFSA 3QMWA 1SCAA 1CP2A 3CO0S 4XYBA 5EP4A 5DNEA 5TXGA 4S1WA 1JMYA 5JAUA 3QEMA 4EQ6B 1JPUA 3JY6A 2QGFA 3K71B 1T9HA 1VJDA 3CZ5A 1O08A 4ZEXA 1OYYA 1IEQA 2FQYA 4RKRA 4BE7B 1AV6A 4C21A 5CYGA 3KJFA 4KFCA 3F3YA 1SFRA 3K0AB 1TUEA 4RULA 5DM0A 2X2FA 3ZI0A 2WIAA 1Z2PX 2XDAA 3LUGA 3SYKA 1S96A 5FFNA 4H08A 4COKA 3ZEIA 3BAFA 1MQSA 2HMAA 3BRCA 4JB8A 4XSHA 2ZUFA 2OENG 2OAEA 4DM4A 4LF6B 1E7WA 3PE4A 1DT3A 4MUJA 1P62B 4XCXA 4V0RA 3QFTA 5KSZA 1WUIS 3VYSB 3R7WA 1UT6A 1MCZA 2P0YA 3RKSA 1RKVA 5FO0A 3LQFA 4J0CA 3WJ1A 1QV9A 4C3VA 1GPDG 4GGOA 1H66A 2G5PA 4M0DA 1X7YA 3ZDCA 3WRVA 4PYLA 4OHBA 4XJTA 3ZH9B 4A8JB 4MW7A 4CLRA 1LF5A 1SM4A 3GFTA 4FB4A 1ECPA 1J49A 1PZEA 1XLVA 3EQZA 2MU1A 3EXHA 1IVNA 3T1VA 3NM6B 3ZW8A 3A6FA 4RTRA 3OH8A 3UB4A 2QN1A 1U16A 2QAGA 2V55B 2WMYA 2WWHA 3DTVB 3IQGX 3JZAA 4QO7A 5BWLA 4Q1VA 3R4VA 2C2BA 2WNHA 3OG9A 2HSZA 4FC6A 1L4GA 4MRMA 4ZWNA 1MJGM 4BV3A 1V48A 3LPNA 5F1YA 4CN8A 5BXQC 4U7TB 1OXBB 1MC1A 3RVSA 5DHAA 2ZIVB 2HMVA 2XVZA 3SEQA 3TL6A 4Z2AA 5KNDA 5EJ9A 5I8WA 3UAOA 4M1OA 4PPFA 4Y2QA 4HRYA 4O4HF 2O2GA 3CUTA 4IAOA 5JDCC 3ESAA 4B8YA 3F47A 4DCCA 1JEDA 2FGKA 5KQLA 1L4FA 3GLIB 3CBGA 1T3LA 1CLEA 4O2RA 4RM3A 2OLJA 4UCQA 3JQCA 1S9DA 3G2JA 4B4DA 2QXTA 4PZPA 1DT5A 2ZREA 5EL0A 4Q3EA 5PNTA 3GFOA 5HF8A 1NF3A 3W9UA 2EDAA 1V3QE 2CNWA 1Q6ZA 2FCRA 3V1TC 3JWPA 1GG5A 3HN6A 3WLAA 3IOCA 4GZMA 4NDNE 1NX9A 2B4AA 4EJFA 3OVMA 4B17A 3C5CA 1KIFA 1ADFA 3G2MA 1J25A 4YNBA 4L4XA 4ARZA 1W85B 3WS7A 1Q0UA 3JQGB 1D07A 3DPIA 3GNSA 4FZJA 1R27A 4X97A 4ZYZA 2OUIA 1DC6A 1VPVA 2FMIA 3I9V6 3EFHA 5TJHA 4MCIA 3RREA 4L3OA 1F6BA 2W37A 1P44A 4JGBA 1US8B 1XTUA 5DPMA 2XYGA 2C9CA 5U4XA 1DVRA 3U09A 1F7UA 5REQB 3DVLA 3UH0A 5L3SB 1X6VA 1MR3F 3EULA 1JEQA 1HFKA 3EZYA 5J2TB 2YXNA 4B7CA 5EZ6B 1JALA 2EKDA 2HMTA 2MSEB 1JJVA 2UAGA 1V8DA 1MEJA 4NARA 3A0RB 3WO0A 4YT2A 5ECGC 4XSVA 5KAPA 4H2DA 3ASUA 1TUIA 3QQ5A 2Q1XA 4BYMA 1HM5A 3MWDB 3VDNB 3L93A 1OE0A 2H8KA 3SEAA 2QNBA 3ID6C 4I0WB 3D6HA 2Q6IA 4AICA 1FUUA 5LCXA 1OC2A 3ESQA 3TNYA 4CQLB 3TRKA 2E6KA 3CZ4A 3LT1A 4R1NA 3BWBA 3BKXA 3E8MA 4Q3OA 4XQGA 5EVJA 1ZD3A 2D5AA 3UTCA 2VNHA 3MTIA 4IV8A 1I94B 4M1EA 5DNUA 2NZ8A 5JD5A 4ARCA 2C9DA 5LBTA 1GWNA 3KLNA 3M70A 1Z5VA 1J0XO 2ZJZA 1RMTA 2REXB 3DMTA 3EBOA 3DTVD 3QVXA 4R83A 5FI0B 4FNAA 5B53A 2CHUA 1HDXA 4FWBA 4LMPA 4RIHA 5EIHA 3AC0A 2ARKA 4XQEA 3H5TA 4K2HA 2QLTA 2VZLA 2R68A 2ILVA 3HY4A 3MJSA 3PJFA 4IFIA 4NYMR 3RYCA 2ZKIA 1T26A 3L6BA 5CD9A 1GM5A 1NMEA 5ITVA 2OG2A 5G4KA 4F9TA 3EBPA 1NDQA 1CDEA 4NRDA 3F0TA 3FWKA 4BRWA 2IZOA 5K3CA 5LDHA 1UMBA 3E7DA 4D56A 4C0SA 4F4CA 5EI5A 5C31A 1Q0HA 1UR5A 2P69A 1SGWA 3OJXA 3PT5A 3Q6MA 5EIFA 4KR9A 1WA5A 3UAVA 5C8YF 1FQKA 4M0CA 1E3IA 4G0NA 2PS9A 3E9NA 4C3ZA 3FBGA 4QUDA 4MWZA 3WK7A 2W6OA 4BATA 5ETJA 2PBFA 1KZ9A 4KO2S 3VPSA 3CVUA 2RGBA 2FP4B 2WKSA 5T64A 1XZEA 4GIBA 4Q1FA 3R3XA 2YWBA 2MSNA 2VRCD 5EQFA 4B31A 2Y1WA 4WVFA 2QMQA 2ZRIA 5FAKA 5JQWA 4XWOA 4YAUA 3TSWA 1U2DC 4UMDA 4W8HA 4ENSA 5LLDA 1BXGB 1NVKA 1XVIA 3HH8A 4G5FA 1BH2A 4MVJI 4TVOA 4ER5A 1H3EA 4ETIA 4ENWA 1XKTA 4HJXA 2UVPA 4GXNA 2V5AA 4G67A 3IE2A 4LXGA 2O50A 2HSEA 3MFQA 2J9FA 2RGWA 3I09A 4KBYA 4QDJA 1ZUNB 4NG4A 4XYMA 3WISA 5JNLA 5KWEA 2QG4A 1U2TA 2XIJA 3HEBA 2Y76A 4P4GA 4H7DA 1JBQA 1NRXA 1VQ1A 4B84A 3FVRA 4K0RA 1Y8CA 2Y0CA 3GJTA 3LVQE 4KFTA 1IBSA 4KKVA 3ZBTA 4AC9A 4DQXA 3W0LB 1PNTA 3PTLA 5BW8A 1N6IA 2IVZA 1DQSA 2D8AA 1YRAA 4IHAA 1R0BA 1CV2A 1PEYA 5CFNA 2VJCA 4IDQA 3GDOA 1HEUA 3R3SA 1I10A 3CXRA 4IDCA 4TKUA 4P31A 1FNSA 2VNKA 3PQ3A 5FIUA 2DPMA 2B21A 1A5TA 1U15A 3JS5A 3PC3A 1X8LA 5HKKA 5LZ2A 2VH5R 3GEIA 3NNNA 3ESRA 4OHPA 1M6WA 4OB7A 1ADBA 2JBHA 3KJEA 3OFJA 3OY7A 4N82A 4ZRDA 1EZZA 2PNFA 2HLNA 3N8KA 1OVMA 2CFOA 1Q1GA 4QVGA 3SXUB 2P9YA 1MKYA 3F90A 1E9SA 1BVHA 1CRPA 1R0SA 3TK1A 4ZTBA 2G07A 1DKOA 3GEHA 2I29A 1Q5PA 2AEEA 3EX7C 1BROA 1I6MA 3AV3A 3EC7A 5JE8A 5IAJA 1EJ2A 2E87A 4N4AA 3NS7A 4A8TA 5I9LA 1GGMA 1OHHD 2PUTA 4UPVA 2XJ4A 4C4TA 1ISRA 4MVJF 5AICA 3TRHA 5DE3A 2G1PA 1U5CA 2Z3WA 2ANBA 3G89A 4RJLA 1ZOSA 2XWQA 4QGFA 2NO6A 4N01A 1F8XA 4KO8A 2AXEA 5COQA 5FOXA 3ROTA 5A6VA 2RHRA 5FR1A 1AZWA 2WFLB 5GMOA 4UD2A 3N07A 2BISA 5HJ2A 4BNWA 1N2HA 1TYCA 2VEDA 1G20E 3AY6A 3JWGA 3ZNOA 1XZCA 5G1PA 1JLRA 3IVAA 4YJDA 3GLGB 4YJGB 4KYUA 4RF3A 1WZCA 2DQKA 1GQQA 2RGDA 4WEOA 3RUHA 2XY4A 1J09A 1G18A 4R2KA 2UUPA 2LZ0A 1BAPA 4Y0AA 2I55A 4J29A 4AO8A 2JLRA 3R6WA 5JQGF 1ZMBA 3PSAA 4C7OA 5EJFA 2A5FA 1QV6A 2XA2A 1VKZA 2ANCA 1B0UA 1L4UA 2NZJA 3RSZA 1I7NA 5HRAA 3IEVA 6REQB 1KRWA 3CX7A 2YZMA 1C0KA 3KPJA 4TQAA 2HU2A 5IEJA 5LA6F 1ZJYA 4IUYA 5M2QA 4BKOA 1JG1A 5CCDA 3USZA 3RK4A 1YIOA 1U2RA 1JEOA 2PN1A 1K5DA 4FFRA 1UPCA 1HTWA 4IRMA 1W44A 4XFKA 1IY8A 3EGCA 1LDMA 1VDMA 2E37A 3Q87B 1K1EA 4PWYA 5JYCA 4G5RA 3UY4A 1TA4A 3F9RA 4YCMA 3F5FA 3H9CA 4KIGA 3O4JA 3HPRA 1C0EA 3BMOA 3E5NA 3WLKX 3ZGOA 2JFQA 3JRNA 4KXYA 5DVZA 1IJEA 4RLQA 5BSMA 1IN1A 3IAM1 1O3YA 4K03A 4CF5A 5JAMA 4AUEA 3A9VA 4KDEA 2P3LA 1M1YB 1G64A 1NOIA 3PHGA 3B36A 4XIIA 5KVQA 4E5YA 4EG3A 5ERGB 4F3RA 4RPCA 2QGNA 3HE3A 3O38A 5G2OA 4CTOA 1JR3E 4ENUA 5JMOA 1P17A 2EAUA 3ZHSA 4DIDA 4EI7A 1P4RA 2FYTA 2J9FB 1QE5A 3TZHA 1OFVA 4TYYA 2BAGA 3P71T 1ODTC 1I30A 3DCNA 4DLTA 2FUKA 3MLAA 4PLHA 4WACA 4UPDA 4J7XA 3LSTA 3PUKA 2NAFA 3MWEA 4OQYA 1BKDR 3PR2B 3VR0A 4XD7D 4ZQIA 4RA9B 1YDHA 1ZD8A 3L49A 5FPKA 4R41A 1LV8A 1P6QA 2CNDA 4YREA 3DKIA 3NBKA 4LPKA 1WMDA 3D2AA 4OU5A 2FW9A 5J4LA 3CLVA 1IHUA 3DPSA 4HLQB 3TIVA 1AUVA 4G0XA 2XECA 3V1MA 5F1KA 5LQJA 3ND6A 3HTXA 1RRVA 2WHYA 4RTNA 3KKQA 3W2HA 1T9CA 3CMMA 3OICA 5DSZA 4V0LA 2KMLA 1ETHA 3U81A 5JXWA 5E0KB 4GOOD 3DEKA 1MO3A 5FBRB 3FF4A 4NU5A 3OTIA 4E46A 1DRJA 4FKBA 3LC0A 4EY7A 2CWWA 2JBAB 4GOND 2QP4A 4X95A 8ATCA 5DNYB 2OP1A 2W0SA 2ZAMA 3DZ8A 1NXOA 3EOZA 3OZWA 3K32A 2GS9A 2JIZA 4JSTA 5A1TA 4D9MA 4P4LA 1M2EA 4OOEA 2P9QA 4CKCA 3TI9A 3FKQA 1PN3A 3KQSA 3IFSA 1ZIYA 4H7EA 4ITRC 3SIPA 4X7MA 1U0TA 1VG8A 3W1VA 5CFZA 3LK6A 1FYVA 1WWKA 3NJRA 1ESMA 2Q21A 1C1DA 4FT4A 1W19A 4QYTA 1X1AA 4WFKA 4KJXA 2IBSA 4F93B 5C81A 2CJXA 4BC0A 5ED0A 1EXNA 2Q5HA 4Q05A 1Z6PA 1DTSA 3QITA 3QVTA 2EF1A 2YIJA 1UDWA 1Z35A 5HRUA 4U9IS 1N2BA 3B8HA 1Z5OA 3L1KA 3LHDA 2MCFA 3VKWA 3ZXUB 2GD2A 1Q0ZA 2BMEA 2VHZA 5H59A 2WU0A 1CZOA 3GH1A 3ICPA 4XEUA 1AUPA 4DC9A 3TIFA 2V74B 2QEQA 3DB1A 3K2QA 3AYZB 2QN3A 4PLPA 5JS2A 1Y6QA 2GWRA 4WCDA 1O6FA 4KSBA 4CIYA 4BGEA 1JXOA 2OZPA 2Q5FA 1XB2A 3H9GA 2ZRCA 4W5OA 1GDTA 1CP3A 3T1YB 2ZE6A 4OHUA 1HYEA 1X0XA 2PYIA 4EPWA 4N0MA 2BM0A 1VIVA 1IE3A 4RA6A 5AM1A 1NBHA 4MW5A 4ZU1X 3ZEAA 2CLHB 1XRSB 5IXYA 4QUEA 1YMUA 4EPVA 3L7KA 2OGUA 4LXQA 1SOWA 4Y9TA 3FWYA 3BXGA 2GK6A 1XPOA 2OT3B 1N8SA 1ONOA 3ILVA 1K9SA 2HRCA 4B81A 2I6TA 5G0WA 1ZU5A 1G1MA 2HZ7A 3I32A 4FOPA 1AC5A 1MRZA 3KQPA 4E6EA 3AETA 4RK4A 1U6IA 5JT1A 2VBGA 2VZ8A 4ZC8A 4EUSA 4AI6A 1OV6A 3WBBA 1E61A 4ZAWA 2XRMA 1QQ6A 3FE2A 4DMFA 5AW2A 1U6KA 4HGZA 3BERA 3LC2O 1ULBA 5KHAA 5A9SB 2FPGB 1W8DA 3SYNA 3UXEA 4S1OA 5F9HA 2COKA 1N1EA 1JDPA 2Z9DA 3DBRA 4UARA 1K8RA 4BFXA 4DR5B 3C3JA 1DIGA 3ZQ6A 3JATB 2I80A 4JELA 4ZI7F 2Z6UA 4P80A 3W9SA 4FGKA 2I2XB 3O0DA 5H0IA 3SJAA 3K53A 4V0ME 3WSTA 5A5GA 4UM8B 1NGSA 2HH9A 3QTLA 4ZT5A 5B4TA 4HTFB 1T9AA 2H52A 4FBMA 3RKUA 4GC5A 2QLBA 4IJ5A 1Z5PA 3MQ4A 2XF8A 3QFRA 3SP1A 3ZIDA 1HI9A 1LFDB 4AF8A 1C7FA 4X3OA 4I81A 1G3IA 2HR1A 3A10A 3CINA 2VP3A 1XAHA 3LQYA 2XKBA 4PZ0A 3MM4A 5HDQA 3NONA 4EI8A 2V7QD 3H8VA 4XR4A 4TVBA 3NHZA 3DYVA 1E8DA 1M6EX 3FLEA 3WYAA 2VP9A 2R1UA 2BDEA 2DR2A 1FLDA 4ZOBA 1ZAKA 3R3WA 5KKCA 3A4TA 4PCVA 4EB8A 2Q7OE 2R1TB 1NUTA 3CUSA 1IK4A 4M76B 4XX0B 1FVOA 3ROXA 3S1LA 3UHJA 5H8WA 1E0JA 1RCTE 2B1QA 4KE7A 1VJGA 5KYTA 2AOTB 2B82A 3JYPA 4HY3A 3I92A 4MRSA 3RWOA 5TV2A 4DSNA 4TKVA 4PFSA 2Y0PA 2WFAA 4XVHA 2YCBA 5BN3A 2PYDA 4NYMQ 4EUHA 4MR8B 2YASA 3UUFA 2BDUA 1MBZA 5ENDA 5KYXB 3UMRA 4BV8A 5KYWA 1G2IA 1E7YA 2B5WA 3MRXA 4GZ5A 4OD0A 4MQ6A 1NULA 3JW8A 5E95A 3OU7A 4BYGA 2A8YA 2B4KA 4PY2A 1BIFA 4RY0A 3SC3A 4N03A 3GDWA 4S1VA 4UVGA 2BIFA 5CX4A 2O3RA 3ACBA 2W2XA 2GRJA 3PDIB 1CEEA 4TVKA 4RQUA 3OUUA 1CC1S 2CXUA 3QKUA 5EN4A 1Z6QA 4X1KB 4C5AA 3KSUA 2NLOA 4A10A 121PA 2EIHA 4C4SA 5KNCD 1N25A 5A1JA 2FDXA 3IOYA 4B6JA 1SVIA 4UOEA 4KUHA 5GOTA 4S05A 1MPXA 1YZGA 3TLJA 2XYQA 1ND6A 2PCLA 4ZJYA 1HE5A 2P7HA 1I4WA 2VSXA 5TQ0A 3HKDA 5JSUA 3C74A 4HMQA 1Z0FA 4FDTA 3UAXA 4ZJUA 2FMFA 1KEPA 1GFIA 4RTLA 4EF4A 3AP3A 5K2MA 2XOKD 4J0DA 3AONB 3KHSA 4PLVA 3Q7IA 5AM5A 4EH1A 1E1QA 2G70A 3SEZA 2R6CA 2ZIFA 2HU5A 1FP1D 4UE3S 3TCKA 4YI3A 4K6HA 3OCEA 2LBPA 4DA4A 1XTIA 5EP1A 3I8XA 4E5SA 1BOFA 3R6LA 3QEBZ 4TWAA 3IBTA 3N2KB 4GG1A 1P5JA 1AIPA 3VV3A 3LLSA 1XIVA 3QXXA 4ANFA 2WG1A 1NXWA 1R9JA 2EJBA 3QU7A 5DI9A 3WHKA 3AEQB 3W5DA 3SPXA 4Y67A 5DXJA 1BA2A 3PFWO 5JVDB 3UOWA 4F3KA 3G0HA 4GKKB 1PX0A 1L5GB 1ONPA 3D4BA 1LQUA 3PNLA 4PQEA 4W5NA 1PF7E 1TGVA 8AT1A 1B0ZA 2NYVA 3INYA 3ZWPA 3I9NA 4YR9A 1DL5A 2PQ2A 1E2HA 4WBNF 4BZZA 1ILEA 2W4MA 3IVGA 5DWDA 3TLXA 4U4AA 3EN0A 2HJGA 1PK9A 2F4VB 2OCDA 1V16B 1Y82A 4UNQA 1LBEA 3VBCA 1B0PA 3DYBA 4MGHA 2SNIE 1TO1E 5EJMA 1WZNA 4E11A 5HQ3B 4ZOLF 3GVCA 1KRXA 4L4SA 1FLVA 5CITA 4G5HA 4EYGA 5BW5A 1UPTA 2JCXA 2JD1A 2YVKA 5CYPA 3SKVA 3T5TA 3ETHA 3O4GA 3PICA 4GZ3A 4NE7A 4EG4A 3W6PA 1DO8A 10MHA 1KDRA 4PPYA 2J1LA 3OCUA 5DNAA 3D6UA 4O2AB 1TZCA 3ZIAD 1X80B 2H4FA 3V7WA 3SIWA 1LK7A 2R6AA 3BILA 1G21E 3TAHA 2OFWA 4YP1A 5IDQA 3AP1A 1QC5A 2HUNA 3THSA 3LO8A 4EO7A 2NTJA 2X5OA 3TTTA 1M0TA 2JKZA 4EB6B 4MVCA 5CVTA 4BQPA 3VJLA 1VL8A 2VDJA 2Y67A 2YJGA 4HP8A 1MXHA 4IOJA 2WSMA 4CM7A 4QTXA 5FA6A 2ZYIA 4BZQA 2Q1TA 4EFLA 3D7LA 3C3EA 2FTKE 2J6BA 1MV8A 3SF8A 4E2XA 1II0A 1QV7A 3U3DA 3V97A 3GMIA 4YECA 3I23A 2KX7A 1CXZA 5H4HA 4QLBA 4ARAA 3MJTA 4OL9A 1G3UA 1L5QA 4TRJA 1B8PA 3BFJA 3VR3D 3ZV5A 3RM3A 2IQ5A 1G2QA 3CG0A 1KH2A 5K6TA 2H57A 1UMCB 2FR1A 2IHVA 2IXBA 2QRKA 2RIPA 3E9CA 3LECA 1JNXX 1O4WA 3KR0A 1GTRA 1ZX1A 4BVKA 1LW6E 3SC2B 4LOIA 4ZQGA 2PANA 3IEIA 1GOTA 4KJZA 4D74A 4O2LA 1AZLA 3ZVMA 2FWNA 2MYPA 4HNTA 4E88A 1H2HA 1KP9A 4IVQA 4MCHA 4RZQA 5JEEA 4CKZA 4NZOA 5CDHA 2DC1A 3U5ZB 1X77A 4ZO8A 5AUOB 4IILA 5KVAA 1RMQA 2QUIA 4O1HA 1RZRA 3VU1A 1R6BX 2ODAA 3QFSA 1WHSB 1JB1A 3L01A 3HXKA 5HE9A 3Q40A 4KNYA 1ZRNA 5EJ4A 1GGHA 1ZC3A 1V35A 2A1TR 2ECOA 2YWRA 3F6CA 3OPYI 2WD7B 4OJTA 3URKA 4ENRA 2J9GA 2IYEA 1IZYA 4EGAA 1BQEA 2H2IA 2G9RA 3E03A 3OCYA 4KQ2A 4UCFA 4YMSA 3GRUA 4IIBA 3H0CA 1YVUA 1NNUA 2ZI6A 1C41A 1R1DA 1Z88A 2P8JA 3HL4A 4JZYA 3HCPA 3DZBA 3HB1A 4MYUA 4BX0A 2XW6A 2RHCA 3HKBB 1QH8B 2IHKA 3I2GA 4YVFA 2D0OB 3KTDA 1I13A 1DC5A 3G5MA 4UPEA 4RLSA 2Q2NA 1DC7A 3PQ6A 4Y2SA 4DEXA 4PG8A 4QYSA 2X76A 1TIPA 2CHFA 3FUVA 5HFJA 1JHRA 1GADO 4PLYA 5ISMA 1KK0A 3FYDA 3JCZA 3PBKA 2O5VA 4GXTA 1ZCFA 1J23A 1XDSA 4TV9B 4Q9HA 3TLAA 3VSDA 4RF5A 4RSMA 2QW0X 1SQGA 5EZ5A 5IKPA 1A2KC 4FDUA 2ZPAA 1LC0A 1IHYA 3KG2A 2G1KA 2XMPA 5C1BA 4M86A 1L5OA 2VSOA 4M37A 1X1SA 1U0NA 2PZLA 4R51A 5EUCA 4ABTA 2IU6A 2ZRHA 3HCAA 1LS1A 2R2AA 1V4NA 3VO1A 3D1JA 1L4NA 4K9OA 1PGPA 3LMKA 4NS4A 2CFSA 3FYUC 1B4DA 3K7EA 3JALA 4XIFA 3S27A 3AKYA 1PTJC 1N2ZA 3MCWA 3THYB 3PFCA 4MQUA 4L2IB 1HTTA 4PC1A 4GYYA 3GV0A 5LKAA 3FAZA 3OOEA 4TXMA 1L5HA 5FT9A 2F7SA 4J0EA 1TAHA 4LNHA 1RIFA 3HDGA 3HDVA 4HOYA 5BSUA 4I9NA 4P98A 4DLRA 3VA7A 1KETA 1H3FA 2NG1A 3LDHA 4FWIB 4MVJA 3IPXA 5L3QB 2BKVA 3IKTA 1Q1EA 1DX6A 4FKZA 2BZSA 3AY3A 3THXB 3RCBA 1MO4A 1C8KA 2P6PA 4AMYA 2H2WA 2YC4C 4RTOA 1CY1A 3C5HA 1PR2A 3QH4A 4F1WA 3I2FA 3HLKA 1KU0A 4B3XA 3U44B 3KSZO 1WB4A 3CX6A 1TEHA 1ZJ6A 3MJRA 3IBSA 3LQ4A 2YQZA 4IEFB 2XCSB 2BGNA 1OWLA 1P3DA 2GEVA 4N49A 1J42A 1Y5NA 3ISVA 1JA1A 1OROA 3OLQA 3E9QA 4GR5A 4M7RA 4UAVA 1YI8A 3LCRA 3HMKA 3RG8A 3T7AA 4OJQA 1N57A 3RABA 4QM6A 1Q3KA 1B8OA 3HFGA 2FW0A 5CK4A 3TQSA 3CNEA 3HZHA 5EE3A 4P4SA 1GIAA 1CRQA 1HFWA 4FS3A 1R7RA 1XE3A 4I1IA 3UCEA 5ERXA 2NU7B 3KDSE 2O8FB 3FF1A 1M6YA 2BGMA 1XN4A 3F7OA 3W04A 4OMFG 2HWXA 3JR7A 1PFGA 3GGCA 2GHIA 2B2XA 4OQMA 5KX5A 1GHTA 3I2YX 1PFWA 4EB3A 1Y8QA 3HEAA 4P93A 4MYSA 2R5NA 4DMMA 5A7GA 2M2IA 3SEFA 4ZHSA 3RADC 1YJCA 4DMKA 3CU5A 3GQVA 2CVZA 4JX9A 2PZ8A 3JVIA 1JE1A 3VU0A 2PS1A 3ZE6A 4DBLC 5HIMA 1JSLA 2Z1NA 4Q47A 1HFEL 5FNVA 2RGCA 1MB9A 2TS1A 3G1WA 1IMJA 1ZCAA 2HJWA 4V2IA 2C5GA 3F49S 4G86A 4ZOQI 1KFEB 2J3IA 3IO5A 4RTPA 3TRIA 4RF2A 2XZTA 2PRZA 3OOHA 4PX5A 3EZLA 4JA0A 1SVWA 1ZVMA 3ESZA 1JXQA 5LZ7A 3ZUPA 1IMOA 2ROQA 3A6HA 1O9HA 2YFQA 3MINA 3QSGA 4M38A 3ZKAA 3QE3A 4CL0A 3FNBA 2BYTA 5TMBA 4HGQA 5GPBA 1GZ4A 1YRWA 4IGEA 4W6ZA 2UV8A 5JMPA 4O2BA 3Q7SA 5B7NA 2BFMA 1GL6A 3NHPA 1C8BA 2QQFA 1UDCA 3K09A 3NTOA 4ZEMA 2QLJA 1PL6A 2YWDA 4KIFA 4QJ5A 3U3OA 3WV4A 2ZS7A 4NCHA 4P83A 3SR0A 1CJMA 1I1NA 3PG5A 3QPDA 1K68A 1KGDA 1E62A 1X42A 1S3GA 1ZLYA 1ZN2A 3A9TA 3BIWA 3ML1A 4MA0A 3HLTA 3RARA 4AMBA 2ZFUA 5J2UA 4FWTA 1VBNA 4FIZA 1NONA 4GI2A 5FPQA 5C5DA 2M6LA 5TX7A 4RF4A 4KV7A 3FTCA 4MAFA 3DDWA 4CKXA 3NM5A 4S1PA 4WKGA 4LGVA 4QXPA 2I1WA 2ZE7A 5EMHA 1HURA 2WJZB 3DV0A 4G2NA 4IH9A 1HF3A 4B74A 3IVCA 5EJ8A 1GQYA 4WOCA 1Q57A 4J6FA 1QTRA 1DMSA 3RBAA 4BP1A 2BF7A 2YZNA 3IUPA 3WKAA 3ZYCA 3MTQA 1OLSB 1YL6A 2C2WA 3E81A 4AY3A 3RAEC 5ICFA 4CQMB 2ZUDA 5BNWA 1XDGA 3VDMA 1RAGA 3C15C 1B6SA 3PHIA 1YF3A 2G7MC 1MIHA 4XB1A 4LJ6A 4UFPA 3VJRA 1C7QA 2ZYAA 3B38A 3HB7A 3Q1LA 3QXJA 1ORRA 2RKWA 4GS5A 5AI8A 3WWCA 1Z4JA 4YH1A 4BNIA 3JTMA 4MAAA 2AC2A 3DMYA 3KELA 4GMDA 2EKZA 4UNNA 5DHPA 5AOVA 3RHTA 3T1HB 1T3TA 5IC4A 2AOXA 2GDJA 1V3TA 4R1QA 1RE5A 1W35A 5CFQA 4QUIA 3PJDA 2QYOA 3K1YA 5KOJB 1UZNA 4LCEA 2CJWB 3HJUA 4MVJP 1F14A 2ATVA 4LKRA 2ZYGA 5D3KA 2P65A 3LYAA 1P3Y1 2B92A 3BD6A 5D2CA 1MQ8B 2WIGA 3ORYA 5FTNA 3TFQA 1U0EA 4Q4LA 2FZKA 1W0CA 5IT0A 3WRXC 5KPDA 2CZQA 2C2XA 1ULAA 4M0UA 4B6OA 3L7CA 4XM2A 2V3WA 5I3ZA 3MWLA 3HUTA 4M9RA 5AW1A 1U8FO 1K4YA 1A9RA 2YBDA 4YALA 2W93A 3USCS 3R8FA 4MVJG 1AB5A 2PLNA 3COVA 5FWXB 3NIFB 1RKBA 2HF2A 2VDUE 1WOYA 4QECA 3R6QA 4F6RB 3BXPA 4DMRA 3CF0A 4EO4A 1IC6A 2C59A 2ECKA 3AFIA 2M6KA 2J3QA 1D1QA 1W25A 1PJQA 1YQEA 3D2LA 3VVCA 3ZXYA 4DDHA 2QAIA 3H5RA 3LXXA 2WFMA 1ZGHA 1VZ2A 4I14A 4PGAA 2LW7A 1BQ4A 4PZ9A 3ZCPA 5C46F 3DE2X 4FFBB 3UCXA 2RHMA 4RD1A 4WK6A 1UZLA 1XRPA 4G26A 4QG3A 1SKAA 4FM9A 1XZFA 2XQVA 3LKZA 1NMYA 3QUSA 4OTZA 4PONA 5CA0F 4UEJA 2PLAA 3NEPX 3D5QA 2BP7A 2GOYA 2PGJA 1RS0A 1P0MA 2OBXA 2VZ9A 3IEMA 1IBLB 3SQXA 1W7AA 1VKOA 1Z9BA 3SQWA 1OASA 3DO6A 5TF0A 1XA3A 3HO1A 3U4CA 1RRGA 4OUDB 1PL7A 2XQJA 4LGYA 4F5DA 1V39A 3ZVKA 1L5MA 2R2GA 2VIIA 4DXAA 3D3WA 4LJSA 1AHIA 2JDIA 3G8BA 1NW6A 2XUDA 5F5XA 3AZOA 4AF7A 5J4VA 4LZJA 4DJEC 3I37X 5BWMA 5L40A 2FR8A 1H8HA 4WCFB 1GZ7A 1AN9A 4MR9A 4MMYB 2RBEA 1DU4A 2ODNA 4IMPA 4L8VA 4E30A 3U16A 1AGPA 1QPBA 3HABA 2E4ZA 3L3BA 4HNRA 3ESCA 2X4LA 5B3JA 2XGGA 3LHKA 4KIJA 4C4YA 4NVRA 2GM4A 5DP2A 1X94A 2QL9A 4D4IA 4F2PA 3ICQB 3O2JA 4FNOA 3S1AA 3ENNA 4AIIA 3K1AB 4L5BA 4H4DA 3HVHA 4DAEA 4Q4CA 4KR2A 5HOQA 5ELMA 1XU7A 2FSFA 1G8HA 3HCBA 2YR0A 2YJ3A 3IAAA 4ZJZA 2Q29A 3WA7A 2AFHA 1MB4A 4Y6OA 4G4SO 3K9BA 4LX0A 1JLSA 2VQ6A 3JTEA 3O8CA 2A9PA 3L7IA 2JJ8A 2X9QA 4IV5A 4ME6A 2WV7A 4RHFA 4C5BA 4DEVA 3ZDEA 5KCZA 3QTBA 3DVRX 4IJUA 2J5XA 1V47A 3DL4A 1WXEA 3DAGA 3KWFA 1E4VA 5EZYF 2ZUVA 1RXYA 1YB4A 5EUBA 3E70C 2YWFA 3H4MA 5IVIA 4ZV9A 4TYWA 2ZVPX 4BL5A 3MJEA 5KU7A 2ACEA 1Z8DA 3K05A 4JLBA 2B7LA 4ITVA 4U3JA 1HDYA 1JHQA 4WUTA 2OKCA 3U40A 1S6YA 4FYIA 4IP0A 2DBQA 3R5XA 2QN9A 1P45A 1GJRA 4AKSA 4QFMA 2HO4A 4N5NA 2QPTA 1ZG3A 1JIIA 1LCIA 5G41A 3UWSA 3W6OA 5C1OA 5J1SB 5AK6A 3TG8A 3IUMA 1ML3A 1QR6A 5BVHB 5FADA 1OILA 3IHTA 2CKMA 5BPFA 3U3RA 1XZKA 2IDMA 4DTIA 1J2TA 1T5IA 4FFMA 2GM9A 3HCRA 4YUAA 2PZAA 1JA9A 3NHFA 5KOHA 3GR6A 1CY6A 3PFKA 4IS2A 4OHMA 4RJTA 1KPHA 4YS6A 5F12A 3AJRA 1IU9A 3SZOA 5K8TA 3PWKA 2W48A 2K4MA 4ENTA 3E3OA 1CPYA 4C0KA 3W8DA 3FWZA 4AO6A 4XARA 4KQKA 1QTNA 1N7HA 2DBRA 2AR7A 3WFIA 1KZYC 4LXTA 4BVHA 3NDBB 1QGDA 3KFLA 2MINB 4WN3A 5DHUA 3UXMA 5J5CA 1U7DA 3KEMA 4G0OA 4ZAYA 5KZMB 2RKBA 2CWDA 1DCNA 3W6UA 5AM2A 3OA2A 3H5OA 4KYTA 3M49A 1G38A 1SOVA 1XQWA 5P8WA 5A4DA 1VHTA 2ERCA 1SG9A 2I8LA 2QTFA 2GPTA 3IDZA 3KOOA 4I6JA 4MUYA 4X1IB 3HKEA 3FHTA 2ID8A 1ORDA 3KUKA 1YZFA 1TTTA 2R25B 1U2PA 2AW5A 2B2CA 4PQGA 1M2HA 2X41A 1UKYA 2EQBA 5CHEA 5K4GA 4II3A 1USIA 3PIIA 1GGEA 4MQ4A 4K6FA 4HRXA 2O48X 3JD2A 5C7IO 4PAMA 1U9IA 2APJA 1VLJA 1FX0A 3FCSB 5FOWA 3GAAA 4L50A 1X0VA 4OI1A 4ES6A 4H6XA 2AQHA 1EUDB 2OXRA 1PS0A 2FP4A 2GKSA 3DMNA 1V9LA 2WZDA 4JP1A 4B34A 4F92B 2WV9A 1XJ5A 3COWA 3MRVA 4LJLA 2C8KA 3TBFA 1Y8RB 2QR2A 1E6EA 2ADFA 2OV4A 3VSCA 4XWWA 4YRGA 1P7WA 3DGEC 3KU1A 1KK1A 2ZRBA 3T4PA 1W5BA 1GRQA 1TYEB 4PVCA 3AEKB 4EAQA 4MVYA 4V38A 1O95D 3W2EA 1T2CA 3IUJA 1N0HA 2VJMA 4JOCA 5FTWA 3S7ZA 3AT1A 3FZQA 1U4NA 2J7KA 3FNIA 3L8EA 4KCGA 3NYQA 1ML4A 2VWPA 1HDIA 1N2JA 3TFWA 2Q5OA 4GLFA 5KBYA 5DTMA 1VHDA 3SS8A 3T9DA 3NTVA 1ZUHA 5FUWA 3J81A 2BJVA 4BKPA 2XUJA 3O3OB 3A36A 2JLSA 4P86A 4MB0A 2I4MA 3IILA 3RFVA 3VR4H 5EMLA 2G9VA 2YJ6A 1B00A 2FLKA 3O95A 5KQPA 3R44A 3M3PA 2I7XA 4DRXA 2ZJAA 1LBTA 1IAVA 2NYAA 1P9OA 3BIXA 1XAJA 1MVNA 1ACLA 1KXZA 2NO1A 3AOGA 3GUHA 1C1HA 2WZBA 3C6QA 1CIVA 1FSZA 1W5TA 3OWHA 4IGIA 4OLFA 2QT0A 4ZQFA 3GNTA 4AK9A 3DEIA 3KD2A 1GXSB 3EXHC 2ZB7A 1SOAA 3FYCA 2JFBA 4KXFB 4DCSA 4NCBA 1FNNA 1Z6AA 1KARA 2PRIA 3O8OA 3PLRA 3ZE7A 1F1JA 1TECE 2I99A 1T24A 3KP1A 4H3KB 3NB0A 4JWTA 4S0ZA 1AA6A 2FWMX 3BQNB 2GBLC 4G5YA 4J49A 1R8JA 5KSYA 2GZRA 1BKYA 3SHTA 3HXQA 2CV2A 3CSSA 1KAEA 4MWBA 3LCVB 5T4EA 4JKYA 2I1LA 5TEVA 5LLSA 3TZQA 3RRXA 4L6IA 1J99A 2O7SA 4GNKA 3OI7A 3SX4A 4MZDA 4LVUA 5KTNA 2FKNA 4CM4B 2HQOA 3L06A 1USVA 4GPBA 2AOTA 1GCAA 1GN9A 3BSWA 4MUEA 5CT6A 1JFSA 1MUUA 3AIKA 5FFMA 4Q02A 3KLPX 2DVMA 5C5IA 4D82A 2ZSAA 5LUBA 4UAUA 4ZVNA 1XZBA 1EEHA 1ZJWA 2CMFA 1K27A 3K94A 4PO9A 4G4JA 1UXKA 2V4UA 4S12A 3WO1A 2G5GX 3Q2OA 1E2LA 1JE0A 4G0MA 2IELA 4RZUA 4Q0MA 4DJJA 1FQOA 1XYVA 4UHDA 2LV8A 3PNQA 4HQKA 2WHRA 3HYNA 3ZGYA 2ZTSA 4V3BA 3IDAA 2WJAA 3DWIA 1T4CA 4JYPA 1K5HA 2YDYA 4CWAA 1PUIA 4EJ0A 3GQBA 1Z29A 3AY7A 4F8YA 5JZVA 1JKFA 3ZU5A 1QHEA 4RLFA 5B6JA 4LHZA 1YCHA 3PE3A 3SBXA 2Y1DA 1EI9A 3BCUA 4LRWA 4P7FA 3IP6A 4U6QA 4CYMA 2KWIA 1ZRSA 1EXWA 4P22A 3DKPA 4L28A 4XRRA 2W6QA 4MRPA 3FFWA 4KVZA 2P1DA 2R4TA 3KPVA 4FDVA 2FVXA 1J8YF 5T4HA 4JZKA 5K09A 4MWCA 3K70D 4HLUA 4M1WA 1HGXA 2PO5A 3MTBA 3PZRA 1NM5A 3COYA 1E79D 4WADA 4E7PA 4EG5A 5BW4A 1BXKA 4WXPA 1R0CA 2QIOA 4CR8A 2VPZA 4WERA 5EZQA 4DIEA 1H42A 4YK7A 4JENA 1KI2A 4NNOA 4RS3A 1XD9A 3PQFA 4FSXA 2BTEA 1PHRA 1JILA 4CETA 5IFLA 1CRZA 3BEDA 3L7OA 1XR3A 3ZWWA 3IL2A 3NZEA 3LZ6A 4LJRA 1B2RA 2BV3A 1AUXA 1Z0JA 1XROA 3K4PA 5C8YA 1H4QA 4D43A 1ZOPA 4L5YA 4FN4A 4BMNA 1X7DA 1V5IA 1ZW6A 2UUOA 3NDRA 3GLIA 1BDJA 3MMPA 1E32A 4ZOEA 4X1YB 1KYVA 2YVLA 4O4LA 1XNRB 1EMDA 4JFAA 4YCLA 4EJMA 5G1OA 8ABPA 1OBCA 2JJ1A 2WTAA 4G65A 2XE4A 1J97A 5AKLA 1Z2CA 2QE6A 2VP6A 2WA1A 3PT9A 3NHRA 3ZHCA 1MIOA 1PWXA 2DAPA 1M6HA 3Q8KA 2F8SA 2GLUA 3BGSA 3HP1A 5TGTA 1YDGA 1E3EA 3OZXA 3D5TA 4KNVA 4YMVA 2PGAA 4TTSA 3GT7A 3T7EA 3H97A 2V9CA 1PJZA 1YASA 1AZTA 1DDIA 2Y1LA 4ID9A 3TLZA 2OCXA 3EG9B 2EJTA 2GSDA 2IK8A 5FWYB 5FX2A 4LF8B 3QIVA 3FMVA 4FYWA 4QARA 1R9NA 2KJQA 4WMLA 1DXYA 5AH0A 4NK5A 5BT8A 1QHIA 5AJWA 3Q2IA 1KHHA 3TQQA 5AUNB 5H1YA 1KQOA 4OHKA 1LSJA 2GK4A 3IUNA 1DAHA 5K3DA 4K9DA 4FEEA 1IXRC 4PM4A 5D00A 1EDZA 1SMKA 4M55A 5JDCA 3EISA 1SPXA 1HY0A 4RO0A 4AZVA 4C0QC 1KPIA 1POXA 4PN3A 4O08A 3OLVA 2O14A 2FU5C 3FSJX 2P75A 3P8ZA 4OAPA 1GV1A 1ADJA 4RETA 1C3XA 1SQ5A 1ZI6A 2CLIB 3H87A 4A73A 4ZVMA 2BE7A 3W9BA 3O1LA 3LPDA 1E2EA 3L1HA 1VIAA 4AM8A 1SXQA 2GN1A 5LUAA 2BM8A 1WF3A 1RI1A 2OZVA 4CKWA 3PC8A 3LPAA 5C3UA 1BU5A 1YZLA 4BB0A 4DDWA 2P5UA 2WLTA 4OFZA 4ZCQA 4DCTA 2VHXA 1WSDA 3WJ2A 3N3BC 1Y1LA 3E7XA 4OHZA 1SN7A 1A9ZA 2AYYA 1PJCA 1UFOA 2C5SA 4GZLA 2B1RA 1E5TA 4ZZ2A 1T9BA 5NULA 3VHXA 5JWOA 1OXSC 3ESBA 1FZTA 1CS0B 1TNDA 2ZSJA 5LB4A 4OBEA 4GKJB 5J40A 5JCPA 5DYYA 2PVSA 3DLPX 5JLJA 2NYRA 4YRTA 2JK0A 3HB0A 4DYHA 5C4MA 2AUMA 2XZPA 3AF0A 3IE0A 2FN7A 2XAAA 1OBFO 4RE6A 2A67A 2HCRA 1GY8A 4KAFA 1QDUA 1YS9A 3ADDA 3OLXA 4IVNA 3S1AB 1RZRD 3LUDA 2GAFA 3HA7A 3N86A 4N7MA 1C81A 1JQAA 4FGSA 2D2VA 3VOBA 3HK2A 1EHYA 2ORIA 1VL2A 3C24A 4ZVKA 1B1CA 3DW3X 1IBRA 1WY7A 4BNTA 1JHOA 1U3TA 2H4XA 3AGQA 1RZ3A 5KVCA 4ZYUA 2RHWA 2P62A 2RB4A 2ZBFA 4FILA 4JI7B 4ER3A 4ETWA 2FG5A 4HGPA 1XZAA 4YYEA 2XGJA 4MQLA 3BZWA 3I2JA 4H31A 5LA6A 5JD3A 5KTKA 4I1YA 1JX6A 3IPRA 2FEMA 1EBBA 2XMGA 2JGEA 3ONFA 5GY7A 2FVYA 1Z2AA 3ISTA 4X84A 5JADA 2X3FA 1E2UA 5THXA 1BMDA 5H3LA 5I9TA 5ES4B 2FW1A 3HDJA 3AESB 4YRPA 5CG2A 1QIGA 4DV6B 5DCLA 3OEWA 3IP9A 3RF6A 2YXLA 2CW5A 2N3ZA 1MD9A 2AL7A 3M4ZA 1TD9A 2W71A 4A5OA 3I61A 1YQ9A 1Z15A 4UXJA 1EX7A 2FZ4A 4AJKA 2ZI3A 3D6MA 2FEKA 3RSSA 3JALB 1EFVB 4OM8A 3QWBA 4M9ZA 3INGA 5LJIA 5IT9A 5KEIA 4I36A 4JK3A 4TUYF 1ZJ4A 3R9IA 4BMSA 3X1KA 1ZL0A 2F3TA 3JAWB 1AH2A 2JA1A 3IUEA 4IHJF 4ZVUA 1IOZA 5KYYA 1VE3A 2F8MA 1DBIA 4IR7A 2VFAA 3QUTA 5KYGA 3HXLA 1DCFA 1ZNXA 1PIWA 1YR1A 1QHFA 3QIAA 2Z2KA 1L7EA 4NAHA 3RRBA 5KKNB 2B7CA 1RAEA 1F2UA 4RABA 4DC0A 2QW8A 1W87A 2HW8A 4J1QA 2J67A 2D59A 3OPVA 4WW0A 4C4PA 3T95A 4NS1A 3DZFA 1IK6A 3FH0A 3WZLA 4IX1A 3E7WA 2WFLA 5DIZA 5CDFA 5IZ4A 2XV1A 3GDGA 2PH5A 3OJWA 1DAKA 2ZETA 1NU6A 4L3VA 1Q1QA 4Y6LA 3ZY4A 4BY9E 4RTKA 3UAWA 1OIXA 4UTRA 5JMTA 2Z3ZA 5C8XA 1SUWA 3K9QO 5JSZB 4KAAA 1Z8FA 5DSTA 5BQXA 1QG6A 4W5RA 1Y9EA 5F64A 5C1IA 2QX7A 5CX1B 4KITB 3CEJA 1A4XA 3UANA 3HVIA 2OV1A 2XNSA 5LQNA 1ZR4A 2CL6X 3ZZMA 5JZ9A 4R54A 5IASA 1D2NA 1K0UA 3PGLA 3PGXA 4B3CA 1SHTX 3L5OA 2QZ4A 3KNZA 4M6WB 1NNI1 2WICA 1GTZA 3UFXB 3R3YA 1Z39A 5ER9A 1U0RA 3UJ8A 4URWR 3LP5A 1XO1A 2DZDA 2X2OA 3E35A 3GIWA 5LP6C 1ISIA 1VMKA 4MKZA 1DG3A 1X9HA 4IOLA 1CERA 3L0OA 4QQ8A 5I01A 1W6UA 2EVWX 1WPXA 4LRYA 4P32A 1HR0B 4ZI3A 1Z5UA 1WB5A 3X1MA 4MUHA 4JOSA 1FDUA 2G5TA 3QXGA 5ALHA 3JZFA 3GZNA 3JD3A 2LVBA 3SR4A 4BECA 3T35A 4HZUA 3AR2A 2X19A 2NYUA 3KT6A 2AX4A 2AZDA 5AQEA 1W0JD 2F9LA 3GW8A 4DT1B 1WTCA 3Q9NA 3MINB 4FOSA 4MO9A 1NHGA 3AZPA 2C82A 4LJ7A 3CSDA 3E53A 4NJMB 1NY6A 4R8SA 5G02A 3ZE0B 5A4JA 1XF9A 4HWRA 4P3YA 4Y3UA 4DILA 3ZD8A 4Q7QA 2Q99A 3E9DA 3IDQA 3WL8A 3ZE9A 3D6JA 3LPMA 4TMYA 3I30X 1V26A 3L05A 3VR4D 4YBZA 1HETA 1PFVA 1ZGBA 5FPYA 3RSFA 1RXVA 1OH7A 1TM5E 3FFAA 5MFPA 3P9KA 2OAGA 5CH8A 3X1ZA 2JAOA 3QE9Y 4JU9A 1RC0A 3DLIA 2NWQA 1Q0LA 2WBLC 1T4DA 2PKRA 5C18A 3HUUA 4RFLA 3AXSA 3CR8A 4WX2B 1RPJA 1CJUC 1RRPA 1LBSA 1Z7WA 4BLTA 2GRUA 2RJNA 5HF9A 4C6TB 1K5PA 3DWGA 2PX0A 3CKLA 1M33A 2IUTA 4JVMA 5T3YA 3S2ZA 4RXMA 1AUQA 4BLSA 1BDIA 2Y0BA 1M66A 3REQB 5HRCA 2OP0A 2GTHA 3ABOB 4W7HA 3C0KA 1DLJA 1LB1B 5IAAA 2IITA 2O7QA 3ZCSA 4G81A 1XVTA 1BMFA 1P3JA 3NG1A 8MHTA 1UMDA 1K6JA 1OREA 1UJNA 3LVBA 4KN6A 2QQ5A 5HZHA 2GWHA 3R0QA 1NVGA 4G1VA 5IH7A 2A4MA 2B35A 4J03A 2WNIA 3SSAA 4K6GA 5BRNA 1FSGA 4QEZA 3DFKA 2O1WA 3IOBA 2QMEA 1UJ5A 2BBWA 4YHBA 3JAMA 3QSYA 1E6CA 4DUPA 2ZZKA 2HT6A 2AMYA 1GRVA 3CB4A 1NBAA 5E7QA 3JQAD 3EEOA 1ZGGA 4X60A 3SCZA 3DLAA 5C52B 4YIHA 1ID1A 4D2IA 2CXPA 3ETJA 4B3MB 2FN8A 3BBLA 3GCDA 1B8NA 4MUFA 3DKVA 5KNDH 4JLOA 2HRRA 4X65B 1JV2B 4Q18A 5F77A 3VVMA 3AVPA 4KH0A 1WDMA 1U7HA 3HDHA 4O02B 5LVAA 4RSRA 2FUEA 1M6NA 5LL6P 1JR3D 4FJ2A 2PFMA 4ALNA 3MOSA 4ZALA 5JC8A 2B36A 1G5RA 3KSDO 3MPUA 2FUSA 2IHJA 3GJ6A 4JR1A 3ZN2A 4BZPA 1T4CB 5HKLA 4ILKA 3BHIA 3L41A 3LUJA 3OBIA 2F55A 2DPHA 2WVJA 2SECE 2WF6A 3OE4A 4R9RA 1KRHA 2P3OA 4TL8A 4JJFA 3ZWYA 2D3WA 1X7WA 1PWHA 2GB4A 4R8RA 4BE9A 2XLCA 3H2GA 4M0MA 1F06A 4M88A 4L9WA 1TW3A 2HIAA 3V46A 1FYEA 1UKZA 4W9MC 4JBLA 4EMUA 2OOSA 2W43A 4P9NA 3VTKA 2NU9B 3QBPA 2FK7A 3OZGA 3GMTA 2B69A 3ZD6A 3LPCA 4R3UC 2BI7A 3WYBA 2HQBA 4MB6A 3HG7A 2M1XA 4IW3B 1JWBB 2Q3JA 1YKFA 2RFLA 4NFHA 4RPJA 1G42A 1G4AE 4RVCA 3SZMA 4BAUA 4UNRA 1BJKA 3LLVA 1NP3A 4CUZA 1CVRA 3PEVA 3ENWA 4F9FA 1XZJA 3IMCA 1OV4A 4LWPA 3UQYS 3FX2A 1UM8A 2SKDA 5CB6A 3F5DA 4ZVOA 3WI7A 4E5VA 4P0QB 1Z06A 1QGUB 2QT1A 3BVPA 5KNBA 1MENA 2X1MA 4FQ7A 2CGEA 2OBFA 1YJ8A 1THTA 2HA5A 5A0FA 2W2KB 3QMPA 4F5YA 2ZRDA 2D1FA 3KZMA 4J8PA 3IIEA 4NNPA 3FVQA 4QPPA 3KU4A 3T3PB 3BFVA 2F2TA 4CHGA 2Z98A 4DA6A 3A04A 2HUPA 4ZDWA 1L5LA 3AUKA 3SX0A 4FLEA 5SY9A 1NC3A 3H1PA 5E4YA 3BULA 2JH3A 2PT9A 4FB5A 1PDWA 1G5TA 5M3BA 3D0KA 4B9EA 3NHMA 2OLEA 3QHPA 1DAOA 2UZ3A 4NESA 3A3NA 2CSUA 3TBHA 2F8TA 2L18A 2YWJA 1J5XA 1V5GA 2VBFA 1Y4ZA 4WT7A 4BZXA 4YRKA 1P2UA 3KXIA 1RHRA 2FMXA 3PS9A 1R4MB 2C31A 1E1QD 3G7SA 1GAJA 3HR8A 4FSDA 2FF5A 4PQFA 4GP7A 5KDOA 2J0SA 5SZKB 2P9ZA 5F91A 1OR8A 1KBOA 5D5HA 4C0WA 5HFAA 1Q1AA 1YFKA 4JYAB 4HUQB 3LH5A 1G21B 3P9IA 2HT1A 2NO9A 3AOEA 4FU0A 3UJAA 2Q1SA 1ND5A 1A8QA 1MOPA 2GA8A 2SKCA 3MTDA 3BMXA 5LD2B 2XXBA 4A5SA 1T9GS 3KSRA 4D3SA 5KHOC 1VSBA 4MVJD 1VKHA 3VZDA 2HOQA 3Q9SA 3N6XA 2IH2A 2WWVD 2E0IA 3FPHA 1M73E 4U3JB 4Z5XA 1YA4A 2XA1A 1VB3A 8ADHA 3T9EA 4DCJA 3D8TA 2WWTA 2WG0A 5L3RA 3SN6A 1HE2A 5EESA 4K9SA 4J0FA 3QYFA 1MT3A 1M8GA 2AXQA 4KXQA 3LBIA 3VTFA 1P0QA 1DC4A 4LHEA 3R5SA 2QV0A 2Z30A 1ZICA 3W06A 2CF6A 5LR6A 4J76A 1C50A 3WOVA 2AEMA 1FUIA 3B1FA 1DQZA 3I2HA 2OSVA 2Q2QA 1I7LA 2F1JA 3GO4A 2EFCB 2CB0A 2X6RA 5SZJA 3T5DA 3ZY6A 1T8TA 4JS0A 4B44A 3OZ7A 1EFUA 1ENOA 3CYFA 4YCDA 5SY4A 1XELA 2CE7A 1OFUA 5AJHA 3MBKA 5FUYA 2HJHA 4QASA 4W5HA 1PLKA 2XMBA 4NENA 1W9MA 3C6XA 2P27A 4O4JA 1I3KA 3VSBA 2OHOA 1E2QA 4R9SA 1BS1A 1X7WB 2QXUA 4WXYB 6GPBA 4Z53A 4A8JC 1VPLA 3BH6A 2QGZA 4G36A 1HDCA 3B70A 3V4FA 1EXMA 3DHYA 3P0EA 4W9NA 4YDRA 2IY7A 1GA4A 3L40A 4YRJA 4TKMA 5HFNA 1QH9A 3KD3A 1XVAA 3JQQA 2FXVA 3TOCA 4JIMA 4RTSA 3K9WA 4UOZA 5FV7A 3JZDA 1Q5NA 2MDTA 2JIQA 2VYNA 2XMRA 2ZWPA 3N59A 4OXRA 4Y7DA 2O2XA 2IOHA 2HMWA 3RB8A 2FH5B 5GONA 3RS3A 3VR3A 1XRNA 1VHWA 1B6GA 1LBIA 2G28A 1YULA 3BGOS 2GD6A 5D01A 2AXPA 3FUWA 4LJ8A 2G17A 4QUHA 5CIQA 4MS3B 4ZU6X 3ZX4A 1YWGO 3D59A 4DHEA 1QYRA 5AM4A 3TMKA 4MVJH 3NHSA 4A8PA 1T5HX 1ADYA 2AS0A 1LDBA 5K0NA 3BXOA 4JU8A 4MPTA 4YRSA 1A8SA 2CC2A 1NR5A 2IKSA 2GXUA 3CVOA 1UOQA 3KZ1E 3L77A 1TPYA 4ARSA 5KIAA 3PWZA 3PB3A 4EFMA 4K86A 4TQ9A 2H2DA 3BMOB 5BR4A 1KZ4A 2JGRA 2ILTA 4YONB 5J9FA 4CM8B 4OXQA 4LX8A 5L3SA 4RIEA 3RVRA 4QWMA 3SQDA 4BN5A 1Q11A 4D6XA 1XCGB 3JRWA 1YD7A 4R01A 2BE9A 3EIWA 2DBVO 1LZKA 3LGXA 3N3AC 4I46A 2XRFA 2XYHA 4QWWA 2P2CA 5CAEA 5HM6A 1M7HA 1PEAA 3E18A 2W6NA 1AZSC 2FFJA 4KAJA 2IPOA 3ANTA 1A2BA 4IH4A 2PGIA 4JX8A 2RARA 2HIMA 3OKCA 4KK3A 4AJLA 1E6KA 1BOOA 4A82A 2N9UA 4RCVA 4CM5A 4QOSA 5DTJA 2Y6UA 1VA4A 3DOHA 3RROA 1VE1A 7YASA 1KYYA 1SU8A 2C9ZA 3N8DA 3ZLJA 1R4NA 4J94A 4MMXB 3ZBPA 2PTGA 4JQZA 3NEYA 4HQNA 5IDWA 4UEKA 1ZXXA 2Y93A 4XGRA 4QSHA 2C04A 3KAQA 3EEIA 3KJIA 4KUGA 2C54A 4F4UA 3P9PA 4Q9IA 3H5WA 3RTDA 3NM4A 2OPBA 5ALUA 5JFGA 1KEZA 5DU2A 4CZ2A 2HRZA 1WNFA 1YTLA 3MJDA 1SO8A 3QVKA 1L4YA 4OL0A 1EVLA 4EAAA 5J58A 4Q15A 5JYDA 3MXTA 3V4RA 3A7DA 2FPPA 1M1NB 1U9JA 5JQGA 3GN2A 1KXJA 1YQXA 2FUCA 2H0AA 3LX4A 3PXXA 4ZDIA 4PIPA 5IARA 4BFLA 4DV0B 2DFVA 1BHJA 4PG4A 5CX1A 3PUVA 1BXRB 1R3DA 3DL0A 1CUGA 4UUNA 5DK6A 4EKIA 4HSGA 1TYDE 3CEMA 4HXGA 3UPTA 5HKAA 1WX1A 3VO9A 2AI2A 2PMEA 3K0BA 1FFXB 2OO7A 3NXSA 1E4YA 3QXCA 2GPYA 3E61A 3GL9A 2HHCA 1RQ2A 3H3XA 3H9JA 3PXAA 2LDXA 1E4EB 5AHKA 3QOXA 4RZIA 3U3MA 5BSEA 4NEQA 4KN5A 4XJSA 1YAJA 5DTRA 3FPBA 4YXFA 3UMYA 3EK2A 2D62A 1VI2A 1NMXA 1Z8HA 5E6UA 2A5DA 1FP7A 1RCFA 3CN7A 4C43A 3ZH2A 4D9BA 4JFRA 3O3MB 3U7IA 1Q7GA 2H5LA 3FMIA 2IYXA 1J3UA 1LVUA 2PRSA 1BS2A 3EVNA 1NOJA 3N70A 3PNMA 2Z5FA 3GFVA 4FFBA 1ECGA 1P60A 1QKIA 2QRLA 2FV8A 4WRRA 1O0CA 1A9XB 4BB6A 5F76A 4KMOA 4TLEA 4GHWA 3NPAA 4OP3A 1W0JA 4ZI2A 2A0UA 2WUFA 3KYDB 2PQ6A 3JARB 3GP3A 5BSKA 4E70A 1DE0A 2WKWA 1PQ4A 1V7PC 4FHFA 3NIGB 4Q3BA 1AD2A 3QJGA 4Q01A 3OUTA 1RWXA 3NAQA 3KXLA 2H1LA 3DDOA 3W05A 1ODCA 3VSAA 1XZQA 2FK8A 1Y8AA 1FMTA 2FPLA 3DVAB 2I1VB 3QPVA 2SKEA 3OC0A 1LPOA 2A7XA 4WLEA 1V45E 2HYDA 4PTZA 1BGWA 1NI4B 2G4LA 5JAIA 1F2VA 4HWPA 1E7SA 1L7AA 3G7UA 4QX6A 5BYBA 3EODA 2FZGA 4ZVQA 3WLTA 2QDXA 1CUZA 2F59A 3O91A 4LVOA 4NDZA 2JFVA 4WZAB 5HP4A 4WLVA 3GTDA 3LWNA 4CPDA 2A6PA 2OVBA 1RPAA 2C7VA 4J07A 4BBAA 4CUKA 1F0YA 4DBZA 3KTAA 3OEHD 5JROA 4REOA 3RC8A 1CDOA 2K2WA 5BUZA 4A0GA 1UF9A 5AK3A 2X0EA 5L8VA 1K9VF 4NSLA 4CM8A 4NBUA 1D04A 1JDBB 1HEYA 2IPLA 1B8UA 2NSLA 3BH7A 5ESWA 3TUIC 1Z74A 2CBGA 1UT5A 1JFLA 1JIQA 1KQNA 3VKVA 3AR9A 3E3LA 5D6BA 1V1MB 4NOKA 4UTOA 3G3EA 1P4SA 1D9XA 2WHQA 2G5CA 2FZVA 4RHYA 4JKOA 2HB6A 1Y48E 1XT6A 1ELOA 1OVGA 1TYAE 2UKDA 3KYBA 3TW8A 3LUAA 1XEXA 3ISJA 2GPNA 2AFHB 5LSAA 1DQRA 1WW3A 3FROA 2FFHA 2QU7A 1Z75A 3AR3A 3WLHA 2O4UX 4J3NA 3V34A 2OR3A 1YRYE 2C0QA 3DBIA 4MGKR 4YMLA 3AP2A 3BRWA 1GT91 4ND6A 7GPBA 4XB6B 3L1UA 3QVWA 3LDAA 2Z5GA 4NX2A 3RVJA 2WU4A 2XNJA 3MLBA 4DWOA 5AJUA 1AOXA 3LF1A 1LNZA 2YHAA 6LDHA 4G0VA 1XTRA 3CLUD 5THKA 2PUWA 3AUYA 3QK7A 3ZGXA 4QBKA 5DWQA 1JAYA 2G77B 3L6EA 1VSVA 4UUQA 4DY6A 1QRTA 4O4IB 4K7JA 1V2HE 3W77A 1WKVA 4ZAZA 3L7AA 4MV4A 4BVFA 3WZMA 2UXDB 1ZK1A 3HSKA 2PZGA 4F71A 3K09C 3LWDA 4HL6A 5F2OA 2P9CA 3EAFA 2WB4A 2QUJA 1K4KA 1UXHA 2ATEA 2IYUA 4Q4JA 1M2OB 5TJ9A 3IOEA 1ZKMA 4RHCA 4HV4A 4YUWA 4D99A 3K0AA 5JALA 3GJQA 3QLVA 3TV2A 4DLPA 2FPIB 3EZ2A 5CDYA 5EJ7A 5HJ7A 4N48A 4DUYB 1P31A 2A5LA 3M81A 1QYVA 4JBNA 1LLFA 1O5IA 1UL1X 1QX4A 5EPOA 5CA1F 4HNHA 2B0CA 2C1EA 2COUA 4F2HA 1LA2A 4DM7A 3VDXA 4PZZA 1G0OA 1QG4A 2ZU0C 4DV4B 3C3MA 4V2UA 4CLXA 3KSBC 2ZXUA 5CXUA 4KKXB 1H2WA 1Q16A 3ZNNA 1H1DA 1E7MA 3GWZA 4QXAA 1N2XA 4RZHA 1BCRA 3IJEB 4DDVA 3T3NA 5HQ3A 1YC2A 3TQIA 5DEOA 1G7SA 3DNMA 4ML3A 4NR0A 1Y8QB 4DJAA 2AE1A 3DMFA 4IZIA 4N40A 4L4UA 4W9NC 5AXBA 5J4HA 2IH5A 4DGQA 3RS4A 4H7FA 4RSHA 1EJ0A 1GQFA 4EHNA 3G13A 4KXLA 1N8TA 4L8LA 5HEKA 1X7XB 1JQLB 3K6SB 4ND8B 1Y9DA 1W5FA 3WP0A 4YC7A 5J5VA 3IP8A 2ZDHA 2AG8A 2B94A 4LYFA 2XF2A 1U2ZA 2F90A 2ZYSA 5T8KC 3SHFA 1U0SY 4A27A 2ZLBA 1NX6A 3FGPA 2A84A 4L73A 4DLYA 4KG7A 4Q1EA 2AKYA 4PXSA 4YMUA 1P33A 5C53B 5EXSA 2BFEA 3F6EX 5FJJA 3ZW7A 3NW9A 4HDNA 3EXHB 1F9AA 3HJRA 3M5CA 3K30A 5EIEA 1NI5A 3FKSA 4NJOA 3V4SA 1UJ4A 3C8UA 1QQBA 1G9TA 2L42A 2R8PA 4URUR 3PQ5A 1UAYA 2AH5A 4GLLA 5IUNC 5JRJA 5CGQB 3P1JA 2J4CA 5ALWA 2AA3A 3BFPA 1BDMA 3UMFA 2VTVA 3NGXA 3PC2A 2P5YA 2UVQA 4KTVE 1O97C 5K6RA 4FYHA 4GRIA 3L4SO 3EXG1 4B3GA 1ILWA 2IU3A 2ZE5A 2O2IA 2BRUA 3KXPA 4RCZA 2A9VA 2RC5A 1ICEA 2EFGA 3Q3IA 4KGXA 3MAJA 3JSAA 1G21A 1GD1O 2ISQA 3C3DA 3KQOA 2XUPA 3WNBA 3DL2A 3U7FB 2XMDA 5KSWB 1N36B 4O1MA 4EP1A 1JBEA 2CL5A 3PU6A 1BRTA 4ER7A 5HNKA 3D2CA 4KX3A 1VMEA 4FINA 5AJZA 2R8RA 3KVYA 4HEHA 2BRUC 3T99A 2OC4A 3UPUA 3JQ8B 4JGIA 1AY0A 5IF9A 3UV3A 2WJIA 2G67A 2WF8A 3AV0B 2JIDA 5K5EA 3T1OA 4F3YA 3MAGA 3R3UA 1F8UA 1E9EA 3HR4A 4PHGA 1WD5A 3N75A 4H17A 4CF3A 3DEJA 4R69A 1UOEA 3VI3B 4LJ9A 3KRTA 1Z7BA 4MKXA 2QR5A 4IKPA 4Q1DA 3WLIA 2J8ZA 3PUXA 4TS9A 4ZV4A 1KMIY 1USGA 4Z7NB 3WLJA 3UK1A 5IM5A 4G5OA 4U7WA 5DNCA 1ISHA 1IM5A 2RG7A 3DPUA 3HNPA 4S24A 1LUAA 5BV7A 4E31A 3H9EO 2GCOB 5K8JB 4MAMA 2IEGA 3H2BA 1OB2A 4Z9FA 1KNXA 1XQXA 2AUTA 1TAGA 4L57A 4HPXB 4TZTA 4BVLA 3NTLA 4DA7A 5BSRA 1F48A 1SBIA 2AI1A 4MS4A 3CPEA 1WLYA 3NHLA 2LRHA 3W7VA 2VDWA 3GT0A 1YVRA 3QZUA 1O96A 5EWJB 5IEBA 3WDKA 5A3RA 2DR0A 4D5GA 2A9QA 1TLFA 2ZUUA 3NP7A 3ZKWB 4L0QA 3PNBA 3EQ6A 2JBWA 1L1RA 1LK0A 2OCIA 1K8XB 3OE7A 521PA 5CH3A 2QD5A 1JDTA 1KOGA 1FSPA 5K0GA 2VP2A 1QGAA 3HUDA 4U2FA 1R15A 2HMUA 4OAQA 2LIVA 1SUEA 3AIIA 3BZUA 3TIIA 2PMCA 3HJAA 3R0IA 3H9UA 2W2LD 2VP0A 2WSYB 3IA2A 4DR1B 4M53A 3CC8A 3E4CA 1L0BA 2L19A 3DH0A 2Q3EA 4KOAA 5T57A 4Z9YA 4E21A 4EG1A 3FPSA 4MS3A 4M49A 3W3AH 1SH7A 1L9XA 4Y2GA 4MQFB 2VJAA 2D5BA 3COSA 3GFGA 1NSTA 3QELA 4CTMA 3MWYW 3GIDA 3KETA 3Q98A 1UJCA 2BMDA 2Y8EA 3DKKA 3E23A 3HJHA 2W8ZA 2CBXA 2I3GA 2ZYVX 4X24A 4FYJA 5DGDA 1UMBB 4JB2A 1NJ1A 2BFCA 2VLBA 4XH9B 5FYQA 4PRKA 1L7PA 4Q34A 5HOEA 4RMHA 3A6LA 1YUMA 1SHLA 1T1EA 4KFUA 1G66A 3KLBA 1NXSA 4U0JA 1KOJA 2X0JA 2ETVA 3RC1A 3QFCA 4OQLA 3RQSA 1COZA 2ACKA 4ADMA 1L4BA 3D8NA 2HF7A 2OCKA 3LY8A 3F2VA 3NUGA 4KLZA 4CV2A 1X15A 2GZ3A 4HO1X 1A82A 5CMLA 3ZLUA 2GO7A 2HN9A 2PD4A 2WRZA 4WZZA 3R76A 2NUTA 3IOMA 3JYQA 4CLOA 1R5JA 3EOAI 4M9QA 2QNIA 4M7PA 4IIYA 4BO1A 2Q28A 3LBHA 4JXKA 4HI0E 4N12A 3W79A 1DFHA 4KAXA 4PN7A 4RD2A 4HGRA 3TFOA 4ZAXA 3T7JA 1VLQA 3VOTA 4A0QA 4D41A 1MRNA 3DEZA 3M6WA 4BFTA 2H2FA 3PXEA 4D9CA 5FUMA 1J8FA 3B6EA 4S0XA 3V8VA 2Q3DA 5DNWA 2X9GA 5BQPA 4YV2A 3VOSA 4E0BA 2H17A 2BF4A 2FGJA 1J2RA 5EEHA 3WGJA 3ZHRA 4ZIRB 3WGQA 1G6OA 1QHXA 4D0LB 2FWIA 1NLMA 1SIWA 3A25A 4K9KA 4DY4A 3HYRA 5CCXA 3NDJA 1U7XA 3G2HA 4N76A 3EAQA 3V7NA 1ECBA 2W6JA 4G63A 3TNJA 2B5OA 2IIVA 2CLSA 2I4IA 4NBTA 1QAMA 1J6UA 4CEJB 1SB9A 4QZVA 3SI7A 4D6PA 4DEYA 2J6HA 4DG9A 3M4XA 4QT4A 5M29A 1TQ4A 1RAAA 3AUJB 4OY3A 5AI9A 1TJVA 3JQ7A 3VZCA 1L1EA 4CF4A 5F3WB 3ZDYB 3U9TA 1KQPA 1XDZA 2G6BA 3KHUA 3GUYA 4DMGA 1RBMA 4XKJA 5H5JA 5IJ9B 1VC2A 1E1CB 5J63A 3KX2A 5EFZA 1OUMA 3AH8A 4RL6A 3WIVA 3GPDG 4A1OA 1J0BA 2AD1A 2WAOA 4J3FA 3X1DA 2G0AA 4I1OA 2O57A 2DP4E 3ECCA 3I52A 1JDJA 1NUAA 4XYGA 3ZKWA 4KMRA 4Y6GB 4JT2A 4ZHQF 3ZWKA 1CB7A 4PSCA 4B47A 5LNK1 2AR9A 4A0HA 1Y80A 3EWNA 4KR3A 1H8ED 3JSXA 1XKLA 3CRQA 1A9XA 1NJ8A 2PQ0A 3LGSA 3VUEA 1HDZA 2FMUA 1F4LA 3EG5A 5J4YA 3Q5EA 1FNBA 4HDSB 5FYDA 4E33A 2I7TA 3UK0A 1EDOA 3AJAA 2W6PA 3ESXA 2WU8A 3KAPA 3UH1A 4D6YA 3NOOA 2X15A 2C5HA 4B0PA 5JH7A 1BHQ1 5CPBA 1JP7A 5FH9A 1DIHA 4ZICA 2W4IA 2UZ1A 3U1BA 3P27A 2YIDA 5L6MB 3E1KA 4AN0A 4YRZA 4YJGA 1M5TA 3W9YA 3NWOA 1STOA 4CNQA 3WDLA 4WNYA 1JLLA 5E6RA 5JUWA 1P1IA 3AO0B 1E66A 4KGZA 5A02A 1V9SA 4FFSA 3AB7A 5EG5A 1JWLA 2NPOA 1G291 5BSVA 5BP7A 1QX3A 4HEJA 3GPCA 3ENZA 1KI6A 1T9GR 3TZEA 1DKMA 5B4VA 5I7UA 2I8AA 3ZWOA 2OO3A 4LMRA 4E5KA 1FSFA 2C5AA 3VM6A 4DL9A 1Z2DA 4MWOA 3ZGNA 1T5DX 2PR2A 1BWQA 1TVMA 4N5HX 4EDHA 1EAYA 2GJ4A 5JV5A 1X70A 4KTTE 4GKVA 3ZLTA 4IG9A 4HWGA 2ZRPA 1CB0A 3TDNA 2JZOA 2A58A 1LLCA 4EY4A 1QIIA 1A96A 2YYSA 4RDIA 3SX2A 2WG2A 2ENWA 3HHEA 3WNCA 3R9WA 1JMVA 4LVCA 1M74A 1RWQA 1GU7A 3HHPA 2CUNA 4D0NA 4GAEA 2PL1A 3EY4A 3OPMA 2PYZA 1R6AA 4A0FA 1OFHA 4G85A 4HHEA 1P77A 3HWSA 5B37A 4YRNA 5BRJA 4E1BA 2Q49A 4CQNA 1XLTA 5KOIA 3ZWCA 3KYCA 5B4UA 5E1DA 4RKYA 5T6BA 1PTJA 2W6IA 4KWHA 4UU8A 4QSMA 2QX8A 3G5UA 4AKEA 1JKXA 1KVRA 1WV1A 4PGGA 3ZCXA 1EM8A 5IWAB 2I5PO 2L17A 4CW7A 1F51E 2RGEA 4MV7A 1L7VC 2JANA 1WVMA 3SJ7A 4HNQA 2QVCA 2P2GA 2VJOA 1V71A 3NBZC 4XD7A 2O8CA 4RHUA 2VPQA 4DG5A 1E6UA 1QFMA 5J23A 1O0BA 4DQKA 5C8VA 3EXEB 3H1BA 3CPSA 3IXLA 1F20A 5DHQA 3TQHA 1E18A 4I50F 1OXXK 2QOEA 3OZFA 4KHZA 1M1ZA 4NCIA 1C7RA 1Q17A 4RZXA 2J3JA 1WHTA 4HAZA 2GI4A 4JVLA 1N78A 2GF0A 1TTHA 1JH9A 1O8CA 4X85A 1HT1E 1II8A 1RI5A 2RHGB 4RPIA 1XMXA 1GZDA 2DQ4A 5KYUA 4NV3A 1RQRA 2V4MA 1HDEA 2QVBA 5FWDA 1KBQA 4CL8A 1PVVA 2OV3A 3UMSA 1YR8A 1NC1A 1WB6A 3PCRB 1ZEMA 1J21A