1QA4A

Hiv-1 nef anchor domain, nmr, 2 structures
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
56
structure length
56
Chain Sequence
GGKWSKSSVVGWPAVRERMRRAEPAADGVGAASRDLEKHGAITSSNTAANNAACAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the anchor-domain of myristoylated and non-myristoylated HIV-1 Nef protein.
pubmed doi rcsb
molecule tags Viral protein
molecule keywords PROTEIN (HIV-1 NEF ANCHOR DOMAIN (2-57))
total genus 1
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1999-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.890.10 Few Secondary Structures Irregular HIV 1 nef anchor domain HIV 1 nef anchor domain 1qa4A00
1QA4A 1QA5A
chains in the Genus database with same CATH superfamily
1QA4A 1QA5A
chains in the Genus database with same CATH topology
1QA4A 1QA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QA4 A;  1QA5 A; 
#chains in the Genus database with same CATH topology
 1QA4 A;  1QA5 A; 
#chains in the Genus database with same CATH homology
 1QA4 A;  1QA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...