1Q9UA

Crystal structure of uncharacterized conserved protein duf302 from bacillus stearothermophilus
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
128
structure length
126
Chain Sequence
AMFHYTVDVSTGMNETIERLEESLKQEGFGVLWQFSVTEKLQEKGLDFSTPMVILEVNPQEAARVLNENLLVGYFLPKLVVYQENGTTKIGMPKPTMLVGMMNDPALKEIAADIEKRLAACLDRCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein APC35924
publication title Crystal structure analysis of Zinc-binding, uncharacterized protein from Bacillus stearothermophilus
rcsb
source organism Geobacillus stearothermophilus
molecule tags Structural genomics, unknown function
total genus 42
structure length 126
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03625 DUF302 Domain of unknown function DUF302
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.70 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TT1751-like domain 1q9uA00
1Q9UA 1J3MA
chains in the Genus database with same CATH superfamily
2NOBA 1VOKA 2NWVA 2DKCA 2OOXA 5BMPA 1YQRA 1QNCA 1M5Q1 1QNEA 3KRMA 1KFIA 3PDKA 2EHBD 4C7PA 2Z8UA 1XSZA 1QTPA 1EBMA 3T4NA 4RODB 1VTOA 2R5XA 3PMGA 1N3CA 1KFQA 3OLPA 1P5DX 2HL8A 2I5WA 1T6AA 4Q11A 1C4GA 1KY7A 1LXTA 1RM1A 1W80A 1MPGA 3TE5A 2QLVA 2JHNA 3F10A 2NLVA 2ZFDB 3OCIA 4EALA 1VOLB 3F0ZA 5JMVD 2NOLA 3RPJA 2QR1A 1NVPA 1P5GX 3I0WA 1VTLE 1M3QA 2HKPA 3KTUA 1K35A 1FN7A 1C9BB 2NOIA 3CWSA 4EAJA 1QN4A 2YH5A 2Y8LA 3BKQX 3OSTA 1QN8A 1QNBA 1B9KA 3EAYA 3HS8A 4TPSA 1N39A 4QG5A 3H1ZA 1PCZA 1R4XA 1YQLA 4BJUA 1CDWA 3N89A 5F9CA 3CWUA 1M3HA 1PCJX 4IL8A 1YQKA 3ENOC 1QN3A 3IH7A 4EJYA 1C47A 5EPCA 4D7RA 2V9JA 3VN5A 1PVSA 2D0CA 3CVSA 4D7QA 1KO9A 4DULA 1LWVA 4PY5A 2O3OA 1PCMX 3TDHA 2NOEA 2FKFA 1AISA 1TUOA 4B0AA 1QNAA 4HJHA 5HSHA 3D7QA 2HL9A 3NA5A 4WXAA 2JPIA 1EUVA 1QN9A 3OH9A 3ASMA 1TBAB 1WQAA 2IV9A 2JOIA 1YTFA 3SNSA 1KY6A 1JDYA 1UL7A 2VJ0A 4MRQA 5AN4A 5KL0A 2NOFA 5IYDP 5BMNA 5IYBP 2FUVA 1MP9A 3CWAA 4I8OA 1JFIC 1LWWA 1KYUA 2D0AA 2H5AX 2DKDA 3DPUA 3RSMA 3UW2A 2JHJA 2NVMA 4CFFA 3OH6A 2QRCA 3C04A 1D3UA 1YQMA 2MZ8A 4WX8A 1WJWA 4EAKA 1DIZA 1Q9UA 1J3MA 3OSEA 1KYFA 1YTBA 2G30A 5IYCP 4ROEB 2IV8A 2NOZA 1TBPA 3ULXA 3OC3C 3I0XA 1QN6A 4EJZA 4EAIA 2QREA 3CWTA 2V8QA 3ENCA 1K2YX 3I3WA 1VKLA 3CW7A 1KYDA 1V5SA 3OSMA 2Y8QA 1HU0A 2HZMA 3D4VA 2Z0FA 1N3AA 3DPTA 1QN7A 2H4LX 1LWYA 1UT4A 4EAGA 4WZSD 2MJ7A 3HS9A 2FGTA 4ROCB 3OGDA 2QRDA 1NGMA 1QN5A 2DKAA 3CVTA 2LAEA 2NOHA 2D0BA 5JN5A 1NH2A 2V92A 2OOYA 1TGHA 1UT7A 1PZDA 2XHIA 1E42A 2HZSA 2YA3A 2FKMX 2F7LA 1QTSA 3EIKA 2PWWA
chains in the Genus database with same CATH topology
1Q9UA 1J3MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q9U A;  1J3M A; 
#chains in the Genus database with same CATH topology
 2NOB A;  1VOK A;  2NWV A;  2DKC A;  2OOX A;  5BMP A;  1YQR A;  1QNC A;  1M5Q 1;  1QNE A;  3KRM A;  1KFI A;  3PDK A;  2EHB D;  4C7P A;  2Z8U A;  1XSZ A;  1QTP A;  1EBM A;  3T4N A;  4ROD B;  1VTO A;  2R5X A;  3PMG A;  1N3C A;  1KFQ A;  3OLP A;  1P5D X;  2HL8 A;  2I5W A;  1T6A A;  4Q11 A;  1C4G A;  1KY7 A;  1LXT A;  1RM1 A;  1W80 A;  1MPG A;  3TE5 A;  2QLV A;  2JHN A;  3F10 A;  2NLV A;  2ZFD B;  3OCI A;  4EAL A;  1VOL B;  3F0Z A;  5JMV D;  2NOL A;  3RPJ A;  2QR1 A;  1NVP A;  1P5G X;  3I0W A;  1VTL E;  1M3Q A;  2HKP A;  3KTU A;  1K35 A;  1FN7 A;  1C9B B;  2NOI A;  3CWS A;  4EAJ A;  1QN4 A;  2YH5 A;  2Y8L A;  3BKQ X;  3OST A;  1QN8 A;  1QNB A;  1B9K A;  3EAY A;  3HS8 A;  4TPS A;  1N39 A;  4QG5 A;  3H1Z A;  1PCZ A;  1R4X A;  1YQL A;  4BJU A;  1CDW A;  3N89 A;  5F9C A;  3CWU A;  1M3H A;  1PCJ X;  4IL8 A;  1YQK A;  3ENO C;  1QN3 A;  3IH7 A;  4EJY A;  1C47 A;  5EPC A;  4D7R A;  2V9J A;  3VN5 A;  1PVS A;  2D0C A;  3CVS A;  4D7Q A;  1KO9 A;  4DUL A;  1LWV A;  4PY5 A;  2O3O A;  1PCM X;  3TDH A;  2NOE A;  2FKF A;  1AIS A;  1TUO A;  4B0A A;  1QNA A;  4HJH A;  5HSH A;  3D7Q A;  2HL9 A;  3NA5 A;  4WXA A;  2JPI A;  1EUV A;  1QN9 A;  3OH9 A;  3ASM A;  1TBA B;  1WQA A;  2IV9 A;  2JOI A;  1YTF A;  3SNS A;  1KY6 A;  1JDY A;  1UL7 A;  2VJ0 A;  4MRQ A;  5AN4 A;  5KL0 A;  2NOF A;  5IYD P;  5BMN A;  5IYB P;  2FUV A;  1MP9 A;  3CWA A;  4I8O A;  1JFI C;  1LWW A;  1KYU A;  2D0A A;  2H5A X;  2DKD A;  3DPU A;  3RSM A;  3UW2 A;  2JHJ A;  2NVM A;  4CFF A;  3OH6 A;  2QRC A;  3C04 A;  1D3U A;  1YQM A;  2MZ8 A;  4WX8 A;  1WJW A;  4EAK A;  1DIZ A;  1Q9U A;  1J3M A;  3OSE A;  1KYF A;  1YTB A;  2G30 A;  5IYC P;  4ROE B;  2IV8 A;  2NOZ A;  1TBP A;  3ULX A;  3OC3 C;  3I0X A;  1QN6 A;  4EJZ A;  4EAI A;  2QRE A;  3CWT A;  2V8Q A;  3ENC A;  1K2Y X;  3I3W A;  1VKL A;  3CW7 A;  1KYD A;  1V5S A;  3OSM A;  2Y8Q A;  1HU0 A;  2HZM A;  3D4V A;  2Z0F A;  1N3A A;  3DPT A;  1QN7 A;  2H4L X;  1LWY A;  1UT4 A;  4EAG A;  4WZS D;  2MJ7 A;  3HS9 A;  2FGT A;  4ROC B;  3OGD A;  2QRD A;  1NGM A;  1QN5 A;  2DKA A;  3CVT A;  2LAE A;  2NOH A;  2D0B A;  5JN5 A;  1NH2 A;  2V92 A;  2OOY A;  1TGH A;  1UT7 A;  1PZD A;  2XHI A;  1E42 A;  2HZS A;  2YA3 A;  2FKM X;  2F7L A;  1QTS A;  3EIK A;  2PWW A; 
#chains in the Genus database with same CATH homology
 1Q9U A;  1J3M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...