1QB7A

Crystal structures of adenine phosphoribosyltransferase from leishmania donovani.
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
236
structure length
236
Chain Sequence
PFKEVSPNSFLLDDSHALSQLLKKSYRWYSPVFSPRNVPRFADVSSITESPETLKAIRDFLVQRYRAMSPAPTHILGFDARGFLFGPMIAVELEIPFVLMRKADKNAGLLIRSEPYEKEYKEAAPEVMTIRYGSIGKGSRVVLIDDVLATGGTALSGLQLVEASDAVVVEMVSILSIPFLKAAEKIHSTANSRYKDIKFISLLSDDALTEENCGDSKNYTGPRVLSCGDVLAEHPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of adenine phosphoribosyltransferase from Leishmania donovani.
pubmed doi rcsb
source organism Leishmania donovani
molecule tags Transferase
molecule keywords ADENINE PHOSPHORIBOSYLTRANSFERASE
total genus 69
structure length 236
sequence length 236
ec nomenclature
pdb deposition date 1999-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qb7A00
1IBSA 1LH0A 5BQPA 4JITA 1DQPA 1Z7GA 1GRVA 5JSQA 1NONA 3EFHA 4RADA 1UFRA 3OZFA 1QCCA 2HCRA 1TC2A 2WNSA 3MJDA 4WN3A 3DAHA 1UPFA 4M0KA 2XBUA 1A97A 1TC1A 1R3UA 2H08A 2JKYA 3M3HA 4P3KA 1BD4A 5IPFA 3MBIA 1O57A 4RV4A 4F8EA 1HMPA 2GEBA 5EUCA 1QB8A 1ZN7A 4M0UA 1A4XA 1U9ZA 2VFAA 2PRZA 3HVUA 4LYYA 1DQNA 1XTVA 1J7JA 1NULA 1OPRA 1PZMA 4QYIA 4QYIB 1DKUA 5BRNA 5BSKA 1P18A 2JKZA 5ESWA 2PRYA 1P19A 2EHJA 4RAQA 1A96A 1I5EA 4RANA 4RACA 1OREA 2JI4A 4RQBA 1QK4A 1P4AA 1QK5A 4RHXA 3ACBA 1G2QA 4P84A 4P82A 1I13A 2YZKA 1QK3A 4RAOA 2FXVA 1A95A 1ECGA 3LPNA 3GEPA 1JLSA 1BD3A 1V9SA 4JLSA 4OHCA 5ESXA 3KB8A 1VSTA 1G9SA 1ZN8A 4FYMA 1ECBA 1AO0A 1OROA 4KN6A 5KAPA 1ECCA 5JV5A 2H07A 4RABA 4MB6A 2H06A 5E38A 1A98A 3OZGA 1STOA 4P81A 1ECFA 4P86A 1YFZA 1G2PA 4PFQA 4ZFNA 5IAOA 1FSGA 4QRIA 4LZNA 5BQOA 1DBRA 1DKRA 1ZN9A 4WMLA 1CJBA 3QW4B 4RHUA 1L1QA 4LZOA 2IGBA 3DMPA 4M0PA 5HKLA 3S5JA 1QB7A 3GGCA 4LZAA 1I0LA 1HGXA 4P83A 4RHYA 4X45A 4RQAA 4PAWA 1XTUA 1XZNA 3GGJA 4TWBA 3LRTA 5HIAA 1MZVA 5K51A 1A3CA 1O5OA 2DY0A 1QCDA 3O7MA 1I14A 1VCHA 1XTTA 3H83A 3OHPA 4Z1OA 2JBHA 5KAMA 3N2LA 1U9YA 1L1RA 1I0IA 1XZ8A 2E55A 1JLRA 1UPUA 1P17A 1D6NA 1ECJA 1VDMA 1WD5A 2AEEA 2C4KA 4LYGA 1W30A 2P1ZA 3G6WA 1Y0BA 1BZYA 3ACCA 4RHTA 3DEZA 4P80A 2PS1A 3ACDA 4IJQA 1GPH1 4X44A 1G9TA 4S2UA 3NAGA
chains in the Genus database with same CATH superfamily
1ZRSA 3EZ7A 5B1HA 4QJ4A 4DPMA 1O08A 2O7QA 1GKLA 4NX2A 2C7BA 2ZIWB 2BDEA 2IY9A 1PJAA 4RHFA 1UR5A 2P9HA 3I2HA 5C8YA 4X95A 4BFUA 3AR8A 4WA7A 4HDSB 1U0NA 1RIIA 5ANRB 4ENRA 2DT8A 2B7LA 3MWDA 4Q9AA 1P5FA 4NRDA 5G3YA 3TGWA 3ZE6A 1DQRA 1JJ7A 1JJFA 1S7GA 1B3RA 2Y1LA 2EBHX 2GN1A 1XNJA 3R3YA 5CA0B 1M66A 4XUDA 5EXXA 3GFPA 1A4RA 3U3XA 4RVGA 4R40A 3DEIA 4XEUA 2ZZNA 1DRWA 4TWJA 4L9WA 5ITWA 1VYHA 3QFTA 1HEYA 2KPOA 3E9ZA 3A4LA 4LX8A 4BZXA 2J6BA 4B6OA 3W2HA 3G17A 3CVXA 3TW6A 2VXOA 3ZD7A 1QQ5A 3JYHA 3W04A 1C4XA 3FN4A 1KNQA 4MS4A 3SX0A 3HO8A 2ZYWX 3JR7A 3U9LA 1XK7A 5IKMA 3KXDA 4NZZA 4HSEA 3U44A 1E4YA 1FQKA 3N8DA 1M0TA 3WY9A 2PU5A 2X15A 3UC9A 1SKYB 3S3TA 3CTMA 4RQBA 1RIFA 4UKDA 5EYPB 3OA0A 3VDRA 4Y1FA 2HBYA 1R5BA 3BMQA 3G13A 4PSVA 1T1JA 4UVIA 4DLYA 1C14A 4DZRA 4YUXA 5DHAA 4ZYZA 2Q2NA 1KO8A 3B8HA 1W2GA 2YQ4A 3LVQE 1Y98A 2H6EA 3NHJA 1C0LA 1E2IA 5EKUA 5HPYB 3UJ6A 4YAKA 5JCJA 4BNNA 4CJXA 3FJYA 1XPUA 4MINA 4BFLA 5EINA 3OEEA 3MM4A 4NK4A 3TB6A 1RLMA 3DOJA 1NXVA 3F0TA 2YYAA 1GR0A 3JQAD 4K87A 4TQAA 3QV1A 4TZTA 4BUZA 4F5WA 4C6TA 4RUKA 5JV5A 4NAVA 4J0IA 3ZXSA 1YS6A 2WAOA 1GUDA 4MQBA 5FDFA 5AVSA 2JEZA 4U1RA 1V96A 4LX0A 2H5LA 5ED4A 2PD3A 2C9YA 5EJ2A 4K9KA 4KQMA 4MV0A 2HV9A 4OYRA 2F8SA 3A11A 1VG1A 3CONA 4IQ0A 1W9MA 4I2NA 1Q95A 2ZJ7A 5AVWA 5HHTA 1V5WA 3S2GA 3AEQB 1KI7A 1CJBA 2M9MA 5EFOA 5K1ZA 3UH1A 2YJGA 5DK4A 5AI6A 2BFFA 3LUGA 3IVAA 2D13A 5A06A 3QOFA 4PF1A 2NNWB 2XUQA 3G8AA 1Z35A 3FHJA 1F3LA 1GKKA 2Q8NA 2DULA 4HAZA 1Q0RA 3TK1A 4V38A 4GOXA 1KR5A 2FSVA 2CLMB 1GGNA 1VFNA 1FX0B 4RXTA 5EPUA 3UV7A 1DRJA 5L9AA 4HNQA 3CWZA 4CM9A 5JAHA 4IQ4A 4MP3A 4ZVUA 2I91A 3PE6A 2ZP1A 4XSVA 2WG2A 1N3LA 3DB2A 1QIMA 4QC2A 4KE7A 4C7OB 4DV3B 3WKCA 1ZGJA 3BL8A 2V55B 3STUA 4EW2A 3OAAA 5BW4A 1MIHA 1PJRA 1JT9A 1XMIA 1V8BA 1Z7BA 2ZI9A 4O5AA 1BCRB 3RSGA 1Z38A 3QVJA 1CVRA 2IU3A 5FOQA 1LPPA 5LOVB 4QBKA 1JR3E 1SU6A 4KUEA 4KH0A 1VE5A 2IF2A 2O8EB 1ICEA 4N3AA 5G41A 3ZXXA 4BB5A 8ABPA 2A33A 4BVJA 2VP2A 1BKYA 1W2WB 4QVGA 3LDHA 5LB4A 4R7ZA 2VF7A 2P7IA 1K4MA 3JYQA 5DT9A 4X8OA 2ZT8A 3UKJA 1HT1E 1SHZA 1ZSVA 3EUWA 2A4KA 3KYIB 4RPGA 1A8HA 4J7AA 2V0CA 5DTQA 4B6SA 4IOMA 3B1KA 9GPBA 2C0PA 3H13A 3BGSA 2DFLA 3C74A 2BMEA 4DLUA 3ABQB 1SN7A 1KH2A 3E23A 2XMPA 3G0OA 1Q77A 1FDSA 3IJPA 3O8LA 4UBOA 3RS5A 1X1SA 1VJGA 3SC4A 4BEWA 2YV2A 4XD2A 1RYBA 4HI0E 2YJ6A 5DISB 2JGJA 1EM6A 2SBTA 3H87A 5HJ5A 1Y1TA 4MARA 2J5BA 3NP9A 4HATA 1LRLA 2B35A 3K16A 3R5TA 4KKXB 1C3JA 4AJKA 4DLKA 1EWRA 1SCNE 5DSXA 1C9EA 5IJWA 1Z5GA 3DVLA 2EGGA 2ZSIA 2Y1OA 1NQOA 1WSAA 2JI7A 5CCBA 1Z6XA 4LYJA 2V96A 1U2GA 2JZCA 4QFBA 1VM6A 2MSDB 5ADVA 1VPDA 1I1HA 2QD5A 2Z1DA 5JMTA 1LTHR 2I54A 2ID7A 3OLZA 2ZULA 3O4HA 5AM1A 5HOQA 2O7NA 2OLKA 4LCJA 1UQRA 2W2XA 2HIHA 2XUZA 5TMEA 1LBIA 4A6PA 4B32A 1IHPA 2EX4A 4K0KB 1WUKS 1MJHA 1ZNYA 1E3WA 2R1ZA 2YN2A 4GX1A 1MTZA 2QKYA 2I76A 4CKZA 3V8VA 3OQ1A 2OXTA 3JPYA 4I36A 4FLFA 4TWZA 3MOSA 4DRZA 3GLSA 2XVZA 5KTTA 3SOZA 1AMNA 2A0WA 2EBWA 1RCTE 3S0JA 2VJMA 1J6UA 2OP0A 3AV3A 2VYVD 1MIOB 2XSZD 4KK4A 1GQYA 2CCGA 2P6NA 4UAUA 4C0LA 4DNOA 3H2BA 4EQ6B 1IWPB 5AKLA 4EEZA 2XVXA 3KJGA 3PJFA 1XWFA 3DZDA 3EFEA 3LRPA 3OQIB 1CUJA 1IMJA 3LKVA 1K08A 1A2KC 1AKEA 1W6RA 2PL1A 1V16A 2V7QA 3EF0A 3H9GA 4N5MA 4KPFC 3ZW8A 4EHIA 4S24A 3BFPA 5TC4A 5LJLA 4CR6A 1CUDA 1U1IA 4R54A 2GBIA 5EMNA 3COYA 4WY8A 5A3SA 5T3UA 3ZDRA 5BQFA 1MO2A 3CMMA 1GG8A 3LQ2A 5AOAA 1ZIDA 2AQ8A 3C7KA 4QJ3A 5KEIA 1EBUA 2QAGA 5D1NA 1ML4A 1PU2A 1U8XX 3KKOA 3NH9A 5TDHA 3T34A 3VYUB 4E3WA 4EP1A 1ZRHA 1BWPA 3AF0A 3IUBA 1I0IA 3G8CA 3FWYA 3HFJA 3OT1A 1JS1X 4KTTE 5FI0B 3IH5A 4GM4A 5FT9A 3G1WA 1GNLA 1REQA 2D1YA 1N2GA 4HDOB 1ZWKA 2H92A 3F6RA 4X1KA 5FI5A 1IWOA 3T52A 2E82A 4PX2A 1OLUB 1P9WA 5CW1A 3MB5A 1MO3A 4YJHB 3ZDDA 4DTCA 2GCPA 3RIMA 3K8QA 3OE4A 1ETHA 3LTEA 1QHFA 3B1WA 5FWDA 4BNWA 2IPMA 4JOBA 1EA5A 2DEUA 4X44A 1LUAA 2C31A 1A8UA 1D1QA 4FBMA 4TRJA 5CITA 1HEIA 2ASEA 2CMGA 2Z8ZA 3C3WA 1MJGA 4BCBA 4ZQCB 4KNYA 1NU8A 4WFQA 4M8KA 2VKTA 5I5GA 3RFCA 3T7KA 4ND2A 4DILA 3K0HA 1C9JA 1CDDA 3HU2A 5H3LA 3JZFA 2BGNA 4G23A 4WY2A 3FR8A 2AJBA 2EIHA 5AVTA 1KJ9A 1TGYA 4WN3A 1FNCA 1G7RA 3EPHA 3GAFA 4IIYA 5IH3A 2PDAA 5EUQB 2FPUA 3ANTA 4GM0A 4IKPA 4YREA 2FJPA 3F97A 2VJPA 3GWZA 4GOMD 5GV8A 2G71A 5KHLB 4PGAA 1KKMA 1J1ZA 4BFCA 1YVEI 2HMVA 1GYRA 2ZSUA 3SYTA 4WNAA 3N0VA 4G97A 3SC3A 4J2TA 2Y1KA 4J76A 1EFLA 1PSDA 2GN2A 4V0RA 4DPLA 3CVJA 2D5AA 1P18A 1YIDA 4H7HA 3WOHA 4RAQA 4HVTA 1ONPA 3JZMA 2FMKA 5JMPA 2OG1A 2PFKA 2XVYA 3L0YA 5AKXA 4M1MA 3X1MA 1D5WA 3OJLA 4LJYA 5L6LB 3MGGA 1BWQA 1SEPA 1AGRA 2VDRB 5J9FA 3X3HA 1NGSA 1I2DA 3QEOA 5EWMB 2VR1A 3LJKA 1F12A 3WGMA 4B31A 2HA0A 2F3QA 2IWRA 2ZRNA 3TVYA 2V1XA 2HDNB 3EUEA 4ZGBA 2DFVA 2FN3A 3U48A 1GTJ1 2IPOA 1X0VA 3ZE9A 2JFOA 4DDWA 6CHYA 2WY2D 2XKKA 4KR7A 4O4LB 2VAVA 2BWJA 4CQLA 1OT3A 2IOFA 4BL5A 2PMBA 5KQSA 2OZEA 1NI3A 2QM8A 2X1MA 2G77B 2VDQB 2YOHA 4LXTA 3RH0A 3FW1A 3ESZA 4QOGA 3EEIA 5CDFE 2H07A 2HNBA 3DMTA 1V4BA 3T0FA 3SJAA 3C7DB 4EG7A 3IEUA 3H9CA 4LPSA 2BUBA 3S2IA 4QXPA 3N0WA 2CLOB 2ZYAA 3TRJA 4ER0A 4AXXA 4NV3A 5CW2A 1Y8ZA 4ZEVA 3UJ3X 1E1KA 3ZHCA 3NFYA 2DRIA 1L4EA 4FXOA 2LCIA 4MDYA 3T94A 1J2JA 4OP3A 1T36A 2WFLA 3VV2A 1K06A 3CZ4A 1TKBA 4PZCA 1WWKA 1BGWA 1M2VA 2QSYA 3IHWA 4AULA 1VYUA 4Z0HO 3LPMA 4MO9A 4J0QA 3G0CA 1RQPA 5JLJA 1XJCA 3PVZA 5DX1A 4DSZA 3GT4A 4UHBA 1LJUA 1QHIA 2YS6A 3BORA 2LRHA 3IKJA 3M6VA 5DHTA 3VI4B 1K27A 1VZ2A 3K72B 4OYLA 1OE0A 1CNFA 2J9GA 1WB6A 3ETDA 4CCAA 4FPXA 3RU3A 3T41A 1OGJA 2J09A 4O08A 3AUSA 2BGUA 4KBFA 2UZ3A 4CQJA 4UU7A 1AOXA 1KOFA 1GSOA 4KU4A 1YRBA 3OCYA 3EVEA 2VZ8A 4W5JA 5P21A 4EX7A 3RAPR 5FUQA 4BQRA 3CINA 1G5RA 3WICA 3OQIA 1JHAA 1R37A 2IXGA 4C0HA 1Z2CA 1JDPA 3HCRA 5TVGA 1OX4A 2IZ6A 4MV9A 3OE1A 3SQDA 4CV3A 5K4HA 2PUEA 1NYRA 2HIGA 4MH0R 4XWTA 3RNOA 4Q4AB 4RELA 1JT2A 3BTOA 1RW4A 1CUGA 2WWRA 4QJIA 5FO1A 4XRGA 2R6JA 4EEKA 3AILA 3AJAA 4DIMA 1GPKA 2WJ6A 3CEAA 3FBWA 1RXIA 1F6WA 1HQKA 1V95A 4KLRA 1AQJA 2WQZA 2Z0MA 3EGEA 3GIDA 5K4GA 2ENUA 4HWKA 5FUXA 2E85A 5BSEA 4TZKA 1OBFO 1NM5A 4OYYA 3B70A 1K5HA 3EIOA 4GR9A 1OVGA 3T5GA 1JHQA 2DLCX 3OT4A 4OQQA 4FGUA 4RM2A 2C92A 2R8OA 3CZQA 5JPCA 5I8ZA 1MF7A 1C8KA 2P4SA 1T2EA 2BMJA 2HJGA 3KD3A 3MCUA 4IR7A 3FF4A 1SC3A 2Y2VA 4AAYA 3O74A 5ALYA 1UKYA 4CT5A 5BWNA 1J5EB 4AN1A 2W90A 3GMSA 1F8XA 1WV1A 4ZPXA 1T29A 2X42A 1U7TA 2OO3A 4AD8A 4DF3A 4LJ8A 1TVCA 3EXHC 3WADA 1Y1KE 3CW8X 3PKJA 3T8YA 2Q5LA 3P52A 3Q0TA 3WL4A 3HSSA 4LHSA 3H65A 3IB3A 4TYPA 2Z6VA 4EJSB 5KX5F 2Q1SA 4RTKA 2I4RA 4RTMA 1A5AB 2AEFA 4HDMA 3GEEA 2VP6A 3E7XA 5PNTA 4OU5A 4LSMA 5A5DA 1JEAA 4CF5A 4IQ8A 3EXG2 1EIZA 4EJFA 2JFBA 2XIQA 3BXGA 5HQ3A 3D7MA 3IUYA 3Q4GA 2O8DA 2GESA 4Y1RA 3Q8LA 1UJMA 3PDJA 5LZ9A 1SBQA 4YO8A 3G0GA 2G4CA 3P4XA 4NF2A 2JJ1A 2MTBA 5JTUA 4YMHA 5SY9A 3W5JA 3NBAA 4OQMA 1DG9A 1AIPA 2AOUA 1JYFA 3C0KA 3K7EA 4GYWA 3TZLA 4ZZ3A 1DCTA 1Y3DE 1KJIA 4NJMA 5J23A 2PKXA 2YUIA 2ZTSA 3T15A 3FPJA 3N70A 2W5UA 3SZGA 1SQFA 4H4CA 4GC9A 2IPXA 2AMYA 2C04A 2CYAA 3G9ZA 4GR5A 4JQOA 4C0JA 2H7VA 3ITDA 1TCBA 2H4WA 1FTGA 2NZ2A 5GGYA 3QW4B 3W1VA 5AMXA 1GCAA 3EVTA 3HR8A 3TTYA 5I4KA 1VPWA 3FPSA 1W93A 1VXOA 4C78A 3TVDA 3MUNA 4K1LA 3GARA 3LHSA 4UEKA 5EESA 4EW3A 4D0SA 4LJSA 3HVKA 5LZ4A 4HEJA 1U65A 2BSXA 2GFQA 2IQIA 4IXNA 4URHA 5FL7D 1G21A 4PZDA 2ZWOA 3QVVA 4PANA 4ZQHA 2QRMA 3T3DA 1MB4A 1QWOA 4WINA 1N0VC 4CQMA 1QE0A 3C70A 1N3IA 2L2QA 1JNYA 2QTZA 5F1KA 3HB5X 5TPZD 4E03A 3GLIA 4P93A 4F60A 1D6SA 1VYTA 1JX6A 3HU5A 3NGLA 1L4KA 3ES9A 4MGIR 5BR4A 2IV3A 1F5NA 1E7QA 1N25A 2B21A 3AR3A 1M6NA 3NONA 3B78A 4LJ9A 4PC3A 2PS1A 4QD3A 4HGQA 1ZGCA 1DWQA 1WB5A 1WJGA 1BJRE 1X1DA 1ZUD1 1CUUA 3AQIA 4ERNA 1K7EB 1YR2A 1Y5IA 1ATIA 3DAPA 3DFKA 4MMXB 4NONA 1BE0A 1Z26A 3GAZA 3M9LA 3PNQA 3V4VB 4QGFA 3B3QA 1GQ2A 1CE8A 2MYUA 4D3XA 3V80A 4PZ9A 1C1YA 3GQBB 1Y6GA 4JBWA 1LPSA 4Q05A 3QWHA 1YL5A 4IDDA 4X8HA 5BSUA 4MICA 1V35A 2YX1A 4GXTA 5GINE 1W35A 2ON6A 2FLWA 2NYAA 4YVFA 5TQVA 2J9XB 1ILEA 3DL4A 3DOEA 5KI6A 1SVOA 5ICCA 1CDOA 2C1ZA 2FJ0A 3KKMA 3UZUA 2JLVA 1YASA 2FN4A 2QN3A 1U80A 4RLFA 3O92A 3WXBA 4BB6A 1MT3A 3TKAA 1AF4A 1L4UA 1DAEA 3K0CA 2B82A 1WTAA 3MW8A 3R3UA 1E2FA 1H5UA 1KKLA 4HWSA 1NT4A 1ONNA 3CKYA 1JBQA 4GL4A 4D56A 4DAEA 4E6EA 3O2JA 3UAXA 3AKZA 4AUMA 1QP0A 3U4AA 1A71A 2X23A 3V8RA 4BRUA 1ZVJA 8MHTA 4O5OA 4PLFA 4EK9A 4BRSA 4Z4IA 1FIUA 3HI6A 1DXOA 3LYAA 2HQ1A 1OR8A 1GNQA 4HUJA 1A8IA 1U0GA 5C7IO 5CCXA 1R8YA 1S96A 2EP5A 4L4SA 5EHZA 2E1PA 3VKHA 1FYDA 1QG0A 1T36B 1GY8A 3PHBE 4FFOA 4QULA 4A0HA 4D9BA 4NMMA 1XZFA 2GXQA 4OIMA 3WGOA 1O54A 4ME6A 2IL1A 1RVV1 2O3RA 2XQIA 4BX3A 4EW6A 1KYIA 3DOCA 2Q41A 3GG9A 3R5JA 3RRFA 3PNYA 4ARZA 2HWUA 4DC9A 5HKKA 2PJDA 3NXKA 1L7OA 1RJGA 4K9SA 4I4NA 1HEUA 4X5OA 2IKSA 2YWXA 3LO5A 4FNGA 3VNVA 5AW5A 5GIOE 1Y80A 2R65A 3I9MA 2DH5A 2I1WA 5TNXA 1P45A 2JW5A 2Y4NA 3TTVA 4DDTA 1EUZA 1MW9X 1K86A 2YRXA 3QU9A 2Q28A 1TM1E 4WZZA 3LLVA 4TTPA 5ELMA 3WRXC 1AQYA 1OA0A 4Q1AA 3AW8A 4A26A 1Q7RA 3H7AA 1CEQA 1FEZA 4QBFA 5KKAA 2BGIA 3KEQA 4RU1A 3VM6A 4UM9B 3FOCA 4WSOA 4C0AC 1JAZA 2W2KB 3MJTA 2O2XA 4K6MA 1UBJS 3B60A 4KDCA 3PI7A 3D6HA 1GADO 4JHLA 5AJVB 3ZIDA 3QKRA 5ICFA 4Y0AA 3UWDA 4GT1A 1LDNA 4PIVA 5TB5A 4C1BA 3AKYA 3KJHA 5BPHA 1RYHA 3CO0S 1VMEA 3GC6A 3L8CA 5K8CA 3BWXA 3WRWA 2OFXA 2BBOA 2JG3A 2VK2A 3OHPA 4KMSA 5GIPE 2JFYA 2ZI6A 2MYNA 1X19A 4A82A 3L8FA 3TMYA 1DJQA 2HDWA 2ZJBA 2V7TA 4REQA 1T6NA 4KRYA 5K8VA 2Q3CA 3REOA 4C30A 4AZSA 1UBEA 4CLOA 2F3UA 5K0FA 1X39A 2O52A 3BE5A 4AMVA 4IGEA 3OFKA 1G7SA 1FZQA 3W5HA 2SHKA 1DZIA 1JP7A 4XI9A 1X7ZA 3SYMA 3DPIA 5KWJA 1C80A 3U13A 4FMCB 2FMXA 1ZIOA 3O8DA 1R8XA 5BR8B 5IJ9A 2D59A 2Z4SA 2RAVA 3FKQA 4QQRA 3LSYA 2GF2A 3F6CA 4Y6OA 5IUJC 5ERYA 4QTYA 1PCXA 3AI7A 1K2VN 2WAXA 4CR7A 3I1IA 3P45A 4DUYB 2A84A 1QE3A 1OWPA 1NNI1 3FZNA 1P5ZB 4S3MA 4AX8A 2CEAA 1U9IA 2ZRGA 3RHFA 4DXAA 2JAHA 1EDZA 1UC5B 2J8ZA 4OSEA 1ZLXA 1VJRA 4FJ1A 1Q50A 3WV4A 1CIPA 2VHVA 3MJDA 4JI1B 4YX9A 1PVOA 4C7JA 2PGLA 2ABWA 1Q44A 3D6MA 1QDEA 3EUFA 5J2TB 2Z2JA 3T5CA 4V1CA 3DBRB 2LW7A 2AHOA 1Z8HA 2QDXA 2AK2A 4R0MA 4ZREA 5GOZA 1U2PA 1C0IA 1ZUHA 1NXQA 5BYKA 1DNPA 3PPYA 3HKEB 4COOA 4C2AA 1VKJA 3KB2A 2GNPA 4F4UA 3HCAA 3OEWA 1NV9A 2QX4A 3QEMA 1FTWA 4NS4A 4MUHA 4QU9A 4CUZA 3KFXA 2FWPA 4WXMA 2IS2A 2HMTA 1NBWB 1X0XA 1E99A 1MFPA 2QJWA 3ASUA 5HE8A 1QK5A 5JDIC 3FOEC 5KU7A 5LIPA 2ZB2A 3NVDA 1BAPA 1O87A 2BOVA 4QRHA 5F35A 3H0CA 3QBTA 2YZKA 1RPAA 5DBGA 5LR6A 4LBWA 4W82A 2V7VA 5AK3A 3OIGA 4OJNA 4B4VA 4CKYA 1NBME 5JD3A 1BDIA 5AQ1A 2X9GA 4BO9A 2V58A 2GKGA 3MT0A 4OLJA 4UTVA 3CUUA 3ADKA 1RYDA 2AKEA 1OROA 4UOEA 1GG9A 3F1KA 5EL0A 1P7WA 2YJTD 3G79A 4IYJA 1N6RA 4F4DA 1D0VA 3D7LA 4TXJA 3DEYX 5IEJA 1HDXA 2EAUA 2RIRA 1MORA 4OHKA 3ZNPA 2VT7A 1IULA 3NKFA 2JVKA 3OWOA 1Q7CA 2HNAA 3GP8A 1EVQA 2C9CA 3OCZA 3UA3A 3TOXA 3WWCA 3G3EA 4LOLA 1IBMB 1G1MA 2LIVA 1Y33E 1R5JA 4XYMA 3VZCA 4C2BA 5BMVB 5J5CA 3DLCA 5C5CA 3AEZA 4W6QA 5AK5A 1NG1A 4P5EA 4WADA 4PRYA 2A9VA 3N8KA 4EENA 1IBKB 1DTWB 3GRUA 2GERA 5HIAA 3Q72A 3UG6A 1U2QA 2DZDA 3U3ZA 3MTDA 4MP6A 1T9GS 3FNIA 1LFDB 3NDPA 4HGYA 4L0CA 4BLPA 1TJNA 3SSAA 5DNEA 3HPRA 1XD2B 4YHBA 5SZIA 1DAIA 1CNMA 5K8JB 3H11B 2H9YA 2AKYA 4B40A 3QJ5A 1YBHA 4BVKA 3RW9A 1DIOB 4MS1A 1WXQA 2H5IA 1W0KA 2JAXA 3M6UA 5P8WA 4KDFA 1GGKA 3A10A 5ITZA 2LIPA 3Q0EA 3HP4A 4RYLA 5K3BA 2DCUA 5I7OA 4UBMA 4BMVA 4A6DA 1QNLA 1XZGA 3CRMA 2PIDA 2PCJA 1KFJB 2FUG1 2RGEA 4XJXA 4CTNA 4OBEA 4HX5A 3PJRA 2DVMA 3PNOA 1QYDA 1G9TA 1WF6A 4BDSA 3RODA 2XOEA 2W37A 4NECA 2CB0A 1AXRA 2ERYA 2B1GA 2YYSA 2CVHA 4TSFA 3OTHA 4XXHA 2XUPA 3AYZB 3BK1A 4CMKA 4B79A 3A32A 4D9CA 2ZETA 2Z08A 3WLQA 1ZMTA 3GYBA 2AJ8A 2VL7A 1N5LA 2QYHA 3QX3A 3AERB 1I8TA 3BSWA 4C7XA 1LBSA 1ZD9A 4HY3A 1XN4A 6PFKA 2NXJA 2JKYA 4XWGA 2CL5A 1I7LA 4ID9A 3UMYA 1BSVA 4HF7A 4B84A 1A9XA 5H0IA 4YR9A 1PD0A 4CIYA 3COSA 4HH0A 1W85B 4JJAA 4XLZA 1CF9A 2FFHA 2Y76A 4HGPA 3HVUA 1DU4A 1HYHA 3H19A 4NENA 1X7XB 1Z37A 5B5SA 2D1QA 5J4LA 5KTPA 5FNZA 3DUFB 4HH1A 3V8EA 1U1GA 4EMUA 1VL5A 2P77A 2NO1A 5JAMA 4JI8B 4WKBA 1SU8A 1P19A 3KOWA 2QTNA 3UF0A 4D8TA 5ITVA 3NWPA 1SA0B 4LRSB 5DU2A 3H5TA 1F8YA 3KOMA 3VR6A 4JVSB 2NT4A 4G36A 1O6GA 4JFRA 3B9BA 4Q1CA 2HRZA 3H9JA 5FHQA 3ISVA 1IJEA 1R5OA 5IAJA 5FFMA 4TXNA 3USZA 1TZJA 1MAWA 4RJJA 4DJAA 3HA2A 5CB0A 3V8NA 2F8TA 2QRPA 1T6BY 1QK3A 1G66A 1EM8A 2C8KA 2WW8A 2XB6A 5DGCA 3SQLA 3VISA 1EDBA 2XYRA 1E92A 2QPOA 5IASA 1KZ6A 1LF5A 3KQSA 4UTOA 4XA8A 4YT5A 3VC2A 3TGLA 5K2OA 2V65A 3CUVA 4F2DA 1W4RA 4IF6A 5LMUB 3QI2A 4IIBA 4TV8F 2G25A 1NWHA 1PGPA 1W96A 2BD0A 1H23A 3NHWA 4NCIA 4P33A 3VVCA 3FH0A 5CYOA 1IYZA 1EK6A 3G0IA 3MBOA 1XXHE 3Q0IA 1BX0A 4HWRA 4RKFA 3UJAA 4EDFA 3KAJA 3QVMA 2WJZB 1CW2B 3MSXA 1JU3A 2NU7B 1L7PA 1FLNA 4EB8A 5I7FA 5JHHB 3E7PA 1M33A 4GUDA 1IRIA 4H7EA 3UHJA 1WBBA 2RAFA 3AFHA 3ICVA 3OQVA 5F4ZA 3V8QA 5KJFA 1VE1A 5CH8A 1K0FA 2YJ5A 3HDVA 4CLRA 2ADMA 3EXHB 4JI0B 4PQGA 1QMPA 4JJIA 2J6HA 1VGRA 4CQNA 2APJA 3L8YA 3PVCA 5IG2A 1CRZA 2JBAB 4WLUA 1KPGA 5TPWB 3ITKA 4PNZA 5F7OA 4MWGA 2JGIA 5EI5A 4F9EA 4L7VA 2G63A 3PL5A 3WWOA 1JEJA 5JXGA 3D1VA 3TCNA 4Z1OA 4XIJA 3WFJA 4H27A 3T1QA 1Z2DA 4ZMRA 2XNSA 4LSGA 2C2GA 1GHTA 1JQLB 2JJ8A 2Q45A 3L6UA 1JLHA 4TROA 3WDKA 3QF4A 5JSZA 2OC4A 2NO4A 4EMBA 2XCIA 3AHGA 1QE5A 4ZPJA 2P9EA 1CZLA 3BQNB 4CTJA 3HHEA 5HXAA 3AVWA 4JWTA 1FXUA 2CV2A 4I50B 1FFAA 2ZEJA 4RZ3A 3ICEA 1YULA 2LCFA 4PLZA 3WBBA 5CA0A 1EMDA 1SKMA 3L82B 3D3WB 3IVRA 3L7IA 10MHA 3F9CA 3A36A 2IE0A 3AM4A 1DBIA 4PE5B 4R8KA 5ALHA 3T38A 1JFSA 3CIFA 3HK2A 2BDUA 2OYRA 4QDTA 4CKBB 5JO9A 3UGJA 3K9BA 4XQCA 2V7XA 2YMLA 2ZXEA 4JOSA 3BWMA 2DQKA 3ND5A 3K0BA 4OU4A 4O8CA 1V39A 1GDHA 3JQAB 5G0WA 4CCYA 4JIMA 4RVUA 3JTMA 1AO3A 1X7YA 2X4LA 1TA9A 2VHWA 4CCWA 4W5OA 2AH5A 2I3AA 2Q5CA 2XBUA 4JHXA 2AXNA 2H08A 2RGNC 3LYUA 4R01A 5E1OA 3RYHB 2C95A 4ALIA 2ZS7A 3AB8A 4PV7A 1WDTA 2ETVA 4CLXA 1E5DA 1JU9A 2P67A 1MIOA 1Y3HA 3VR3D 3PEUA 3WFZA 3A58B 1LWNA 4KO8A 2PN1A 2XYPA 2GBPA 2GTPA 3HVIA 3PQFA 1QCYA 2OXEA 1WZ2A 3ZHUA 3G88A 1Y8CA 2PLWA 1PT9A 3EDYA 2E6UX 2VUHB 5IKEA 4V0LA 4MW2A 1XE3A 1SVUA 5B7PA 3WJAA 2A9KA 2X3UA 3FJ1A 5HCNA 1A27A 3CF4G 2XDYA 5BQ5A 4UUQA 3V4RA 3I52A 3BG5A 2X6QA 3N8GA 4S1OA 3ZR4B 2VN8A 2J30A 1G7TA 2VYNA 4KLCA 3BZWA 3T3IA 1AUOA 2FPRA 2NZUG 5CG2A 3Q1KA 3FTNA 3ORFA 5JNVA 3GIWA 2AFHA 5EJ5A 3C8DA 4JLSA 4UVGA 5EHXA 4PC1A 5LD2B 4H7PA 1N2CE 4HC4A 5ESXA 5AVYA 3CW9A 1N32B 1ZN8A 3KQTA 4ERXA 3SQNA 3THYA 4ANFA 2XRFA 1BVRA 3LT5A 2RKWA 2IKQA 1M7BA 1DKQA 1B8VA 3CLUD 3GJXC 1Z07A 1YZLA 5HZMA 5CX1B 1TQ4A 5DI3A 4B3JA 4D8XA 3FCUB 5JJBA 1U31A 5KTNA 4D99A 2BKEA 1B8UA 3H1EA 3S6JA 2DR2A 3RC2A 4E1VA 1ZLYA 4HX2A 1ZUWA 3WLIA 4G0VA 1N7JA 1C0KA 1OFVA 2R751 1ZX1A 3FIJA 5KNBA 2HMSA 2AA3A 5KYXB 1VP3A 2AXPA 2WG1A 2BLNA 3ZY4A 5CGZA 4RQAA 3JQGA 5DI9A 3ZHBA 3VC3A 5JEDA 4JP8A 3IELA 1G3QA 4K9PA 4HLDA 3F7MA 4ES6A 1JJVA 1RSZA 3H83A 4RETA 4Y9SA 3SC6A 4BLVA 3IJEB 5EJ6A 1MO6A 3HV2A 1N0IA 1NHGA 3F9RA 4XUCA 1X1RA 3R8XA 1YNSA 2AI3A 3BMCB 1D6NA 3CZRA 2A2ZA 1P60A 4GI2A 4EI9A 4QA9A 3ZDYB 1N1DA 3OE5A 4NARA 5CIYA 3KQOA 4AY2A 2ZE7A 2GPYA 5DYYA 5HILA 2QVLA 4PTZA 4BNXA 1Q91A 1F5SA 2PYDA 4LNAA 1Y3FE 4I7EA 4CKCA 4LBYA 5F76A 3QLTA 2H5EA 2VHQA 3WYEA 3HJAA 2VBGA 3TQTA 3EJWA 2WVAA 4MPPA 2ZI3A 4NYIQ 4IJQA 5L95A 2GGSA 3HN2A 5DCUA 4YWHA 3ZTWA 4I1SA 1NBMA 1YH3A 2C82A 2X2FA 1U04A 3WZLA 4YJGB 1KSGA 4F8YA 4OK3A 3TINA 1MXFA 4CG2A 2Q3BA 3P9XA 5DVZA 4D8YA 2JI6A 1CB0A 1EZ1A 3B3AA 1NAHA 1XR3A 2IYLD 2XMBA 4NMLA 3ZX4A 2FMTA 4R1LA 4OFXA 2WJ3A 3D6TB 1OIXA 1OASA 2JRLA 3B3GA 1ST2A 3REGA 3TX6A 5GM1A 2PKYX 1R6VA 5F64A 3A1UA 4WUTA 5FWAA 1IC6A 2O3SA 2X7HA 5DM2A 2BSQA 5IEBA 4DDKA 3BUSA 4YCCA 3OUTA 4JI5B 3HJHA 1ZK3A 4KYIB 3EULA 3FTDA 1J0AA 4BQOA 4Y1RB 5F5XA 4RDCA 4Z7NB 4DMLA 3VDXA 2QU7A 4X24A 2C2MA 2X4IA 3RC7A 4LV8B 4GE0A 3FAZA 3OTOB 1G42A 1XMOB 2DWUA 3AGPA 3FGPA 2JHCA 4HTFB 4KODA 4KXYA 5ARBA 4WTOA 4Z4GA 3TIVA 4DEVA 1K6XA 4HMQA 3IEMA 3UMVA 2ZVQX 1QFSA 1TK2A 4QPZA 5C32A 3EGXB 3Q6MA 4K6HA 2NU7A 2QIPA 1T43A 3E48A 4QPJC 1ZQ1A 1Q21A 4WUVA 2O8BA 1W5AA 1N1MA 2C5EA 2YN0A 1NDHA 3ET5A 1PS9A 3O8NA 3DMDA 2M6RA 4TLDA 5KDDA 2NXWA 2NSLA 3PX2A 4EY4A 2AJDA 1Z4NA 2BM0A 1J1IA 3V1NA 4LS3A 1H66A 4UZEA 3PWZA 3GBVA 2VF5X 3INYA 2DWCA 4KLNA 5BVHB 2PXXA 4NBVA 3RU2A 3HMKA 3C85A 3QUCA 3DONA 1REQB 3NDRA 4R16A 1YHNA 3HCFA 4NBWA 2G8NA 4EKGA 1N78A 2ACKA 3C8ZA 1Z4PX 4E2FA 5KPJA 4MQUA 1EFTA 5JCZA 2DPHA 3ETHA 5KYUA 4EDHA 4GX5A 4KRFA 1D8TA 3HJTA 4BEVA 1VGQA 4FI3C 4Z0NA 1FZTA 2WSYB 2PIAA 2C88A 3P97A 4QUEA 2PWPA 2PSJA 4FDTA 4YAWA 1F38A 3VDMA 3ABSB 4AQ7A 4CV2A 1S3SA 4H3KB 4A8JB 1U81A 4QRIA 1PFQA 3F98A 4JC5A 5EXDA 4A4DA 3GRVA 4NXNB 1M2OA 1LRJA 1RKUA 2XCLA 4WY5A 3RVOA 1AHHA 1PJCA 2NVBA 5H9VA 5EWJB 1RLIA 5JWOA 1T9ZA 1H2YA 1IHOA 1WCIB 2ZUDA 4RHYA 1RAGA 1SBYA 4R3UC 5D8DA 1WMDA 1HFEL 1MCZA 2YNMC 4XM1A 2VJNA 3TW4A 3GI1A 4DMRA 3VMFA 1Q3TA 2H4YA 3HN6A 1XQXA 1IEVA 3EZYA 3A2MA 1Y6FA 5JJLA 1A88A 5BWOA 4N3BA 5ER6A 3U0BA 1Y3CE 3M6FA 1CR0A 2XQKA 3BJRA 1FQJA 4IXMA 3M5DA 4L0MA 5H3HA 3RSLA 3OCUA 3D7RA 2ZB7A 3PQ3A 4N7JA 4CN8A 1DAGA 3S1AB 1D4AA 5FEMA 4NYJR 1ZJZA 3N8NA 4MRAA 4QOSA 4CMJA 4YMWA 3RRMA 5IFLA 2R5FA 4HKTA 2NZWA 2ZRCA 4UHJA 1RHUA 4MW1A 1M0EA 1P7ZA 2GBLC 4HPWA 4LWZA 4QO8A 4R1OA 1THTA 2Q5QA 1VLMA 3QPCA 3RTDA 3V8PA 1G3MA 1GO2A 1CY1A 2BONA 5I7VA 2FRDA 4ZOLA 4ZDWA 4D57A 1WP4A 1DEKA 2NV6A 5IT0A 5I51A 3ZZ0A 3AO0B 2J7KA 4C3ZA 2X86A 3IA7A 4FFPA 4F4HA 4CEJB 4IIJB 2ZLBA 2W2VA 4Q4JB 3SR0A 4UBLA 4EATA 3QBJA 1SCUA 3LQ4A 3VYVA 1ZIYA 3FGZA 4ASUD 3M6LA 1UXKA 4BQIA 4IDCA 5JYDA 2H63A 2RI1A 4O2AF 3WNZA 4C1NA 1EK1A 5EUCA 4EFNA 4XJTA 3I01M 4LF4B 3P19A 5KYXA 1P5JA 2B4AA 2V3WA 4W1RA 1I4TD 2PRZA 3NNDA 5ADUS 1SXJB 1XA3A 3LQ1A 1GPMA 3D6FA 1OV4A 5JS8A 5LYJB 3NOXA 4CIBA 1EBFA 4B74A 1NBEA 1PGQA 3PUHA 1RC8A 3O84A 5L3SA 4L5AA 5E0OA 3Q8KA 5DI3B 2A59A 1TJ5A 1JQJC 4H6VA 3RAEC 3HPQA 3LUPA 3LHKA 3E8MA 4DA8A 2PS0A 1ETUA 3WHPA 3T9CA 2FPLA 2PT5A 4ZYLA 1SD2A 2GK6A 3C16C 4YRTA 1LZLA 3C3EA 3URKA 3ZU5A 3C6KA 4Z1MA 2ACWA 3M6AA 4OQPA 4BOYA 5L7WA 2P9FA 2C42A 1FJHA 2GEKA 4Z3KA 3HEBA 5T6BA 4DLWA 2YINC 4NPCA 4O63O 3OQOA 4XDGA 3Q40A 1V9SA 3E9DA 4HL6A 3CLSC 1SKBA 5IDVA 3PXUA 5FBRB 4U39A 4AKHA 1QH8A 3DNPA 1YBMA 5B12A 2WJYA 1YQGA 1VG8A 4GI7A 1K0UA 2V0NA 1FFXB 1JDSA 3GUVA 4O4IF 5C8DA 3SQXA 1MW8X 4NATA 4R0VA 1W4ZA 3QTTA 2PZFA 3N58A 1Z4JA 2ZSKA 4JUCA 4RPCA 5FFFA 3TSWA 2N42A 2YXBA 2UZIR 3FKJA 1P7CA 2R48A 3AY6A 3N59A 4FKBA 1PNRA 4B47A 1UXJA 3N2KB 4HAXA 5E3IA 5JC1A 4CL0A 4IOLA 4Y1GA 5EUBA 3E4CA 2OENG 1W5FA 1Z0UA 2EJCA 1FRVA 1P2FA 2HZ7A 5DTEA 1VHDA 2AOTB 1PO7A 2FQYA 3OZTA 3WLLA 4DMCA 1SCKA 2Y0CA 4KOAA 3JZAA 3KAQA 5DEIA 1JA1A 1QANA 2D54A 4M7OA 3WKBA 5HBGA 2JLYA 1IVSA 2OK8A 2WJVA 4XDZA 2P0YA 3G1UA 1E4EA 1RLJA 1VLLA 2HWKA 4OHVA 1PEKE 4EHLA 5KJCA 4C20A 4LJ6A 2Q49A 3CG4A 3GHYA 4KBGA 4AWBA 2D1RA 3AI3A 4L8YA 3JATB 3VU9A 4AX4A 1OTXA 3KXKA 2K2QB 4HN4B 2Q2QA 3FHCB 4KGZA 1F0PA 4G0ZA 4DQDA 3IO3A 2Q1WA 4BBAA 2IDJA 2VHZA 1PEYA 2NO7A 4ESOA 5FA5A 4C5AA 4F85A 5T67A 3IDAA 3IR7A 1F2DA 3F3SA 1HYBA 3RT9A 5A4DA 4ZGGA 2XEXA 3MCTA 4CE6A 4URXR 2UYHA 3LIPA 5AJZA 2WD7B 2ZYGA 5TRTA 4A7PA 5KZMB 2XB9A 1F8UA 4YFVA 1NPDA 2X5XA 4DHEA 1NOIA 5EHQA 3QE2A 1UODA 3UT6A 4PZPA 3R7LA 4YPOA 1Z18A 2O7VA 3MWLA 2PSEA 2PZJA 1UJ5A 1ZEJA 2FU5C 2HLNA 2HU7A 2QM0A 2VDOB 4YUVA 3ZCPA 3E35A 4D0RA 2D5LA 2AS0A 2NOAA 2OV2A 5AUNB 4ZTUB 4ZO7A 1GQSA 3AQ4A 5CYFA 1H69A 2MINB 2Y71A 1IK4A 2D1FA 1DEOA 2AOTA 1T2NA 3E2MA 1Z0DA 3PD0A 3P9SA 4L5IA 3NO4A 3BIWA 4UAGA 1NXOA 1YZHA 5HUJA 2R7MA 4L27A 2FFJA 1E2BA 1W0JD 2YIMA 3U5TA 3RF7A 3R3HA 1KJYA 5AKIA 5LQUA 3BWCA 3E81A 3C97A 5IDXA 1L4GA 1HETA 1L7XA 5KVQA 2VYCA 1E9BA 2ONCA 4E5MA 3JQQA 2R4QA 4ZANA 4FFWA 3EIUA 5KCMA 4JLOA 3RTAA 3F49S 2WKPA 4Y2JA 3ZD9A 5J59A 1XHLA 1YIOA 2CMKA 2PRJA 5EJIA 1QYVA 1UBRS 2WB2A 3QPVA 4EJSA 2GZDA 4LHVA 2YXPX 4MVCA 3HP7A 2M98A 3S2FA 3IESA 4RHXA 3KLPX 3GCWA 4LBZA 3QNMA 1EHCA 4FYYA 4IX9A 1LW7A 4JP5A 4M9QA 2OHVA 4Q93A 2WM8A 3KTAB 4ZK2A 1M34A 1KQNA 4WKCA 4HNGA 1XNHA 3EMKA 3HBJA 1E7MA 2A4MA 2XDAA 2AFVA 2OCKA 4QIHA 4FXPA 4ECEA 3ZVNA 1LNZA 4TKVB 2TMDA 4AZWA 5EJEA 3WGQA 3H42B 1GNRA 3AC0A 3CGWA 4XWOA 1GYPA 4HB4A 1AO0A 4DWWA 4D9HA 2RHOA 5IF9A 4DMHA 1O6FA 1J0XO 1GU7A 1ZK2A 1TT7A 2PD6A 3COPA 3OG9A 4HUQA 2R44A 4KC0A 4ZAZA 5LXTA 4LQLA 1DJLA 4RSHA 2UZ1A 4YECA 5C1IA 1SFRA 3L7YA 2HD4A 3AVOA 4BMOB 4IX1A 2PEYA 3RYIA 3ZGYA 2WHPB 5FPHA 3TAUA 2GNAA 2W6CX 1U4SA 2PGIA 1SC6A 4BZZA 4UUBA 3IAXA 5D3MA 2EEZA 4X7MA 4YH1A 1MRZA 4KGDA 2ZE6A 4HAYA 3ZIUA 1PR5A 4MWTA 3GA0A 4QASA 1A72A 3CNLA 4RGBA 3KYBA 4BFWA 2JA1A 4M89A 1BCRA 4I0WB 4K2HA 1MD9A 3LWDA 4N8DA 1VL1A 2R6HA 1FJGB 3V1YA 1SC9A 4GS5A 3FWZA 2JZOA 1TFRA 1QV9A 2J6IA 2RHHA 2J9RA 2PX5A 4TWRA 4KGVA 2GLUA 3ET4A 3HU1A 2ZUTA 4R84A 4D42A 3VR0A 2PQ0A 2F48A 1T9KA 4YR7A 2YWDA 3WFIA 4OHRA 1MJFA 3D4NA 4QQFA 3FI9A 5ERGB 5ABPA 5MF6A 3IILA 2GLTA 1YSCA 3RS9A 1EFKA 3HUUA 4LOKA 1CQIA 1YL6A 2UYGA 2XLCA 3D5QA 4G0QA 4GECA 4OAQA 1YGPA 4R41A 5EMMA 3WLSA 3N2ZB 2WSLA 2PUGA 4FR5A 1EI9A 1V4NA 2D06A 3FNRA 3ODGA 1F0NA 2F2TA 3AONB 4TQUS 1EGAA 4FI3F 3DO5A 3HSKA 3SBEA 2QTVA 4ZAVA 3P9RA 4GPEA 4HG2A 1YZ3A 3EJ6A 4F2WA 3NCHA 1GPDG 4PHHA 2R6FA 4FDAA 4RMJA 3J7TA 3C6ZA 3F9IA 2WICA 4N3GA 1JDNA 1QGZA 1CQJB 3NHKA 5EGNA 3RFXA 4RZQA 3KKPA 1WG8A 1R3DA 1GQOA 1I7NA 3P9KA 4D0NA 1LC0A 1XCBA 4YLGA 4PX9A 4BKPA 4D6PA 1PR1A 1O8BA 3MBIA 3TMAA 2IEDA 4P32A 4BJ6A 1XU7A 2O05A 5CTJA 1UKAA 4UZFA 1JEYA 3FLEA 3GEHA 2QY6A 2R66A 5LQMA 2EKZA 1RWOA 3GOHA 1PNOA 1R4ZA 2FJUA 1N4AA 2CT8A 2C7OA 4LF5B 4TTIA 3FMPB 4E0BA 4R0NA 3NJ8A 4MA0A 4OHZA 1G8YA 3UAVA 3VHQA 1WVMA 3DW1X 2H54A 2P0AA 2AXQA 3QA9A 3NJ4A 4XOIA 3ZOZA 2V6BA 1VB5A 2PXCA 4OH7A 4F11A 5DH9A 3FGOA 1N5KA 2EW2A 3OZRA 4FKZA 4KRGA 3ZHQA 5FJJA 1YI0A 4C0QC 4CM7A 4Q1EA 2IX9A 2AG0A 4HS9A 3K8YA 5I9TA 4DUGA 2EVWX 1JI3A 2YOFA 1L4MA 2PX3A 3BD9A 1GN9A 2WWIA 4FMDF 5U1PA 4ABYA 3SHQA 4ACAA 1KU6A 2ZRQA 1N8NA 4FS3A 4GGPA 2VJOA 2JNWA 1ST3A 2UUPA 2WIFA 4UXJA 4P7GA 1ZM2A 4M9RA 4EGSA 5KTSA 3NW9A 1JHDA 1V4VA 2X9NA 1OD6A 2BGKA 1HE1C 2WA2A 3L6CA 3LY9A 3L7CA 5HFAA 1N77A 1QF7A 5JH7A 2MSLA 2Y1CA 4ZCSA 3UATA 4Z54A 3NUGA 3KZNA 3O8QB 1TK9A 1KVRA 2PKCA 2PX2A 3G8BA 2XNDD 1IJKA 2GNOA 2RI6A 3HEAA 3QVOA 4G0NA 5AK0A 1CR1A 2J4CA 1N5OX 2XEDA 3RVMA 5LYJF 1ZSNA 3DSRA 5AJWA 4HRYA 1O6CA 1WXFA 2HEGA 3RUCA 4R8MA 4OBWA 4RFVA 5CYPA 3V2IA 2YRFA 3B5JA 4H1UA 5KVCA 3JRNA 3E3LA 3CEMA 2PRSA 3PC3A 1Q1GA 3U40A 4PFJA 3HWSA 4M8IA 4QUHA 1EGVB 3PDIB 4WJKB 2D2FA 2OO7A 4NJEB 5DCWA 3T0GA 2HJ9A 2KM1A 3GFVA 1P2VA 1XQ9A 3L77A 3PWTA 2Z5GA 1RCFA 1T25A 4KIJA 2QN6A 5C8ZA 1JDBC 3GRYA 4BNTA 4FGWA 2J9ZB 2ZG6A 1WBDA 2RCYA 2ZAYA 2I34A 4WJLA 5BWMA 1SZPA 3W9SA 2XQJA 3WDLA 1KIAA 1UJCA 2OT3B 3I04M 3KJZA 3MRXA 1XTRA 4KIUA 3M0EA 4ZT2A 4OLBA 2RD2A 4Z2YA 1RKBA 4HTAA 1EX1A 4PZ0A 4F72A 1PP4A 2Q62A 1JSZA 1YO6A 4UE2A 4O4IB 1NR5A 3QFCA 3DHYA 3QX9A 1G0NA 2OHIA 3HWWA 2IUTA 2LE0A 2GTHA 3LZCA 1X1CA 1FNNA 4OM8A 1F2UA 1PGOA 3AKCA 3OLYA 5EVCA 4CCYB 4B43A 3CF2A 4RFSB 1X7YB 3H6KA 1H2FA 2XZTA 3O0DA 4QOHA 2G82A 2FZCA 3GLHB 3V7WA 1C8BA 4BNGA 4V1CI 1SKUA 4QJBA 5BQPA 1E1QD 1TPZA 3PHIA 4MRNA 3THRA 3Q8MA 1Q0ZA 1WQ1R 1IPFA 4TYMA 5CT5A 5I9NA 1UZLA 1WQ3A 3U6KA 2OHHA 5CA1B 4W8GA 4PQYA 5JNSA 4PGGA 5M3BA 4TRNA 1BVUA 2Q0QA 1D04A 2PWBA 1YZYA 3ANNA 2YR0A 3C5WP 3ICWA 1QOPB 2F59A 4YIKA 5AO9A 1NQXA 1Q16A 1UKBA 2IDZA 1AT1A 3GY0A 2X0IA 3RABA 3BTVA 3U17A 4PIPA 4KXQA 2QMHA 5TIIA 1Z12A 2FSVC 1EP1B 1HSZA 3TLGB 3A28A 4CF4A 4WBNA 1NZFA 4O1IA 1TZBA 2HHAA 1X2BA 4Y9RA 1EBBA 4BMZA 4HLUA 2LR0A 3R8CA 4AVYA 3RT7A 1M0SA 1DFIA 1VCOA 2OXCA 2V3VA 3KQPA 4Z86A 5T3YA 3T6KA 3TRHA 4EPRA 5AFSA 2HDOA 1H5QA 4FBGA 2EYQA 5LP6F 1CZRA 5CX1A 1SURA 3OQPA 1MRSA 1QC5A 4YDSA 1TFUA 3UPUA 2H51A 1U6KA 3MS4A 1GUFA 3T7JA 3EIWA 4DOMA 1M1XB 1E0JA 3N0RA 5FTKA 3HKCA 3EZNA 4S1NA 1NAIA 2O7RA 4A5OA 2O57A 3TI7A 1SU4A 1CQPA 1CS4C 5ALVA 4MUNA 3VZQA 1SULA 4FHGA 4EA6A 3ZZNA 4INZA 3UWSA 2CHQA 3JQFA 1LNSA 1YU9A 4S05A 1WDWB 4Q3KA 1HQCA 5KNCD 5A0TA 1POXA 4PQRA 3ODPA 1DQZA 3TLJA 1YFLA 5A0FA 3H11A 2C3YA 3CNOA 2ZIXB 4R5MA 4P7KA 4F6CA 2ORYA 5B4TA 5CT8A 5KNDD 2R8YA 3PZRA 4FB5A 3IPAA 5BQ3A 1G20E 5JALA 3ADBA 2CFRA 3BXEA 4M60A 1S9HA 2CUZA 2B98A 2GUGA 3EE6A 4QOFA 4E30A 4XYLA 5MHTA 1LK7A 2JFPA 1W0CA 3S28A 3CWCA 5L40A 3M2TA 1MB3A 3HYSA 2CJXA 4Q39A 3RSOA 1UBCA 2E4YA 4DDVA 2R85A 4G56A 3J80A 3NHFA 1H8EA 1T9HA 2CFSA 3F90A 2YV5A 4FOSA 3VVBA 1NMYA 1BJKA 2WJPA 2YUTA 2E48A 1M72A 1N2HA 3MSCA 1J97A 4Y6GB 4B48A 4QGGA 1ABBA 1M1YA 2R86A 2PUFA 1CFZA 3D6JA 2V7WA 3JQ8B 3K2IA 4OQ4A 4EGJA 3H7IA 2H1OA 1I4OA 3GLVA 3EODA 3CR3C 5KMGA 3I6ZA 3F3YA 1X8XA 3KYDB 4IIGA 1E1LA 1YDFA 4N82A 1KO7A 5HK9A 3C7TA 4LGVA 4NENB 1EXWA 2K7ZA 1AH2A 3Q8XB 4O29A 7ABPA 4CV1A 4PLYA 3WS7A 1BEEA 2XHZA 1XDUA 3CA8A 4RJLA 2H31A 2EWVA 2R8PA 4IOJA 2YMQA 1I80A 3M70A 4WGFA 1E6MA 4JBYA 2GJ9A 1HORA 2YVUA 3BIOA 1V11A 2ZJ6A 3NV9A 2WM2A 1J20A 4F5YA 1Q0LA 4DYHA 5JNWA 1TM5E 3GPCA 2IU4A 2KS6A 1DO2A 1MC4A 1SCAA 2XUAA 3VSEA 4PS1A 5GADl 1Y9AA 4TUYF 3VPGA 3QYAA 3SWWA 4B85A 1KS9A 1XAJA 2JHAA 1YT5A 3DDUA 3HCOA 4RS4A 4A73A 4DMMA 1UWLA 1UZMA 5HF8A 2PUWA 3FKSD 3EH2A 3OX1A 1O94D 3FWPA 4MPDA 4FGJA 5EN4A 2ACEA 4QKQA 1KP3A 5L45A 4YYZA 3ZJTA 1XI2A 3TO5A 5F33A 4RD2A 4HAVA 3OF5A 4HX9A 3EQ7A 1EEHA 1UDWA 3BB3A 3GZNB 4ZC8A 5BNTA 1RWPA 3CX8A 1JECA 3CX6A 3DV2A 5A9TA 1ZW6A 2J45A 3RJZA 3UWKA 3DV9A 3EIEA 5EIWA 4Q12A 5FWXA 4EPVA 5ALKA 2WT9A 3F6SA 1NYQA 4YRMA 1XTQA 3D8HA 4X64B 4JR1A 3I01A 3O8RA 3LM8A 2CHVA 3DZJA 2VP9A 4ZVKA 1T1RA 2GO7A 1YCHA 3RVBA 3D4PA 1QIDA 2IXAA 1K7SN 1UCFA 4RZIA 5JO0A 3IDFA 5KOJB 2IODA 1DAMA 4M0CA 5D86A 4UVEA 4RHEA 2VZEA 3MOGA 5J3JA 2J5QA 121PA 1KMQA 4D92A 1A9TA 4DEXA 4WNYA 3UOGA 2IOFK 2VHCA 3RO7A 3ZWNA 3PE4A 1TTHA 2R00C 3OPMA 3UGQA 5BUSA 1SCDA 3LUCA 4JB0A 1E3QA 3UTCA 3W6PA 4BNYA 3SU8A 1JFVA 2H1RA 5J1SB 1QVWA 2VA8A 1ZMBA 1GA6A 2H4FA 4NBUA 4P4UA 2A5YB 4Y8VA 4F2GA 1PHRA 1GVHA 3BM5A 2JLUA 2YXDA 2SKCA 3IIMA 2ZT5A 4WZBA 1RAIA 5LQDA 4KN6A 2QTGA 1RS0A 3RTEA 2QL9A 4PTYA 3SKVA 3HVRA 5A9RA 1UM8A 3RLFA 4J0EA 1WUYA 2HF8A 4UHKA 5ICSA 4GMGA 2F17A 1ISSA 1T3LA 4YI5A 5UKDA 4CDNA 2YWJA 4GKKB 3TF5A 4JEUA 2YHAA 3PZBA 3DE1X 2PSSA 3T0IA 3PD7A 4A5SA 1RQRA 3GMIA 3M4YA 1RTKA 3EIXA 1Q22A 5JSYA 3RIYA 5F3WB 1OQAA 2QW0X 4AMGA 4AF6A 1PBNA 3GG2A 4DA7A 5HUHA 1SQSA 3VR5D 5KBYA 1WAMA 2XE7A 4QUKA 4BVHA 1ZJ6A 1IOVA 4D8VA 3W6NA 3JWGA 4DADA 5IJAA 4RK5A 3RKUA 3RYHA 3ZPXA 4CU2A 3NIFB 4P0TA 3U1VA 4JL8A 4MB2A 1IM5A 3AUTA 1BJTA 1U2ZA 1T8UA 2Q5EA 2Q5FA 3GEBA 3NTQA 4OXYA 2EFDB 1JUDA 5J63A 4JEIA 3AIOA 4JLDA 4MB0A 3NT5A 2ZITA 1H3NA 3ESDA 3GFOA 2QD4A 5THQA 1XZIA 1KK0A 1UP4A 2RC5A 3GZ4A 3NHSA 3A7DA 4DJDC 4XZ3A 5FBKA 4H2DA 4Q4AA 1FUYB 3EZ6A 1ZI8A 2W8BA 1IZ9A 3GELA 2IC5A 4RVDA 4AJEA 4Z6KA 5BOSB 1BZYA 4K40A 4YT4A 4A8TA 5D85A 1QBGA 4Z7OB 4HUQB 4NMHA 1V45E 4J90A 3I45A 4ZKEA 2YZ2A 4IIJA 2JGLA 3LDUA 5JARA 1QX4A 4NXMB 1RZUA 2HQRA 4KCGA 3DP9A 3W5AA 1Z7EA 4MSUA 3WGYA 1IUKA 3KJFA 4IHJF 4WOPA 5H59A 3G7NA 1VFPA 1I7PA 5AOBA 1Q2XA 2AG5A 5BVGA 3O26A 1EINA 2J0UB 1QHXA 2Q29A 4GX0A 4H6PA 4I55F 1RWNA 1ZW1A 4BUCA 5ALOA 2L19A 4ZZIA 1QG4A 3HHPA 2OVFA 2RAPA 4UHEA 3UXEA 3HBLA 3FSRA 2QZSA 2WSMA 2YS7A 2W2OA 1X80A 4IJKA 5LQNA 3NGXA 2BW0A 4Q02A 4OUDA 3QKSA 4KJXA 4LCEA 2QX9A 2GXUA 3DMYA 5IXSA 2NU9B 3UW1A 3WVNA 4DB2A 1KI3A 2FKNA 4TVSA 1U6JA 3K70D 4FZ5A 3V9PA 4FFRA 2C1XA 2MT9A 4BO2A 3SBOA 1II9A 4YJHA 2COKA 2C2BA 1A69A 4HDCA 1CFJA 3RF6A 4AQDA 3B48A 1DJMA 3DZ8A 4P6VF 3ZIAA 3V4OA 1LLFA 1NL3A 1TD9A 3HFRA 3O91A 2M6KA 2VJMB 3UPDA 4JB2A 5A71A 4B71A 3UJPA 1SXJC 1VSUA 5KSYA 3KSAC 1I3CA 2G72A 1Z47A 2ZIGA 5AT1A 2OKGA 1CS0B 2H4ZA 2JRCA 4DLSA 2H5JA 1H6CA 3ZHTA 2RBEA 5EMJA 1S3FA 3PCXA 3NM4A 2HWYA 3RGGA 3ISJA 1NXWA 3R77A 2E87A 4G9EA 3TIGA 5AW4A 1O58A 1WXXA 1X94A 3AFGA 3LV8A 2RIPA 3HZHA 3CSSA 1BQ4A 2JD0A 1VJDA 2AFRA 4JC0A 1GRNA 1BXKA 1N5JA 1P2TA 4C5BA 4F0JA 2GK7A 4ALJA 4I2VA 1KDVA 4PLVA 4JVMA 4YROA 1IE3A 4G2TA 3EX7C 1UZUA 3BXHA 1ECCA 4B4UA 2Z6UA 1K89A 1NV8A 4OPMA 2IEAA 3W90A 1QORA 4KQ2A 3OPYI 4QDZA 2OCIA 3AHDA 4JL6A 1ZINA 4U6QA 3VHRA 4ER7A 2B8NA 3PI6A 1NMQA 2Y99A 4WOBA 5J2UF 5DKFA 2FCRA 5TEWA 4QYXA 5AW1A 4WFJA 2C7PA 3UFXA 1C3OA 1RM0A 3ZU2A 4F1JA 1CBUA 4OOFA 1CP3A 1SKAA 1T5IA 3IKLA 1XPJA 1L5NA 2WPDD 4U2FA 1Y7PA 1E4EB 4QECA 3JD3A 2Q3HA 3KQKA 2IW1A 1I0LA 3WYCA 1M6HA 3AIIA 5A9SB 3A9VA 1TAUA 5IW8A 5EIBC 1K5DA 1E77A 3BF8A 3I0ZA 2I2CA 3CZMA 4C4AA 1NG9A 2P2DA 2HMAA 3DQQA 3NWOA 2VUSA 2ZAIA 1PR6A 1Y1PA 2FZ4A 2A92A 3BERA 3MWFA 3ND7A 4TXLA 3RIHA 4E14A 3AJRA 1U4NA 2OZLB 5ALWA 1YVUA 4ARAA 5JNRA 3OFNA 4KUHA 4M9ZA 2XI4A 1C7FA 2I71A 4DCSA 1L4FA 4ITRC 1JKIA 1NM5C 2QT0A 4IH9A 1MENA 1PZHA 2B61A 3IUMA 3JY6A 4LKOA 1W30A 1V5IA 4AECA 3TLAA 4F5DA 2E3JA 1K68A 1ZZGA 3SICE 1Q57A 5ALMA 3I8XA 4MWSA 1DKNA 1NVTA 2IOYA 1NBIA 4M1QA 4LN1A 3GV0A 1ZD1A 2FW0A 1ISJA 4PNHA 4QGBA 4OHOA 3GLGA 1TMGE 3TCXB 3W8RA 2XR1A 3EB9A 1XMJA 2FPWA 3KYCA 2HSJA 2K87A 1AMUA 4JXXA 3D59A 2IYWA 1OYVA 2O2HA 3ECAA 3BREA 5AI4A 5B58T 4F1KA 3UJ9A 1OXMA 1YR9A 4PO9A 4ZAGA 1DQYA 1BWRA 2I5PO 2Z4TA 3A1FA 1K6IA 1C9NA 1WXIA 2IPNA 2J0QA 4JU8A 4MYTA 1I4DD 3AHEA 3W3AH 4UPEA 1JVBA 1QPGA 2WZBA 1AURA 1XAHA 3JQEA 3PYLA 1ZSYA 4IIUA 3VKVA 1A8PA 4FE3A 1AZWA 3K2EA 3J81k 2J07A 1V8FA 1H2XA 3NBZC 1R5NA 2EDCA 1W7AA 1NNEA 3RS0A 3ONVA 2GEBA 2QUHA 1AUVA 2CGEA 1R4MB 3UTDA 3DMHA 1T2CA 4AK9A 1SVIA 2C5GA 1GUAA 2M6SA 3TDNA 2GPJA 1UBLS 3ESYA 4KXXA 4YRIA 1XVLA 3MTGA 1FVXA 3GJ7A 1XJ5A 1M5TA 2OVBA 2ZBUA 1F2TA 3L49A 1O3YA 4Q4HA 5LLSA 3R7SA 4ARVA 4EB3A 3PQ5A 2CNNA 2NM0A 2GCOB 3NR2A 4RZSA 3N5CA 1ODKA 3T3GA 1A4IA 1LPAB 3CN7A 5CVDA 1OI4A 2GCGA 2IUSA 2JF0A 2XE4A 1DO0A 2GD1O 4G0UA 2QTCA 3D2CA 1B42A 4HAWA 4BV8A 4BX9A 3ZCVA 2OGZA 4HXFB 1C9DB 1M83A 2K6GA 2DSTA 1Z29A 2WZCA 3GL9A 3ZYZA 3BFJA 1Z88A 2A0FA 2JASA 1KR2A 4OKIA 3E27A 5ER9A 2WDZA 3FFTA 4U5XA 3SJ7A 5I4BA 4W5QA 5JDCA 2J3HA 4Q15A 3OKAA 4XGRA 4EA9A 1RI5A 5M34A 1HNWB 4PXSA 3KC2A 4L4YA 2CL0X 3CVYA 5FQNA 3ZV7A 4R83A 1RYFA 3SQMA 1I3MA 4DT1B 1IVYA 4RKQA 4KVFA 2BI4A 4B7CA 1B2LA 4TTAA 4OA8A 4WESB 5FA6A 3RRNA 3ELWA 2CLHB 1WSDA 2WYOA 1A1VA 5DWDA 5LOVF 4Q1BA 4EMTA 4DE5A 3JWPA 1FXSA 3F7OA 4MZDA 1RABA 2ZYUX 1BVHA 4DJJA 1RXUA 1T5SA 3IA2A 1T6YA 3L7BA 4KDRA 4QLOA 2YWRA 4QE3A 1IM8A 4G5OA 1SG9A 3ZE8A 5KKNB 4OA5A 1IQ0A 4GZ3A 3SF0A 1DAHA 3AHJA 4E2XA 4JFAA 4LTNA 4QM7A 4Q24A 2Q4DA 3RUIA 3ITEA 3KR2A 2I9KA 2Z6QA 4CUKA 1E3DA 3I6MA 3KD2A 3QFFA 3ZCRA 4HCJA 2VI5A 2ZJ1A 2ZRPA 5HM6A 1ZD8A 1Q7BA 2DUNA 4RPHA 3UV6A 2OHFA 4J0KA 1SOWA 3TR0A 4OMDA 4NPAA 2A5DA 4G25A 3EG9B 3GROA 1RWWA 4YPVA 5EJFA 2VQFB 4ZYXA 2OMKA 2CMHA 3WYAA 2OGWA 4MITA 3DEZA 2O2ZA 2C0CA 2IHTA 3DWEX 4Q9LA 2ZJ3A 4R2JA 4R5HA 3NTLA 1DXQA 2FP4A 4DM7A 1BHJA 3TRKA 3G2LA 1O9BA 4WOKA 2EKDA 4C3VA 4MKIA 3JAWB 4QQNA 3SEFA 4CTMA 5K9ZA 5DHRA 2PUBA 3WIBA 3WLFA 2J7PA 1I4WA 2IHKA 2ZOSA 4IV0A 4YP1A 1ZO8A 3GMTA 3QVLA 1C3VA 4MVJF 1XCPA 5LLDA 1D1PA 1GCOA 3AL2A 3R1IA 4TS9A 4D3DA 2GI4A 1X87A 4W6ZA 2WAYA 2IW3A 1G6KA 4ARSA 4DIEA 5FWYA 1JR6A 1N1EA 5FIUA 1Z68A 3O4RA 1XEWY 3PPXA 4M0KA 5B1SA 1YC5A 3DBLB 5AJTA 3X1KA 2BTEA 3MRSA 4YI3A 3CFYA 1BTOA 1U8EA 2QZPA 3P94A 4TKZA 3KPUA 4Z5XA 4A0GA 2W6JA 3MMNA 1W88A 1GNSA 1RXYA 2GCNA 2R1TB 1IXZA 1HT2E 3LLUA 4JQSA 4X6UA 3T7CA 3U44B 1J2EA 2I4IA 2VWGA 2NT3A 1HM5A 3G9QA 4WASA 4RKYA 2PKQO 1S8AA 4B87A 1LDYA 1IQUA 2QNIA 4LXGA 5H7XA 1GL6A 4C0KA 2DLDA 5AK4A 1BO6A 3CKMA 2AW5A 1CZOA 2O0JA 1VL2A 4ZQBA 4RCVA 3BMXA 3WK5A 4NY1A 4UBIA 1KH1A 4B81A 1Y3AA 3CNQS 1UWVA 4MVJA 4UHHA 5E3JA 2OYCA 3RREA 1TEXA 2ADOA 1OI2A 2GJ8A 2BLLA 3L7MA 3JPWA 3IS3A 1KI8A 1MOPA 3LF1A 4GD3Q 4NU5A 4PC7A 2VUIB 2WFMA 2H00A 4DUZB 1P1HA 4QQKA 5JZBA 3PGVA 4EFMA 2B4QA 4Y7DA 3W9BA 5T8KA 3QFRA 2GVZC 4IG4A 2FPSA 3KLOA 4AI6A 3RUFA 2GM9A 2VPXA 3EARA 4ZQIA 3BEDA 3D7NA 3U80A 3E3OA 3K94A 1EUDA 2PA3A 3RJMA 4FSXA 2GQ0A 4N40A 1NJGA 3NHZA 4LPKA 3OM0A 4XQEA 4KN9S 1O9GA 1Z15A 5HRAA 1ICIA 1ZGGA 3IMFA 4DCCA 5BRAA 2ZWVA 4JNCA 2CVFA 1FW8A 2H0RA 3DDZX 2O20A 3KDPA 4I9UA 3V1LA 4EQZA 1ZVQA 4ZDJA 1PL6A 1GCGA 2A0YA 4H15A 5IN5A 1D9ZA 5ELXA 3TXAA 4MRRA 2R6R1 1E6KA 3FDIA 1T5BA 4EG0A 3W8NA 5KQGA 1MO5A 1QH9A 3ZWOA 1ISRA 1SOUA 2BEWA 4X71A 5I7RA 1FTNA 3LLCA 1EDOA 1NURA 2EKLA 3GGCA 3OY2A 1T0IA 4PRLA 5HCUA 1V6AA 4FNMA 4FDUA 1W5BA 2PBZA 3IV7A 4U7JA 4WLVA 4BAGA 4BP1A 1T8TA 1XXHB 1TM3E 2W43A 3AZPA 1P0PA 5EKTA 1Z08A 1YJ8A 3A1WA 2EZTA 3KM0A 4IHJA 2VSNA 3D2AA 2CK3A 3MA0A 4YAUA 2PTGA 1YD7A 3BQ9A 4AMZA 1F48A 5EE5B 3ENZA 1U9YA 3E82A 2QRZA 1C7JA 4ZHQB 1HDEA 3OKCA 2CFCA 2CHGA 3LXXA 2BZSA 5AHXA 1IUPA 1F14A 2C4KA 3Q7QA 3TGPA 3VU0A 4MVJE 3RS7A 3H97A 4YRQA 2UVQA 2A5LA 4PX3A 5C31A 1SC1A 4HFMA 3EXAA 3EZ9A 4E3ZA 4PLCA 1T3SA 4MO2A 2JAQA 2D00A 5BURA 5ADWA 4F3KA 3L02A 5JVDB 2DY1A 4GYYA 4QJ5A 4XW2A 4DCJA 3IAM6 1ZESA 1QRUA 1XSEA 4YPFA 2EQBA 2WINI 2WSSA 5J1TB 5A3JA 3MTEA 5C7OO 1KWKA 5KX5B 1XEXA 4QXAA 4WK6A 2OY0A 2ATXA 4QPDA 1FSZA 4O2AB 1QU2A 2I7VA 4KLZA 3LQYA 4L73A 1TCUA 3HEMA 3NTVA 4YUWA 1KYWA 3EQ2A 4PLHA 1V7PC 4JSRA 1E5VA 3NM5A 4LZLA 1I6LA 2IS4A 1R50A 2HGZA 3VTKA 1K88A 4YMIA 3WTCA 1A9YA 1VKZA 2ENWA 1OIWA 1LSSA 5DLPA 3D3QA 5DASA 1OTHA 1QHHA 2FZ5A 5BV2P 3PNVA 4Y2HA 1C50A 5IKOA 3EPKA 1UM9B 4M0UA 4TUYA 2IHYA 4R3WA 1MU0A 5AVKA 3GZJA 4P2BA 3KE8A 3WYBA 5LBIA 3OECA 2BT4A 2VF2A 4MKXA 4OHBA 3W5BA 2FP4B 1O94C 2B3DA 4KXMA 3VSDA 4AP9A 3H04A 4J0CA 2XITA 5CTAA 1VJTA 3IR5A 3HS3A 4LHZA 5EKSA 4HEQA 4M2LA 5AI5A 3ELBA 4EF4A 1F9EA 2RGXA 2EJWA 2DETA 3EOBI 5FNVA 1DEHA 3NTRA 4CBVA 5LXTB 3RSQA 3OPXA 3C15C 3V5NA 3WGLA 3O7WA 2BGGA 1JEDA 1BFDA 1HY3A 2M2IA 3FVVA 2AUTA 2IHUA 1UMCA 2CVPA 1V47A 5LU9A 2NP7A 4L8FA 4PLWA 1U8ZA 4K03A 2FPGA 3COVA 1JEQA 1A95A 3TFWA 3UT5A 3SQWA 3RHTA 4B9EA 4Y7CA 2FUG6 1D7OA 1LQTA 1NQTA 2C54A 5JOQA 1MB9A 3HXMA 1AKTA 2L82A 3KTDA 1BRTA 3I42A 5I9SA 4AO6A 1E3EA 4GVPA 4LY3A 3QLVA 1YZKA 1J5XA 1OXTA 5I3CA 2BELA 2JJQA 3PP8A 4ETIA 3QI7A 5K5EA 2BFAA 5TY0A 5DNWA 4C4TA 2B8EA 3C24A 3C8MA 3CRW1 4PG8A 2GEJA 2FZKA 4ZOQI 3VR1A 1KEZA 1BQEA 2JI9A 2ZGVA 1ONOA 3I12A 3PQEA 1MV5A 3OICA 4Z8YA 4DCOA 3ZGXA 4AJHA 4B34A 4KSYA 2H85A 3BRWD 3NAQA 3N0XA 4DLNA 4IDOA 1X7DA 3TL2A 3OOJA 1XTBA 1X86B 3G2QA 3NOVA 4ZEMA 4EPTA 3AL3A 1JA9A 2IU6A 1B1CA 1ES9A 3FYUB 3L8EA 1VL8A 1N7HA 2IEGA 1UL1X 1X6VA 1T4DA 2CZGA 3GXBA 3S40A 4UCWA 5TXGA 4LF6B 2C9ZA 2HYIC 2D0OB 3C8UA 2AT1A 2ZUSA 3EWSA 3O3OB 4I1VA 2C4UA 4X41A 2QL5A 4PAOA 4UM8B 4UQLA 3EXHA 2P6RA 1LDEA 1KMIY 2ECOA 2B8WA 2ZM6B 1E9SA 3PJGA 3RFUA 1KGDA 1MOSA 3LW7A 4GLFA 3VAAA 3EWIA 1SIBE 2QNRA 2GS9A 3C7AA 3DO6A 4OG2A 4M83A 3ENWA 4PFKA 2QRVB 3ZK8A 4CG1A 4ESEA 1Z63A 4J1NA 3OOSA 2ODNA 1QQAA 2Z30A 1FTQA 1U0TA 1O6BA 1XJQA 4R98A 3TQOA 3V3KA 3V8BA 5JXIA 2D2XA 2XY4A 4NULA 5G0TA 2P2SA 1AV7A 4YRGA 5J2TA 1NLZA 1IXSB 4YY3B 1D0SA 2A0XA 4PG4A 3SHWA 3LFUA 4F12A 4KQ6A 1MQSA 1V8DA 2JIZD 3ZHVA 3AF3A 1S89A 2VPPA 4D9GA 2EQAA 3G59A 4TS3A 5IMBA 2RH8A 3DD5A 3ZKWA 1VGVA 2B2NA 2AZ4A 4B6EA 3K0KA 1CRWG 1QSGA 2LV8A 2XIJA 1J39A 1MHPA 3NC4A 1L4LA 2PGAA 3PXXA 1RM4A 3QQPA 5IMSA 1NVVR 2NXCA 3R7DA 2I78A 1ATZA 4RIIA 2O48X 3UMJA 1Q74A 1KDOA 3A4YA 3BE8A 2XWQA 4J1TC 3TECE 5IULC 1CUZA 4PHGA 2XNJA 5BWBA 2VFAA 2V7EA 2YCLA 3CM0A 3FVTA 3GVIA 3I0NA 3OFJA 4LYYA 3ZY6A 4RGYA 3N3BC 1JLLA 2O0KA 1JPJA 1HE3A 2I9PA 5JANA 4E11A 3WI7A 4GPD1 4PCVA 4MWOA 1RM3A 1L5OA 3PPVA 4H08A 2IVFA 5DTRA 2BTQA 2N1MA 4DV0B 3VC7A 4DPKA 2QVZX 2W93A 3VJLA 4ARBA 1A9PA 5BV8A 2E49A 1XZMA 2NYRA 2R8BA 1M7GA 3HQ4O 4MVJH 4TPKA 1SHTX 3OA2A 4DCMA 1H65A 1P5HA 1V6CA 3C3XA 1TIKA 3SFZA 3KUCA 3D8RA 1IHXA 3N74A 5CG1A 3G6KA 1AQUA 5JR3A 3D4LA 3LLSA 2H3HA 3VZPA 4V0ME 3I32A 1EFVB 4I5EA 4Y2SA 3MTAA 5DWVA 4D4IA 6Q21A 3RYCA 4UPVA 3THSA 5B53A 4W1SA 4Y1EA 1XALA 1LV8A 3EMDA 2MCFA 1QDLB 3RD5A 4Q82A 1VSTA 4C05A 1FMFA 3LCUA 4MHOA 1KFEB 4FM9A 2PKWA 1G59A 2L69A 2OV1A 1A7JA 4TLEA 1SXJD 2Q3JA 3D5EA 5F77A 2FSPA 1T4BA 1LKZA 1AK9A 2JH9A 1W5SA 2W8ZA 3OETA 1IG0A 2DBRA 4R8LA 4WBNF 3ZCTA 4JAVC 4BO1A 2VEOA 1HZZC 2QR3A 3BH7A 4B3IA 4DLAA 2FK8A 1I1OA 1CZUA 3RYTC 1FF9A 4MW0A 4OQFA 2OTCA 3RB8A 4M1KA 3FA2A 4ZOLB 5B1YA 5HKLA 5FBVB 3IAS6 4DSTA 4M0PA 1J9GA 4COKA 2I2XB 4U9UA 1RZRA 1YJXA 1R2QA 3PUXA 3SMQA 5A1TA 2BPOA 4RPKA 3WNDA 1Z06A 3AVVA 1J2RA 1TJPB 1SCUB 2QG6A 3U7EB 3GA7A 4GKJB 1WY5A 3E0XA 2VPZA 1E3JA 1PW7A 1V16B 4V0QA 2B4KA 3IQZA 3RADC 3ZBTA 3OFSA 1Q1ZA 2P3OA 5CH3A 2AD1A 2X40A 1VLQA 3GCDA 2FW6A 3NHAA 2FEKA 4OLHA 1M1ZA 4TYQA 5GPBA 1NQWA 5JT1A 1RADA 3M89A 2ZSAA 1HDRA 3K9FC 1S2LA 4CXMA 3TJRA 2ZIAA 4URFA 2JLAA 4E5PA 2JH8A 3PB3A 2CLDX 4ZYTA 1RVDA 1QMGA 2VYFA 1DDIA 3AGQA 1U28C 5KSZA 3OMLA 4XTRA 4Y9UA 1P62B 1RDFA 3CBQA 3NWJA 1PZXA 2YV3A 3QVTA 2B2CA 3RYFB 1G38A 5IJ0B 4G5YA 1XZEA 3CH4B 5E95A 3TQRA 3C8HA 2HCFA 4FHCA 2JFFA 2OOKA 5DX0A 2BEJA 1LBHA 1P7VA 5FBQB 2G8LA 4O59O 1BMDA 4P9NA 3ZS8A 1BW9B 4WKOA 2FZVA 2X5OA 3DWFA 3EXG1 5FTLA 4LBVA 3A4VA 4ZHQF 1JL3A 1UPFA 5K3FB 1TTTA 5L3VA 3FE2A 2C8LA 2Z58A 4GBED 2IZ5A 1TLLA 2DOKA 1WHTA 4NCKA 1M5RA 2WFZA 5F73A 4JI6B 3ASYA 1BXRA 4ISCA 4WCFB 4IDGA 1L3CA 2XGGA 3SX4A 4EGCB 4PXYA 1UOPA 4M8LA 1LC3A 4MR8A 1DUSA 2A3NA 5BSRA 1HDCA 1U3WA 2YV1A 1JDBB 4J4BA 2IYOA 3NBUA 3LE8A 4IFIA 2B69A 4WHMA 4BU0A 2C9DA 3E22B 3BQMB 2FEAA 1UQTA 1OREA 1XUOA 2Z9CA 4WLFA 1CUXA 1GPYA 1I33A 1RI3A 3ORSA 2HH9A 3QU5A 2LTAA 2QI9C 3OMXA 4G01B 3KT0A 2YVQA 4XB1A 3ZVKA 1U98A 3L0IB 1OAKA 5E6RA 2P90A 2VDMB 4YN3A 3OZIA 1Y8AA 5TR9A 1J9ZA 1TQ6A 5FORA 4QOJA 1D1SA 1JMKC 1XF1A 1KVSA 3AIMA 1QPZA 2IV7A 2F00A 3NFRA 3THYB 3DF7A 1OH8A 1N5IA 4FR0A 4F84A 3CUTA 4Y6QA 2UXBB 3ZXUB 4V2IA 2XTMA 4NCHA 4EOGA 3MMXA 1ORRA 1SO8A 2FOLA 2IXTA 5JAUA 3VHXA 1NDQA 1XTPA 3G2PA 4K9OA 5EC8A 5CAEA 1E8MA 5JISA 2QBYB 3AY0A 3NETA 1FTYA 3LFHA 1QZZA 1EK5A 4Y3UA 5EZYA 5DTJA 5LQCA 3RSSA 3WKEA 3KU4A 3MXOA 1KQGA 1KDZA 4L9SA 4EHNA 1NR1A 3FMOB 4H17A 4KVGA 3BCUA 2PZMA 1Y8RA 4M54A 2JCYA 2YRWA 4N54A 4TZ0A 1VMIA 4WECA 4YWJA 1IY2A 2HNKA 2HCJB 4IZ6A 3OZVA 4Z0PA 3R20A 3R3WA 1IY9A 1GV1A 3QXCA 5IAOA 1RWXA 1WKCA 2QG4A 5D51S 1DB3A 3REQA 1EWKA 4I1YA 1QQBA 2OMEA 2VNKA 1NW9B 4D1YA 2RGUA 1NUAA 2N75A 2ZAOA 4MVWA 4QHSA 4YLEA 1Y5MA 1ZD2P 2OM6A 2XAAA 3Q7PA 5EJMA 4OK6A 4Q9DA 4EO4A 2MDTA 2RKOA 5B55A 5JAQA 3KVVA 3HJFA 1KL7A 4Q21A 3FYHA 5KNLA 2FR8C 1NW5A 3ICOA 1V0JA 1E6LA 2ZJOA 3NM6B 1U5CA 4M46A 4D9JA 3I37X 4Q01A 4Y2TA 2CMDA 1KTIA 1HRKA 5EP4A 1SHLA 1CSEE 1JEEA 1SOVA 3TM5A 5BV7A 5DBFA 3MC1A 5PGMA 2OFFA 4XE5A 3D7SA 2AUMA 3EPJA 3ANSA 4I6EA 5TT1A 1JIQA 1P1IA 3M5WA 3JATA 4UBKA 3VU9B 3OZXA 3ANLA 2UU9B 4RFLA 2MMCA 3GLHA 4ND7A 3KVRA 2JCGA 4O1HA 2XVMA 1DOHA 2DP4E 3M4NA 2Y68A 4WEOA 4WLNA 5H02A 1LS1A 4M4SA 5EUMA 4O2BB 3T35A 1YDWA 3W78A 1P8JA 5AUOB 2O23A 3TLGA 3OTWA 3U7RA 4WBNB 2WWYA 2H7XA 3OY7A 4HGOA 4WXRA 1X7WB 4WXYB 2VJAA 5AESA 4KWTA 1EAYA 4HDAA 2VXYA 5KQRA 1CV2A 3PYXA 3CH6A 3Q3HA 2BI7A 3L18A 2XH8A 4XPIA 3V34A 3LC0A 4U0JA 2J6CA 2PFGA 4F3TA 3UAZA 4U8HA 2QTHA 3HKDB 1SH7A 4ER5A 2D2EA 3ADPA 2I66A 1K66A 3PKZA 1XYVA 2V9ZA 4F96A 2O0LA 5REQB 5K0ZA 1IAVA 4YO7A 1SVLA 4BY9E 2WB4A 5C8VA 3PK0A 1YNOA 2I03A 2DBZA 1QC5B 1QFZA 4EH1A 2JIPA 5IUKC 4AIIA 1A4XA 5HA5A 1T2FA 3KSRA 4QOEA 1ENPA 4MGYR 1A5SB 2PZGA 2WVJA 3WLNA 1R6UA 2YNMA 5CGQB 4N01A 4OYHA 2LDXA 3PS9A 2JLCA 4EFKA 3IIJA 4JJEA 4MV4A 2Y3IA 3ANMA 3VR6H 1GTRA 2Q99A 3K4HA 2VJDA 1PK9A 4NK5A 1TOAA 2H2WA 2FV8A 2H59A 1G6HA 1TLFA 2FQXA 2XXJA 1MG5A 1Z4MA 3E5NA 4C0SA 4EY8A 3TQQA 2CN1A 2FK7A 4V0KA 4P7FA 3HP1A 1RFLA 3B1FA 2Q6KA 4FQ8A 4P54A 2CDBA 3ZE7A 1SELA 2F43B 1P2DA 1UC8A 2O1WA 3GHHA 3TFOA 4LRXA 2WUFA 1JLSA 3KR1A 4HJRA 2IIQA 1QZ3A 1A76A 3NHBA 4AY4A 5JVDF 5IVIA 1U63A 5LVAA 2ISQA 2X76A 3HBFA 1D09A 3FFWA 4OHMA 4YV1A 3WK6A 1FJXA 2CVZA