1Q9GA

Nmr structure of the outer membrane protein ompx in dhpc micelles
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
148
structure length
148
Chain Sequence
ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKNDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of the integral membrane protein OmpX
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords Outer membrane protein X
total genus 12
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2003-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 1q9gA00
1Q9GA 1THQA 2GE4A 1BXWA 4PUXA 2MNHA 1Q9FA 3G7GA 2X27X 2F1TA 3QRCA 2K0LA 3C5OA 3GP6A 2N2LA 1MM4A 2JMMA 2F1VA 2M07A 2ERVA 3QRAA 1P4TA 1MM5A 2LHFA 4RLCA 1ORMA 1G90A 1QJ9A 2N2MA 2M06A 1QJ8A 2MHLA 1QJPA
chains in the Genus database with same CATH superfamily
5GTHO 5AFUK 2KXPB 2XTQA 4FOZA 4O4UA 2ODJA 2MNHA 5G26A 3SZVA 1HXXA 4AYMC 2IWWA 4FRTA 4O49A 3POQA 1Q9FA 3G7GA 3UPGA 3O0EA 3SY7A 2XE2A 1H6S1 4FZLA 5DL5A 4K3CA 4N75A 7PRNA 3AA0A 1IZNA 1S5LO 3JCUO 3KZIO 5E79O 4K3BA 2J4UP 1MM4A 2JMMA 4PJ0O 3DWNA 3VE2A 1E54A 2IWVA 3PQUA 1IZNB 3AA6B 3UU2A 4C4VA 3AAEA 3UAQA 3A0BO 5KAFO 1PHOA 2XE3A 4AUIA 5GTIO 4O4XA 2FGRA 2LHFA 4RLCA 4PR7A 1GFQA 3POXA 1HXTA 2KXPA 4B61A 4KRAA 2KC0A 2N2MA 5B66O 3AA7A 3DA4A 2Y2XA 1QJ8A 3AA1A 1QJPA 3NSGA 3SYSA 3T0SA 3JTYA 4LSFA 2WJQA 2YPVA 4C4VB 5JDPA 1ZHZA 3LK41 5PRNA 2YNKA 3AAAB 4GHBA 4RJXA 3SY9A 5G38A 4E1TA 4GF4A 4RL9A 3TZGA 3A2SX 2X27X 4D64A 3PGSA 2F1TA 2Y0KA 4JCHA 2XE5A 4AKRA 1OSMA 2PRNA 4IL6O 2O4VA 3DWOX 4FESA 3SYBA 2F1VA 1MPFA 3EMNX 2M07A 5G3AA 1P4TA 6PRNA 3T24A 5DL6A 5AFUL 3K19A 4RLBA 3VY9X 2WVPA 4GCPA 4LSEA 3PRNA 4D65A 5TISO 4AFKA 4N74A 1ORMA 3LK2A 1GFOA 1G90A 4UB8O 4FZNA 2OMFA 4LSHA 2R88A 1QJ9A 2KDYA 5EE2A 3BRYA 4O3YA 1Q9GA 1THQA 2GE4A 1BXWA 4FUVA 1GFMA 4C00A 3LK3A 4AYDC 4FQEA 4KR4A 5GV0A 3PF1A 4Z3TA 3SZDA 3NJTA 2KZ7B 2R4PA 2XMXA 3DA3A 3A0HO 4FZMA 2K4TA 3QRCA 3C5OA 4G75A 2W80C 3GP6A 3V8UA 4KR8A 4CTDA 5KAIO 5T5FA 2ZLDA 3T20A 2QTKA 3QRAA 3FYXA 4AYEC 1GFNA 2WJRA 2W81C 5G39A 2KZ7A 4AKRB 1BH3A 2R4NA 2R89A 5IYUA 3PGRA 2Y0HA 3WU2O 3VE1A 2R4LA 2XTRA 1YS5A 4FSPA 3LK2B 5B5EO 4O3WA 3PGUA 8PRNA 3HWBA 3AA1B 1HXUA 4QQ1A 5ADXL 5H2FO 3AA7B 3BS0A 4AZLA 4F4BA 4N58A 4RJWA 3KVDD 2F1CX 2M06A 1T16A 2X9KA 4LSIA 3POUA 2JQYA 2AXTO 4PUXA 3RBHA 2XG6A 4JFBA 2LFUA 2Y7SA 3VY8X 4UB6O 1ZHYA 4AYID 4D5UA 4XNKA 2PORA 3BRZA 1BT9A 3WI5A 3WI4A 1ZHTA 3AAEB 2K0LA 2ZFGA 3AA6A 1ZHXA 2N2LA 3HOEA 1PRNA 4E1SA 1T1LA 4FT6A 4FRXA 3VZWX 4N59A 4GCQA 3AAAA 2XE1A 2J1NA 5DL7A 2ERVA 3AA0B 3HOLA 3LK3B 4AYNA 1ZHWA 4BUMX 1MM5A 3PQSA 4FMSA 4O3ZA 4XNLA 5D5DA 4AKMA 1OPFA 2R8AA 3VZTX 4U9CA 5ADXK 2Y0LA 5DL8A 4G76A 4C69X 2FGQX 5FVNA 3HW9A 4GCSA 3VZUX 1GFPA 4O3XB 3DZMA 4FSOA 3LK42 2R4OA 2MHLA 3PORA
chains in the Genus database with same CATH topology
5AFUK 2KXPB 2XTQA 4FOZA 4O4UA 2ODJA 2MNHA 5G26A 3SZVA 1HXXA 4AYMC 3UPGA 4FRTA 4O49A 3POQA 1Q9FA 3G7GA 3O0EA 3SY7A 2XE2A 1H6S1 4FZLA 5DL5A 7PRNA 3AA0A 1IZNA 2J4UP 1MM4A 2JMMA 3VE2A 1E54A 3PQUA 3UU2A 1IZNB 3AA6B 3AAEA 3UAQA 1PHOA 2XE3A 4AUIA 4O4XA 2FGRA 2LHFA 4RLCA 1GFQA 3POXA 1HXTA 2KXPA 4B61A 4KRAA 2KC0A 2N2MA 3AA7A 3DA4A 2Y2XA 1QJ8A 3AA1A 1QJPA 3NSGA 3SYSA 3T0SA 3JTYA 4LSFA 2YPVA 5JDPA 1ZHZA 3LK41 5PRNA 2YNKA 3AAAB 4GHBA 4RJXA 3SY9A 4E1TA 4GF4A 4RL9A 3TZGA 3A2SX 2X27X 4D64A 4AKRA 2F1TA 2Y0KA 4JCHA 2XE5A 1OSMA 2PRNA 2O4VA 3SYBA 4FESA 2F1VA 1MPFA 3EMNX 2M07A 1P4TA 6PRNA 3T24A 5DL6A 5AFUL 3K19A 4RLBA 3VY9X 4GCPA 4LSEA 3PRNA 4D65A 4AFKA 1ORMA 3LK2A 1GFOA 1G90A 4FZNA 2OMFA 4LSHA 1QJ9A 2KDYA 5EE2A 4O3YA 1Q9GA 1THQA 2GE4A 1BXWA 4FUVA 1GFMA 3LK3A 4AYDC 4KR4A 5GV0A 4Z3TA 3SZDA 2KZ7B 3DA3A 2XMXA 4FZMA 3V8UA 2K4TA 3QRCA 3C5OA 4G75A 2W80C 3GP6A 4KR8A 5T5FA 2ZLDA 3T20A 2QTKA 3QRAA 4AYEC 1GFNA 2W81C 2KZ7A 4AKRB 1BH3A 5IYUA 2Y0HA 3VE1A 2XTRA 1YS5A 4FSPA 3LK2B 8PRNA 4O3WA 3HWBA 3AA1B 1HXUA 4QQ1A 5ADXL 3AA7B 4AZLA 4F4BA 4N58A 4RJWA 3KVDD 2M06A 4LSIA 3POUA 4PUXA 3RBHA 2XG6A 4JFBA 2LFUA 2Y7SA 3VY8X 4AYID 1ZHYA 4D5UA 4XNKA 2PORA 3WI5A 1BT9A 3WI4A 1ZHTA 3AAEB 2K0LA 2ZFGA 3AA6A 1ZHXA 2N2LA 3HOEA 1PRNA 4E1SA 3VZWX 4FT6A 4FRXA 4N59A 4GCQA 3AAAA 2XE1A 2J1NA 5DL7A 2ERVA 3AA0B 3HOLA 3LK3B 4AYNA 1ZHWA 4BUMX 1MM5A 3PQSA 4FMSA 4O3ZA 4XNLA 5D5DA 4AKMA 1OPFA 3VZTX 4U9CA 5ADXK 2Y0LA 5DL8A 4G76A 4C69X 2FGQX 5FVNA 3HW9A 4GCSA 3VZUX 1GFPA 4O3XB 4FSOA 3LK42 3FYXA 2MHLA 3PORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q9G A;  1THQ A;  2GE4 A;  1BXW A;  4PUX A;  2MNH A;  1Q9F A;  3G7G A;  2X27 X;  2F1T A;  3QRC A;  2K0L A;  3C5O A;  3GP6 A;  2N2L A;  1MM4 A;  2JMM A;  2F1V A;  2M07 A;  2ERV A;  3QRA A;  1P4T A;  1MM5 A;  2LHF A;  4RLC A;  1ORM A;  1G90 A;  1QJ9 A;  2N2M A;  2M06 A;  1QJ8 A;  2MHL A;  1QJP A; 
#chains in the Genus database with same CATH topology
 5GTH O;  5AFU K;  2KXP B;  2XTQ A;  4FOZ A;  4O4U A;  2ODJ A;  2MNH A;  5G26 A;  3SZV A;  1HXX A;  4AYM C;  2IWW A;  4FRT A;  4O49 A;  3POQ A;  1Q9F A;  3G7G A;  3UPG A;  3O0E A;  3SY7 A;  2XE2 A;  1H6S 1;  4FZL A;  5DL5 A;  4K3C A;  4N75 A;  7PRN A;  3AA0 A;  1IZN A;  1S5L O;  3JCU O;  3KZI O;  5E79 O;  4K3B A;  2J4U P;  1MM4 A;  2JMM A;  4PJ0 O;  3DWN A;  3VE2 A;  1E54 A;  2IWV A;  3PQU A;  1IZN B;  3AA6 B;  3UU2 A;  4C4V A;  3AAE A;  3UAQ A;  3A0B O;  5KAF O;  1PHO A;  2XE3 A;  4AUI A;  5GTI O;  4O4X A;  2FGR A;  2LHF A;  4RLC A;  4PR7 A;  1GFQ A;  3POX A;  1HXT A;  2KXP A;  4B61 A;  4KRA A;  2KC0 A;  2N2M A;  5B66 O;  3AA7 A;  3DA4 A;  2Y2X A;  1QJ8 A;  3AA1 A;  1QJP A;  3NSG A;  3SYS A;  3T0S A;  3JTY A;  4LSF A;  2WJQ A;  2YPV A;  4C4V B;  5JDP A;  1ZHZ A;  3LK4 1;  5PRN A;  2YNK A;  3AAA B;  4GHB A;  4RJX A;  3SY9 A;  5G38 A;  4E1T A;  4GF4 A;  4RL9 A;  3TZG A;  3A2S X;  2X27 X;  4D64 A;  3PGS A;  2F1T A;  2Y0K A;  4JCH A;  2XE5 A;  4AKR A;  1OSM A;  2PRN A;  4IL6 O;  2O4V A;  3DWO X;  4FES A;  3SYB A;  2F1V A;  1MPF A;  3EMN X;  2M07 A;  5G3A A;  1P4T A;  6PRN A;  3T24 A;  5DL6 A;  5AFU L;  3K19 A;  4RLB A;  3VY9 X;  2WVP A;  4GCP A;  4LSE A;  3PRN A;  4D65 A;  5TIS O;  4AFK A;  4N74 A;  1ORM A;  3LK2 A;  1GFO A;  1G90 A;  4UB8 O;  4FZN A;  2OMF A;  4LSH A;  2R88 A;  1QJ9 A;  2KDY A;  5EE2 A;  3BRY A;  4O3Y A;  1Q9G A;  1THQ A;  2GE4 A;  1BXW A;  4FUV A;  1GFM A;  4C00 A;  3LK3 A;  4AYD C;  4FQE A;  4KR4 A;  5GV0 A;  3PF1 A;  4Z3T A;  3SZD A;  3NJT A;  2KZ7 B;  2R4P A;  2XMX A;  3DA3 A;  3A0H O;  4FZM A;  2K4T A;  3QRC A;  3C5O A;  4G75 A;  2W80 C;  3GP6 A;  3V8U A;  4KR8 A;  4CTD A;  5KAI O;  5T5F A;  2ZLD A;  3T20 A;  2QTK A;  3QRA A;  3FYX A;  4AYE C;  1GFN A;  2WJR A;  2W81 C;  5G39 A;  2KZ7 A;  4AKR B;  1BH3 A;  2R4N A;  2R89 A;  5IYU A;  3PGR A;  2Y0H A;  3WU2 O;  3VE1 A;  2R4L A;  2XTR A;  1YS5 A;  4FSP A;  3LK2 B;  5B5E O;  4O3W A;  3PGU A;  8PRN A;  3HWB A;  3AA1 B;  1HXU A;  4QQ1 A;  5ADX L;  5H2F O;  3AA7 B;  3BS0 A;  4AZL A;  4F4B A;  4N58 A;  4RJW A;  3KVD D;  2F1C X;  2M06 A;  1T16 A;  2X9K A;  4LSI A;  3POU A;  2JQY A;  2AXT O;  4PUX A;  3RBH A;  2XG6 A;  4JFB A;  2LFU A;  2Y7S A;  3VY8 X;  4UB6 O;  1ZHY A;  4AYI D;  4D5U A;  4XNK A;  2POR A;  3BRZ A;  1BT9 A;  3WI5 A;  3WI4 A;  1ZHT A;  3AAE B;  2K0L A;  2ZFG A;  3AA6 A;  1ZHX A;  2N2L A;  3HOE A;  1PRN A;  4E1S A;  1T1L A;  4FT6 A;  4FRX A;  3VZW X;  4N59 A;  4GCQ A;  3AAA A;  2XE1 A;  2J1N A;  5DL7 A;  2ERV A;  3AA0 B;  3HOL A;  3LK3 B;  4AYN A;  1ZHW A;  4BUM X;  1MM5 A;  3PQS A;  4FMS A;  4O3Z A;  4XNL A;  5D5D A;  4AKM A;  1OPF A;  2R8A A;  3VZT X;  4U9C A;  5ADX K;  2Y0L A;  5DL8 A;  4G76 A;  4C69 X;  2FGQ X;  5FVN A;  3HW9 A;  4GCS A;  3VZU X;  1GFP A;  4O3X B;  3DZM A;  4FSO A;  3LK4 2;  2R4O A;  2MHL A;  3POR A; 
#chains in the Genus database with same CATH homology
 5AFU K;  2KXP B;  2XTQ A;  4FOZ A;  4O4U A;  2ODJ A;  2MNH A;  5G26 A;  3SZV A;  1HXX A;  4AYM C;  3UPG A;  4FRT A;  4O49 A;  3POQ A;  1Q9F A;  3G7G A;  3O0E A;  3SY7 A;  2XE2 A;  1H6S 1;  4FZL A;  5DL5 A;  7PRN A;  3AA0 A;  1IZN A;  2J4U P;  1MM4 A;  2JMM A;  3VE2 A;  1E54 A;  3PQU A;  3UU2 A;  1IZN B;  3AA6 B;  3AAE A;  3UAQ A;  1PHO A;  2XE3 A;  4AUI A;  4O4X A;  2FGR A;  2LHF A;  4RLC A;  1GFQ A;  3POX A;  1HXT A;  2KXP A;  4B61 A;  4KRA A;  2KC0 A;  2N2M A;  3AA7 A;  3DA4 A;  2Y2X A;  1QJ8 A;  3AA1 A;  1QJP A;  3NSG A;  3SYS A;  3T0S A;  3JTY A;  4LSF A;  2YPV A;  5JDP A;  1ZHZ A;  3LK4 1;  5PRN A;  2YNK A;  3AAA B;  4GHB A;  4RJX A;  3SY9 A;  4E1T A;  4GF4 A;  4RL9 A;  3TZG A;  3A2S X;  2X27 X;  4D64 A;  4AKR A;  2F1T A;  2Y0K A;  4JCH A;  2XE5 A;  1OSM A;  2PRN A;  2O4V A;  3SYB A;  4FES A;  2F1V A;  1MPF A;  3EMN X;  2M07 A;  1P4T A;  6PRN A;  3T24 A;  5DL6 A;  5AFU L;  3K19 A;  4RLB A;  3VY9 X;  4GCP A;  4LSE A;  3PRN A;  4D65 A;  4AFK A;  1ORM A;  3LK2 A;  1GFO A;  1G90 A;  4FZN A;  2OMF A;  4LSH A;  1QJ9 A;  2KDY A;  5EE2 A;  4O3Y A;  1Q9G A;  1THQ A;  2GE4 A;  1BXW A;  4FUV A;  1GFM A;  3LK3 A;  4AYD C;  4KR4 A;  5GV0 A;  4Z3T A;  3SZD A;  2KZ7 B;  3DA3 A;  2XMX A;  4FZM A;  3V8U A;  2K4T A;  3QRC A;  3C5O A;  4G75 A;  2W80 C;  3GP6 A;  4KR8 A;  5T5F A;  2ZLD A;  3T20 A;  2QTK A;  3QRA A;  4AYE C;  1GFN A;  2W81 C;  2KZ7 A;  4AKR B;  1BH3 A;  5IYU A;  2Y0H A;  3VE1 A;  2XTR A;  1YS5 A;  4FSP A;  3LK2 B;  8PRN A;  4O3W A;  3HWB A;  3AA1 B;  1HXU A;  4QQ1 A;  5ADX L;  3AA7 B;  4AZL A;  4F4B A;  4N58 A;  4RJW A;  3KVD D;  2M06 A;  4LSI A;  3POU A;  4PUX A;  3RBH A;  2XG6 A;  4JFB A;  2LFU A;  2Y7S A;  3VY8 X;  4AYI D;  1ZHY A;  4D5U A;  4XNK A;  2POR A;  3WI5 A;  1BT9 A;  3WI4 A;  1ZHT A;  3AAE B;  2K0L A;  2ZFG A;  3AA6 A;  1ZHX A;  2N2L A;  3HOE A;  1PRN A;  4E1S A;  3VZW X;  4FT6 A;  4FRX A;  4N59 A;  4GCQ A;  3AAA A;  2XE1 A;  2J1N A;  5DL7 A;  2ERV A;  3AA0 B;  3HOL A;  3LK3 B;  4AYN A;  1ZHW A;  4BUM X;  1MM5 A;  3PQS A;  4FMS A;  4O3Z A;  4XNL A;  5D5D A;  4AKM A;  1OPF A;  3VZT X;  4U9C A;  5ADX K;  2Y0L A;  5DL8 A;  4G76 A;  4C69 X;  2FGQ X;  5FVN A;  3HW9 A;  4GCS A;  3VZU X;  1GFP A;  4O3X B;  4FSO A;  3LK4 2;  3FYX A;  2MHL A;  3POR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...