1Q9EA

Rnase t1 variant with adenine specificity
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHEFRNWNGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNase T1 Variant RV Cleaves Single-Stranded RNA after Purines Due to Specific Recognition by the Asn46 Side Chain Amide.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
molecule keywords Guanyl-specific ribonuclease T1 precursor
total genus 27
structure length 104
sequence length 104
chains with identical sequence B, C
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2003-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1q9eA00
2ZA4A 3BU4A 1BNSA 1BSCA 1TTOA 3D5IA 3DGYA 1BSDA 1I3IA 5HOHA 1BNGA 5RNTA 1BRGA 2KF4A 1YNVX 1UCKA 1B2UA 1BVIA 1BAOA 1RDSA 4BU4A 3WR2A 1I2EA 1AQZA 1DE3A 2SARA 1RN1A 1UCLA 7GSPA 1BRNL 2RBIA 2KF5A 3AGOA 1JBTA 1B21A 1RGLA 1BRHA 1GMPA 2F5MA 3URPA 1T2HA 2BU4A 1FUTA 1LRAA 1YVSA 9RNTA 1I0VA 1BGSA 3AGNA 1X1WA 1BSEA 1RN4A 3D4AA 3RNTA 1X1YA 1FZUA 1BNIA 1BSBA 4J5KA 1BNRA 4J5GA 1HZ1A 1IYYA 3WHOA 7RNTA 1X1UA 5BIRA 1G02A 1FUSA 1RNTA 2HOHA 1CH0A 1R4YA 1TRQA 1T2IA 1B3SA 1RHLA 1B27A 1RLSA 1BNEA 3Q3FA 4HAAA 1HYFA 1LOYA 1BRIA 1RTUA 5BU4A 1GOVA 1UCJA 1RGKA 1GMQA 1RSNA 1UCIA 1BUJA 1GOYA 1I2GA 2RNTA 3KCHA 2F56A 1FW7A 6RNTA 1BRJA 1B2SA 1B20A 3D5GA 3AHSA 1BRKA 3DH2A 6GSPA 1DETA 1Q9EA 2AADA 3SYUA 1SARA 2KF3A 4GSPA 1RGEA 1BU4A 1FYSA 4GHOA 5GSPA 1I70A 1BANA 4BIRA 1A2PA 1LOVA 1RNBA 1BNJA 1RGGA 1X1XA 2GSPA 1RCKA 1LNIA 1RGAA 2KAAA 1BSAA 1JBRA 1RCLA 1RGCA 1GSPA 1ZGXA 1C54A 1MGWA 1PY3A 3GSPA 1I3FA 2BIRA 2F5WA 1B2XA 2C4BA 2F4YA 1PYLA 1LOWA 1RGFA 2KF6A 1MGRA 4RNTA 8RNTA 1RMSA 1BRSA 1RGHA 1B2MA 3A5EA 4HOHA 3BIRA 1BIRA 1BNFA 1I0XA 1GMRA 1YGWA 3HOHA 1I8VA 1GOUA 3AHWA 1B2ZA 1JBSA 1AY7A 2AAEA 1I2FA 1TRPA 1BOXA
chains in the Genus database with same CATH superfamily
3LZAA 1MWSA 1TTOA 1SIIA 1OHPA 2LQVA 4H61A 3QK9A 1D6YA 2RSXA 1CYVA 1BVIA 1IV7A 1O7NB 3CCV3 3D79A 4BU4A 3WR2A 1SJWA 1ROAA 3F14A 3GZYB 1WQLB 2F98A 3F8HA 4KZ1A 1RGLA 1V57A 4PEJA 1BRHA 3JUNA 1GMPA 1TU5A 5I97A 3CCJ3 3OWUA 3G6E3 2BU4A 3FGYA 3JUPA 2CG0A 1AV4A 1BGSA 2HMOB 4X2OA 5AIHA 1FGRA 3EHCA 5IG4A 1BSEA 4EC6A 1KD14 1ZS7A 3RNTA 2HMJB 3N54B 3X3YA 3F8XA 3VGNA 4HM6B 1W5ZA 2C11A 2F86B 1FZUA 1BSBA 1BNRA 1IVVA 3LMLA 4XM4A 1VQP3 3PZWA 1A90A 1X1UA 5BIRA 1RNTA 3CME3 1VQ63 1TRQA 1A2KA 2H0HA 1M904 1RHLA 2H0GA 2STDA 3KSED 1RLSA 4U13A 3WA3A 3OWSA 3Q3FA 5IF6A 4HAAA 1HYFA 4CCVA 4EW5A 1UCJA 2GXFA 4WWUC 4WHAA 5HGRA 1Q7Y4 1UI7A 1RSNA 1US1A 4LGQA 4K1UA 4H3UA 2E2TA 4RZMA 4WYKA 3ECFA 2K0MA 1M9GA 4XB5A 5KP1A 2K54A 3I553 3MYTA 2RGQA 2WGQA 3DY5A 3AHSA 1FGQA 4HM1B 2IYJA 3DH2A 3TDGA 1YJ93 1DETA 1JB4A 1TP6A 1FGMA 3JUMA 3RDEA 1J2BA 3CMA3 2P0MA 4R9LA 1QJGA 1DMNA 1JN5B 2INXA 2BMRB 1PU4A 2XH9A 3JVCA 2BT3A 1DVDA 3G16A 4HVNA 3SLUA 1A2PA 5BXQA 1RGGA 1TUHA 5IG5A 1ULJB 1LNIA 1RGAA 4HM7B 2XSOB 3NBBA 5JBSA 1VQ93 1VQ73 1W6CA 2FXTA 1ZGXA 1MGWA 1E3VA 1PY3A 2P0XA 4N6LA 3WDGB 4BTYA 1D6UA 1DYUA 3U97A 3DGMA 4AEQA 1KQS2 3KIIA 2C4BA 2GEXA 1AVKA 2ML5A 1RGFA 3LTDA 4WP5A 3FG4A 4NREA 3QRDA 4FMDA 4K61A 1BRSA 2ZL8A 1WMNA 2M7OA 4XBTA 4BTWA 3A5EA 1B2MA 1QVF2 4N6V0 1GY6A 3S27A 2XFSA 4NPBA 3B4OA 2BO9B 1GMRA 5D83A 4HM0B 5G2GA 3ZG0A 1GOUA 4I4KA 1G96A 1K8A4 3D9RA 3B4PA 3MPHA 3NHXA 4GSPA 5AIFA 4DKIA 3BU4A 2ZDJA 4N6MA 1BNSA 3LTBA 3MG3A 3LTCA 4HM2B 4NHFA 1ASKA 3AMOA 3D5IA 2CC3A 3NQYA 4ILFA 5CLKA 3SVAA 2QA43 1BNGA 3NM2A 4J8TA 1BRGA 2KF4A 4WYKB 2W56A 4EYCA 3EN8A 1JZOA 1YNVX 1YJN3 1KC84 2E2VA 3AMOB 3KFQC 1YIJ3 1BAOA 3FF0A 2XSHB 4OUQA 1O7WB 4ORLA 4MEIA 1EKMA 1AQZA 2W9PA 3NV0B 5ELUA 2SARA 1RN1A 4QWTA 1BRNL 4KT3B 2YX9A 4L8PA 3FH1A 3AGOA 4LEHA 3L0RA 4FCMA 5KP4A 1JBTA 3HIGA 3PGBA 3KSPA 4CPKA 3LT8A 2W0QA 2F5MA 3Q90A 1T2HA 2CHCA 2Z7AA 3PXMA 1FUTA 4JRFA 3IPTA 1IDPA 5IEOA 9RNTA 1I0VA 1ZO2A 3AGNA 3ER7A 1DVCA 1X1WA 3NUVA 4FMBA 3EC9A 5CF1A 3CNXA 2CWUA 2Z77A 1SPUA 5AYRB 1OF5A 1X1YA 3CCQ3 2P09A 1VQQA 3LH4A 3X3ZA 2YFJB 4J5KA 1BNIA 4J5GA 2K3DA 3N9HA 1HZ1A 1Q864 1G02A 3SX1A 2HOHA 4O02B 1CH0A 1NWWA 1R4YA 5CXOA 1B3SA 5AI1A 1B27A 1PFPA 1BNEA 1U8CB 4IPBA 1ZX2A 5D81A 3UB1A 1BRIA 2RFRA 3B8LA 1GOVA 3EJVA 2ZHXB 4R9KA 3ZFZA 1RGKA 1VZZA 4J9AA 2GBXB 1A67A 1FUWA 1Z1SA 2BMOB 2KRTA 3FF2A 3KN4A 1NJI4 3EBTA 1K28A 2RNTA 4FMAA 2FGTA 1IVWA 3BLZA 2E2UA 3HI7A 1FGOA 2CX1A 2F56A 2CFLA 1U5OA 4KVHA 3G4S3 2CFKA 2B1XB 1B2SA 1B20A 3D5GA 3T0UA 3V98A 3K0ZA 4KFEA 1JRQA 1WTHA 3SYUA 2WOFA 3I0YA 4HZBB 3DGLA 3K7CA 2OQEC 1RGEA 1FYSA 2W56B 3LOYA 2Y73A 3K63A 4KFFA 1I70A 1OGZA 1O7HB 1BANA 1YVBI 1OHSA 2PNCA 2V1LA 1K9M4 1SIHA 2CFDA 3WA2X 3NX0A 2GSPA 4R4KA 2IA7A 5DRVA 5LC6A 3UJMA 1JNQA 1BSAA 1JBRA 1RCLA 2W2CA 2CIUA 5M18A 2XF3A 2HMNB 3HIIA 1W02A 1EQKA 2XFTA 4BL2A 1C54A 4XBYA 2R4IA 2XR8B 2SBLA 3DXOA 3GSPA 1I3FA 4L8OA 2CG1A 2P05A 5STDA 3Q1CA 1Q814 2F4YA 1N8R4 5M19A 1PYLA 2D42A 1S723 1M1K4 4XBXA 2W03A 8RNTA 1N9EA 1RMSA 4HZ9B 1RGHA 1IT7A 2IMJA 3OX9A 1O7GB 4N6UA 1WMPA 2QIYA 2MF7A 5JPUA 3HK4A 1BNFA 1I0XA 4RBNA 1OH0A 3IMAB 2CFGA 1GS3A 1I8VA 3CC43 2D1WA 3NQZA 3AHWA 5EVHA 1CQSA 2XGNA 1M1XB 3CNMA 4IT7A 4MMYB 5FW5A 2AAEA 4ZM8A 1Q40A 1JZDA 1BOXA 2OCTA 2OOVC 1QAFA 3FCSB 4O3VA 5AIIA 5DREA 5IENA 2GEYA 3J7Yd 3CU3A 3CC73 3CC23 5HOHA 2QGUA 3NBJA 5RNTA 5KP3A 1YIT3 3CD63 3NV0A 3CCE3 1B2UA 2P38A 2UX0A 4N6NB 3H51A 2B24B 1KSIA 4CJNA 1R4CA 1I2EA 2R41A 3FG1A 1DE3A 1UCLA 7GSPA 1LXEA 1B21A 1LOXA 4WFOA 2MC8A 1N9JA 2KXGA 1IT8A 3OXAA 3URPA 1IQ8A 1HU9A 1LRAA 1YVSA 3IJEB 4MMXB 4Q53A 1JV2B 4MMZB 3CPOA 1NB5I 1RRLA 5IEPA 1WNHA 3DM8A 3MG2A 3BNCA 5M1AA 1UI8A 4FMCA 1OPYA 3NBRA 3BB9A 1VQ83 2Y74A 3F7SA 3T8NA 3CCL3 2CFWA 1K734 3NXJA 3CXC2 2W9QA 3WHOA 2QEX3 1FUSA 3SOYA 3ROBA 3OV4A 3KZTA 3EBYA 1YJW3 3FKAA 1VQM3 2JQ5A 1E97A 2J8XB 3DGNA 3GRDA 1LOYA 1RTUA 3PYJA 1EUIC 4LYLB 1C7HA 1N5PA 3EQQB 3GZBA 3LT9A 3UL5A 1JKGB 3JUQA 5IW9A 1GMQA 2OTJ3 1UCIA 5AEUB 1IU7A 2KCDA 2XEPA 1O7PB 4N6OB 1GD3A 1Q42A 1V74A 1GOYA 3PCSA 4FR9A 4LSOA 1I2GA 4MJDA 2YFLB 3MHEA 1FW7A 1BRJA 1V58A 7STDA 4OVMA 2OTL3 1D6ZA 1CYUA 4HM4B 2WOHA 4LZIA 1BRKA 1HKXA 1NB3I 2L1SA 2W04A 1Q9EA 2AADA 3MSOA 6GSPA 1SARA 2W6JH 3EE1A 1JJ22 2KF3A 3LXUX 2GU3A 2IUKA 4STDA 4GHOA 3LTAA 3ALAA 5GSPA 3HZPA 5A0OB 1ULIB 4GB5A 5TGNA 1EG9B 4BIRA 1UGIA 1Q40B 1BUQA 1TFOA 1RNBA 4RNZA 1IVXA 3FLJA 3GZRA 5AEWB 1N8QA 1VQK3 1T5YA 2KAAA 1MNLA 2JDIH 4BL3A 3VSYA 4FCZA 4AKYA 3K9MC 3V99A 3EX9A 1NDOB 1JN5A 1QALA 2BIRA 3MWZA 3Q2PA 1L5GB 4HM8B 1B2XA 3F7XA 2F99A 5LC7A 2UGIA 1LOWA 2BMQB 1MWTA 1IV9A 1OUNA 2KF6A 3GAXA 5IERA 2HMKB 3CCR3 3DUKA 3KKGA 3GWRA 4HYZA 4OK0A 2Q07A 1GY5A 1S5AA 3G713 4N6TA 3F40A 1YHQ3 1K41A 2IY2A 4R1KA 2GU1A 5JPPA 3CPW2 4G1MB 1MWRA 1YGWA 5G1LA 3X41A 1WMOA 1YI23 4IIAA 1Q824 3FZWA 3CCM3 1SQWA 2Z76A 4HJLB 4O8SA 1AY7A 3BIRA 1I2FA 4HM5B 5AYSC 3OW22 4BTXA 2ZA4A 3SEDA 5D82A 1BSCA 3WOFB 1UGHI 4I5QA 1LNHA 1NNVA 1OHOA 3DGYA 1BSDA 1A2VA 4EV5A 1G0TA 1NU3A 3HX8A 1UCKA 4HM3B 1NO3A 1DMQA 4K1VA 5CK6A 1Q7HA 2A15A 3PS8A 3X3XA 1RDSA 1LQGC 3LYGA 2IUJA 1JKGA 3EN1B 2YFIB 5CF2A 1W7CA 3M8CA 1W6GA 3F9SA 4L7KA 3T8UA 1UW1A 3DMCA 5FGOA 1VQO3 1JB5A 2FNQA 1EEJA 4AKZA 1QAKA 2RBIA 2KF5A 2GBWB 1W6YA 3E99A 5IG0A 1E3RA 3UL6A 3FG3A 1DMMA 3A76A 3S5CA 3V92A 1AR0A 1QMAA 3BNEA 3K5TA 5BVBA 4TX4A 1RN4A 2O9UX 3D4AA 4KFDA 3S67A 3SXXA 3X42A 1VQL3 1IQYA 3H3HA 1RN7A 4LMIA 2RCDA 3CCS3 3WMDA 1IYYA 7RNTA 1FGTA 1KWIA 1UUWB 1O7MB 3WODG 1T2IA 4RNYA 1JB2A 3PCRA 4EBGA 2C10A 1MWUA 2BHMA 2OOVA 5IG3A 1UUVB 4K90B 1STFI 5BU4A 1LQMB 2L4VA 5G1KA 4GL6A 2CX0A 4XDWA 3O8YA 2CWVA 3X40A 1RKYA 1VQ53 1LVNA 4HKVB 1BUJA 3JUOA 3UNLA 1FA3A 3WOEB 1YGEA 4CDLA 1VQ43 3VF1A 5AIGA 1AVLA 1W2ZA 3KCHA 3I563 4R80A 2LYXA 1IVUA 6RNTA 1EA2A 1OACA 1QVG2 1UUGB 3S28A 3S29A 3CCU3 3RGAA 1W4NA 2XRXB 3NM7A 2CW9A 2CK3H 1BU4A 1IK3A 1W01A 3FSDA 1MOLA 2HMMB 1LOVA 1BNJA 1OCVA 1W2B2 1RJOA 1TFKA 1W00A 1X1XA 1RCKA 2HMLB 2XGLA 3B7CA 3G8ZA 1N5HA 3KE7A 3MKIA 1T3BA 2WO0A 4JF8A 1ROVA 1TJDA 2Z6BA 3RGRA 1OF5B 1Y4KA 1RGCA 4N3VA 1GSPA 1ISKA 3GZXB 1STDA 5EQLA 2CH9A 4O2HA 3SOAA 3DGOA 2F5WA 3STDA 3BNBA 3EF8A 1GYBA 1F8NA 4X2HA 2I9WA 1GD4A 1UDII 1MGRA 2UUGC 3D3LA 4RNTA 5ELJA 2OQEA 2CWTA 4EXRA 3G0KA 2O3OA 5EEOA 1TIJA 4HOHA 1RRHA 8CHOA 2PZVA 2WGOA 1IQXA 3BNDA 1OGXA 2OWPA 3U1WA 1BIRA 3ZG5A 3MG1A 2ML6A 3HOHA 3OWYA 2BNGA 3EB8A 4HBRA 2CKFB 3N8BA 4EV2A 6STDA 2H0IA 4XDVA 1VQN3 1B2ZA 4FCJA 1JBSA 1CEWI 1I3IA 1TRPA 3DZLA 1GY7A
chains in the Genus database with same CATH topology
2ZA4A 3BU4A 1BNSA 1BSCA 1TTOA 3D5IA 3DGYA 1BSDA 1I3IA 5HOHA 1BNGA 5RNTA 1BRGA 2KF4A 1YNVX 1UCKA 1B2UA 1BVIA 1BAOA 1RDSA 4BU4A 3WR2A 1I2EA 1AQZA 1DE3A 2SARA 1RN1A 1UCLA 7GSPA 1BRNL 2RBIA 2KF5A 3AGOA 1JBTA 1B21A 1RGLA 1BRHA 1GMPA 2F5MA 3URPA 1T2HA 2BU4A 1FUTA 1LRAA 1YVSA 9RNTA 1I0VA 1BGSA 3AGNA 1X1WA 1BSEA 1RN4A 3D4AA 3RNTA 1X1YA 1FZUA 1BNIA 1BSBA 4J5KA 1BNRA 4J5GA 1HZ1A 1IYYA 3WHOA 7RNTA 1X1UA 5BIRA 1G02A 1FUSA 1RNTA 2HOHA 1CH0A 1R4YA 1TRQA 1T2IA 1B3SA 1RHLA 1B27A 1RLSA 1BNEA 3Q3FA 4HAAA 1HYFA 1LOYA 1BRIA 1RTUA 5BU4A 1GOVA 1UCJA 1RGKA 1GMQA 1RSNA 1UCIA 1BUJA 1GOYA 1I2GA 2RNTA 3KCHA 2F56A 1FW7A 6RNTA 1BRJA 1B2SA 1B20A 3D5GA 3AHSA 1BRKA 3DH2A 6GSPA 1DETA 1Q9EA 2AADA 3SYUA 1SARA 2KF3A 4GSPA 1RGEA 1BU4A 1FYSA 4GHOA 5GSPA 1I70A 1BANA 4BIRA 1A2PA 1LOVA 1RNBA 1BNJA 1RGGA 1X1XA 2GSPA 1RCKA 1LNIA 1RGAA 2KAAA 1BSAA 1JBRA 1RCLA 1RGCA 1GSPA 1ZGXA 1C54A 1MGWA 1PY3A 3GSPA 1I3FA 2BIRA 2F5WA 1B2XA 2C4BA 2F4YA 1PYLA 1LOWA 1RGFA 2KF6A 1MGRA 4RNTA 8RNTA 1RMSA 1BRSA 1RGHA 1B2MA 3A5EA 4HOHA 3BIRA 1BIRA 1BNFA 1I0XA 1GMRA 1YGWA 3HOHA 1I8VA 1GOUA 3AHWA 1B2ZA 1JBSA 1AY7A 2AAEA 1I2FA 1TRPA 1BOXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZA4 A;  3BU4 A;  1BNS A;  1BSC A;  1TTO A;  3D5I A;  3DGY A;  1BSD A;  1I3I A;  5HOH A;  1BNG A;  5RNT A;  1BRG A;  2KF4 A;  1YNV X;  1UCK A;  1B2U A;  1BVI A;  1BAO A;  1RDS A;  4BU4 A;  3WR2 A;  1I2E A;  1AQZ A;  1DE3 A;  2SAR A;  1RN1 A;  1UCL A;  7GSP A;  1BRN L;  2RBI A;  2KF5 A;  3AGO A;  1JBT A;  1B21 A;  1RGL A;  1BRH A;  1GMP A;  2F5M A;  3URP A;  1T2H A;  2BU4 A;  1FUT A;  1LRA A;  1YVS A;  9RNT A;  1I0V A;  1BGS A;  3AGN A;  1X1W A;  1BSE A;  1RN4 A;  3D4A A;  3RNT A;  1X1Y A;  1FZU A;  1BNI A;  1BSB A;  4J5K A;  1BNR A;  4J5G A;  1HZ1 A;  1IYY A;  3WHO A;  7RNT A;  1X1U A;  5BIR A;  1G02 A;  1FUS A;  1RNT A;  2HOH A;  1CH0 A;  1R4Y A;  1TRQ A;  1T2I A;  1B3S A;  1RHL A;  1B27 A;  1RLS A;  1BNE A;  3Q3F A;  4HAA A;  1HYF A;  1LOY A;  1BRI A;  1RTU A;  5BU4 A;  1GOV A;  1UCJ A;  1RGK A;  1GMQ A;  1RSN A;  1UCI A;  1BUJ A;  1GOY A;  1I2G A;  2RNT A;  3KCH A;  2F56 A;  1FW7 A;  6RNT A;  1BRJ A;  1B2S A;  1B20 A;  3D5G A;  3AHS A;  1BRK A;  3DH2 A;  6GSP A;  1DET A;  1Q9E A;  2AAD A;  3SYU A;  1SAR A;  2KF3 A;  4GSP A;  1RGE A;  1BU4 A;  1FYS A;  4GHO A;  5GSP A;  1I70 A;  1BAN A;  4BIR A;  1A2P A;  1LOV A;  1RNB A;  1BNJ A;  1RGG A;  1X1X A;  2GSP A;  1RCK A;  1LNI A;  1RGA A;  2KAA A;  1BSA A;  1JBR A;  1RCL A;  1RGC A;  1GSP A;  1ZGX A;  1C54 A;  1MGW A;  1PY3 A;  3GSP A;  1I3F A;  2BIR A;  2F5W A;  1B2X A;  2C4B A;  2F4Y A;  1PYL A;  1LOW A;  1RGF A;  2KF6 A;  1MGR A;  4RNT A;  8RNT A;  1RMS A;  1BRS A;  1RGH A;  1B2M A;  3A5E A;  4HOH A;  3BIR A;  1BIR A;  1BNF A;  1I0X A;  1GMR A;  1YGW A;  3HOH A;  1I8V A;  1GOU A;  3AHW A;  1B2Z A;  1JBS A;  1AY7 A;  2AAE A;  1I2F A;  1TRP A;  1BOX A; 
#chains in the Genus database with same CATH topology
 3LZA A;  1MWS A;  1TTO A;  1SII A;  1OHP A;  2LQV A;  4H61 A;  3QK9 A;  1D6Y A;  2RSX A;  1CYV A;  1BVI A;  1IV7 A;  1O7N B;  3CCV 3;  3D79 A;  4BU4 A;  3WR2 A;  1SJW A;  1ROA A;  3F14 A;  3GZY B;  1WQL B;  2F98 A;  3F8H A;  4KZ1 A;  1RGL A;  1V57 A;  4PEJ A;  1BRH A;  3JUN A;  1GMP A;  1TU5 A;  5I97 A;  3CCJ 3;  3OWU A;  3G6E 3;  2BU4 A;  3FGY A;  3JUP A;  2CG0 A;  1AV4 A;  1BGS A;  2HMO B;  4X2O A;  5AIH A;  1FGR A;  3EHC A;  5IG4 A;  1BSE A;  4EC6 A;  1KD1 4;  1ZS7 A;  3RNT A;  2HMJ B;  3N54 B;  3X3Y A;  3F8X A;  3VGN A;  4HM6 B;  1W5Z A;  2C11 A;  2F86 B;  1FZU A;  1BSB A;  1BNR A;  1IVV A;  3LML A;  4XM4 A;  1VQP 3;  3PZW A;  1A90 A;  1X1U A;  5BIR A;  1RNT A;  3CME 3;  1VQ6 3;  1TRQ A;  1A2K A;  2H0H A;  1M90 4;  1RHL A;  2H0G A;  2STD A;  3KSE D;  1RLS A;  4U13 A;  3WA3 A;  3OWS A;  3Q3F A;  5IF6 A;  4HAA A;  1HYF A;  4CCV A;  4EW5 A;  1UCJ A;  2GXF A;  4WWU C;  4WHA A;  5HGR A;  1Q7Y 4;  1UI7 A;  1RSN A;  1US1 A;  4LGQ A;  4K1U A;  4H3U A;  2E2T A;  4RZM A;  4WYK A;  3ECF A;  2K0M A;  1M9G A;  4XB5 A;  5KP1 A;  2K54 A;  3I55 3;  3MYT A;  2RGQ A;  2WGQ A;  3DY5 A;  3AHS A;  1FGQ A;  4HM1 B;  2IYJ A;  3DH2 A;  3TDG A;  1YJ9 3;  1DET A;  1JB4 A;  1TP6 A;  1FGM A;  3JUM A;  3RDE A;  1J2B A;  3CMA 3;  2P0M A;  4R9L A;  1QJG A;  1DMN A;  1JN5 B;  2INX A;  2BMR B;  1PU4 A;  2XH9 A;  3JVC A;  2BT3 A;  1DVD A;  3G16 A;  4HVN A;  3SLU A;  1A2P A;  5BXQ A;  1RGG A;  1TUH A;  5IG5 A;  1ULJ B;  1LNI A;  1RGA A;  4HM7 B;  2XSO B;  3NBB A;  5JBS A;  1VQ9 3;  1VQ7 3;  1W6C A;  2FXT A;  1ZGX A;  1MGW A;  1E3V A;  1PY3 A;  2P0X A;  4N6L A;  3WDG B;  4BTY A;  1D6U A;  1DYU A;  3U97 A;  3DGM A;  4AEQ A;  1KQS 2;  3KII A;  2C4B A;  2GEX A;  1AVK A;  2ML5 A;  1RGF A;  3LTD A;  4WP5 A;  3FG4 A;  4NRE A;  3QRD A;  4FMD A;  4K61 A;  1BRS A;  2ZL8 A;  1WMN A;  2M7O A;  4XBT A;  4BTW A;  3A5E A;  1B2M A;  1QVF 2;  4N6V 0;  1GY6 A;  3S27 A;  2XFS A;  4NPB A;  3B4O A;  2BO9 B;  1GMR A;  5D83 A;  4HM0 B;  5G2G A;  3ZG0 A;  1GOU A;  4I4K A;  1G96 A;  1K8A 4;  3D9R A;  3B4P A;  3MPH A;  3NHX A;  4GSP A;  5AIF A;  4DKI A;  3BU4 A;  2ZDJ A;  4N6M A;  1BNS A;  3LTB A;  3MG3 A;  3LTC A;  4HM2 B;  4NHF A;  1ASK A;  3AMO A;  3D5I A;  2CC3 A;  3NQY A;  4ILF A;  5CLK A;  3SVA A;  2QA4 3;  1BNG A;  3NM2 A;  4J8T A;  1BRG A;  2KF4 A;  4WYK B;  2W56 A;  4EYC A;  3EN8 A;  1JZO A;  1YNV X;  1YJN 3;  1KC8 4;  2E2V A;  3AMO B;  3KFQ C;  1YIJ 3;  1BAO A;  3FF0 A;  2XSH B;  4OUQ A;  1O7W B;  4ORL A;  4MEI A;  1EKM A;  1AQZ A;  2W9P A;  3NV0 B;  5ELU A;  2SAR A;  1RN1 A;  4QWT A;  1BRN L;  4KT3 B;  2YX9 A;  4L8P A;  3FH1 A;  3AGO A;  4LEH A;  3L0R A;  4FCM A;  5KP4 A;  1JBT A;  3HIG A;  3PGB A;  3KSP A;  4CPK A;  3LT8 A;  2W0Q A;  2F5M A;  3Q90 A;  1T2H A;  2CHC A;  2Z7A A;  3PXM A;  1FUT A;  4JRF A;  3IPT A;  1IDP A;  5IEO A;  9RNT A;  1I0V A;  1ZO2 A;  3AGN A;  3ER7 A;  1DVC A;  1X1W A;  3NUV A;  4FMB A;  3EC9 A;  5CF1 A;  3CNX A;  2CWU A;  2Z77 A;  1SPU A;  5AYR B;  1OF5 A;  1X1Y A;  3CCQ 3;  2P09 A;  1VQQ A;  3LH4 A;  3X3Z A;  2YFJ B;  4J5K A;  1BNI A;  4J5G A;  2K3D A;  3N9H A;  1HZ1 A;  1Q86 4;  1G02 A;  3SX1 A;  2HOH A;  4O02 B;  1CH0 A;  1NWW A;  1R4Y A;  5CXO A;  1B3S A;  5AI1 A;  1B27 A;  1PFP A;  1BNE A;  1U8C B;  4IPB A;  1ZX2 A;  5D81 A;  3UB1 A;  1BRI A;  2RFR A;  3B8L A;  1GOV A;  3EJV A;  2ZHX B;  4R9K A;  3ZFZ A;  1RGK A;  1VZZ A;  4J9A A;  2GBX B;  1A67 A;  1FUW A;  1Z1S A;  2BMO B;  2KRT A;  3FF2 A;  3KN4 A;  1NJI 4;  3EBT A;  1K28 A;  2RNT A;  4FMA A;  2FGT A;  1IVW A;  3BLZ A;  2E2U A;  3HI7 A;  1FGO A;  2CX1 A;  2F56 A;  2CFL A;  1U5O A;  4KVH A;  3G4S 3;  2CFK A;  2B1X B;  1B2S A;  1B20 A;  3D5G A;  3T0U A;  3V98 A;  3K0Z A;  4KFE A;  1JRQ A;  1WTH A;  3SYU A;  2WOF A;  3I0Y A;  4HZB B;  3DGL A;  3K7C A;  2OQE C;  1RGE A;  1FYS A;  2W56 B;  3LOY A;  2Y73 A;  3K63 A;  4KFF A;  1I70 A;  1OGZ A;  1O7H B;  1BAN A;  1YVB I;  1OHS A;  2PNC A;  2V1L A;  1K9M 4;  1SIH A;  2CFD A;  3WA2 X;  3NX0 A;  2GSP A;  4R4K A;  2IA7 A;  5DRV A;  5LC6 A;  3UJM A;  1JNQ A;  1BSA A;  1JBR A;  1RCL A;  2W2C A;  2CIU A;  5M18 A;  2XF3 A;  2HMN B;  3HII A;  1W02 A;  1EQK A;  2XFT A;  4BL2 A;  1C54 A;  4XBY A;  2R4I A;  2XR8 B;  2SBL A;  3DXO A;  3GSP A;  1I3F A;  4L8O A;  2CG1 A;  2P05 A;  5STD A;  3Q1C A;  1Q81 4;  2F4Y A;  1N8R 4;  5M19 A;  1PYL A;  2D42 A;  1S72 3;  1M1K 4;  4XBX A;  2W03 A;  8RNT A;  1N9E A;  1RMS A;  4HZ9 B;  1RGH A;  1IT7 A;  2IMJ A;  3OX9 A;  1O7G B;  4N6U A;  1WMP A;  2QIY A;  2MF7 A;  5JPU A;  3HK4 A;  1BNF A;  1I0X A;  4RBN A;  1OH0 A;  3IMA B;  2CFG A;  1GS3 A;  1I8V A;  3CC4 3;  2D1W A;  3NQZ A;  3AHW A;  5EVH A;  1CQS A;  2XGN A;  1M1X B;  3CNM A;  4IT7 A;  4MMY B;  5FW5 A;  2AAE A;  4ZM8 A;  1Q40 A;  1JZD A;  1BOX A;  2OCT A;  2OOV C;  1QAF A;  3FCS B;  4O3V A;  5AII A;  5DRE A;  5IEN A;  2GEY A;  3J7Y d;  3CU3 A;  3CC7 3;  3CC2 3;  5HOH A;  2QGU A;  3NBJ A;  5RNT A;  5KP3 A;  1YIT 3;  3CD6 3;  3NV0 A;  3CCE 3;  1B2U A;  2P38 A;  2UX0 A;  4N6N B;  3H51 A;  2B24 B;  1KSI A;  4CJN A;  1R4C A;  1I2E A;  2R41 A;  3FG1 A;  1DE3 A;  1UCL A;  7GSP A;  1LXE A;  1B21 A;  1LOX A;  4WFO A;  2MC8 A;  1N9J A;  2KXG A;  1IT8 A;  3OXA A;  3URP A;  1IQ8 A;  1HU9 A;  1LRA A;  1YVS A;  3IJE B;  4MMX B;  4Q53 A;  1JV2 B;  4MMZ B;  3CPO A;  1NB5 I;  1RRL A;  5IEP A;  1WNH A;  3DM8 A;  3MG2 A;  3BNC A;  5M1A A;  1UI8 A;  4FMC A;  1OPY A;  3NBR A;  3BB9 A;  1VQ8 3;  2Y74 A;  3F7S A;  3T8N A;  3CCL 3;  2CFW A;  1K73 4;  3NXJ A;  3CXC 2;  2W9Q A;  3WHO A;  2QEX 3;  1FUS A;  3SOY A;  3ROB A;  3OV4 A;  3KZT A;  3EBY A;  1YJW 3;  3FKA A;  1VQM 3;  2JQ5 A;  1E97 A;  2J8X B;  3DGN A;  3GRD A;  1LOY A;  1RTU A;  3PYJ A;  1EUI C;  4LYL B;  1C7H A;  1N5P A;  3EQQ B;  3GZB A;  3LT9 A;  3UL5 A;  1JKG B;  3JUQ A;  5IW9 A;  1GMQ A;  2OTJ 3;  1UCI A;  5AEU B;  1IU7 A;  2KCD A;  2XEP A;  1O7P B;  4N6O B;  1GD3 A;  1Q42 A;  1V74 A;  1GOY A;  3PCS A;  4FR9 A;  4LSO A;  1I2G A;  4MJD A;  2YFL B;  3MHE A;  1FW7 A;  1BRJ A;  1V58 A;  7STD A;  4OVM A;  2OTL 3;  1D6Z A;  1CYU A;  4HM4 B;  2WOH A;  4LZI A;  1BRK A;  1HKX A;  1NB3 I;  2L1S A;  2W04 A;  1Q9E A;  2AAD A;  3MSO A;  6GSP A;  1SAR A;  2W6J H;  3EE1 A;  1JJ2 2;  2KF3 A;  3LXU X;  2GU3 A;  2IUK A;  4STD A;  4GHO A;  3LTA A;  3ALA A;  5GSP A;  3HZP A;  5A0O B;  1ULI B;  4GB5 A;  5TGN A;  1EG9 B;  4BIR A;  1UGI A;  1Q40 B;  1BUQ A;  1TFO A;  1RNB A;  4RNZ A;  1IVX A;  3FLJ A;  3GZR A;  5AEW B;  1N8Q A;  1VQK 3;  1T5Y A;  2KAA A;  1MNL A;  2JDI H;  4BL3 A;  3VSY A;  4FCZ A;  4AKY A;  3K9M C;  3V99 A;  3EX9 A;  1NDO B;  1JN5 A;  1QAL A;  2BIR A;  3MWZ A;  3Q2P A;  1L5G B;  4HM8 B;  1B2X A;  3F7X A;  2F99 A;  5LC7 A;  2UGI A;  1LOW A;  2BMQ B;  1MWT A;  1IV9 A;  1OUN A;  2KF6 A;  3GAX A;  5IER A;  2HMK B;  3CCR 3;  3DUK A;  3KKG A;  3GWR A;  4HYZ A;  4OK0 A;  2Q07 A;  1GY5 A;  1S5A A;  3G71 3;  4N6T A;  3F40 A;  1YHQ 3;  1K41 A;  2IY2 A;  4R1K A;  2GU1 A;  5JPP A;  3CPW 2;  4G1M B;  1MWR A;  1YGW A;  5G1L A;  3X41 A;  1WMO A;  1YI2 3;  4IIA A;  1Q82 4;  3FZW A;  3CCM 3;  1SQW A;  2Z76 A;  4HJL B;  4O8S A;  1AY7 A;  3BIR A;  1I2F A;  4HM5 B;  5AYS C;  3OW2 2;  4BTX A;  2ZA4 A;  3SED A;  5D82 A;  1BSC A;  3WOF B;  1UGH I;  4I5Q A;  1LNH A;  1NNV A;  1OHO A;  3DGY A;  1BSD A;  1A2V A;  4EV5 A;  1G0T A;  1NU3 A;  3HX8 A;  1UCK A;  4HM3 B;  1NO3 A;  1DMQ A;  4K1V A;  5CK6 A;  1Q7H A;  2A15 A;  3PS8 A;  3X3X A;  1RDS A;  1LQG C;  3LYG A;  2IUJ A;  1JKG A;  3EN1 B;  2YFI B;  5CF2 A;  1W7C A;  3M8C A;  1W6G A;  3F9S A;  4L7K A;  3T8U A;  1UW1 A;  3DMC A;  5FGO A;  1VQO 3;  1JB5 A;  2FNQ A;  1EEJ A;  4AKZ A;  1QAK A;  2RBI A;  2KF5 A;  2GBW B;  1W6Y A;  3E99 A;  5IG0 A;  1E3R A;  3UL6 A;  3FG3 A;  1DMM A;  3A76 A;  3S5C A;  3V92 A;  1AR0 A;  1QMA A;  3BNE A;  3K5T A;  5BVB A;  4TX4 A;  1RN4 A;  2O9U X;  3D4A A;  4KFD A;  3S67 A;  3SXX A;  3X42 A;  1VQL 3;  1IQY A;  3H3H A;  1RN7 A;  4LMI A;  2RCD A;  3CCS 3;  3WMD A;  1IYY A;  7RNT A;  1FGT A;  1KWI A;  1UUW B;  1O7M B;  3WOD G;  1T2I A;  4RNY A;  1JB2 A;  3PCR A;  4EBG A;  2C10 A;  1MWU A;  2BHM A;  2OOV A;  5IG3 A;  1UUV B;  4K90 B;  1STF I;  5BU4 A;  1LQM B;  2L4V A;  5G1K A;  4GL6 A;  2CX0 A;  4XDW A;  3O8Y A;  2CWV A;  3X40 A;  1RKY A;  1VQ5 3;  1LVN A;  4HKV B;  1BUJ A;  3JUO A;  3UNL A;  1FA3 A;  3WOE B;  1YGE A;  4CDL A;  1VQ4 3;  3VF1 A;  5AIG A;  1AVL A;  1W2Z A;  3KCH A;  3I56 3;  4R80 A;  2LYX A;  1IVU A;  6RNT A;  1EA2 A;  1OAC A;  1QVG 2;  1UUG B;  3S28 A;  3S29 A;  3CCU 3;  3RGA A;  1W4N A;  2XRX B;  3NM7 A;  2CW9 A;  2CK3 H;  1BU4 A;  1IK3 A;  1W01 A;  3FSD A;  1MOL A;  2HMM B;  1LOV A;  1BNJ A;  1OCV A;  1W2B 2;  1RJO A;  1TFK A;  1W00 A;  1X1X A;  1RCK A;  2HML B;  2XGL A;  3B7C A;  3G8Z A;  1N5H A;  3KE7 A;  3MKI A;  1T3B A;  2WO0 A;  4JF8 A;  1ROV A;  1TJD A;  2Z6B A;  3RGR A;  1OF5 B;  1Y4K A;  1RGC A;  4N3V A;  1GSP A;  1ISK A;  3GZX B;  1STD A;  5EQL A;  2CH9 A;  4O2H A;  3SOA A;  3DGO A;  2F5W A;  3STD A;  3BNB A;  3EF8 A;  1GYB A;  1F8N A;  4X2H A;  2I9W A;  1GD4 A;  1UDI I;  1MGR A;  2UUG C;  3D3L A;  4RNT A;  5ELJ A;  2OQE A;  2CWT A;  4EXR A;  3G0K A;  2O3O A;  5EEO A;  1TIJ A;  4HOH A;  1RRH A;  8CHO A;  2PZV A;  2WGO A;  1IQX A;  3BND A;  1OGX A;  2OWP A;  3U1W A;  1BIR A;  3ZG5 A;  3MG1 A;  2ML6 A;  3HOH A;  3OWY A;  2BNG A;  3EB8 A;  4HBR A;  2CKF B;  3N8B A;  4EV2 A;  6STD A;  2H0I A;  4XDV A;  1VQN 3;  1B2Z A;  4FCJ A;  1JBS A;  1CEW I;  1I3I A;  1TRP A;  3DZL A;  1GY7 A; 
#chains in the Genus database with same CATH homology
 2ZA4 A;  3BU4 A;  1BNS A;  1BSC A;  1TTO A;  3D5I A;  3DGY A;  1BSD A;  1I3I A;  5HOH A;  1BNG A;  5RNT A;  1BRG A;  2KF4 A;  1YNV X;  1UCK A;  1B2U A;  1BVI A;  1BAO A;  1RDS A;  4BU4 A;  3WR2 A;  1I2E A;  1AQZ A;  1DE3 A;  2SAR A;  1RN1 A;  1UCL A;  7GSP A;  1BRN L;  2RBI A;  2KF5 A;  3AGO A;  1JBT A;  1B21 A;  1RGL A;  1BRH A;  1GMP A;  2F5M A;  3URP A;  1T2H A;  2BU4 A;  1FUT A;  1LRA A;  1YVS A;  9RNT A;  1I0V A;  1BGS A;  3AGN A;  1X1W A;  1BSE A;  1RN4 A;  3D4A A;  3RNT A;  1X1Y A;  1FZU A;  1BNI A;  1BSB A;  4J5K A;  1BNR A;  4J5G A;  1HZ1 A;  1IYY A;  3WHO A;  7RNT A;  1X1U A;  5BIR A;  1G02 A;  1FUS A;  1RNT A;  2HOH A;  1CH0 A;  1R4Y A;  1TRQ A;  1T2I A;  1B3S A;  1RHL A;  1B27 A;  1RLS A;  1BNE A;  3Q3F A;  4HAA A;  1HYF A;  1LOY A;  1BRI A;  1RTU A;  5BU4 A;  1GOV A;  1UCJ A;  1RGK A;  1GMQ A;  1RSN A;  1UCI A;  1BUJ A;  1GOY A;  1I2G A;  2RNT A;  3KCH A;  2F56 A;  1FW7 A;  6RNT A;  1BRJ A;  1B2S A;  1B20 A;  3D5G A;  3AHS A;  1BRK A;  3DH2 A;  6GSP A;  1DET A;  1Q9E A;  2AAD A;  3SYU A;  1SAR A;  2KF3 A;  4GSP A;  1RGE A;  1BU4 A;  1FYS A;  4GHO A;  5GSP A;  1I70 A;  1BAN A;  4BIR A;  1A2P A;  1LOV A;  1RNB A;  1BNJ A;  1RGG A;  1X1X A;  2GSP A;  1RCK A;  1LNI A;  1RGA A;  2KAA A;  1BSA A;  1JBR A;  1RCL A;  1RGC A;  1GSP A;  1ZGX A;  1C54 A;  1MGW A;  1PY3 A;  3GSP A;  1I3F A;  2BIR A;  2F5W A;  1B2X A;  2C4B A;  2F4Y A;  1PYL A;  1LOW A;  1RGF A;  2KF6 A;  1MGR A;  4RNT A;  8RNT A;  1RMS A;  1BRS A;  1RGH A;  1B2M A;  3A5E A;  4HOH A;  3BIR A;  1BIR A;  1BNF A;  1I0X A;  1GMR A;  1YGW A;  3HOH A;  1I8V A;  1GOU A;  3AHW A;  1B2Z A;  1JBS A;  1AY7 A;  2AAE A;  1I2F A;  1TRP A;  1BOX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...