1Q9EA

Rnase t1 variant with adenine specificity
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHEFRNWNGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanyl-specific ribonuclease T1 precursor
publication title RNase T1 Variant RV Cleaves Single-Stranded RNA after Purines Due to Specific Recognition by the Asn46 Side Chain Amide.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
total genus 27
structure length 104
sequence length 104
chains with identical sequence B, C
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2003-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1q9eA00
1TRPA 1GMPA 1FYSA 6RNTA 3D5GA 1RGEA 1LNIA 1B2UA 1FUTA 1RGFA 2KF4A 5HOHA 1GSPA 1MGWA 1T2IA 1BNEA 2GSPA 2KF6A 3DH2A 1BSCA 1PY3A 1BNRA 4RNTA 7GSPA 3D5IA 4BIRA 3BIRA 5BU4A 2F5WA 1X1UA 1RGAA 2KF3A 1FZUA 1R4YA 2SARA 1Q9EA 1BRKA 3AGNA 1JBTA 1BIRA 1B2SA 1X1YA 6GSPA 2ZA4A 1T2HA 1YGWA 1X1XA 1BNGA 1LOWA 2KF5A 3DGYA 1FW7A 1B3SA 1HZ1A 1I3FA 1RGKA 1RNTA 1RGHA 4HOHA 3SYUA 1BRIA 1AY7A 1RLSA 4BU4A 1TTOA 2F56A 1B20A 4J5KA 2BIRA 1BRGA 1LOYA 3D4AA 3AHSA 1BANA 9RNTA 1BSDA 8RNTA 1PYLA 2C4BA 1CH0A 1BNJA 1B21A 1GOVA 2F4YA 1RTUA 1BUJA 1UCIA 1BOXA 1B2ZA 3BU4A 1RCLA 2RNTA 3RNTA 1RGCA 1UCLA 5GSPA 1I8VA 3GSPA 1GMQA 1BNSA 3KCHA 4GSPA 1I70A 1BRHA 1UCJA 3AGOA 1BU4A 5BIRA 7RNTA 1RSNA 1I0VA 1I2GA 1HYFA 5RNTA 1BRJA 1B2MA 1ZGXA 1I3IA 4J5GA 2RBIA 1B27A 1DETA 2BU4A 1BSBA 1X1WA 1AQZA 3A5EA 1I0XA 1RN4A 1LRAA 1RNBA 1I2FA 1RGGA 1A2PA 1YVSA 1BSAA 1B2XA 1BGSA 1SARA 1LOVA 1RGLA 1FUSA 1MGRA 1JBRA 1G02A 1BNIA 1BRNL 1BNFA 1RDSA 1JBSA 1BSEA 1BVIA 3AHWA 2F5MA 1GMRA 3WR2A 1DE3A 1UCKA 4GHOA 2AADA 1IYYA 4HAAA 1RCKA 1BAOA 1GOYA 1I2EA 1RN1A 2AAEA 3Q3FA 3WHOA 2KAAA 1RHLA 1RMSA 1TRQA 1C54A 1YNVX 2HOHA 1BRSA 1GOUA 3URPA 3HOHA
chains in the Genus database with same CATH superfamily
2P05A 1FYSA 1N9EA 1SQWA 1RGEA 1RN7A 1LNIA 1FUTA 1RGFA 2YX9A 3X3ZA 2Z76A 5HOHA 1T2IA 2GSPA 3FG4A 1BNEA 2KF6A 3N9HA 3UB1A 3UL6A 4K61A 3G4S3 1IQYA 2ZDJA 1PY3A 3LYGA 4RNTA 5EQLA 5BXQA 1QAKA 4BIRA 3D3LA 2F86B 4KT3B 5BU4A 3I0YA 2L4VA 5AEUB 1A2KA 5IG5A 1JKGB 2F5WA 1X1UA 3DGOA 2LYXA 3URPA 1K9M4 4LZIA 4G1MB 1O7NB 2WGOA 3AGNA 1NNVA 1JBTA 2BT3A 4FCZA 1X1YA 6GSPA 3NX0A 4FCMA 1W00A 2OOVA 1ROVA 3I563 1DMMA 4EXRA 4LEHA 4MEIA 3CCE3 1UUGB 2KF5A 1LOWA 4K90B 3BB9A 1M1K4 2C10A 5IENA 1IQ8A 1RNTA 1I3FA 1QMAA 4XBTA 3D79A 3KE7A 4EV5A 1QVG2 4WP5A 3DUKA 4N6LA 1AY7A 2Z77A 3KSPA 3QK9A 1RLSA 3GWRA 4N6NB 2F56A 1B20A 1NWWA 3LT9A 2Y74A 2BIRA 1BRGA 2BHMA 3D4AA 1JN5A 3X3XA 4BL3A 6STDA 3CME3 1BANA 1S5AA 1IU7A 3DXOA 1EKMA 1ULIB 1WTHA 3CCR3 2R4IA 4ORLA 3CPW2 1B21A 1UCIA 1BOXA 2B24B 1W7CA 4Q53A 3WOEB 2RNTA 1L5GB 4FMDA 1N5HA 1LVNA 2R41A 5ELUA 1YIT3 4XBYA 1BNSA 3A76A 3NBRA 1I70A 3BNBA 1BRHA 2E2UA 3F9SA 1DMQA 4N6V0 2W9PA 3CCJ3 1CEWI 3AGOA 3ALAA 2P38A 4N6TA 3OX9A 1W6YA 2W03A 1I2GA 3PYJA 1EEJA 1BRJA 1TUHA 1YJ93 1TIJA 1W6GA 1B27A 2CWUA 3PGBA 5KP4A 1Q40A 2CKFB 2CHCA 1FUWA 3KN4A 2FNQA 4LYLB 3OWYA 1LRAA 4KFDA 2O9UX 1KWIA 1OPYA 3AMOA 1YGEA 4O8SA 3S28A 4CJNA 4HM2B 1FGTA 3CCL3 1DVDA 5IG3A 3RGRA 1UDII 1R4CA 2Z6BA 4L8OA 5IW9A 1MGRA 1JBRA 1BNIA 1Q7Y4 3U97A 1Y4KA 3X40A 3HZPA 1JBSA 3F8HA 1DYUA 3X3YA 1LXEA 1GMRA 2F5MA 4CCVA 3WA3A 2RFRA 1UCKA 2H0HA 2H0IA 4ZM8A 3CMA3 1OACA 1RHLA 4FMBA 1KC84 4PEJA 1RMSA 1VQ63 3MKIA 5LC6A 1VQQA 3S27A 1STFI 2XSOB 1US1A 3OXAA 1Q7HA 1C54A 4NPBA 3B7CA 1VQM3 4EC6A 1V57A 5STDA 4NREA 5AIHA 5JPUA 3FCSB 2GBWB 4H3UA 4GL6A 1IV9A 3H3HA 3M8CA 4EBGA 6RNTA 1B2UA 2FGTA 2KF4A 4R4KA 3E99A 1O7GB 3DH2A 1NB3I 3FF0A 1BSCA 3BNEA 3KFQC 1BNRA 1UGHI 3TDGA 3V99A 1MOLA 3LZAA 4OVMA 3VSYA 2J8XB 4XDWA 1K41A 2XH9A 3EJVA 1VQL3 2CG0A 1FZUA 3DGMA 1JN5B 2CX1A 1YHQ3 3ECFA 2W0QA 5AYRB 1D6YA 3JUPA 3SOAA 3CCS3 4L8PA 1FGRA 1O7PB 2CK3H 1F8NA 1Q42A 1BNGA 1MWUA 4R1KA 1O7HB 3DGYA 4MMXB 1N8QA 1NU3A 3F8XA 1M904 3N8BA 1WQLB 3DY5A 3SYUA 4BTWA 2CFWA 3BNDA 3CNMA 1W6CA 3NBBA 2D42A 1TTOA 4BU4A 4MMZB 1Q814 1N8R4 2CFGA 4J5KA 1VQK3 2XFTA 1LNHA 3MHEA 3B4PA 4J9AA 3S67A 1NJI4 1Q40B 2BMRB 3AHSA 1CYVA 3NBJA 1IV7A 4R9KA 3CCU3 2C4BA 1CH0A 2OOVC 3D9RA 2F4YA 3AMOB 4FMCA 3GZBA 1UCLA 4O3VA 1STDA 2H0GA 1KQS2 1DVCA 3HIIA 1I8VA 1GY7A 1UUVB 2XGNA 3SXXA 1BUQA 3NQZA 5AI1A 2C11A 3EB8A 3WMDA 1BU4A 1ROAA 1C7HA 4JRFA 2CWVA 3GZYB 2M7OA 1VQ73 2D1WA 1E97A 3EC9A 3X42A 2F98A 1JB2A 3RGAA 4H61A 1I3IA 4J5GA 3LTCA 1DETA 2CFDA 4WYKA 2IMJA 2BU4A 5LC7A 1RRHA 4LGQA 2CG1A 1X1WA 2MF7A 1TJDA 1W02A 3GAXA 4IPBA 2MC8A 1KSIA 2CFKA 1IT8A 5CK6A 1AVLA 1RN4A 1UUWB 4FMAA 3PXMA 1K28A 5IG4A 3L0RA 3B8LA 1Z1SA 2QA43 1RNBA 4RBNA 3DM8A 2UGIA 3FLJA 1V74A 4GB5A 3Q90A 1BSAA 4STDA 1B2XA 1SIIA 4RNYA 1LOVA 3CC23 1RGLA 3CCV3 1QVF2 1U5OA 1FUSA 1YI23 4AKZA 3ROBA 2K3DA 3DGLA 1W4NA 4QWTA 1BVIA 1VQP3 1NDOB 3DMCA 2BNGA 3BNCA 2FXTA 3EX9A 4GHOA 2JDIH 1HU9A 1OGXA 1BAOA 2BMQB 1RN1A 2AAEA 2YFLB 3Q3FA 4LMIA 5HGRA 2OTL3 3OV4A 2V1LA 3OW22 2OWPA 3LH4A 1WMPA 3G6E3 2GEXA 3PCRA 1MWRA 3EE1A 3CU3A 2HOHA 3FF2A 3FKAA 1BRSA 1GOUA 3K7CA 4HM1B 5G1KA 4WHAA 4EV2A 3NHXA 3F40A 1VQO3 2QGUA 5CF2A 1K8A4 4RZMA 1GMPA 1JJ22 5IEPA 5G2GA 3D5GA 3G16A 1NO3A 5DRVA 8CHOA 2K0MA 3JUOA 2UX0A 5ELJA 1MGWA 1MNLA 1G0TA 2ZL8A 4HM3B 3BLZA 1OCVA 3S5CA 3VF1A 1ZS7A 2OCTA 3CC73 2W6JH 3MSOA 2W56A 2I9WA 4KFEA 5M18A 3OWUA 3EF8A 1TFKA 3SX1A 2STDA 2B1XB 3EN8A 4KZ1A 1R4YA 2SARA 5EEOA 3ZG0A 1CYUA 1VQ83 2OQEA 4XDVA 1B2SA 1ISKA 2XSHB 3IJEB 1AV4A 3KIIA 4HM5B 2P09A 2ZA4A 1T2HA 4KVHA 2RGQA 1X1XA 4N6UA 1GD3A 4K1VA 3O8YA 3KZTA 5I97A 1AR0A 1GS3A 1FW7A 5FW5A 2W9QA 1TU5A 1HZ1A 1O7MB 1RGKA 1JB5A 2WOFA 1RGHA 2HMLB 4HOHA 4EYCA 1BRIA 1ASKA 2GXFA 3OWSA 1GYBA 3ZFZA 3LTAA 3Q1CA 4WYKB 1OHPA 3CXC2 5JBSA 9RNTA 2WOHA 4K1UA 8RNTA 1JZDA 1PYLA 4RNZA 1BNJA 1GOVA 4OUQA 1B2ZA 4HM7B 1D6ZA 2OTJ3 4MMYB 3NM2A 3PS8A 3HI7A 4R9LA 4HM0B 4LSOA 2CC3A 1O7WB 3GSPA 4JF8A 4GSPA 1W2ZA 4HZBB 2UUGC 3FG3A 3NM7A 2HMMB 3STDA 3MG2A 5CXOA 5IEOA 1SJWA 3FH1A 3X41A 5EVHA 1A2VA 1RSNA 5JPPA 1I0VA 1YIJ3 3KKGA 1HYFA 1SIHA 4FCJA 5DREA 3RDEA 2HMNB 2GEYA 2WGQA 2GBXB 3KSED 2BO9B 1BSBA 1OF5A 5M1AA 1OH0A 5AIGA 1YVBI 1AQZA 2XR8B 4N6OB 3T8NA 1I0XA 1RJOA 2XF3A 3JVCA 3SOYA 4N6MA 3JUNA 4XM4A 2A15A 2IY2A 2P0MA 1PFPA 1YJN3 1EA2A 4IT7A 4NHFA 1RGGA 4I5QA 3GZRA 5A0OB 1QALA 1SARA 1BGSA 3FSDA 4IIAA 1Q824 4XB5A 2E2TA 1IT7A 3SVAA 1G02A 1IVVA 5CLKA 1BNFA 2CH9A 1JV2B 1RDSA 5IG0A 1BRNL 3UJMA 3WODG 2HMOB 3K9MC 2PZVA 3FGYA 1IQXA 4BL2A 1FGOA 3DGNA 3I553 2W56B 1TFOA 1GY6A 1Q864 4X2HA 4HM8B 2AADA 1IYYA 1EQKA 1RCKA 1A67A 1AVKA 1I2EA 2YFJB 1M9GA 2Y73A 5IF6A 3J7Yd 1G96A 1N5PA 4WFOA 1IVUA 2KAAA 3WHOA 3HX8A 4HKVB 1EG9B 1TP6A 3PZWA 1W2B2 3VGNA 2HMJB 3HOHA 1TRPA 3HIGA 5AEWB 2YFIB 2KRTA 3WDGB 2WO0A 1WNHA 4HVNA 2LQVA 1VQ53 1FGQA 3UNLA 1S723 2IA7A 1GSPA 4O2HA 1RRLA 3GRDA 1JZOA 3N54B 3MG3A 4U13A 4BTXA 3CC43 2F99A 3NV0A 1UW1A 1QJGA 3D5IA 7GSPA 3BIRA 1OUNA 3MG1A 1T3BA 4HYZA 5CF1A 2IYJA 3NXJA 4KFFA 1RGAA 2KF3A 1LQGC 3LTDA 3ER7A 4FR9A 2ML6A 2W2CA 4AEQA 3IMAB 1Q9EA 1W5ZA 1BRKA 3EN1B 3PCSA 1BIRA 3Q2PA 4CPKA 5TGNA 1VQ93 2ZHXB 1IVWA 1E3VA 2GU3A 4OK0A 2L1SA 5D83A 1K734 4J8TA 1V58A 1YGWA 3G713 3DZLA 1OGZA 4EW5A 4DKIA 1JRQA 4HBRA 2RCDA 3IPTA 1GY5A 2E2VA 1WMOA 4WWUC 1B3SA 3EBYA 3F14A 3WA2X 3WOFB 2RSXA 4BTYA 2QIYA 3EHCA 1J2BA 4XBXA 3G0KA 1MWTA 4HJLB 3LMLA 1ZX2A 3JUQA 1VQ43 3K0ZA 3U1WA 4HZ9B 1GD4A 3HK4A 2CW9A 2XFSA 1JKGA 1LOYA 2CX0A 1OF5B 2OQEC 3NQYA 2SBLA 5AYSC 3V92A 1OHOA 2HMKB 3B4OA 1LQMB 1BSDA 2XGLA 1OHSA 3V98A 2W04A 1MWSA 1RTUA 4R80A 3BU4A 1BUJA 1JB4A 1LOXA 1RCLA 1VZZA 3FZWA 1JNQA 1RGCA 2KXGA 3LTBA 4HM6B 3RNTA 3QRDA 1EUIC 4O02B 5GSPA 3GZXB 3K5TA 1GMQA 3KCHA 1E3RA 3T8UA 1RKYA 1A90A 2BMOB 2XEPA 1FA3A 4MJDA 3T0UA 1UCJA 2ML5A 3LXUX 3NUVA 5BIRA 1ZO2A 1KD14 2JQ5A 7RNTA 3MYTA 5KP3A 2CWTA 5RNTA 1B2MA 1ZGXA 3F7SA 5AIIA 5M19A 4ILFA 2RBIA 2Q07A 1N9JA 3G8ZA 4HM4B 2O3OA 1T5YA 2XRXB 2INXA 1IK3A 1QAFA 1WMNA 2PNCA 3A5EA 4AKYA 1NB5I 1M1XB 3CPOA 1UI7A 3CNXA 5FGOA 3CD63 3H51A 3MWZA 1I2FA 2IUKA 3F7XA 3FG1A 3EBTA 4TX4A 1A2PA 1YVSA 5IERA 2KCDA 1D6UA 3LT8A 5AIFA 3CCM3 4I4KA 1PU4A 4N3VA 1W01A 2GU1A 5BVBA 1ULJB 3S29A 7STDA 1BSEA 3AHWA 3WR2A 4X2OA 3JUMA 2CIUA 3NV0B 1UGIA 2P0XA 3EQQB 2IUJA 5D81A 1DE3A 1UI8A 3ZG5A 1IVXA 4HAAA 3K63A 3LOYA 2CFLA 1CQSA 1GOYA 3SLUA 4CDLA 2QEX3 2Z7AA 1YJW3 1VQN3 3MPHA 3SEDA 5KP1A 1IDPA 2K54A 5D82A 1TRQA 5G1LA 4L7KA 1YNVX 3CCQ3 1HKXA 3UL5A 1SPUA 1DMNA 1FGMA 1U8CB
chains in the Genus database with same CATH topology
1TRPA 1GMPA 1FYSA 6RNTA 3D5GA 1RGEA 1LNIA 1B2UA 1FUTA 1RGFA 2KF4A 5HOHA 1GSPA 1MGWA 1T2IA 1BNEA 2GSPA 2KF6A 3DH2A 1BSCA 1PY3A 1BNRA 4RNTA 7GSPA 3D5IA 4BIRA 3BIRA 5BU4A 2F5WA 1X1UA 1RGAA 2KF3A 1FZUA 1R4YA 2SARA 1Q9EA 1BRKA 3AGNA 1JBTA 1BIRA 1B2SA 1X1YA 6GSPA 2ZA4A 1T2HA 1YGWA 1X1XA 1BNGA 1LOWA 2KF5A 3DGYA 1FW7A 1B3SA 1HZ1A 1I3FA 1RGKA 1RNTA 1RGHA 4HOHA 3SYUA 1BRIA 1AY7A 1RLSA 4BU4A 1TTOA 2F56A 1B20A 4J5KA 2BIRA 1BRGA 1LOYA 3D4AA 3AHSA 1BANA 9RNTA 1BSDA 8RNTA 1PYLA 2C4BA 1CH0A 1BNJA 1B21A 1GOVA 2F4YA 1RTUA 1BUJA 1UCIA 1BOXA 1B2ZA 3BU4A 1RCLA 2RNTA 3RNTA 1RGCA 1UCLA 5GSPA 1I8VA 3GSPA 1GMQA 1BNSA 3KCHA 4GSPA 1I70A 1BRHA 1UCJA 3AGOA 1BU4A 5BIRA 7RNTA 1RSNA 1I0VA 1I2GA 1HYFA 5RNTA 1BRJA 1B2MA 1ZGXA 1I3IA 4J5GA 2RBIA 1B27A 1DETA 2BU4A 1BSBA 1X1WA 1AQZA 3A5EA 1I0XA 1RN4A 1LRAA 1RNBA 1I2FA 1RGGA 1A2PA 1YVSA 1BSAA 1B2XA 1BGSA 1SARA 1LOVA 1RGLA 1FUSA 1MGRA 1JBRA 1G02A 1BNIA 1BRNL 1BNFA 1RDSA 1JBSA 1BSEA 1BVIA 3AHWA 2F5MA 1GMRA 3WR2A 1DE3A 1UCKA 4GHOA 2AADA 1IYYA 4HAAA 1RCKA 1BAOA 1GOYA 1I2EA 1RN1A 2AAEA 3Q3FA 3WHOA 2KAAA 1RHLA 1RMSA 1TRQA 1C54A 1YNVX 2HOHA 1BRSA 1GOUA 3URPA 3HOHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TRP A;  1GMP A;  1FYS A;  6RNT A;  3D5G A;  1RGE A;  1LNI A;  1B2U A;  1FUT A;  1RGF A;  2KF4 A;  5HOH A;  1GSP A;  1MGW A;  1T2I A;  1BNE A;  2GSP A;  2KF6 A;  3DH2 A;  1BSC A;  1PY3 A;  1BNR A;  4RNT A;  7GSP A;  3D5I A;  4BIR A;  3BIR A;  5BU4 A;  2F5W A;  1X1U A;  1RGA A;  2KF3 A;  1FZU A;  1R4Y A;  2SAR A;  1Q9E A;  1BRK A;  3AGN A;  1JBT A;  1BIR A;  1B2S A;  1X1Y A;  6GSP A;  2ZA4 A;  1T2H A;  1YGW A;  1X1X A;  1BNG A;  1LOW A;  2KF5 A;  3DGY A;  1FW7 A;  1B3S A;  1HZ1 A;  1I3F A;  1RGK A;  1RNT A;  1RGH A;  4HOH A;  3SYU A;  1BRI A;  1AY7 A;  1RLS A;  4BU4 A;  1TTO A;  2F56 A;  1B20 A;  4J5K A;  2BIR A;  1BRG A;  1LOY A;  3D4A A;  3AHS A;  1BAN A;  9RNT A;  1BSD A;  8RNT A;  1PYL A;  2C4B A;  1CH0 A;  1BNJ A;  1B21 A;  1GOV A;  2F4Y A;  1RTU A;  1BUJ A;  1UCI A;  1BOX A;  1B2Z A;  3BU4 A;  1RCL A;  2RNT A;  3RNT A;  1RGC A;  1UCL A;  5GSP A;  1I8V A;  3GSP A;  1GMQ A;  1BNS A;  3KCH A;  4GSP A;  1I70 A;  1BRH A;  1UCJ A;  3AGO A;  1BU4 A;  5BIR A;  7RNT A;  1RSN A;  1I0V A;  1I2G A;  1HYF A;  5RNT A;  1BRJ A;  1B2M A;  1ZGX A;  1I3I A;  4J5G A;  2RBI A;  1B27 A;  1DET A;  2BU4 A;  1BSB A;  1X1W A;  1AQZ A;  3A5E A;  1I0X A;  1RN4 A;  1LRA A;  1RNB A;  1I2F A;  1RGG A;  1A2P A;  1YVS A;  1BSA A;  1B2X A;  1BGS A;  1SAR A;  1LOV A;  1RGL A;  1FUS A;  1MGR A;  1JBR A;  1G02 A;  1BNI A;  1BRN L;  1BNF A;  1RDS A;  1JBS A;  1BSE A;  1BVI A;  3AHW A;  2F5M A;  1GMR A;  3WR2 A;  1DE3 A;  1UCK A;  4GHO A;  2AAD A;  1IYY A;  4HAA A;  1RCK A;  1BAO A;  1GOY A;  1I2E A;  1RN1 A;  2AAE A;  3Q3F A;  3WHO A;  2KAA A;  1RHL A;  1RMS A;  1TRQ A;  1C54 A;  1YNV X;  2HOH A;  1BRS A;  1GOU A;  3URP A;  3HOH A; 
#chains in the Genus database with same CATH topology
 2P05 A;  1FYS A;  1N9E A;  1SQW A;  1RGE A;  1RN7 A;  1LNI A;  1FUT A;  1RGF A;  2YX9 A;  3X3Z A;  2Z76 A;  5HOH A;  1T2I A;  2GSP A;  3FG4 A;  1BNE A;  2KF6 A;  3N9H A;  3UB1 A;  3UL6 A;  4K61 A;  3G4S 3;  1IQY A;  2ZDJ A;  1PY3 A;  3LYG A;  4RNT A;  5EQL A;  5BXQ A;  1QAK A;  4BIR A;  3D3L A;  2F86 B;  4KT3 B;  5BU4 A;  3I0Y A;  2L4V A;  5AEU B;  1A2K A;  5IG5 A;  1JKG B;  2F5W A;  1X1U A;  3DGO A;  2LYX A;  3URP A;  1K9M 4;  4LZI A;  4G1M B;  1O7N B;  2WGO A;  3AGN A;  1NNV A;  1JBT A;  2BT3 A;  4FCZ A;  1X1Y A;  6GSP A;  3NX0 A;  4FCM A;  1W00 A;  2OOV A;  1ROV A;  3I56 3;  1DMM A;  4EXR A;  4LEH A;  4MEI A;  3CCE 3;  1UUG B;  2KF5 A;  1LOW A;  4K90 B;  3BB9 A;  1M1K 4;  2C10 A;  5IEN A;  1IQ8 A;  1RNT A;  1I3F A;  1QMA A;  4XBT A;  3D79 A;  3KE7 A;  4EV5 A;  1QVG 2;  4WP5 A;  3DUK A;  4N6L A;  1AY7 A;  2Z77 A;  3KSP A;  3QK9 A;  1RLS A;  3GWR A;  4N6N B;  2F56 A;  1B20 A;  1NWW A;  3LT9 A;  2Y74 A;  2BIR A;  1BRG A;  2BHM A;  3D4A A;  1JN5 A;  3X3X A;  4BL3 A;  6STD A;  3CME 3;  1BAN A;  1S5A A;  1IU7 A;  3DXO A;  1EKM A;  1ULI B;  1WTH A;  3CCR 3;  2R4I A;  4ORL A;  3CPW 2;  1B21 A;  1UCI A;  1BOX A;  2B24 B;  1W7C A;  4Q53 A;  3WOE B;  2RNT A;  1L5G B;  4FMD A;  1N5H A;  1LVN A;  2R41 A;  5ELU A;  1YIT 3;  4XBY A;  1BNS A;  3A76 A;  3NBR A;  1I70 A;  3BNB A;  1BRH A;  2E2U A;  3F9S A;  1DMQ A;  4N6V 0;  2W9P A;  3CCJ 3;  1CEW I;  3AGO A;  3ALA A;  2P38 A;  4N6T A;  3OX9 A;  1W6Y A;  2W03 A;  1I2G A;  3PYJ A;  1EEJ A;  1BRJ A;  1TUH A;  1YJ9 3;  1TIJ A;  1W6G A;  1B27 A;  2CWU A;  3PGB A;  5KP4 A;  1Q40 A;  2CKF B;  2CHC A;  1FUW A;  3KN4 A;  2FNQ A;  4LYL B;  3OWY A;  1LRA A;  4KFD A;  2O9U X;  1KWI A;  1OPY A;  3AMO A;  1YGE A;  4O8S A;  3S28 A;  4CJN A;  4HM2 B;  1FGT A;  3CCL 3;  1DVD A;  5IG3 A;  3RGR A;  1UDI I;  1R4C A;  2Z6B A;  4L8O A;  5IW9 A;  1MGR A;  1JBR A;  1BNI A;  1Q7Y 4;  3U97 A;  1Y4K A;  3X40 A;  3HZP A;  1JBS A;  3F8H A;  1DYU A;  3X3Y A;  1LXE A;  1GMR A;  2F5M A;  4CCV A;  3WA3 A;  2RFR A;  1UCK A;  2H0H A;  2H0I A;  4ZM8 A;  3CMA 3;  1OAC A;  1RHL A;  4FMB A;  1KC8 4;  4PEJ A;  1RMS A;  1VQ6 3;  3MKI A;  5LC6 A;  1VQQ A;  3S27 A;  1STF I;  2XSO B;  1US1 A;  3OXA A;  1Q7H A;  1C54 A;  4NPB A;  3B7C A;  1VQM 3;  4EC6 A;  1V57 A;  5STD A;  4NRE A;  5AIH A;  5JPU A;  3FCS B;  2GBW B;  4H3U A;  4GL6 A;  1IV9 A;  3H3H A;  3M8C A;  4EBG A;  6RNT A;  1B2U A;  2FGT A;  2KF4 A;  4R4K A;  3E99 A;  1O7G B;  3DH2 A;  1NB3 I;  3FF0 A;  1BSC A;  3BNE A;  3KFQ C;  1BNR A;  1UGH I;  3TDG A;  3V99 A;  1MOL A;  3LZA A;  4OVM A;  3VSY A;  2J8X B;  4XDW A;  1K41 A;  2XH9 A;  3EJV A;  1VQL 3;  2CG0 A;  1FZU A;  3DGM A;  1JN5 B;  2CX1 A;  1YHQ 3;  3ECF A;  2W0Q A;  5AYR B;  1D6Y A;  3JUP A;  3SOA A;  3CCS 3;  4L8P A;  1FGR A;  1O7P B;  2CK3 H;  1F8N A;  1Q42 A;  1BNG A;  1MWU A;  4R1K A;  1O7H B;  3DGY A;  4MMX B;  1N8Q A;  1NU3 A;  3F8X A;  1M90 4;  3N8B A;  1WQL B;  3DY5 A;  3SYU A;  4BTW A;  2CFW A;  3BND A;  3CNM A;  1W6C A;  3NBB A;  2D42 A;  1TTO A;  4BU4 A;  4MMZ B;  1Q81 4;  1N8R 4;  2CFG A;  4J5K A;  1VQK 3;  2XFT A;  1LNH A;  3MHE A;  3B4P A;  4J9A A;  3S67 A;  1NJI 4;  1Q40 B;  2BMR B;  3AHS A;  1CYV A;  3NBJ A;  1IV7 A;  4R9K A;  3CCU 3;  2C4B A;  1CH0 A;  2OOV C;  3D9R A;  2F4Y A;  3AMO B;  4FMC A;  3GZB A;  1UCL A;  4O3V A;  1STD A;  2H0G A;  1KQS 2;  1DVC A;  3HII A;  1I8V A;  1GY7 A;  1UUV B;  2XGN A;  3SXX A;  1BUQ A;  3NQZ A;  5AI1 A;  2C11 A;  3EB8 A;  3WMD A;  1BU4 A;  1ROA A;  1C7H A;  4JRF A;  2CWV A;  3GZY B;  2M7O A;  1VQ7 3;  2D1W A;  1E97 A;  3EC9 A;  3X42 A;  2F98 A;  1JB2 A;  3RGA A;  4H61 A;  1I3I A;  4J5G A;  3LTC A;  1DET A;  2CFD A;  4WYK A;  2IMJ A;  2BU4 A;  5LC7 A;  1RRH A;  4LGQ A;  2CG1 A;  1X1W A;  2MF7 A;  1TJD A;  1W02 A;  3GAX A;  4IPB A;  2MC8 A;  1KSI A;  2CFK A;  1IT8 A;  5CK6 A;  1AVL A;  1RN4 A;  1UUW B;  4FMA A;  3PXM A;  1K28 A;  5IG4 A;  3L0R A;  3B8L A;  1Z1S A;  2QA4 3;  1RNB A;  4RBN A;  3DM8 A;  2UGI A;  3FLJ A;  1V74 A;  4GB5 A;  3Q90 A;  1BSA A;  4STD A;  1B2X A;  1SII A;  4RNY A;  1LOV A;  3CC2 3;  1RGL A;  3CCV 3;  1QVF 2;  1U5O A;  1FUS A;  1YI2 3;  4AKZ A;  3ROB A;  2K3D A;  3DGL A;  1W4N A;  4QWT A;  1BVI A;  1VQP 3;  1NDO B;  3DMC A;  2BNG A;  3BNC A;  2FXT A;  3EX9 A;  4GHO A;  2JDI H;  1HU9 A;  1OGX A;  1BAO A;  2BMQ B;  1RN1 A;  2AAE A;  2YFL B;  3Q3F A;  4LMI A;  5HGR A;  2OTL 3;  3OV4 A;  2V1L A;  3OW2 2;  2OWP A;  3LH4 A;  1WMP A;  3G6E 3;  2GEX A;  3PCR A;  1MWR A;  3EE1 A;  3CU3 A;  2HOH A;  3FF2 A;  3FKA A;  1BRS A;  1GOU A;  3K7C A;  4HM1 B;  5G1K A;  4WHA A;  4EV2 A;  3NHX A;  3F40 A;  1VQO 3;  2QGU A;  5CF2 A;  1K8A 4;  4RZM A;  1GMP A;  1JJ2 2;  5IEP A;  5G2G A;  3D5G A;  3G16 A;  1NO3 A;  5DRV A;  8CHO A;  2K0M A;  3JUO A;  2UX0 A;  5ELJ A;  1MGW A;  1MNL A;  1G0T A;  2ZL8 A;  4HM3 B;  3BLZ A;  1OCV A;  3S5C A;  3VF1 A;  1ZS7 A;  2OCT A;  3CC7 3;  2W6J H;  3MSO A;  2W56 A;  2I9W A;  4KFE A;  5M18 A;  3OWU A;  3EF8 A;  1TFK A;  3SX1 A;  2STD A;  2B1X B;  3EN8 A;  4KZ1 A;  1R4Y A;  2SAR A;  5EEO A;  3ZG0 A;  1CYU A;  1VQ8 3;  2OQE A;  4XDV A;  1B2S A;  1ISK A;  2XSH B;  3IJE B;  1AV4 A;  3KII A;  4HM5 B;  2P09 A;  2ZA4 A;  1T2H A;  4KVH A;  2RGQ A;  1X1X A;  4N6U A;  1GD3 A;  4K1V A;  3O8Y A;  3KZT A;  5I97 A;  1AR0 A;  1GS3 A;  1FW7 A;  5FW5 A;  2W9Q A;  1TU5 A;  1HZ1 A;  1O7M B;  1RGK A;  1JB5 A;  2WOF A;  1RGH A;  2HML B;  4HOH A;  4EYC A;  1BRI A;  1ASK A;  2GXF A;  3OWS A;  1GYB A;  3ZFZ A;  3LTA A;  3Q1C A;  4WYK B;  1OHP A;  3CXC 2;  5JBS A;  9RNT A;  2WOH A;  4K1U A;  8RNT A;  1JZD A;  1PYL A;  4RNZ A;  1BNJ A;  1GOV A;  4OUQ A;  1B2Z A;  4HM7 B;  1D6Z A;  2OTJ 3;  4MMY B;  3NM2 A;  3PS8 A;  3HI7 A;  4R9L A;  4HM0 B;  4LSO A;  2CC3 A;  1O7W B;  3GSP A;  4JF8 A;  4GSP A;  1W2Z A;  4HZB B;  2UUG C;  3FG3 A;  3NM7 A;  2HMM B;  3STD A;  3MG2 A;  5CXO A;  5IEO A;  1SJW A;  3FH1 A;  3X41 A;  5EVH A;  1A2V A;  1RSN A;  5JPP A;  1I0V A;  1YIJ 3;  3KKG A;  1HYF A;  1SIH A;  4FCJ A;  5DRE A;  3RDE A;  2HMN B;  2GEY A;  2WGQ A;  2GBX B;  3KSE D;  2BO9 B;  1BSB A;  1OF5 A;  5M1A A;  1OH0 A;  5AIG A;  1YVB I;  1AQZ A;  2XR8 B;  4N6O B;  3T8N A;  1I0X A;  1RJO A;  2XF3 A;  3JVC A;  3SOY A;  4N6M A;  3JUN A;  4XM4 A;  2A15 A;  2IY2 A;  2P0M A;  1PFP A;  1YJN 3;  1EA2 A;  4IT7 A;  4NHF A;  1RGG A;  4I5Q A;  3GZR A;  5A0O B;  1QAL A;  1SAR A;  1BGS A;  3FSD A;  4IIA A;  1Q82 4;  4XB5 A;  2E2T A;  1IT7 A;  3SVA A;  1G02 A;  1IVV A;  5CLK A;  1BNF A;  2CH9 A;  1JV2 B;  1RDS A;  5IG0 A;  1BRN L;  3UJM A;  3WOD G;  2HMO B;  3K9M C;  2PZV A;  3FGY A;  1IQX A;  4BL2 A;  1FGO A;  3DGN A;  3I55 3;  2W56 B;  1TFO A;  1GY6 A;  1Q86 4;  4X2H A;  4HM8 B;  2AAD A;  1IYY A;  1EQK A;  1RCK A;  1A67 A;  1AVK A;  1I2E A;  2YFJ B;  1M9G A;  2Y73 A;  5IF6 A;  3J7Y d;  1G96 A;  1N5P A;  4WFO A;  1IVU A;  2KAA A;  3WHO A;  3HX8 A;  4HKV B;  1EG9 B;  1TP6 A;  3PZW A;  1W2B 2;  3VGN A;  2HMJ B;  3HOH A;  1TRP A;  3HIG A;  5AEW B;  2YFI B;  2KRT A;  3WDG B;  2WO0 A;  1WNH A;  4HVN A;  2LQV A;  1VQ5 3;  1FGQ A;  3UNL A;  1S72 3;  2IA7 A;  1GSP A;  4O2H A;  1RRL A;  3GRD A;  1JZO A;  3N54 B;  3MG3 A;  4U13 A;  4BTX A;  3CC4 3;  2F99 A;  3NV0 A;  1UW1 A;  1QJG A;  3D5I A;  7GSP A;  3BIR A;  1OUN A;  3MG1 A;  1T3B A;  4HYZ A;  5CF1 A;  2IYJ A;  3NXJ A;  4KFF A;  1RGA A;  2KF3 A;  1LQG C;  3LTD A;  3ER7 A;  4FR9 A;  2ML6 A;  2W2C A;  4AEQ A;  3IMA B;  1Q9E A;  1W5Z A;  1BRK A;  3EN1 B;  3PCS A;  1BIR A;  3Q2P A;  4CPK A;  5TGN A;  1VQ9 3;  2ZHX B;  1IVW A;  1E3V A;  2GU3 A;  4OK0 A;  2L1S A;  5D83 A;  1K73 4;  4J8T A;  1V58 A;  1YGW A;  3G71 3;  3DZL A;  1OGZ A;  4EW5 A;  4DKI A;  1JRQ A;  4HBR A;  2RCD A;  3IPT A;  1GY5 A;  2E2V A;  1WMO A;  4WWU C;  1B3S A;  3EBY A;  3F14 A;  3WA2 X;  3WOF B;  2RSX A;  4BTY A;  2QIY A;  3EHC A;  1J2B A;  4XBX A;  3G0K A;  1MWT A;  4HJL B;  3LML A;  1ZX2 A;  3JUQ A;  1VQ4 3;  3K0Z A;  3U1W A;  4HZ9 B;  1GD4 A;  3HK4 A;  2CW9 A;  2XFS A;  1JKG A;  1LOY A;  2CX0 A;  1OF5 B;  2OQE C;  3NQY A;  2SBL A;  5AYS C;  3V92 A;  1OHO A;  2HMK B;  3B4O A;  1LQM B;  1BSD A;  2XGL A;  1OHS A;  3V98 A;  2W04 A;  1MWS A;  1RTU A;  4R80 A;  3BU4 A;  1BUJ A;  1JB4 A;  1LOX A;  1RCL A;  1VZZ A;  3FZW A;  1JNQ A;  1RGC A;  2KXG A;  3LTB A;  4HM6 B;  3RNT A;  3QRD A;  1EUI C;  4O02 B;  5GSP A;  3GZX B;  3K5T A;  1GMQ A;  3KCH A;  1E3R A;  3T8U A;  1RKY A;  1A90 A;  2BMO B;  2XEP A;  1FA3 A;  4MJD A;  3T0U A;  1UCJ A;  2ML5 A;  3LXU X;  3NUV A;  5BIR A;  1ZO2 A;  1KD1 4;  2JQ5 A;  7RNT A;  3MYT A;  5KP3 A;  2CWT A;  5RNT A;  1B2M A;  1ZGX A;  3F7S A;  5AII A;  5M19 A;  4ILF A;  2RBI A;  2Q07 A;  1N9J A;  3G8Z A;  4HM4 B;  2O3O A;  1T5Y A;  2XRX B;  2INX A;  1IK3 A;  1QAF A;  1WMN A;  2PNC A;  3A5E A;  4AKY A;  1NB5 I;  1M1X B;  3CPO A;  1UI7 A;  3CNX A;  5FGO A;  3CD6 3;  3H51 A;  3MWZ A;  1I2F A;  2IUK A;  3F7X A;  3FG1 A;  3EBT A;  4TX4 A;  1A2P A;  1YVS A;  5IER A;  2KCD A;  1D6U A;  3LT8 A;  5AIF A;  3CCM 3;  4I4K A;  1PU4 A;  4N3V A;  1W01 A;  2GU1 A;  5BVB A;  1ULJ B;  3S29 A;  7STD A;  1BSE A;  3AHW A;  3WR2 A;  4X2O A;  3JUM A;  2CIU A;  3NV0 B;  1UGI A;  2P0X A;  3EQQ B;  2IUJ A;  5D81 A;  1DE3 A;  1UI8 A;  3ZG5 A;  1IVX A;  4HAA A;  3K63 A;  3LOY A;  2CFL A;  1CQS A;  1GOY A;  3SLU A;  4CDL A;  2QEX 3;  2Z7A A;  1YJW 3;  1VQN 3;  3MPH A;  3SED A;  5KP1 A;  1IDP A;  2K54 A;  5D82 A;  1TRQ A;  5G1L A;  4L7K A;  1YNV X;  3CCQ 3;  1HKX A;  3UL5 A;  1SPU A;  1DMN A;  1FGM A;  1U8C B; 
#chains in the Genus database with same CATH homology
 1TRP A;  1GMP A;  1FYS A;  6RNT A;  3D5G A;  1RGE A;  1LNI A;  1B2U A;  1FUT A;  1RGF A;  2KF4 A;  5HOH A;  1GSP A;  1MGW A;  1T2I A;  1BNE A;  2GSP A;  2KF6 A;  3DH2 A;  1BSC A;  1PY3 A;  1BNR A;  4RNT A;  7GSP A;  3D5I A;  4BIR A;  3BIR A;  5BU4 A;  2F5W A;  1X1U A;  1RGA A;  2KF3 A;  1FZU A;  1R4Y A;  2SAR A;  1Q9E A;  1BRK A;  3AGN A;  1JBT A;  1BIR A;  1B2S A;  1X1Y A;  6GSP A;  2ZA4 A;  1T2H A;  1YGW A;  1X1X A;  1BNG A;  1LOW A;  2KF5 A;  3DGY A;  1FW7 A;  1B3S A;  1HZ1 A;  1I3F A;  1RGK A;  1RNT A;  1RGH A;  4HOH A;  3SYU A;  1BRI A;  1AY7 A;  1RLS A;  4BU4 A;  1TTO A;  2F56 A;  1B20 A;  4J5K A;  2BIR A;  1BRG A;  1LOY A;  3D4A A;  3AHS A;  1BAN A;  9RNT A;  1BSD A;  8RNT A;  1PYL A;  2C4B A;  1CH0 A;  1BNJ A;  1B21 A;  1GOV A;  2F4Y A;  1RTU A;  1BUJ A;  1UCI A;  1BOX A;  1B2Z A;  3BU4 A;  1RCL A;  2RNT A;  3RNT A;  1RGC A;  1UCL A;  5GSP A;  1I8V A;  3GSP A;  1GMQ A;  1BNS A;  3KCH A;  4GSP A;  1I70 A;  1BRH A;  1UCJ A;  3AGO A;  1BU4 A;  5BIR A;  7RNT A;  1RSN A;  1I0V A;  1I2G A;  1HYF A;  5RNT A;  1BRJ A;  1B2M A;  1ZGX A;  1I3I A;  4J5G A;  2RBI A;  1B27 A;  1DET A;  2BU4 A;  1BSB A;  1X1W A;  1AQZ A;  3A5E A;  1I0X A;  1RN4 A;  1LRA A;  1RNB A;  1I2F A;  1RGG A;  1A2P A;  1YVS A;  1BSA A;  1B2X A;  1BGS A;  1SAR A;  1LOV A;  1RGL A;  1FUS A;  1MGR A;  1JBR A;  1G02 A;  1BNI A;  1BRN L;  1BNF A;  1RDS A;  1JBS A;  1BSE A;  1BVI A;  3AHW A;  2F5M A;  1GMR A;  3WR2 A;  1DE3 A;  1UCK A;  4GHO A;  2AAD A;  1IYY A;  4HAA A;  1RCK A;  1BAO A;  1GOY A;  1I2E A;  1RN1 A;  2AAE A;  3Q3F A;  3WHO A;  2KAA A;  1RHL A;  1RMS A;  1TRQ A;  1C54 A;  1YNV X;  2HOH A;  1BRS A;  1GOU A;  3URP A;  3HOH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...