1Q9EA

Rnase t1 variant with adenine specificity
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
b'ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHEFRNWNGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanyl-specific ribonuclease T1 precursor
publication title RNase T1 Variant RV Cleaves Single-Stranded RNA after Purines Due to Specific Recognition by the Asn46 Side Chain Amide.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
total genus 27
structure length 104
sequence length 104
chains with identical sequence B, C
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2003-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1q9eA00
9RNTA 1LOVA 2KF3A 2F56A 1FZUA 1I70A 1T2IA 1RGFA 1RMSA 4HOHA 2AADA 1AY7A 4BU4A 1BNJA 5HOHA 1X1YA 1RTUA 2ZA4A 1LRAA 3AGOA 1YVSA 1PYLA 1B20A 1C54A 1X1XA 1AQZA 1I2EA 2KAAA 2SARA 1B21A 1RHLA 4HAAA 1RN4A 2KF6A 1UCLA 3D5GA 1BNFA 3DGYA 1I3IA 1I2GA 5BIRA 1X1WA 1B2ZA 1B2XA 3HOHA 1BUJA 1BRJA 1TRPA 1I3FA 1UCIA 1GMQA 1GMPA 2GSPA 1RLSA 1UCKA 1RNBA 5RNTA 2F5WA 3AGNA 1G02A 1DE3A 1A2PA 1BIRA 1PY3A 3AHWA 5BU4A 1BU4A 1FUTA 1RNTA 1R4YA 1TRQA 1T2HA 1B27A 1HZ1A 5GSPA 4GSPA 2RNTA 3GSPA 1X1UA 1RGLA 2AAEA 1B3SA 1BRNL 1RGHA 1JBRA 4BIRA 4RNTA 1BNGA 1RCKA 3BU4A 1BSCA 1DETA 1BNRA 4GHOA 8RNTA 1GOVA 1BSDA 1LNIA 7RNTA 2KF5A 1LOYA 3Q3FA 1RGKA 1BSBA 1BRKA 1JBSA 7GSPA 1B2MA 3URPA 1BOXA 2F5MA 1RDSA 1FUSA 1I0VA 4J5GA 1CH0A 1BNSA 3D4AA 1I8VA 1BRSA 1IYYA 1YGWA 1GOYA 1RGAA 2RBIA 1BNIA 1BRIA 1BSAA 3D5IA 2F4YA 1RN1A 2HOHA 3RNTA 1ZGXA 1RGCA 1RCLA 1RSNA 3A5EA 2C4BA 4J5KA 1JBTA 1GOUA 1BSEA 2KF4A 1GSPA 3DH2A 3WHOA 3SYUA 1B2SA 1I2FA 1TTOA 1BVIA 3KCHA 1MGWA 1LOWA 1BAOA 1BRGA 1UCJA 1BNEA 3BIRA 1BANA 6RNTA 1FW7A 1RGEA 3AHSA 1I0XA 1B2UA 1YNVX 1MGRA 1SARA 1Q9EA 2BIRA 1RGGA 1GMRA 2BU4A 1HYFA 1BGSA 6GSPA 3WR2A 1BRHA 1FYSA
chains in the Genus database with same CATH superfamily
3GZBA 3NM7A 2RSXA 5AIFA 1JB2A 2K0MA 4HOHA 4N6NB 2CG0A 5KP3A 3CCM3 5M18A 1AY7A 1IK3A 3S5CA 2M7OA 1BNJA 2OWPA 1DMQA 2OCTA 3CNXA 1RTUA 2E2TA 2CFKA 2ZA4A 5AIGA 1LRAA 1A2VA 1YVSA 3AGOA 1JB4A 3TDGA 1N9EA 1PFPA 3CXC2 3JVCA 1UUWB 2XGNA 3LH4A 1VQ43 2CX0A 3RGRA 1C54A 4RBNA 1VQ83 2KAAA 1LQMB 2D1WA 1B21A 3BNCA 1NNVA 3FCSB 4HAAA 4XM4A 5IG4A 1S723 3NHXA 3D5GA 1BNFA 2Y73A 3DGYA 1T3BA 1IVVA 3Q1CA 3OWSA 1MWTA 5D83A 1ULIB 1VQQA 5ELUA 5CF2A 1GS3A 1QJGA 1KQS2 5I97A 3EHCA 5EVHA 1GMQA 1GMPA 2GSPA 4O8SA 1UCKA 3BNBA 2F5WA 2CWTA 2L4VA 1A2PA 3OV4A 4JRFA 4O02B 1QALA 2B24B 3LTBA 2HMMB 3QK9A 1MWUA 3HZPA 1YIT3 1IV7A 4O3VA 3NBRA 3S28A 2P38A 2WGQA 3UB1A 3RDEA 4GSPA 4LMIA 2RNTA 2GXFA 4HM3B 3HX8A 2CFGA 3EBYA 3GSPA 3EC9A 3IMAB 1QVG2 2HMKB 1JBRA 4BIRA 5D81A 2GEYA 4RNTA 1LXEA 1YJW3 3NQYA 1O7PB 2I9WA 4GHOA 1Q824 4HM2B 4STDA 4BTWA 3CCV3 5D82A 3FLJA 3MG3A 3OXAA 7RNTA 3MYTA 3EF8A 5EQLA 2IMJA 1CEWI 2BO9B 1IV9A 3URPA 2F5MA 3K63A 7GSPA 2CFDA 1IU7A 4MMZB 1JZOA 3MG2A 4AEQA 4IIAA 2IUKA 2L1SA 4FCZA 4FMDA 1BNSA 3D4AA 1Q42A 1I8VA 4LGQA 1W2ZA 1N8R4 1O7NB 1NJI4 1OACA 2CWVA 3DGOA 3T0UA 1VQM3 3F7XA 2YFLB 3UJMA 1OPYA 1UI7A 5IG3A 4OUQA 2F98A 5AEUB 2XSHB 1D6ZA 3EN1B 2CW9A 3RNTA 3CCR3 1GYBA 1WNHA 1YJ93 5IW9A 4XBXA 1N5HA 4J5KA 1E3VA 3F7SA 3EX9A 1JBTA 3N8BA 1BSEA 5IENA 1M1XB 2W0QA 3JUQA 1J2BA 1ROVA 2JQ5A 3H51A 4H61A 1I2FA 4OVMA 1BVIA 3PZWA 3LXUX 4QWTA 1K28A 3UNLA 3OWUA 4N3VA 1OHPA 1W02A 3X42A 3BIRA 3PXMA 1LNHA 3GZRA 1BANA 3MWZA 3CME3 2P0XA 5FGOA 3CCE3 3M8CA 1EG9B 2OTJ3 2XRXB 4J8TA 1YNVX 2RFRA 1Q9EA 4N6TA 4N6V0 1VZZA 3PS8A 1IQ8A 1RJOA 1FGRA 1BGSA 2GU1A 1W6YA 2W56A 1FYSA 1W5ZA 2KF3A 4HJLB 2JDIH 1ZX2A 2GBXB 1I70A 4KT3B 1RMSA 2AADA 4N6LA 3X3ZA 5G1LA 3V92A 4XBYA 4MEIA 3CC73 3UL5A 4BU4A 1OCVA 2XFSA 3NXJA 4BL2A 4BTYA 3LTCA 3WA2X 3FH1A 1B20A 4MMYB 2WGOA 1AR0A 4XB5A 1OGZA 2GBWB 4MMXB 3T8UA 4EW5A 2R41A 1Q7Y4 3F14A 1JN5B 1RN4A 5STDA 3F40A 4N6OB 3DMCA 2XR8B 4KVHA 1I3IA 1I2GA 3DY5A 3LTAA 2H0GA 3DGLA 3T8NA 1SQWA 3X3YA 3G0KA 3HOHA 4NREA 1BRJA 1TRPA 1UCIA 5DRVA 1ZS7A 5G1KA 2MF7A 2Z76A 3EB8A 1RNBA 2IA7A 1G02A 3NBBA 4DKIA 1PY3A 5AIHA 1DVCA 4GL6A 3WMDA 1BU4A 1STFI 4CJNA 4LZIA 1GY5A 1OHOA 3B8LA 4XDWA 5HOHA 1TRQA 3CC23 3LT8A 2W9QA 1YVBI 3EQQB 2FXTA 4XBTA 4FMCA 2KXGA 1X1UA 4XDVA 1RGLA 2CFWA 2UGIA 3KZTA 5AI1A 1RGHA 3CMA3 2ZDJA 1V57A 1DVDA 1AVKA 3BU4A 3QRDA 2HMOB 3B4OA 3VF1A 1NU3A 1O7MB 2QEX3 2QGUA 2OQEA 3CCQ3 1GOVA 1LNIA 2OTL3 1K734 1FA3A 2K54A 4EV2A 1LOYA 3Q3FA 1RGKA 4R9LA 1VQ63 1N5PA 5FW5A 4N6UA 3LTDA 3MHEA 1RDSA 1IVUA 1FUSA 3BNDA 1HU9A 2W2CA 5IEPA 4AKZA 2CC3A 1CH0A 1G96A 4HM4B 2W03A 8CHOA 3SOAA 1JZDA 1STDA 3EN8A 2W9PA 3OW22 3V99A 1IT7A 3F9SA 4OK0A 1GOYA 4WHAA 3AMOA 1BNIA 1BSAA 3X41A 5BVBA 1RRHA 2F4YA 2ZL8A 4HM1B 3I563 1RN1A 4HM8B 4CPKA 3O8YA 4IT7A 5AIIA 3NBJA 3A5EA 4Q53A 2C4BA 1M1K4 1BUQA 1KSIA 1WQLB 2R4IA 1VQ93 3Q2PA 3SYUA 3KCHA 4FCMA 4L8PA 1MGWA 3CPOA 3SOYA 3SVAA 1C7HA 4HBRA 1BAOA 2YFIB 1BRGA 1MWRA 2E2VA 1Q814 5AYSC 1O7WB 3F8HA 1UDII 3ZFZA 4LYLB 1B2MA 2Z77A 1DMNA 1US1A 3DUKA 1RGEA 1WMPA 4R9KA 1VQ53 1FW7A 2MC8A 1I0XA 1Y4KA 2GU3A 3LOYA 5G2GA 2XH9A 3FF2A 1HYFA 4RNZA 3PCSA 3FG3A 1UGIA 3JUMA 1W01A 3GZYB 3K7CA 4R1KA 1GD3A 3WOEB 9RNTA 1LOVA 2F56A 3MPHA 5LC6A 3U97A 4U13A 1QVF2 2CH9A 2STDA 4L7KA 5BXQA 3I0YA 1RGFA 4BL3A 4EXRA 3KSPA 1Z1SA 1U8CB 3DGMA 2IYJA 2CG1A 4TX4A 1PU4A 1JJ22 3FG1A 2PZVA 3BNEA 2CK3H 4NPBA 1PYLA 4L8OA 3BLZA 3S29A 4HKVB 2IY2A 1W00A 4KFFA 1I2EA 1JRQA 2SARA 3LYGA 1Q40A 1K41A 1UUVB 1UCLA 2CWUA 2KF6A 2QA43 1W6GA 1YJN3 2LYXA 4IPBA 3NM2A 2PNCA 2H0HA 4HM7B 3SXXA 1FGOA 1X1WA 5DREA 1B2ZA 4HZ9B 3D3LA 1B2XA 1EA2A 1BUJA 1TFKA 4LSOA 1IDPA 5IG0A 1RLSA 3S27A 5RNTA 1BIRA 3AHWA 3WA3A 2OQEC 1R4YA 2ZHXB 4WYKA 1T2HA 1SPUA 3E99A 1YGEA 1B27A 1HZ1A 1VQK3 4HYZA 3CCU3 1JKGA 5CF1A 1ISKA 3DXOA 2Z6BA 1K8A4 1W4NA 4O2HA 2AAEA 1B3SA 1KWIA 1BRNL 1E97A 1EKMA 1TJDA 4NHFA 5EEOA 1RCKA 1YIJ3 3K0ZA 1BSCA 1BNRA 5CK6A 1IT8A 4ILFA 2CHCA 2CX1A 3MSOA 1SIIA 4R80A 1FGTA 8RNTA 1BSDA 1W6CA 2OOVA 1FUWA 1LQGC 2XGLA 1ULJB 4FMBA 4FR9A 1TU5A 1BSBA 1QAKA 1BRKA 1JBSA 3WOFB 4GB5A 5CLKA 1BOXA 1IVWA 4FCJA 2W56B 2YFJB 1I0VA 3UL6A 1Q864 2BMOB 4J5GA 3HIGA 2WOFA 5JBSA 2BT3A 1QAFA 1U5OA 3FKAA 4EV5A 3Q90A 1GY6A 4N6MA 1WMNA 2HMNB 4ORLA 3X3XA 3EJVA 3ROBA 3B4PA 1IQXA 3CNMA 1RGAA 3N54B 4MJDA 4WYKB 1VQ73 1OHSA 3D5IA 1NB5I 1RRLA 3DGNA 5HGRA 1RGCA 3FSDA 5IERA 1ZO2A 2CKFB 3JUOA 3VGNA 1UUGB 1N9JA 1YHQ3 1AV4A 5A0OB 1TUHA 1CYUA 1GOUA 1T5YA 2KF4A 1GSPA 3WHOA 1A90A 1V58A 1B2SA 1TTOA 2IUJA 3ER7A 4WFOA 2A15A 3JUPA 3NQZA 1UI8A 2KRTA 1JNQA 6STDA 1VQP3 1TIJA 1NB3I 5AYRB 1ASKA 1IVXA 1S5AA 2HMLB 3SLUA 2CIUA 1LVNA 2UUGC 2YX9A 2GEXA 3LT9A 3GRDA 3AHSA 3V98A 4G1MB 4WP5A 1B2UA 1VQO3 1SARA 1WMOA 3GZXB 5KP4A 4H3UA 1RGGA 1GMRA 1HKXA 5M19A 3B7CA 4K61A 3CCS3 1FGMA 2BNGA 6GSPA 1BRHA 4K1VA 1IQYA 7STDA 1KC84 1JV2B 2C10A 2O9UX 3EBTA 1FZUA 2F86B 3FF0A 3U1WA 2INXA 1T2IA 1UGHI 2P0MA 5AEWB 3N9HA 5KP1A 4J9AA 2UX0A 3MG1A 4HM6B 1X1YA 2Z7AA 2QIYA 5IEOA 4EC6A 3OX9A 3X40A 3CU3A 3D79A 1D6UA 2V1LA 3G8ZA 5TGNA 3ZG0A 4KZ1A 3J7Yd 1A67A 3KE7A 1X1XA 3KN4A 3L0RA 3PGBA 1AQZA 1VQN3 1RHLA 3G16A 3HI7A 1ROAA 1R4CA 4I5QA 4KFDA 2H0IA 1SJWA 2P09A 5BIRA 3NV0A 4KFEA 4LEHA 1OF5A 4HM0B 1M904 2O3OA 2XSOB 1W2B2 2D42A 1I3FA 1O7GB 3AMOB 3ECFA 3RGAA 1NO3A 2Q07A 1DE3A 1EQKA 3AGNA 3KFQC 3NX0A 5BU4A 1DMMA 1FUTA 3WR2A 1L5GB 2F99A 2OOVC 1RNTA 3EE1A 2Y74A 3FZWA 1VQL3 3ALAA 1GY7A 1TP6A 1RKYA 1EEJA 3MKIA 5GSPA 4HVNA 4FMAA 4I4KA 5ELJA 2BMRB 1UW1A 5IF6A 3I553 3WODG 1QMAA 5LC7A 1OUNA 4AKYA 1M9GA 3GWRA 1KD14 4RNYA 3WDGB 1BNGA 5JPPA 3G6E3 1DETA 3D9RA 1OH0A 1RN7A 1DYUA 2ML5A 4HZBB 1N8QA 1NWWA 1O7HB 2HMJB 2XEPA 3A76A 1E3RA 3F8XA 5CXOA 1GD4A 4CDLA 1EUIC 2C11A 1W7CA 1MWSA 2KF5A 2KCDA 1MOLA 2BHMA 4RZMA 1MNLA 3NV0B 3CD63 3STDA 5JPUA 1OF5B 2W6JH 3KIIA 1WTHA 1CYVA 2RGQA 3KSED 3PCRA 3SX1A 3JUNA 4EBGA 1K9M4 3CC43 1JN5A 3G713 1A2KA 3ZG5A 4R4KA 1NDOB 4X2OA 2BMQB 1BRSA 1IYYA 3DZLA 1SIHA 3S67A 3H3HA 4X2HA 3OWYA 1TFOA 3K9MC 1YGWA 1G0TA 2XF3A 2RBIA 2RCDA 2WOHA 1BRIA 2W04A 2XFTA 4PEJA 1YI23 4WWUC 3KKGA 1Q7HA 3CCJ3 3PYJA 2CFLA 2HOHA 3LMLA 1AVLA 1ZGXA 3NUVA 2ML6A 1V74A 2K3DA 1Q40B 1RCLA 1RSNA 3LZAA 3HK4A 2J8XB 1FGQA 3IPTA 1LOXA 3K5TA 3DH2A 2FGTA 1F8NA 2SBLA 3VSYA 2B1XB 4K1UA 3CCL3 1LOWA 1JB5A 3HIIA 4EYCA 1UCJA 3IJEB 4BTXA 4CCVA 3CPW2 5M1AA 1BNEA 5IG5A 3FGYA 3SEDA 6RNTA 4K90B 1D6YA 1CQSA 1MGRA 3BB9A 4JF8A 3G4S3 2BIRA 4HM5B 3GAXA 2BU4A 3DM8A 2E2UA 2P05A 2LQVA 1JKGB 4ZM8A 3FG4A 2FNQA 1OGXA 2WO0A
chains in the Genus database with same CATH topology
9RNTA 1LOVA 2KF3A 2F56A 1FZUA 1I70A 1T2IA 1RGFA 1RMSA 4HOHA 2AADA 1AY7A 4BU4A 1BNJA 5HOHA 1X1YA 1RTUA 2ZA4A 1LRAA 3AGOA 1YVSA 1PYLA 1B20A 1C54A 1X1XA 1AQZA 1I2EA 2KAAA 2SARA 1B21A 1RHLA 4HAAA 1RN4A 2KF6A 1UCLA 3D5GA 1BNFA 3DGYA 1I3IA 1I2GA 5BIRA 1X1WA 1B2ZA 1B2XA 3HOHA 1BUJA 1BRJA 1TRPA 1I3FA 1UCIA 1GMQA 1GMPA 2GSPA 1RLSA 1UCKA 1RNBA 5RNTA 2F5WA 3AGNA 1G02A 1DE3A 1A2PA 1BIRA 1PY3A 3AHWA 5BU4A 1BU4A 1FUTA 1RNTA 1R4YA 1TRQA 1T2HA 1B27A 1HZ1A 5GSPA 4GSPA 2RNTA 3GSPA 1X1UA 1RGLA 2AAEA 1B3SA 1BRNL 1RGHA 1JBRA 4BIRA 4RNTA 1BNGA 1RCKA 3BU4A 1BSCA 1DETA 1BNRA 4GHOA 8RNTA 1GOVA 1BSDA 1LNIA 7RNTA 2KF5A 1LOYA 3Q3FA 1RGKA 1BSBA 1BRKA 1JBSA 7GSPA 1B2MA 3URPA 1BOXA 2F5MA 1RDSA 1FUSA 1I0VA 4J5GA 1CH0A 1BNSA 3D4AA 1I8VA 1BRSA 1IYYA 1YGWA 1GOYA 1RGAA 2RBIA 1BNIA 1BRIA 1BSAA 3D5IA 2F4YA 1RN1A 2HOHA 3RNTA 1ZGXA 1RGCA 1RCLA 1RSNA 3A5EA 2C4BA 4J5KA 1JBTA 1GOUA 1BSEA 2KF4A 1GSPA 3DH2A 3WHOA 3SYUA 1B2SA 1I2FA 1TTOA 1BVIA 3KCHA 1MGWA 1LOWA 1BAOA 1BRGA 1UCJA 1BNEA 3BIRA 1BANA 6RNTA 1FW7A 1RGEA 3AHSA 1I0XA 1B2UA 1YNVX 1MGRA 1SARA 1Q9EA 2BIRA 1RGGA 1GMRA 2BU4A 1HYFA 1BGSA 6GSPA 3WR2A 1BRHA 1FYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 9RNT A;  1LOV A;  2KF3 A;  2F56 A;  1FZU A;  1I70 A;  1T2I A;  1RGF A;  1RMS A;  4HOH A;  2AAD A;  1AY7 A;  4BU4 A;  1BNJ A;  5HOH A;  1X1Y A;  1RTU A;  2ZA4 A;  1LRA A;  3AGO A;  1YVS A;  1PYL A;  1B20 A;  1C54 A;  1X1X A;  1AQZ A;  1I2E A;  2KAA A;  2SAR A;  1B21 A;  1RHL A;  4HAA A;  1RN4 A;  2KF6 A;  1UCL A;  3D5G A;  1BNF A;  3DGY A;  1I3I A;  1I2G A;  5BIR A;  1X1W A;  1B2Z A;  1B2X A;  3HOH A;  1BUJ A;  1BRJ A;  1TRP A;  1I3F A;  1UCI A;  1GMQ A;  1GMP A;  2GSP A;  1RLS A;  1UCK A;  1RNB A;  5RNT A;  2F5W A;  3AGN A;  1G02 A;  1DE3 A;  1A2P A;  1BIR A;  1PY3 A;  3AHW A;  5BU4 A;  1BU4 A;  1FUT A;  1RNT A;  1R4Y A;  1TRQ A;  1T2H A;  1B27 A;  1HZ1 A;  5GSP A;  4GSP A;  2RNT A;  3GSP A;  1X1U A;  1RGL A;  2AAE A;  1B3S A;  1BRN L;  1RGH A;  1JBR A;  4BIR A;  4RNT A;  1BNG A;  1RCK A;  3BU4 A;  1BSC A;  1DET A;  1BNR A;  4GHO A;  8RNT A;  1GOV A;  1BSD A;  1LNI A;  7RNT A;  2KF5 A;  1LOY A;  3Q3F A;  1RGK A;  1BSB A;  1BRK A;  1JBS A;  7GSP A;  1B2M A;  3URP A;  1BOX A;  2F5M A;  1RDS A;  1FUS A;  1I0V A;  4J5G A;  1CH0 A;  1BNS A;  3D4A A;  1I8V A;  1BRS A;  1IYY A;  1YGW A;  1GOY A;  1RGA A;  2RBI A;  1BNI A;  1BRI A;  1BSA A;  3D5I A;  2F4Y A;  1RN1 A;  2HOH A;  3RNT A;  1ZGX A;  1RGC A;  1RCL A;  1RSN A;  3A5E A;  2C4B A;  4J5K A;  1JBT A;  1GOU A;  1BSE A;  2KF4 A;  1GSP A;  3DH2 A;  3WHO A;  3SYU A;  1B2S A;  1I2F A;  1TTO A;  1BVI A;  3KCH A;  1MGW A;  1LOW A;  1BAO A;  1BRG A;  1UCJ A;  1BNE A;  3BIR A;  1BAN A;  6RNT A;  1FW7 A;  1RGE A;  3AHS A;  1I0X A;  1B2U A;  1YNV X;  1MGR A;  1SAR A;  1Q9E A;  2BIR A;  1RGG A;  1GMR A;  2BU4 A;  1HYF A;  1BGS A;  6GSP A;  3WR2 A;  1BRH A;  1FYS A; 
#chains in the Genus database with same CATH topology
 3GZB A;  3NM7 A;  2RSX A;  5AIF A;  1JB2 A;  2K0M A;  4HOH A;  4N6N B;  2CG0 A;  5KP3 A;  3CCM 3;  5M18 A;  1AY7 A;  1IK3 A;  3S5C A;  2M7O A;  1BNJ A;  2OWP A;  1DMQ A;  2OCT A;  3CNX A;  1RTU A;  2E2T A;  2CFK A;  2ZA4 A;  5AIG A;  1LRA A;  1A2V A;  1YVS A;  3AGO A;  1JB4 A;  3TDG A;  1N9E A;  1PFP A;  3CXC 2;  3JVC A;  1UUW B;  2XGN A;  3LH4 A;  1VQ4 3;  2CX0 A;  3RGR A;  1C54 A;  4RBN A;  1VQ8 3;  2KAA A;  1LQM B;  2D1W A;  1B21 A;  3BNC A;  1NNV A;  3FCS B;  4HAA A;  4XM4 A;  5IG4 A;  1S72 3;  3NHX A;  3D5G A;  1BNF A;  2Y73 A;  3DGY A;  1T3B A;  1IVV A;  3Q1C A;  3OWS A;  1MWT A;  5D83 A;  1ULI B;  1VQQ A;  5ELU A;  5CF2 A;  1GS3 A;  1QJG A;  1KQS 2;  5I97 A;  3EHC A;  5EVH A;  1GMQ A;  1GMP A;  2GSP A;  4O8S A;  1UCK A;  3BNB A;  2F5W A;  2CWT A;  2L4V A;  1A2P A;  3OV4 A;  4JRF A;  4O02 B;  1QAL A;  2B24 B;  3LTB A;  2HMM B;  3QK9 A;  1MWU A;  3HZP A;  1YIT 3;  1IV7 A;  4O3V A;  3NBR A;  3S28 A;  2P38 A;  2WGQ A;  3UB1 A;  3RDE A;  4GSP A;  4LMI A;  2RNT A;  2GXF A;  4HM3 B;  3HX8 A;  2CFG A;  3EBY A;  3GSP A;  3EC9 A;  3IMA B;  1QVG 2;  2HMK B;  1JBR A;  4BIR A;  5D81 A;  2GEY A;  4RNT A;  1LXE A;  1YJW 3;  3NQY A;  1O7P B;  2I9W A;  4GHO A;  1Q82 4;  4HM2 B;  4STD A;  4BTW A;  3CCV 3;  5D82 A;  3FLJ A;  3MG3 A;  3OXA A;  7RNT A;  3MYT A;  3EF8 A;  5EQL A;  2IMJ A;  1CEW I;  2BO9 B;  1IV9 A;  3URP A;  2F5M A;  3K63 A;  7GSP A;  2CFD A;  1IU7 A;  4MMZ B;  1JZO A;  3MG2 A;  4AEQ A;  4IIA A;  2IUK A;  2L1S A;  4FCZ A;  4FMD A;  1BNS A;  3D4A A;  1Q42 A;  1I8V A;  4LGQ A;  1W2Z A;  1N8R 4;  1O7N B;  1NJI 4;  1OAC A;  2CWV A;  3DGO A;  3T0U A;  1VQM 3;  3F7X A;  2YFL B;  3UJM A;  1OPY A;  1UI7 A;  5IG3 A;  4OUQ A;  2F98 A;  5AEU B;  2XSH B;  1D6Z A;  3EN1 B;  2CW9 A;  3RNT A;  3CCR 3;  1GYB A;  1WNH A;  1YJ9 3;  5IW9 A;  4XBX A;  1N5H A;  4J5K A;  1E3V A;  3F7S A;  3EX9 A;  1JBT A;  3N8B A;  1BSE A;  5IEN A;  1M1X B;  2W0Q A;  3JUQ A;  1J2B A;  1ROV A;  2JQ5 A;  3H51 A;  4H61 A;  1I2F A;  4OVM A;  1BVI A;  3PZW A;  3LXU X;  4QWT A;  1K28 A;  3UNL A;  3OWU A;  4N3V A;  1OHP A;  1W02 A;  3X42 A;  3BIR A;  3PXM A;  1LNH A;  3GZR A;  1BAN A;  3MWZ A;  3CME 3;  2P0X A;  5FGO A;  3CCE 3;  3M8C A;  1EG9 B;  2OTJ 3;  2XRX B;  4J8T A;  1YNV X;  2RFR A;  1Q9E A;  4N6T A;  4N6V 0;  1VZZ A;  3PS8 A;  1IQ8 A;  1RJO A;  1FGR A;  1BGS A;  2GU1 A;  1W6Y A;  2W56 A;  1FYS A;  1W5Z A;  2KF3 A;  4HJL B;  2JDI H;  1ZX2 A;  2GBX B;  1I70 A;  4KT3 B;  1RMS A;  2AAD A;  4N6L A;  3X3Z A;  5G1L A;  3V92 A;  4XBY A;  4MEI A;  3CC7 3;  3UL5 A;  4BU4 A;  1OCV A;  2XFS A;  3NXJ A;  4BL2 A;  4BTY A;  3LTC A;  3WA2 X;  3FH1 A;  1B20 A;  4MMY B;  2WGO A;  1AR0 A;  4XB5 A;  1OGZ A;  2GBW B;  4MMX B;  3T8U A;  4EW5 A;  2R41 A;  1Q7Y 4;  3F14 A;  1JN5 B;  1RN4 A;  5STD A;  3F40 A;  4N6O B;  3DMC A;  2XR8 B;  4KVH A;  1I3I A;  1I2G A;  3DY5 A;  3LTA A;  2H0G A;  3DGL A;  3T8N A;  1SQW A;  3X3Y A;  3G0K A;  3HOH A;  4NRE A;  1BRJ A;  1TRP A;  1UCI A;  5DRV A;  1ZS7 A;  5G1K A;  2MF7 A;  2Z76 A;  3EB8 A;  1RNB A;  2IA7 A;  1G02 A;  3NBB A;  4DKI A;  1PY3 A;  5AIH A;  1DVC A;  4GL6 A;  3WMD A;  1BU4 A;  1STF I;  4CJN A;  4LZI A;  1GY5 A;  1OHO A;  3B8L A;  4XDW A;  5HOH A;  1TRQ A;  3CC2 3;  3LT8 A;  2W9Q A;  1YVB I;  3EQQ B;  2FXT A;  4XBT A;  4FMC A;  2KXG A;  1X1U A;  4XDV A;  1RGL A;  2CFW A;  2UGI A;  3KZT A;  5AI1 A;  1RGH A;  3CMA 3;  2ZDJ A;  1V57 A;  1DVD A;  1AVK A;  3BU4 A;  3QRD A;  2HMO B;  3B4O A;  3VF1 A;  1NU3 A;  1O7M B;  2QEX 3;  2QGU A;  2OQE A;  3CCQ 3;  1GOV A;  1LNI A;  2OTL 3;  1K73 4;  1FA3 A;  2K54 A;  4EV2 A;  1LOY A;  3Q3F A;  1RGK A;  4R9L A;  1VQ6 3;  1N5P A;  5FW5 A;  4N6U A;  3LTD A;  3MHE A;  1RDS A;  1IVU A;  1FUS A;  3BND A;  1HU9 A;  2W2C A;  5IEP A;  4AKZ A;  2CC3 A;  1CH0 A;  1G96 A;  4HM4 B;  2W03 A;  8CHO A;  3SOA A;  1JZD A;  1STD A;  3EN8 A;  2W9P A;  3OW2 2;  3V99 A;  1IT7 A;  3F9S A;  4OK0 A;  1GOY A;  4WHA A;  3AMO A;  1BNI A;  1BSA A;  3X41 A;  5BVB A;  1RRH A;  2F4Y A;  2ZL8 A;  4HM1 B;  3I56 3;  1RN1 A;  4HM8 B;  4CPK A;  3O8Y A;  4IT7 A;  5AII A;  3NBJ A;  3A5E A;  4Q53 A;  2C4B A;  1M1K 4;  1BUQ A;  1KSI A;  1WQL B;  2R4I A;  1VQ9 3;  3Q2P A;  3SYU A;  3KCH A;  4FCM A;  4L8P A;  1MGW A;  3CPO A;  3SOY A;  3SVA A;  1C7H A;  4HBR A;  1BAO A;  2YFI B;  1BRG A;  1MWR A;  2E2V A;  1Q81 4;  5AYS C;  1O7W B;  3F8H A;  1UDI I;  3ZFZ A;  4LYL B;  1B2M A;  2Z77 A;  1DMN A;  1US1 A;  3DUK A;  1RGE A;  1WMP A;  4R9K A;  1VQ5 3;  1FW7 A;  2MC8 A;  1I0X A;  1Y4K A;  2GU3 A;  3LOY A;  5G2G A;  2XH9 A;  3FF2 A;  1HYF A;  4RNZ A;  3PCS A;  3FG3 A;  1UGI A;  3JUM A;  1W01 A;  3GZY B;  3K7C A;  4R1K A;  1GD3 A;  3WOE B;  9RNT A;  1LOV A;  2F56 A;  3MPH A;  5LC6 A;  3U97 A;  4U13 A;  1QVF 2;  2CH9 A;  2STD A;  4L7K A;  5BXQ A;  3I0Y A;  1RGF A;  4BL3 A;  4EXR A;  3KSP A;  1Z1S A;  1U8C B;  3DGM A;  2IYJ A;  2CG1 A;  4TX4 A;  1PU4 A;  1JJ2 2;  3FG1 A;  2PZV A;  3BNE A;  2CK3 H;  4NPB A;  1PYL A;  4L8O A;  3BLZ A;  3S29 A;  4HKV B;  2IY2 A;  1W00 A;  4KFF A;  1I2E A;  1JRQ A;  2SAR A;  3LYG A;  1Q40 A;  1K41 A;  1UUV B;  1UCL A;  2CWU A;  2KF6 A;  2QA4 3;  1W6G A;  1YJN 3;  2LYX A;  4IPB A;  3NM2 A;  2PNC A;  2H0H A;  4HM7 B;  3SXX A;  1FGO A;  1X1W A;  5DRE A;  1B2Z A;  4HZ9 B;  3D3L A;  1B2X A;  1EA2 A;  1BUJ A;  1TFK A;  4LSO A;  1IDP A;  5IG0 A;  1RLS A;  3S27 A;  5RNT A;  1BIR A;  3AHW A;  3WA3 A;  2OQE C;  1R4Y A;  2ZHX B;  4WYK A;  1T2H A;  1SPU A;  3E99 A;  1YGE A;  1B27 A;  1HZ1 A;  1VQK 3;  4HYZ A;  3CCU 3;  1JKG A;  5CF1 A;  1ISK A;  3DXO A;  2Z6B A;  1K8A 4;  1W4N A;  4O2H A;  2AAE A;  1B3S A;  1KWI A;  1BRN L;  1E97 A;  1EKM A;  1TJD A;  4NHF A;  5EEO A;  1RCK A;  1YIJ 3;  3K0Z A;  1BSC A;  1BNR A;  5CK6 A;  1IT8 A;  4ILF A;  2CHC A;  2CX1 A;  3MSO A;  1SII A;  4R80 A;  1FGT A;  8RNT A;  1BSD A;  1W6C A;  2OOV A;  1FUW A;  1LQG C;  2XGL A;  1ULJ B;  4FMB A;  4FR9 A;  1TU5 A;  1BSB A;  1QAK A;  1BRK A;  1JBS A;  3WOF B;  4GB5 A;  5CLK A;  1BOX A;  1IVW A;  4FCJ A;  2W56 B;  2YFJ B;  1I0V A;  3UL6 A;  1Q86 4;  2BMO B;  4J5G A;  3HIG A;  2WOF A;  5JBS A;  2BT3 A;  1QAF A;  1U5O A;  3FKA A;  4EV5 A;  3Q90 A;  1GY6 A;  4N6M A;  1WMN A;  2HMN B;  4ORL A;  3X3X A;  3EJV A;  3ROB A;  3B4P A;  1IQX A;  3CNM A;  1RGA A;  3N54 B;  4MJD A;  4WYK B;  1VQ7 3;  1OHS A;  3D5I A;  1NB5 I;  1RRL A;  3DGN A;  5HGR A;  1RGC A;  3FSD A;  5IER A;  1ZO2 A;  2CKF B;  3JUO A;  3VGN A;  1UUG B;  1N9J A;  1YHQ 3;  1AV4 A;  5A0O B;  1TUH A;  1CYU A;  1GOU A;  1T5Y A;  2KF4 A;  1GSP A;  3WHO A;  1A90 A;  1V58 A;  1B2S A;  1TTO A;  2IUJ A;  3ER7 A;  4WFO A;  2A15 A;  3JUP A;  3NQZ A;  1UI8 A;  2KRT A;  1JNQ A;  6STD A;  1VQP 3;  1TIJ A;  1NB3 I;  5AYR B;  1ASK A;  1IVX A;  1S5A A;  2HML B;  3SLU A;  2CIU A;  1LVN A;  2UUG C;  2YX9 A;  2GEX A;  3LT9 A;  3GRD A;  3AHS A;  3V98 A;  4G1M B;  4WP5 A;  1B2U A;  1VQO 3;  1SAR A;  1WMO A;  3GZX B;  5KP4 A;  4H3U A;  1RGG A;  1GMR A;  1HKX A;  5M19 A;  3B7C A;  4K61 A;  3CCS 3;  1FGM A;  2BNG A;  6GSP A;  1BRH A;  4K1V A;  1IQY A;  7STD A;  1KC8 4;  1JV2 B;  2C10 A;  2O9U X;  3EBT A;  1FZU A;  2F86 B;  3FF0 A;  3U1W A;  2INX A;  1T2I A;  1UGH I;  2P0M A;  5AEW B;  3N9H A;  5KP1 A;  4J9A A;  2UX0 A;  3MG1 A;  4HM6 B;  1X1Y A;  2Z7A A;  2QIY A;  5IEO A;  4EC6 A;  3OX9 A;  3X40 A;  3CU3 A;  3D79 A;  1D6U A;  2V1L A;  3G8Z A;  5TGN A;  3ZG0 A;  4KZ1 A;  3J7Y d;  1A67 A;  3KE7 A;  1X1X A;  3KN4 A;  3L0R A;  3PGB A;  1AQZ A;  1VQN 3;  1RHL A;  3G16 A;  3HI7 A;  1ROA A;  1R4C A;  4I5Q A;  4KFD A;  2H0I A;  1SJW A;  2P09 A;  5BIR A;  3NV0 A;  4KFE A;  4LEH A;  1OF5 A;  4HM0 B;  1M90 4;  2O3O A;  2XSO B;  1W2B 2;  2D42 A;  1I3F A;  1O7G B;  3AMO B;  3ECF A;  3RGA A;  1NO3 A;  2Q07 A;  1DE3 A;  1EQK A;  3AGN A;  3KFQ C;  3NX0 A;  5BU4 A;  1DMM A;  1FUT A;  3WR2 A;  1L5G B;  2F99 A;  2OOV C;  1RNT A;  3EE1 A;  2Y74 A;  3FZW A;  1VQL 3;  3ALA A;  1GY7 A;  1TP6 A;  1RKY A;  1EEJ A;  3MKI A;  5GSP A;  4HVN A;  4FMA A;  4I4K A;  5ELJ A;  2BMR B;  1UW1 A;  5IF6 A;  3I55 3;  3WOD G;  1QMA A;  5LC7 A;  1OUN A;  4AKY A;  1M9G A;  3GWR A;  1KD1 4;  4RNY A;  3WDG B;  1BNG A;  5JPP A;  3G6E 3;  1DET A;  3D9R A;  1OH0 A;  1RN7 A;  1DYU A;  2ML5 A;  4HZB B;  1N8Q A;  1NWW A;  1O7H B;  2HMJ B;  2XEP A;  3A76 A;  1E3R A;  3F8X A;  5CXO A;  1GD4 A;  4CDL A;  1EUI C;  2C11 A;  1W7C A;  1MWS A;  2KF5 A;  2KCD A;  1MOL A;  2BHM A;  4RZM A;  1MNL A;  3NV0 B;  3CD6 3;  3STD A;  5JPU A;  1OF5 B;  2W6J H;  3KII A;  1WTH A;  1CYV A;  2RGQ A;  3KSE D;  3PCR A;  3SX1 A;  3JUN A;  4EBG A;  1K9M 4;  3CC4 3;  1JN5 A;  3G71 3;  1A2K A;  3ZG5 A;  4R4K A;  1NDO B;  4X2O A;  2BMQ B;  1BRS A;  1IYY A;  3DZL A;  1SIH A;  3S67 A;  3H3H A;  4X2H A;  3OWY A;  1TFO A;  3K9M C;  1YGW A;  1G0T A;  2XF3 A;  2RBI A;  2RCD A;  2WOH A;  1BRI A;  2W04 A;  2XFT A;  4PEJ A;  1YI2 3;  4WWU C;  3KKG A;  1Q7H A;  3CCJ 3;  3PYJ A;  2CFL A;  2HOH A;  3LML A;  1AVL A;  1ZGX A;  3NUV A;  2ML6 A;  1V74 A;  2K3D A;  1Q40 B;  1RCL A;  1RSN A;  3LZA A;  3HK4 A;  2J8X B;  1FGQ A;  3IPT A;  1LOX A;  3K5T A;  3DH2 A;  2FGT A;  1F8N A;  2SBL A;  3VSY A;  2B1X B;  4K1U A;  3CCL 3;  1LOW A;  1JB5 A;  3HII A;  4EYC A;  1UCJ A;  3IJE B;  4BTX A;  4CCV A;  3CPW 2;  5M1A A;  1BNE A;  5IG5 A;  3FGY A;  3SED A;  6RNT A;  4K90 B;  1D6Y A;  1CQS A;  1MGR A;  3BB9 A;  4JF8 A;  3G4S 3;  2BIR A;  4HM5 B;  3GAX A;  2BU4 A;  3DM8 A;  2E2U A;  2P05 A;  2LQV A;  1JKG B;  4ZM8 A;  3FG4 A;  2FNQ A;  1OGX A;  2WO0 A; 
#chains in the Genus database with same CATH homology
 9RNT A;  1LOV A;  2KF3 A;  2F56 A;  1FZU A;  1I70 A;  1T2I A;  1RGF A;  1RMS A;  4HOH A;  2AAD A;  1AY7 A;  4BU4 A;  1BNJ A;  5HOH A;  1X1Y A;  1RTU A;  2ZA4 A;  1LRA A;  3AGO A;  1YVS A;  1PYL A;  1B20 A;  1C54 A;  1X1X A;  1AQZ A;  1I2E A;  2KAA A;  2SAR A;  1B21 A;  1RHL A;  4HAA A;  1RN4 A;  2KF6 A;  1UCL A;  3D5G A;  1BNF A;  3DGY A;  1I3I A;  1I2G A;  5BIR A;  1X1W A;  1B2Z A;  1B2X A;  3HOH A;  1BUJ A;  1BRJ A;  1TRP A;  1I3F A;  1UCI A;  1GMQ A;  1GMP A;  2GSP A;  1RLS A;  1UCK A;  1RNB A;  5RNT A;  2F5W A;  3AGN A;  1G02 A;  1DE3 A;  1A2P A;  1BIR A;  1PY3 A;  3AHW A;  5BU4 A;  1BU4 A;  1FUT A;  1RNT A;  1R4Y A;  1TRQ A;  1T2H A;  1B27 A;  1HZ1 A;  5GSP A;  4GSP A;  2RNT A;  3GSP A;  1X1U A;  1RGL A;  2AAE A;  1B3S A;  1BRN L;  1RGH A;  1JBR A;  4BIR A;  4RNT A;  1BNG A;  1RCK A;  3BU4 A;  1BSC A;  1DET A;  1BNR A;  4GHO A;  8RNT A;  1GOV A;  1BSD A;  1LNI A;  7RNT A;  2KF5 A;  1LOY A;  3Q3F A;  1RGK A;  1BSB A;  1BRK A;  1JBS A;  7GSP A;  1B2M A;  3URP A;  1BOX A;  2F5M A;  1RDS A;  1FUS A;  1I0V A;  4J5G A;  1CH0 A;  1BNS A;  3D4A A;  1I8V A;  1BRS A;  1IYY A;  1YGW A;  1GOY A;  1RGA A;  2RBI A;  1BNI A;  1BRI A;  1BSA A;  3D5I A;  2F4Y A;  1RN1 A;  2HOH A;  3RNT A;  1ZGX A;  1RGC A;  1RCL A;  1RSN A;  3A5E A;  2C4B A;  4J5K A;  1JBT A;  1GOU A;  1BSE A;  2KF4 A;  1GSP A;  3DH2 A;  3WHO A;  3SYU A;  1B2S A;  1I2F A;  1TTO A;  1BVI A;  3KCH A;  1MGW A;  1LOW A;  1BAO A;  1BRG A;  1UCJ A;  1BNE A;  3BIR A;  1BAN A;  6RNT A;  1FW7 A;  1RGE A;  3AHS A;  1I0X A;  1B2U A;  1YNV X;  1MGR A;  1SAR A;  1Q9E A;  2BIR A;  1RGG A;  1GMR A;  2BU4 A;  1HYF A;  1BGS A;  6GSP A;  3WR2 A;  1BRH A;  1FYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...