1Q9GA

Nmr structure of the outer membrane protein ompx in dhpc micelles
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
148
structure length
148
Chain Sequence
ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKNDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of the integral membrane protein OmpX
pubmed doi rcsb
molecule keywords Outer membrane protein X
molecule tags Membrane protein
source organism Escherichia coli
total genus 12
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2003-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 1q9gA00
2N2MA 1THQA 2F1VA 3QRCA 3G7GA 1QJPA 2GE4A 1QJ9A 2MHLA 1BXWA 1G90A 2JMMA 2MNHA 1Q9GA 1MM4A 2ERVA 4RLCA 1ORMA 2LHFA 1P4TA 3QRAA 2N2LA 1QJ8A 3C5OA 3GP6A 2M06A 2X27X 2M07A 1MM5A 2F1TA 1Q9FA 4PUXA 2K0LA
chains in the Genus database with same CATH superfamily
5DL5A 3WU2O 2X9KA 3V8UA 1ZHXA 3QRCA 3A0BO 4LSHA 3LK2B 2IWVA 1QJPA 2GE4A 3LK3B 4PJ0O 4FUVA 3VY8X 4FMSA 4K3CA 3AA6A 3AA1B 1MPFA 3JCUO 3POUA 1G90A 4FT6A 3AAEB 3PQUA 4AZLA 3WI4A 4AKRA 5KAIO 3POXA 4O3XB 3DWNA 2QTKA 2ODJA 4RLCA 4N58A 4JFBA 4RL9A 5D5DA 1HXTA 2LHFA 3AA6B 4JCHA 4E1TA 4Z3TA 7PRNA 3PGRA 1PRNA 2Y0LA 3SY9A 4D5UA 3HW9A 3K19A 1T16A 3DWOX 1QJ8A 3GP6A 4KR4A 4O3WA 4RJXA 3HOEA 2X27X 3RBHA 5AFUL 2Y2XA 4FZMA 3AA7A 4C4VA 2Y0HA 3HWBA 3A0HO 3BRYA 3KZIO 2F1VA 2YNKA 4N74A 5DL6A 3VZWX 2XE3A 4C00A 1E54A 1QJ9A 5DL8A 2KXPA 2MHLA 3AA7B 2R4PA 2XE5A 1BXWA 5AFUK 1S5LO 4C69X 1OPFA 2OMFA 3PF1A 2XG6A 3NSGA 4AYID 3UU2A 2IWWA 2JMMA 2MNHA 2ZLDA 4D64A 1MM4A 5IYUA 1IZNA 4QQ1A 5PRNA 1GFOA 5G3AA 2KC0A 2J4UP 4FZNA 1GFQA 3PGUA 2KZ7A 4FQEA 2N2LA 2Y0KA 5E79O 3C5OA 5B66O 5ADXK 4AYNA 2JQYA 1T1LA 3VE1A 3BRZA 4AUIA 8PRNA 4O49A 3AAAA 4B61A 1IZNB 1GFNA 4G75A 5B5EO 2R8AA 3UPGA 2W81C 2O4VA 3PGSA 1BH3A 4AFKA 2KZ7B 1PHOA 3BS0A 2F1CX 2YPVA 3DZMA 4GHBA 2PRNA 3G7GA 4GCSA 4IL6O 2R4OA 4PR7A 4UB8O 3PQSA 5G38A 3PORA 5TISO 1HXUA 3AAAB 3FYXA 6PRNA 4LSEA 4C4VB 5G26A 5FVNA 4LSFA 2R89A 5ADXL 5GV0A 4GF4A 4GCPA 2K4TA 3T20A 5GTIO 4D65A 3SYBA 4FSPA 3VZTX 4O3YA 4FSOA 1P4TA 2KXPB 4UB6O 2XE1A 4KRAA 3VE2A 3HOLA 4XNKA 4AKMA 2WVPA 2W80C 3NJTA 3A2SX 3KVDD 5G39A 4AYDC 1ZHTA 5KAFO 4RLBA 3LK41 3POQA 2KDYA 3DA4A 2Y7SA 3LK42 4FRXA 4G76A 4O4XA 2F1TA 3AA1A 4K3BA 5EE2A 3SYSA 4PUXA 4RJWA 3AAEA 1OSMA 3T0SA 4E1SA 2N2MA 3PRNA 2LFUA 2XTRA 2R88A 4XNLA 2WJQA 1BT9A 1THQA 5GTHO 1HXXA 1ZHWA 2R4NA 2XE2A 4N75A 5H2FO 4AYMC 4LSIA 3VY9X 4F4BA 3SZDA 2FGRA 2PORA 2XTQA 2FGQX 3AA0A 3O0EA 3SY7A 4AKRB 2J1NA 4CTDA 4FESA 4U9CA 1YS5A 1GFMA 1Q9GA 4GCQA 1ZHYA 4FOZA 2ERVA 4KR8A 3TZGA 3UAQA 1ORMA 2AXTO 5DL7A 3T24A 5T5FA 3QRAA 4AYEC 1ZHZA 4FRTA 2XMXA 4FZLA 2R4LA 4N59A 2ZFGA 3AA0B 4O3ZA 4BUMX 1GFPA 5JDPA 2M06A 2WJRA 1H6S1 3LK2A 2M07A 3SZVA 3LK3A 3VZUX 3WI5A 3EMNX 1MM5A 3DA3A 3JTYA 1Q9FA 4O4UA 2K0LA
chains in the Genus database with same CATH topology
5DL5A 3V8UA 1ZHXA 3QRCA 4LSHA 3LK2B 1QJPA 2GE4A 3LK3B 3VY8X 4FUVA 4FMSA 3AA6A 3AA1B 1MPFA 1G90A 3POUA 4FT6A 3AAEB 3PQUA 4AZLA 3WI4A 3POXA 4O3XB 2QTKA 2ODJA 4RLCA 4N58A 4JFBA 4RL9A 5D5DA 1HXTA 2LHFA 3AA6B 4JCHA 4E1TA 4Z3TA 7PRNA 1PRNA 2Y0LA 3SY9A 4D5UA 3HW9A 3K19A 4KR4A 1QJ8A 3GP6A 4O3WA 4RJXA 3HOEA 2X27X 3RBHA 5AFUL 2Y2XA 4FZMA 3AA7A 2Y0HA 3HWBA 2F1VA 2YNKA 5DL6A 3VZWX 2XE3A 1E54A 1QJ9A 5DL8A 2KXPA 2MHLA 3AA7B 5AFUK 2XE5A 1BXWA 4C69X 1OPFA 2OMFA 2XG6A 3NSGA 4AYID 3UU2A 2JMMA 2MNHA 2ZLDA 4D64A 1MM4A 5IYUA 1IZNA 4QQ1A 5PRNA 1GFOA 2KC0A 2J4UP 4FZNA 1GFQA 2KZ7A 2N2LA 2Y0KA 3C5OA 5ADXK 4AYNA 8PRNA 3VE1A 4AUIA 4O49A 3AAAA 4B61A 1IZNB 1GFNA 4G75A 3UPGA 2W81C 2O4VA 1BH3A 4AFKA 2KZ7B 1PHOA 4AKRA 2YPVA 4GHBA 2PRNA 3G7GA 4GCSA 3VZTX 4E1SA 3PQSA 3PORA 1HXUA 3AAAB 3FYXA 6PRNA 4LSEA 5G26A 5FVNA 4LSFA 5ADXL 5GV0A 4GF4A 4GCPA 2K4TA 3T20A 4D65A 3SYBA 4FSPA 4O3YA 4FSOA 1P4TA 2KXPB 2XE1A 4KRAA 3HOLA 4XNKA 4AKMA 2W80C 3A2SX 3KVDD 4AYDC 1ZHTA 4RLBA 3LK41 3POQA 2KDYA 3DA4A 2Y7SA 3LK42 4FRXA 4G76A 4O4XA 2F1TA 3AA1A 5EE2A 3SYSA 3VE2A 4PUXA 4RJWA 3AAEA 1OSMA 3T0SA 2N2MA 3PRNA 2LFUA 2XTRA 4XNLA 1BT9A 1THQA 1HXXA 1ZHWA 2XE2A 4AYMC 4LSIA 3VY9X 4F4BA 3SZDA 2FGRA 2PORA 2XTQA 2FGQX 3AA0A 3O0EA 3SY7A 4AKRB 2J1NA 4FESA 4U9CA 1YS5A 1GFMA 1Q9GA 4GCQA 1ZHYA 4FOZA 2ERVA 4KR8A 3TZGA 3UAQA 1ORMA 5DL7A 3T24A 5T5FA 3QRAA 4AYEC 1ZHZA 4FRTA 2XMXA 4FZLA 4N59A 4O3ZA 2ZFGA 3AA0B 4BUMX 1GFPA 5JDPA 2M06A 3SZVA 1H6S1 3LK2A 2M07A 3LK3A 3VZUX 3WI5A 3EMNX 1MM5A 3DA3A 3JTYA 1Q9FA 4O4UA 2K0LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N2M A;  1THQ A;  2F1V A;  3QRC A;  3G7G A;  1QJP A;  2GE4 A;  1QJ9 A;  2MHL A;  1BXW A;  1G90 A;  2JMM A;  2MNH A;  1Q9G A;  1MM4 A;  2ERV A;  4RLC A;  1ORM A;  2LHF A;  1P4T A;  3QRA A;  2N2L A;  1QJ8 A;  3C5O A;  3GP6 A;  2M06 A;  2X27 X;  2M07 A;  1MM5 A;  2F1T A;  1Q9F A;  4PUX A;  2K0L A; 
#chains in the Genus database with same CATH topology
 5DL5 A;  3WU2 O;  2X9K A;  3V8U A;  1ZHX A;  3QRC A;  3A0B O;  4LSH A;  3LK2 B;  2IWV A;  1QJP A;  2GE4 A;  3LK3 B;  4PJ0 O;  4FUV A;  3VY8 X;  4FMS A;  4K3C A;  3AA6 A;  3AA1 B;  1MPF A;  3JCU O;  3POU A;  1G90 A;  4FT6 A;  3AAE B;  3PQU A;  4AZL A;  3WI4 A;  4AKR A;  5KAI O;  3POX A;  4O3X B;  3DWN A;  2QTK A;  2ODJ A;  4RLC A;  4N58 A;  4JFB A;  4RL9 A;  5D5D A;  1HXT A;  2LHF A;  3AA6 B;  4JCH A;  4E1T A;  4Z3T A;  7PRN A;  3PGR A;  1PRN A;  2Y0L A;  3SY9 A;  4D5U A;  3HW9 A;  3K19 A;  1T16 A;  3DWO X;  1QJ8 A;  3GP6 A;  4KR4 A;  4O3W A;  4RJX A;  3HOE A;  2X27 X;  3RBH A;  5AFU L;  2Y2X A;  4FZM A;  3AA7 A;  4C4V A;  2Y0H A;  3HWB A;  3A0H O;  3BRY A;  3KZI O;  2F1V A;  2YNK A;  4N74 A;  5DL6 A;  3VZW X;  2XE3 A;  4C00 A;  1E54 A;  1QJ9 A;  5DL8 A;  2KXP A;  2MHL A;  3AA7 B;  2R4P A;  2XE5 A;  1BXW A;  5AFU K;  1S5L O;  4C69 X;  1OPF A;  2OMF A;  3PF1 A;  2XG6 A;  3NSG A;  4AYI D;  3UU2 A;  2IWW A;  2JMM A;  2MNH A;  2ZLD A;  4D64 A;  1MM4 A;  5IYU A;  1IZN A;  4QQ1 A;  5PRN A;  1GFO A;  5G3A A;  2KC0 A;  2J4U P;  4FZN A;  1GFQ A;  3PGU A;  2KZ7 A;  4FQE A;  2N2L A;  2Y0K A;  5E79 O;  3C5O A;  5B66 O;  5ADX K;  4AYN A;  2JQY A;  1T1L A;  3VE1 A;  3BRZ A;  4AUI A;  8PRN A;  4O49 A;  3AAA A;  4B61 A;  1IZN B;  1GFN A;  4G75 A;  5B5E O;  2R8A A;  3UPG A;  2W81 C;  2O4V A;  3PGS A;  1BH3 A;  4AFK A;  2KZ7 B;  1PHO A;  3BS0 A;  2F1C X;  2YPV A;  3DZM A;  4GHB A;  2PRN A;  3G7G A;  4GCS A;  4IL6 O;  2R4O A;  4PR7 A;  4UB8 O;  3PQS A;  5G38 A;  3POR A;  5TIS O;  1HXU A;  3AAA B;  3FYX A;  6PRN A;  4LSE A;  4C4V B;  5G26 A;  5FVN A;  4LSF A;  2R89 A;  5ADX L;  5GV0 A;  4GF4 A;  4GCP A;  2K4T A;  3T20 A;  5GTI O;  4D65 A;  3SYB A;  4FSP A;  3VZT X;  4O3Y A;  4FSO A;  1P4T A;  2KXP B;  4UB6 O;  2XE1 A;  4KRA A;  3VE2 A;  3HOL A;  4XNK A;  4AKM A;  2WVP A;  2W80 C;  3NJT A;  3A2S X;  3KVD D;  5G39 A;  4AYD C;  1ZHT A;  5KAF O;  4RLB A;  3LK4 1;  3POQ A;  2KDY A;  3DA4 A;  2Y7S A;  3LK4 2;  4FRX A;  4G76 A;  4O4X A;  2F1T A;  3AA1 A;  4K3B A;  5EE2 A;  3SYS A;  4PUX A;  4RJW A;  3AAE A;  1OSM A;  3T0S A;  4E1S A;  2N2M A;  3PRN A;  2LFU A;  2XTR A;  2R88 A;  4XNL A;  2WJQ A;  1BT9 A;  1THQ A;  5GTH O;  1HXX A;  1ZHW A;  2R4N A;  2XE2 A;  4N75 A;  5H2F O;  4AYM C;  4LSI A;  3VY9 X;  4F4B A;  3SZD A;  2FGR A;  2POR A;  2XTQ A;  2FGQ X;  3AA0 A;  3O0E A;  3SY7 A;  4AKR B;  2J1N A;  4CTD A;  4FES A;  4U9C A;  1YS5 A;  1GFM A;  1Q9G A;  4GCQ A;  1ZHY A;  4FOZ A;  2ERV A;  4KR8 A;  3TZG A;  3UAQ A;  1ORM A;  2AXT O;  5DL7 A;  3T24 A;  5T5F A;  3QRA A;  4AYE C;  1ZHZ A;  4FRT A;  2XMX A;  4FZL A;  2R4L A;  4N59 A;  2ZFG A;  3AA0 B;  4O3Z A;  4BUM X;  1GFP A;  5JDP A;  2M06 A;  2WJR A;  1H6S 1;  3LK2 A;  2M07 A;  3SZV A;  3LK3 A;  3VZU X;  3WI5 A;  3EMN X;  1MM5 A;  3DA3 A;  3JTY A;  1Q9F A;  4O4U A;  2K0L A; 
#chains in the Genus database with same CATH homology
 5DL5 A;  3V8U A;  1ZHX A;  3QRC A;  4LSH A;  3LK2 B;  1QJP A;  2GE4 A;  3LK3 B;  3VY8 X;  4FUV A;  4FMS A;  3AA6 A;  3AA1 B;  1MPF A;  1G90 A;  3POU A;  4FT6 A;  3AAE B;  3PQU A;  4AZL A;  3WI4 A;  3POX A;  4O3X B;  2QTK A;  2ODJ A;  4RLC A;  4N58 A;  4JFB A;  4RL9 A;  5D5D A;  1HXT A;  2LHF A;  3AA6 B;  4JCH A;  4E1T A;  4Z3T A;  7PRN A;  1PRN A;  2Y0L A;  3SY9 A;  4D5U A;  3HW9 A;  3K19 A;  4KR4 A;  1QJ8 A;  3GP6 A;  4O3W A;  4RJX A;  3HOE A;  2X27 X;  3RBH A;  5AFU L;  2Y2X A;  4FZM A;  3AA7 A;  2Y0H A;  3HWB A;  2F1V A;  2YNK A;  5DL6 A;  3VZW X;  2XE3 A;  1E54 A;  1QJ9 A;  5DL8 A;  2KXP A;  2MHL A;  3AA7 B;  5AFU K;  2XE5 A;  1BXW A;  4C69 X;  1OPF A;  2OMF A;  2XG6 A;  3NSG A;  4AYI D;  3UU2 A;  2JMM A;  2MNH A;  2ZLD A;  4D64 A;  1MM4 A;  5IYU A;  1IZN A;  4QQ1 A;  5PRN A;  1GFO A;  2KC0 A;  2J4U P;  4FZN A;  1GFQ A;  2KZ7 A;  2N2L A;  2Y0K A;  3C5O A;  5ADX K;  4AYN A;  8PRN A;  3VE1 A;  4AUI A;  4O49 A;  3AAA A;  4B61 A;  1IZN B;  1GFN A;  4G75 A;  3UPG A;  2W81 C;  2O4V A;  1BH3 A;  4AFK A;  2KZ7 B;  1PHO A;  4AKR A;  2YPV A;  4GHB A;  2PRN A;  3G7G A;  4GCS A;  3VZT X;  4E1S A;  3PQS A;  3POR A;  1HXU A;  3AAA B;  3FYX A;  6PRN A;  4LSE A;  5G26 A;  5FVN A;  4LSF A;  5ADX L;  5GV0 A;  4GF4 A;  4GCP A;  2K4T A;  3T20 A;  4D65 A;  3SYB A;  4FSP A;  4O3Y A;  4FSO A;  1P4T A;  2KXP B;  2XE1 A;  4KRA A;  3HOL A;  4XNK A;  4AKM A;  2W80 C;  3A2S X;  3KVD D;  4AYD C;  1ZHT A;  4RLB A;  3LK4 1;  3POQ A;  2KDY A;  3DA4 A;  2Y7S A;  3LK4 2;  4FRX A;  4G76 A;  4O4X A;  2F1T A;  3AA1 A;  5EE2 A;  3SYS A;  3VE2 A;  4PUX A;  4RJW A;  3AAE A;  1OSM A;  3T0S A;  2N2M A;  3PRN A;  2LFU A;  2XTR A;  4XNL A;  1BT9 A;  1THQ A;  1HXX A;  1ZHW A;  2XE2 A;  4AYM C;  4LSI A;  3VY9 X;  4F4B A;  3SZD A;  2FGR A;  2POR A;  2XTQ A;  2FGQ X;  3AA0 A;  3O0E A;  3SY7 A;  4AKR B;  2J1N A;  4FES A;  4U9C A;  1YS5 A;  1GFM A;  1Q9G A;  4GCQ A;  1ZHY A;  4FOZ A;  2ERV A;  4KR8 A;  3TZG A;  3UAQ A;  1ORM A;  5DL7 A;  3T24 A;  5T5F A;  3QRA A;  4AYE C;  1ZHZ A;  4FRT A;  2XMX A;  4FZL A;  4N59 A;  4O3Z A;  2ZFG A;  3AA0 B;  4BUM X;  1GFP A;  5JDP A;  2M06 A;  3SZV A;  1H6S 1;  3LK2 A;  2M07 A;  3LK3 A;  3VZU X;  3WI5 A;  3EMN X;  1MM5 A;  3DA3 A;  3JTY A;  1Q9F A;  4O4U A;  2K0L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...