1QAEA

The active site of serratia endonuclease contains a conserved magnesium-water cluster
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
240
structure length
240
Chain Sequence
IDNCAVGCPTGGSSNVSIVRHAYTLNNNSTTKFANWVAYHITKDTPASGKTRNWKTDPALNPADTLAPADYTGANAALKVDRGHQAPLASLAGVSDWESLNYLSNITPQKSDLNQGAWARLEDQERKLIDRADISSVYTVTGPLYERDMGKLPGTQKAHTIPSAYWKVIFINNSPAVNHYAAFLFDQNTPKGADFCQFRVTVDEIEKRTGLIIWAGLPDDVQASLKSKPGVLPELMGCKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The active site of Serratia endonuclease contains a conserved magnesium-water cluster.
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Endonuclease
molecule keywords PROTEIN (EXTRACELLULAR ENDONUCLEASE)
total genus 76
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature ec 3.1.30.2: Serratia marcescens nuclease.
pdb deposition date 1999-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01223 Endonuclease_NS DNA/RNA non-specific endonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.570.10 Alpha Beta 3-Layer(aba) Sandwich Extracellular Endonuclease; Chain A Extracellular Endonuclease, subunit A 1qaeA00
2XRGA 1ZM8A 3NKNA 4QN0A 5DLVA 5KXAA 5LQQA 3WAXA 4GTWA 1G8TA 5IJSA 4ZGAA 5GKCA 4ZG9A 3NKMA 5HRTA 3OWVA 5GKPA 3WAVA 4B56A 2XH3A 2XGRA 2O3BA 4GTYA 4QGOA 4E3YA 3NKOA 3WAWA 1QL0A 3NKQA 5DLTA 3ISMA 4GTXA 2XR9A 3WAYA 3NKPA 1SMNA 4QH0A 5DLWA 4ZG6A 4A1NA 5IJQA 4ZG7A 3NKRA 5LIAA 5L0KA 3S5BA 4GTZA 5L0EA 1QAEA 5L0BA 5INHA
chains in the Genus database with same CATH superfamily
2XRGA 1ZM8A 3NKNA 4QN0A 5DLVA 5KXAA 5LQQA 3WAXA 4GTWA 1G8TA 5IJSA 4ZGAA 5GKCA 4ZG9A 3NKMA 5HRTA 3OWVA 5GKPA 3WAVA 4B56A 2XH3A 2XGRA 2O3BA 4GTYA 4QGOA 4E3YA 3NKOA 3WAWA 1QL0A 3NKQA 5DLTA 3ISMA 4GTXA 2XR9A 3WAYA 3NKPA 1SMNA 4QH0A 5DLWA 4ZG6A 4A1NA 5IJQA 4ZG7A 3NKRA 5LIAA 5L0KA 3S5BA 4GTZA 5L0EA 1QAEA 5L0BA 5INHA
chains in the Genus database with same CATH topology
2XRGA 1ZM8A 3NKNA 4QN0A 5DLVA 5KXAA 5LQQA 3WAXA 4GTWA 1G8TA 5IJSA 4ZGAA 5GKCA 4ZG9A 3NKMA 5HRTA 3OWVA 5GKPA 3WAVA 4B56A 2XH3A 2XGRA 2O3BA 4GTYA 4QGOA 4E3YA 3NKOA 3WAWA 1QL0A 3NKQA 5DLTA 3ISMA 4GTXA 2XR9A 3WAYA 3NKPA 1SMNA 4QH0A 5DLWA 4ZG6A 4A1NA 5IJQA 4ZG7A 3NKRA 5LIAA 5L0KA 3S5BA 4GTZA 5L0EA 1QAEA 5L0BA 5INHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XRG A;  1ZM8 A;  3NKN A;  4QN0 A;  5DLV A;  5KXA A;  5LQQ A;  3WAX A;  4GTW A;  1G8T A;  5IJS A;  4ZGA A;  5GKC A;  4ZG9 A;  3NKM A;  5HRT A;  3OWV A;  5GKP A;  3WAV A;  4B56 A;  2XH3 A;  2XGR A;  2O3B A;  4GTY A;  4QGO A;  4E3Y A;  3NKO A;  3WAW A;  1QL0 A;  3NKQ A;  5DLT A;  3ISM A;  4GTX A;  2XR9 A;  3WAY A;  3NKP A;  1SMN A;  4QH0 A;  5DLW A;  4ZG6 A;  4A1N A;  5IJQ A;  4ZG7 A;  3NKR A;  5LIA A;  5L0K A;  3S5B A;  4GTZ A;  5L0E A;  1QAE A;  5L0B A;  5INH A; 
#chains in the Genus database with same CATH topology
 2XRG A;  1ZM8 A;  3NKN A;  4QN0 A;  5DLV A;  5KXA A;  5LQQ A;  3WAX A;  4GTW A;  1G8T A;  5IJS A;  4ZGA A;  5GKC A;  4ZG9 A;  3NKM A;  5HRT A;  3OWV A;  5GKP A;  3WAV A;  4B56 A;  2XH3 A;  2XGR A;  2O3B A;  4GTY A;  4QGO A;  4E3Y A;  3NKO A;  3WAW A;  1QL0 A;  3NKQ A;  5DLT A;  3ISM A;  4GTX A;  2XR9 A;  3WAY A;  3NKP A;  1SMN A;  4QH0 A;  5DLW A;  4ZG6 A;  4A1N A;  5IJQ A;  4ZG7 A;  3NKR A;  5LIA A;  5L0K A;  3S5B A;  4GTZ A;  5L0E A;  1QAE A;  5L0B A;  5INH A; 
#chains in the Genus database with same CATH homology
 2XRG A;  1ZM8 A;  3NKN A;  4QN0 A;  5DLV A;  5KXA A;  5LQQ A;  3WAX A;  4GTW A;  1G8T A;  5IJS A;  4ZGA A;  5GKC A;  4ZG9 A;  3NKM A;  5HRT A;  3OWV A;  5GKP A;  3WAV A;  4B56 A;  2XH3 A;  2XGR A;  2O3B A;  4GTY A;  4QGO A;  4E3Y A;  3NKO A;  3WAW A;  1QL0 A;  3NKQ A;  5DLT A;  3ISM A;  4GTX A;  2XR9 A;  3WAY A;  3NKP A;  1SMN A;  4QH0 A;  5DLW A;  4ZG6 A;  4A1N A;  5IJQ A;  4ZG7 A;  3NKR A;  5LIA A;  5L0K A;  3S5B A;  4GTZ A;  5L0E A;  1QAE A;  5L0B A;  5INH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...