1QB7A

Crystal structures of adenine phosphoribosyltransferase from leishmania donovani.
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
236
structure length
236
Chain Sequence
PFKEVSPNSFLLDDSHALSQLLKKSYRWYSPVFSPRNVPRFADVSSITESPETLKAIRDFLVQRYRAMSPAPTHILGFDARGFLFGPMIAVELEIPFVLMRKADKNAGLLIRSEPYEKEYKEAAPEVMTIRYGSIGKGSRVVLIDDVLATGGTALSGLQLVEASDAVVVEMVSILSIPFLKAAEKIHSTANSRYKDIKFISLLSDDALTEENCGDSKNYTGPRVLSCGDVLAEHPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of adenine phosphoribosyltransferase from Leishmania donovani.
pubmed doi rcsb
source organism Leishmania donovani
molecule tags Transferase
molecule keywords ADENINE PHOSPHORIBOSYLTRANSFERASE
total genus 69
structure length 236
sequence length 236
ec nomenclature
pdb deposition date 1999-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qb7A00
4RACA 1XZ8A 2XBUA 4RABA 1ECCA 1MZVA 1NONA 3H83A 3QW4B 5EUCA 5BQOA 1ECBA 4WN3A 1DKRA 1FSGA 4FYMA 1D6NA 3O7MA 5KAMA 5KAPA 1G2PA 4RAOA 1P19A 4PAWA 4P86A 3LRTA 1OROA 1I0IA 5IPFA 1QCCA 2PRYA 1A4XA 1I0LA 1CJBA 4TWBA 4LZAA 1IBSA 3DAHA 3ACBA 1XZNA 3NAGA 3LPNA 3N2LA 4RANA 1P18A 1VCHA 2JKYA 3DEZA 4RHYA 4ZFNA 1XTTA 1QCDA 4RHUA 5HKLA 4RHTA 1DQPA 1QK5A 1A98A 3ACCA 1Z7GA 1HGXA 2GEBA 4QYIB 4S2UA 5BSKA 1PZMA 4RQAA 1HMPA 4KN6A 1G9SA 4WMLA 1QB8A 1ZN8A 1ZN7A 4P83A 1W30A 1DBRA 1OPRA 1OREA 3HVUA 1P17A 1ZN9A 4QYIA 5ESWA 2H06A 4PFQA 4RAQA 3GGJA 4RQBA 5BRNA 1ECGA 3S5JA 5BQPA 3OZGA 4RHXA 2YZKA 1Y0BA 5JSQA 1J7JA 3GGCA 1TC2A 1WD5A 1NULA 3EFHA 5K51A 4P81A 1DKUA 4MB6A 4LZNA 2FXVA 3M3HA 4M0UA 1DQNA 1I5EA 1XTVA 5JV5A 4F8EA 3KB8A 1A95A 2WNSA 2JBHA 2H08A 1VSTA 3MBIA 4LYYA 1STOA 1G9TA 2PRZA 4JLSA 1A97A 4X45A 2P1ZA 4P82A 1R3UA 3OZFA 2AEEA 2JI4A 5ESXA 4RV4A 1LH0A 2C4KA 2E55A 2IGBA 4QRIA 1ECFA 3MJDA 2H07A 1BD4A 1BD3A 4OHCA 1ECJA 1O5OA 5E38A 3OHPA 2JKZA 1JLRA 1XTUA 4JITA 4P3KA 1TC1A 4RADA 4IJQA 4Z1OA 2EHJA 1QK3A 1U9YA 2PS1A 1L1RA 3GEPA 4LZOA 1V9SA 1UPFA 1A96A 1AO0A 1L1QA 1I13A 2VFAA 5HIAA 1A3CA 1I14A 3G6WA 4LYGA 4M0PA 4P80A 1P4AA 4P84A 1G2QA 1O57A 2HCRA 4X44A 1YFZA 3DMPA 1QK4A 1GPH1 1UPUA 3ACDA 1U9ZA 1GRVA 5IAOA 2DY0A 1BZYA 1JLSA 1QB7A 1VDMA 1UFRA 4M0KA
chains in the Genus database with same CATH superfamily
3SHQA 3H83A 2QVZX 5HIKA 1PW5A 3B6EA 1YRBA 2D5BA 1ECBA 4L15A 3UT5A 5DNUA 2UXCB 3MA0A 1ESCA 1JKFA 2D2IA 3TXXA 3VR2A 2WRZA 2XTZA 3WISA 1I7PA 1UF9A 2Z57A 4U9UA 2Z8YM 3H5VA 4DKXA 5EXPA 1M6HA 5B53A 5G0TA 3FOBA 4DLTA 3QG1A 3LRXA 1RQXA 4D9MA 1F8YA 2B2XA 5IKPA 1V2GA 4QOJA 3MJHA 1QKIA 4K40A 4D6YA 2PN1A 1OY1A 5CURA 5ITSA 2WYVA 4CF3A 5FPKA 4ZALA 4DJTA 4WIAA 5EXTA 4K05A 4DMFA 3PUKA 1C9JA 1QF6A 3HZOA 3U3OA 3PD0A 4J29A 4AN0A 4AURA 4QUEA 1WHSA 3A1DA 1X1CA 1USGA 5T64A 2FZ4A 3O8NA 4U4AA 5AQEA 5B4UA 4UZFA 1QIJA 4IRXA 4WMLA 2FG5A 3EC1A 1J21A 2EBUA 4RKYA 2ZVPX 2PSJA 4ZN6A 4TKLA 1CY8A 4XYGA 2B6HA 2CVOA 3ASUA 4FP9A 4AG3A 2Z4RA 2NV0A 5HE9A 3T3DA 4BB5A 2NV2B 4I4CA 3NWBA 5AVVA 1RC8A 1KXJA 2VYND 3QVUA 3EUAA 2BFBA 4KZKA 2WEKA 3RYHB 3ZWKA 5AW3A 1E3QA 3CEPB 4HUQA 3AEZA 4KSYA 4J0EA 2PV7A 2FUCA 4FD2A 3T9BA 4PBRA 3W6UA 1JG3A 4X1YB 3ZIDA 1BX3A 3OCJA 5BXYA 3AOGA 4GI7A 1UAGA 3D7KA 4GX2A 4KQFA 1D2MA 3I6ZA 1SQGA 5CNIA 2RJNA 4GE0A 3RTDA 1BE8A 1S2MA 1U8XX 1GU0A 2P1DA 1XTKA 1TEHA 2VJAA 2VUUA 1WXGA 4X7RA 1HI9A 1XXLA 5FUVA 3UKJA 4B34A 1U28A 1B2LA 4IOJA 4MW7A 4C5AA 3R6WA 2GGSA 4G5OA 4CT4B 4C7OA 1G21E 3E7FA 4BO2A 3THRA 1OU4A 4U02A 3IIJA 3TXYA 3UT0A 2GF9A 5BQXA 5C1OA 2RC5A 1UBUS 4B3TB 5AXCA 4XI9A 3R3HA 1TUIA 5AKZA 3ADOA 4M1KA 2VHCA 4R41A 3UMYA 3KAKA 2AXEA 1PR1A 4JJEA 4KO1S 1G4UR 1COWA 4MIKA 5E7JA 4NJMA 3NVMB 4RCVA 2PLWA 5LXTF 5DJ5A 4ENSA 2FFQA 1AQJA 3JZIA 5KYKA 4XYBA 4E32A 1B42A 3CXRA 3I37X 3E7PA 1V1RA 1Q91A 2G8NA 2GKSA 3NTVA 4TZ0A 2Y77A 1CR1A 3AF2A 1WWKA 2X0IA 2RK6A 2NU9B 1K0FA 3ZDQA 1HWYA 2WFMA 1BWPA 2ZFUA 3B2QA 3AR9A 1J20A 4BMDA 1Q12A 2PUAA 4PG7A 4A27A 1HLGA 3F6RA 3RNOA 5FYDA 4JLDA 3L8CA 4OIFA 2FN8A 2R25B 3DDUA 3M82A 3QLJA 2PX3A 2QX9A 3GFRA 4XD7A 4BLOA 5KIAA 3HVHA 3KLBA 4P08A 5H9WA 5JAIA 1YB5A 3DAPA 2CNDA 5B1EA 3RIHA 2IYZA 1U0HC 4B44A 2BGJA 1G5PA 3OWOA 2H4XA 3SDZA 3TG2A 1YQUA 2GSDA 2H0RA 3PXAA 3ESRA 4WN3A 4FYMA 5EKXA 2ZG6A 5CPFA 4BECA 2C99A 3HUFA 1PYOA 3DF7A 2O8BA 3KEQA 2PRKA 3S27A 4D9CA 2BKVA 1NP7A 2R44A 3SZOA 4KREA 2A5YB 1SXGA 5K0EA 3QXJA 4BKRA 2WILA 5IEBA 2QX7A 2VF5X 1UEXC 3B6ZA 3CH7A 2N42A 4G4IA 3ASZA 5C8ZA 4W9MC 1J9EA 1P1JA 2PKRA 4R7TA 5J2UA 3RC8A 3B38A 4F0JA 2Q3MA 3GUCA 1DDGA 2I80A 4QZVA 1QH9A 2LGJA 2B5WA 3NASA 3JD3A 2HSEA 2I1QA 5JS7A 3HDQA 4HYEA 1J1IA 4ZI2A 3M6FA 2YXDA 4MQLA 3S1SA 1EESA 1BN7A 4PIVA 5EERA 2VRCA 1TAQA 2ZBDA 4K28A 1WV1A 4DC0A 1USVA 2UVQA 3BMNB 1AGYA 1DAOA 3HBMA 2B9EA 1MB0A 3EVDA 1R8JA 3OU7A 4L9SA 2BZ0A 4LDPA 4Q1FA 1B6SA 3BSYA 5KCZA 5KOIA 5KNCA 1COZA 2JFFA 3A7DA 3SHTA 3UO8B 3IKJA 4UHCA 1E2LA 1XIVA 3O91A 5A3RA 4TWZA 5IJXA 1PL6A 5F9FA 2VQ6A 4DLVA 3KR1A 2QTCA 1DAKA 1RMTA 5JZOA 3BAZA 1NULA 4KIGA 3CUUA 3G85A 4MQFB 2YN0A 2BEKA 4MCHA 3H5NA 2ARKA 2NAPA 2C58A 3NBAA 3NHYA 4AT1A 2YIVX 1ZL2A 3DMDA 2JGJA 3IH5A 4I1VA 2VH1A 2UXDB 4M7PA 3ZWQA 4NOMA 2YJGA 2A1UA 1NOJA 3O90A 3Q15C 4EATA 1X3SA 2BR5A 3IS3A 1GCUA 2FDRA 2Z6VA 3A6GA 4Y67A 1O7JA 3NM6B 4ZQGA 5JU6A 1ZG3A 4HDOB 4MYRA 1PSZA 4GKAA 3UB2A 3ZWMA 4FBLA 3IT0A 4IO0A 4X8OA 3S7TA 2VN8A 2OHHA 4IV0A 3SHVA 3PVZA 1L4EA 5CVTA 2GM3A 4IG4A 4O4HB 2CXUA 4QLAA 2VRCD 4C7JA 2I1VB 5T4BA 5JSUA 3L7KA 1W2HA 4J1SA 4K2HA 2V7GA 2I3ZA 3RC3A 7YASA 4MQ5A 1WMSA 4NEGA 3PDJA 1CDOA 4X3PA 1Y7IA 3MGBA 3JWEA 4R1PA 4HQLA 1Z83A 4WNCA 1I36A 1G63A 1BX0A 2BN4A 1A04A 1V39A 3RWBA 2FWMX 1Q83A 4BQOA 4F3YA 5JISA 2JFNA 3TR0A 5L45A 3GLQA 2SCUB 4EKIA 1DBPA 2AJTA 3WB1A 4NPAA 4QTUB 1H2HA 2HYDA 5IDWA 2DSNA 2ADMA 3JQRA 2VP6A 3IQZA 3ITEA 5D51S 1YR6A 1U9IA 5DN9A 4ZDWA 3D54D 2J6IA 2PBRA 2A57A 3FVTA 3NPAA 3GJ4A 3DXZA 3H5TA 4Y7DA 1LSJA 5TSDA 1PDOA 2FP4B 1K8ZB 3I8XA 4MNTA 4R1UA 1TZKA 1HDEA 1NJSA 3IUSA 4BFCA 4BCCA 1GXSA 2QAJA 4G0VA 1HE3A 4M6WB 1AC5A 4TL6A 2AX3A 1XZ8A 4YUAA 5LPNA 1C9EA 3G9QA 3OZVA 2EW8A 1CUZA 1NVVQ 3IR5A 1N3IA 4RE6A 1EUDB 2QMHA 1SN7A 1L5HB 3PL1A 4GSYA 4L0CA 2I66A 1DWPA 2VNHA 3GPIA 4IAOA 3QEJA 1Q16A 4IKEA 3W2TA 4GAEA 3SSAA 4BMYA 5K45A 1A9XA 1R64A 4GOKA 2RHHA 5CBKA 2J3DA 1U8AA 1Z08A 5L8VA 4L7QA 3H3FA 4BFLA 2GAFA 2JZNA 1VJ5A 3LLUA 3OECA 4I55F 5IF3A 3L1IA 4BQFA 3ZC3A 4IJUA 2ZIVB 1MV5A 4RELA 3KSBC 2DX7A 2IYVA 1BMQA 2VZ9A 4HWOA 2IOFA 1CT9A 3OPYB 4A8TA 4MPJA 3WB0A 2O0LA 2FFBA 2BM9A 2YX1A 1DQPA 3V8NA 3IP9A 4BZQA 1THMA 3EFOB 2IL1A 2OZKA 3MRXA 3ZEAA 4ZZ1A 2YIDA 1E2NA 3GRFA 3RPEA 5I7SA 3AZQA 4FSHA 4OB8A 2R8RA 4UNIA 4Y2SA 3U7IA 1GDDA 5CFOA 2CZCA 2GBIA 5IWCA 1JKJA 1KO7A 3BHMA 3IQXA 2M6LA 3RROA 3EDMA 4RNDB 1BAPA 1H2YA 1AS0A 2ZROA 3OM1A 1A9QA 1V5EA 3QELA 4NTZA 2HADA 2QVGA 4QFCA 3TSOA 4D3DA 4FGJA 1Z6ZA 2UUBB 1JT9A 3RYCA 1WCIA 4PW0A 3RYFA 3NAMA 2JS7A 3C39A 1XQ9A 2HMUA 3BVPA 4U6NA 4LRWA 3CF0A 2BONA 1VL0A 1NW4A 1SU7A 3CKLA 4C1NA 1ZK3A 2QL5A 4OHKA 2C92A 4N3CA 4YC7A 3WIBA 4GOMD 1O87A 4YUXA 3FJ1A 2VYQA 5EPUA 2JLBA 1KVUA 4F3TA 2NO6A 2C4NA 2P2SA 2H7CA 4A2PA 2ZCUA 3OZSA 3C8DA 1HURA 1SBIA 2HBYA 1KZYC 2BFBB 3LUCA 2I4TA 4F1WA 3HADA 3TAXA 3ZWDA 2B7CA 2GN0A 521PA 1O94A 1Y3BE 4ZOAA 2E4WA 2IPLA 2OMKA 4P98A 5IAJA 4A5SA 4OFZA 2IJGX 1QONA 4DB2A 1Q14A 3C7AA 2QR5A 2QMQA 2EX0A 1R0LA 3EWIA 1ECFA 1JZQA 2G1KA 3NWOA 2Z1MA 4PAOA 4TLAA 3IKVA 1T8SA 1YRLA 2YJTD 3L0PA 1E6CA 2OP1A 1I3NA 3X1ZA 2CT8A 2JAWA 4PFJA 3ADBA 2VDNB 1NA5A 3PNOA 1Z9BA 1TM4E 3EZ9A 5A3QA 3QEMA 4N6NA 5LSAA 4B8YA 2VJBA 4KLZA 2CFCA 5B36A 1EHIA 4RIEA 1SQ6A 1U8FO 2Q4RA 3DB2A 3UKOA 4E21A 1RXSA 3UMBA 4EGQA 2YV1A 2PT9A 4LS3A 5H83A 2AR9A 4AVYA 4B3BA 2C3OA 4ER7A 5I9BA 3QY0A 4MI9A 4TN5A 3VJKA 1V4VA 4I55B 4KHPB 3NV9A 3HDYA 2IW1A 2IYNA 2JD2A 3WB2A 4BBZA 3DFKA 1B6RA 3N3AC 3ZOKA 1NF8A 4Q01A 1Z35A 2FSGA 2WJWA 2Y9MB 1BS1A 1RM0A 2R11A 5EAIA 1U31A 1BNCA 4PPNA 4E31A 2Y99A 3GNLA 4HDQB 4JOBA 4K6HA 1GNPA 1TKAA 4MS1B 1XA3A 5KX5F 4EB6B 4MQBA 4ZVNA 3C98A 3IXLA 3RVSA 1BMTA 1W4AA 2EFJA 5HPYB 1PJCA 3AONB 1Z68A 2QR3A 4D46A 2C3YA 2FX3A 3Q1LA 3VU1A 1D6SA 3HHEA 1ULBA 3IP1A 4CKWA 3GDGA 1G16A 2O5CA 1C0PA 1IPFA 3UK1A 3NUGA 4XOUA 5DLEA 1LD3A 3UGKA 4BNYA 3ZWOA 3FTEA 1YA6A 1QFJA 3IQGX 4GOJA 10MHA 2HPAA 4M1ZA 3T1OA 1SXJC 3WIEA 4WV3A 3RUFA 1U2QA 1VPLA 2WMNB 2QAIA 3FTPA 1P18A 3L49A 4IMJB 1LLFA 1JQDA 1SCUA 1IRXA 3NO4A 5K20A 1H4QA 2Q5HA 3V2GA 4CTJA 2CLHB 3VVCA 5IT9A 2VTVA 1SVSA 3HB9A 2DTDA 4RHUA 3DVLA 3IYLW 1HE4A 2CNKA 3FPKA 3MRSA 2CC2A 4FN4A 2X6TA 3JRWA 3FYDA 1V3QE 2RH9B 4D6PA 4D8UA 4O1IA 3DDZX 3A4NA 3JD4A 4WDRA 4CEJB 3QTTA 4GR4A 3E3AA 2FPOA 4Z3OA 2FRVA 3SSNA 3M1YA 3VYUB 1KMIY 1RI5A 2JFOA 4R1LA 1NT4A 1GNVA 3NC1C 1MKYA 1VKHA 2DBVO 1RT9A 5FBHA 1X2BA 1ZUWA 1TT7A 3PU6A 1D4ZA 1XWFA 3PGA1 5CGQB 1KSGA 3TUIC 4BLWA 4C6TB 4YMHA 1R74A 3JPYA 4JOSA 3ASVA 1CUUA 4MUBA 1ZK4A 2EVWX 2Q2OA 4UKDA 3DDWA 1VCNA 1I1QB 2CE7A 1SUCA 1QHXA 3IIIA 5H7XA 4CEHA 3BGSA 4TSKA 1EXMA 3DHNA 3QP9A 3A9TA 3F7NA 3NLLA 2SKEA 2NVUA 2QXUA 3BX1A 4X6UA 4MJ3A 2RGAA 4GNKA 2NZ8A 3CNHA 2VAMA 3PRHA 1F4PA 1HE1C 1II0A 3LDFA 3NHJA 1GRRA 3IEKA 3VNAA 3GPLA 4MW4A 2GBPA 2ZTUA 2Q1XA 1AY0A 4JT2A 3BTSA 1Z4KA 2QEQA 4C29A 4RTKA 3R24A 4QD3A 5DTEA 5KNBA 2YVAA 2XDQB 3MFYA 4X41A 3CW9A 1M7GA 3EVBA 4GMDA 2W43A 1IWBB 1U3TA 3X2SA 4P5PA 3ZGXA 4C0KA 4ZJUA 1KKMA 2NU8A 2FUG6 2C4KA 4L2IB 2Q45A 3S8MA 1T34A 1O08A 3DTYA 4IIJA 4URFA 4ZXPA 1HE5A 3NKVA 1Q17A 4HT3B 2P9FA 3I9MA 3OFKA 4Y6OA 3I8OA 3YASA 3ZY4A 1R0YA 1ZCFA 1JFFB 3FHLA 3PKIA 3RW9A 3LUGA 3ANXA 4QODA 4QU9A 5ITZB 4BB0A 1A27A 4S2EA 1KBOA 1NWHA 2ENWA 3A4YA 1ORIA 1RYEA 3FMPB 3P20A 2JCXA 3OWXA 5HGJA 2OYRA 4IDGA 4BB6A 3BIJA 5HQJA 1E2KA 1XJCA 1YQWA 2ZRKA 3GEIA 1W2WB 1RJ9A 1TO6A 3DVRX 4TLCA 5FPHA 3W90A 5FAKA 3MXOA 4LYGA 4TTQA 1SOVA 1P73A 2QGFA 1TI7A 3UJAA 1JR3D 5C5EA 1L5OA 1NUSA 1YDWA 1KP2A 4YUWA 2IXEA 4HN9A 3AY0A 3RBVA 4DA8A 3EZFA 1U0TA 3O26A 2LR0A 1A8PA 1RE0A 5ES4B 5IM4A 1CS4C 1LW7A 4JP8A 5H8WA 1QIEA 2D0IA 4PBSA 2GBFA 1XFDA 3QU9A 2IDMA 1WNTA 2FKAA 3MSCA 4NBSA 5GQSA 4P32A 1WVMA 1EMDA 2IUFA 2Q3JA 4ICIA 1KY4A 1RLUA 2BHTA 2VF7A 4EHLA 4C0BA 3QENA 5CLIA 2C4WA 4N3NA 2FP4A 4Z9AA 2WV9A 5FA6A 3DZJA 4R1OA 3D8SA 5J1TB 1MQ8B 3RU7A 5BNZA 1UAYA 1Y42X 4ZWNA 1E8NA 3RARA 2J0QA 4HHEA 3HYTA 2C9YA 5B12A 4DFDA 2Q0HA 3TTYA 4F06A 2CXPA 1TJPB 2QT0A 4CM4B 2O3RA 1OSNA 1JJIA 4UPEA 2FE1A 1NW7A 4IOMA 5ALPA 5ICGA 1X39A 4XUGB 2ZP1A 4L4ZA 2JJ1A 2PH5A 2PK3A 4L9WA 5GV7A 5JQGF 2WBLC 3C48A 3DO5A 3MWKA 4G4JA 4DREA 4JXXA 1I7SB 3NYRA 1E9BA 4L5IA 3BIFA 4Z7NB 4P3NA 1Y3IA 3M83A 4G37A 1G7CA 3DPIA 4ZRNA 3C3CA 3ENKA 4K6MA 4RZHA 1H6DA 3BXOA 5CA1B 5T7BA 2DCMA 5LZ5A 4BVLA 4BFTA 2GXUA 3R0VA 4H1VA 4NP6A 3JD1A 3KDSE 4G0WA 3L1UA 1UBTS 3RTAA 1KKUA 3UJ7A 1XA4A 3GUYA 1U7UA 4TZKA 4P2GA 5DNYB 4OXIA 4FHZA 1G66A 2XQFA 4BFYA 5CLQA 3AY6A 1YK1A 4EFNA 1Z6QA 4U2EA 5G0UA 3TI7A 3Q9NA 1BWSA 2IC5A 4DV7B 1L5NA 2IBMA 1GKKA 3KWLA 4EPXA 2FU5C 1UDRA 2R2AA 4IPTA 4FBGA 1DB3A 3OC0A 4MYSA 3FZGA 4YO8A 2JLZA 2IYRA 2JDID 1RKVA 1Z5OA 1DG1G 1SHZA 4NICA 4F21A 1KKLA 5DIZA 4JLMA 4TS4A 4MTCA 1V1RB 2F48A 3S99A 3OF3A 2NPOA 2QW1A 1U94A 1ULAA 2YVLA 1RE1A 4GECA 3TGWA 2NUTA 1BEZA 1Z5NA 4NKRA 1DUSA 3C6XA 1A9SA 2E55A 2W2OA 2YIMA 4MJXA 4IIVA 1LDGA 4Q4AA 1GPBA 2XUIA 6REQA 4LWOA 4DQ0A 1RHJA 3K9HA 5DBIA 2HHCA 4FILA 4Q7QA 4PS1A 1ZJWA 1DXYA 1NX9A 5LZ8A 3UV3A 1OV6A 4YXWD 2ZJ1A 1RAFA 4URWR 1U0RA 4ZYWA 1NATA 2NZVG 5A05A 4RFSB 1F0YA 3Q7SA 4B84A 1AKWA 4B0PA 1HFEL 2MSDB 4WA7A 3WS7A 3QVLA 6PFKA 1CXZA 1VP9A 3AG5A 1LQ2A 5J63A 4XQ9A 2OSVA 2HAEA 4QOHA 1FNMA 121PA 5JRZA 1USUA 2H2WA 2W6NA 4K0RA 2PQ6A 3BL8A 1MOSA 1OYWA 1T6ZA 2IY8A 1MG5A 1R12A 2QZJA 3CVJA 3IO3A 4MV5A 2R62A 2BE9A 4H3KB 2JFHA 2VNSA 2WD8A 5I4BA 1F12A 3ZTWA 3VU9B 4ER3A 3JCZA 2I62A 2OT3B 1Z2DA 4P22A 3L7YA 3WBKA 4C01A 3FGPA 1V5GA 5GZ6A 1LFDB 4I4TA 2G5CA 3GDWA 1FSGA 1L3CA 2PGOA 1DAHA 1KYVA 1KAQA 1QLJA 2PJZA 2XADA 4N5MA 5IZ4A 4JWKA 2FPKA 2H1OA 2PX6A 3ZR4B 5HTOA 2P5UA 3Q0IA 2PRYA 3P0JA 1VDZA 1CUCA 4I5DA 3B70A 5DK6A 4DMUB 1ODSA 5AVTA 3R3JA 2N0SA 2PS3A 1PG2A 3WNDA 3KV1A 5DGTA 4F3RA 2C0QA 2QV7A 3WO1A 4CFZA 1QE0A 4GQBA 2RAFA 2VAVA 4JP1A 2AXQA 1Z2CA 2QW8A 1CZKA 3VTZA 1EJ6A 5B6PA 4X1IB 3H1PA 2ZM5A 2OEPA 3QITA 4I19A 3AI1A 3D4LA 2EP5A 3KVNA 3M5PA 4H7HA 4R8RA 5FJIA 4DBVO 5ALRA 3UBTA 5EIBD 2QQFA 3ZYZA 1XALA 1AGXA 2NAFA 1R6TA 3EE6A 2XYVA 3UJHA 4Z51A 2MMGA 1NUHA 5DW0A 1A8HA 3JV7A 4MULA 2INGX 1I9CA 1UDBA 1XEXA 1Z56C 1TM5E 2ANBA 3E4DA 3HKBB 3L5OA 4R2IA 4X65B 4WBNA 3BMXA 4MEJA 1DBRA 3D2BA 3VOBA 2UZ1B 5A2QA 5JJCA 3AHGA 3D5QA 2X19A 3I28A 4PFQA 1VYTA 4S35A 2ZDHA 4JL8A 4ZI5A 4PYKA 4PYNA 4CIDA 2F4VB 1U0BB 5CYFA 4BAGA 4N76A 1T91A 3ZI7A 4BVHA 5A4DA 1L9XA 3G1TA 1UR5A 1YR7A 2GFQA 4DEVA 2CEAA 1T5TA 1NRXA 3RC9A 1N2BA 3W8DA 3BB4A 2GJ9A 1R6AA 3K5PA 3NXSA 1NF2A 2CUZA 3IDOA 4GHWA 3S7ZA 3FOEC 5MN6A 2C4TA 1DT3A 2PUFA 2H5IA 3HGQA 2Q2NA 2W83A 3ELBA 1RYZA 1CVRA 2K5UA 4ND8B 4IG9A 4LMBA 5KB3A 4QECA 3EZNA 2Q46A 2VEDA 2PMEA 1GPNA 5BYKA 3GT7A 1X1DA 1E5QA 2L17A 2ZI5A 4J2HA 2OO5C 1NVDA 3AFNA 4XVHA 1Q15A 4JJ4A 4Q5IA 5FWDA 3D3JA 3EXFB 2F43B 1FVXA 3TSWA 2AQIA 1CIJA 1C4KA 4BNUA 1JJFA 2QTNA 4EY6A 2YUIA 2I4NA 3FFWA 1EJBA 3I6MA 2H11A 1XNGA 4KQWA 4N0QA 3UPTA 4CT5A 4HGQA 2B92A 1ESEA 3BXZA 3CRMA 5FUYA 3DCNA 2HRQA 4ASUA 3OIWA 1P5RA 4D98A 2WKSA 3NBMA 5J47A 4YJFB 3KB1A 3UK0A 1UDAA 1ZEMA 3A11A 1ADBA 1JVSA 3B3FA 3SS8A 5A2GA 2ZYAA 4UJ5A 2X9GA 4JIGA 1X6VA 3DFZA 2QKYA 3D6JA 4WKOA 3N6XA 1R27A 1KC1A 5FTJA 1GGFA 4ZQEA 1CUIA 5JCXA 1J39A 5DVZA 4AP5A 3N74A 3AUAA 1E2GA 1IOZA 1SB8A 2A78A 1CNFA 1DXOA 2IRWA 3NANA 3OQJA 4UUNA 3H2GA 2QTGA 3KKLA 4ACAA 4DBLC 4QOGA 5LYJA 3ROEA 3IVXA 3VU9A 3QW4B 2FNAA 3VVBA 2D59A 2KLBA 3CRNA 3PUYA 5GZ1A 3RQIA 1GNQA 4QRHA 4X7MA 3U7RA 4GYKA 4PQFA 4O3FA 1VIMA 4YY3B 2SNIE 2MYPA 1C7ZA 3KUCA 1RXCA 2RONA 3FNEA 3OEWA 4K88A 4QXMA 5FI3A 3DDHA 3NEYA 5KTPA 5EVJA 4QOFA 1M1YB 3KLNA 4JQSA 2WA2A 1JIVA 2HCTA 5EA2A 2I6SA 3R5XA 1DTSA 2Q6KA 4IFIA 4AYXA 3RUHA 2GXAA 2FOIA 1AKNA 2ICAA 3INYA 4OMCA 5ALLA 3A1VA 2XNDD 4HK4A 4YMWA 4WFQA 4A03A 1OYYA 2YC2C 3A1FA 4OQNA 3CC8A 2PMDA 3J81A 3UATA 4AW9A 4FZJA 4S12A 5F4BA 1H23A 1S4QA 1XDUA 2LWIA 4I50A 1Y3HA 4KHZA 4KQHA 4NJEA 4RHTA 4AX8A 7REQA 2OZLB 3GBSA 2O20A 3K09A 4RVNA 2UUPA 4EB3A 3IE1A 2WHPA 4J16A 5E0OA 4KLNA 5FBLB 4M1SA 4DMLA 3RBXA 1OAOC 2QTFA 4PYMA 3UBMA 3G5AA 1C3XA 2X15A 1X1TA 5TPZD 2Y1GA 3U44B 3KDAA 4OXNA 2GK3A 3URMA 4ZV9A 1I8TA 1TMYA 5D3MA 5AP9A 3DWIA 1RQ2A 4DLUA 4ND3A 4A23A 2E5LB 2VWGA 2FEAA 1PN3A 1M2VA 3GZNA 2W6IA 1FL9A 2AFRA 3G9XA 1EX6A 4RQBA 5DHFA 3CQ9A 3G2MA 3QU7A 3VR2D 1ZD2P 4MA0A 4BAZA 4DSAA 4ZI7B 5B3KA 5JSQA 4OHYA 2BZ1A 3ZDXB 1PR6A 1R8QA 1G7SA 4WECA 1M7BA 1NSYA 1WLSA 2PH7A 4MUEA 5CXUA 3WTCA 1SELA 1JU9A 4YMGA 2XB6A 1LBHA 3GYGA 1XMOB 1W59A 3TAHA 4RO0A 2CDAA 1C0KA 2GOYA 1K7YA 4HFNA 3HSKA 4C07A 4C7VA 2W37A 1GNSA 3WWCA 1Z0KA 5I9TA 3LYHA 4NXMB 4LRUA 4OREX 1LDEA 3TZHA 2BSXA 2XGMA 2ZVJA 3EY4A 2R00C 4S05A 4HB0A 2QD1A 1DDIA 2GLUA 3MPOA 1E96A 1FP4B 5JO9A 4EG1A 4D99A 3K1AA 1WU7A 1SXIA 3H5LA 4OI0A 5HZKA 5ESXA 4JB8A 9ATCA 2ZJFA 3H6GA 2HSJA 5DGCA 5IMSA 2HQSA 2HJRA 2DECA 5JXWA 3ZHZA 4MPPA 1DKOA 1Y1SA 2BI8A 2ECQA 4UDXX 3TRIA 4WRRA 5B6IA 3PGVA 5KTTA 2TYSB 2ZUEA 1A69A 1QK3A 4R8KA 2MTBA 4LXYA 3KAJA 5JI3E 4D26A 4Q3DA 1G5QA 2FN7A 1GRNA 5JVDB 4REOA 3IAAA 1FB5A 1FS5A 4CODB 2WWHA 1DO2A 5MN4A 2H1WA 3HB7A 1CUDA 4DTIA 2ZJ0A 1YC2A 2A1TR 4G36A 1MEEA 2O4UX 4EHJA 2V6FA 2IYTA 3FIUA 3IDFA 4RWEA 4FCVA 1XZEA 3KJNA 3LGAA 1IQPA 1BZYA 1F3OA 1O03A 2N75A 3CB2A 1XTJA 2QG4A 1T1EA 4IV8A 2ODQA 4LXGA 5DM2A 3RBZA 3QPUA 4KQXA 3GLGB 4PZDA 3ZX4A 4DY6A 1P1FA 4LJSA 4BVFA 2ZCJA 2YNMA 1HDXA 3N5KA 3W9BA 3R8XA 4DDHA 3L1VA 1T36B 2G04A 1XMPA 1N8SA 1CRWG 4EI9A 3D4IA 1COWD 5LR6A 1XEWY 1EE1A 1Y63A 2J3LA 4NI5A 2PX2A 1WDLA 1AKEA 5TDHA 2M2IA 5E2IA 1KZ1A 3D0KA 2GD6A 1XZNA 1E2HA 4DUPA 3EF3A 5IANA 1MHTA 1JDJA 3LTNC 3CSDA 2JASA 1B26A 2PZEA 1YZVA 3EZLA 1DMRA 2NU6B 1GGNA 3HSYA 3SNHA 1M6NA 4JA2A 4UBKA 4B83A 3TVTA 1N4DA 1F3LA 1TX4B 2G07A 4J0IA 2QRKA 5L53A 1BGXT 1MP0A 3F4BA 5EUMA 2V6GA 3UUEA 3RADC 5JCJD 3N59A 1PS8A 4YLGA 3RVNA 2AUTA 3UUGA 4JYZA 4NENB 3LKBA 4GOOD 4YMIA 4AS3A 1QFYA 4BO1A 4PY2A 1RQLA 4A0HA 3IFSA 2VDWB 4EHBA 1JF8A 4R9VA 3D1VA 1EU1A 4IUCS 2Q6VA 4CKBA 3TW8B 2HXSA 5THXA 3A6EA 2HB6A 2VAXA 2V8OA 1P80A 1Z4QA 2BEVB 2D2XA 1Y6JA 5AXBA 3VH2A 5I7EA 2QMEA 2RK3A 1OXTA 2CNOA 2V1UA 2CV0A 4YAIA 4P35A 1RLJA 5K4GA 1VTKA 1DOAA 3PLNA 1OXVA 3VYTB 3VPFA 5DMXA 2XUZA 2VVTA 1TK9A 3BL5A 1K97A 3EVNA 5P8WA 1XFAA 1WTAA 1YB2A 2ZWVA 3BM5A 4JLAA 4YRJA 5JY1A 5KINB 4PSAA 2IHKA 3W9UA 2HM7A 1CUXA 4BTLA 3IT2A 1KGDA 4LTNA 4WFJA 2G9ZA 1KPIA 3ISTA 4BNZA 3I23A 3LDHA 3FSRA 1T2VA 4PNPA 1U5AA 1JDVA 3KT6A 3SBXA 3GLFE 2VQSA 5L40A 4B75A 1GZSA 3Q8KA 3GJXC 3QKSB 4EELA 4TL7A 2C8JA 4KLCA 3B3QA 3EVEA 3V8EA 2FPGB 4TMVA 1E2QA 3ZEIA 4QRIA 5IW8A 5C53B 4OUKX 4ECAA 1PZXA 1U7OA 2FMTA 3U3ZA 3LX5A 2I6GA 4DARA 1O5OA 2ZE6A 3HDTA 5E38A 1KEKA 4YIHA 1L7PA 1Q0UA 3KX2A 3HJFA 1CUEA 4TN1A 4O4LF 3ZX5A 4GZ6A 4CCAA 2Q07A 1QANA 3EIUA 1PZGA 1QH8B 2XIQA 4KPUB 3I30X 4RIFA 3NCTA 2NSYA 4G89A 4RZ3A 2AMFA 2NO0A 4HUQB 1ZW6A 4WKNA 5FT9A 4D7AA 5KC8A 3DUFB 3C8MA 2QLJA 4FE7A 4FQ7A 4RE5A 4HGZA 3VDNB 3VR6H 1P2DA 1MJNA 1MRNA 3QI2A 2MR5A 3JS5A 4AM8A 5LU8A 3NOQA 3RJMA 1Z2AA 1ZXLA 3CTMA 4GICA 4JC8A 3T5DA 2BGIA 3UFXB 5JMTA 3NM4A 1GPKA 1TEVA 4LJ5A 3WDSA 2XCSB 1REQA 3G59A 2WJVA 3VC2A 3OETA 2XWSA 2WF5A 4PAGA 1SM4A 3IIEA 3AF5A 3E22A 4QEKA 4WN9A 4NOKA 5JWOA 1XRPA 2J0SA 3KLOA 1YMUA 2G9UA 2DQ4A 1XDGA 4FOPA 5KYTA 2V6MA 2WVGA 5KYUB 1G2PA 3C4QA 4WOPA 4O8ZA 1RZRD 3C3YA 2GAAA 3ENZA 5JXGA 1BEEA 1XDBA 3GA7A 2M6KA 1R8XA 4MHTA 3FRIA 5HF8A 1CJBA 4QUHA 3GEMA 4KL8S 4C2TA 4PLCA 4QFMA 3K0HA 1FUIA 5AM2A 2P9QA 4KGDA 5TS2A 2X2OA 4LOHA 1NSFA 3FCAA 4UEOA 3K0FA 1MR3F 3OD1A 2FJPA 2F59A 4QVIA 2X42A 4B45A 2C0CA 3EWAA 3TEJA 3JD0A 2OBYA 3SJBA 1JMYA 4QDZA 2C2BA 4NDZA 3FF4A 3R3SA 3CEMA 1U80A 2OOKA 3LC0A 3P1JA 1X1QA 2CWDA 3MJVA 1QBKC 3UK6A 5HOEA 1U2RA 1PZMA 5HTKA 3WGYA 4H1WA 4ZKDA 2I8AA 4RTQA 3OBIA 4RQAA 1WIWA 3U3DA 3WXBA 3RTCA 1K9VF 1KJ8A 1LJ8A 1IZ8A 2PG3A 3L4JA 3CJTA 3DO8A 2QJRA 2XJ9A 1M2GA 1PJ8A 1SVMA 3MN1A 2RGNC 2GASA 3AEKB 3BK1A 5G02A 4QYIA 2X9QA 7REQB 2ZTLA 3C7TA 4Y1FA 5AM0A 2HHJA 4WNIA 4IJVA 3AJEA 2W6JA 4B6PA 2YWXA 3I39X 2B9VA 4MUKA 4ZRMA 2ZSJA 3DLBA 1THTA 1Y4SA 2QPAA 3MWGA 4O8CA 1E3JA 5BSTA 5I3CA 5IG2A 1Y8QA 3LCVB 2ZE8A 4MA4A 4XDYA 3CW8X 2WD7B 4XUEA 4RKQA 1E1QA 1O6ZA 2WC1A 3HM2A 3T5MA 4EJFA 3DMTC 4KIWA 2VHQA 3N2ZB 1E92A 1CJKC 1E1RA 2OXRA 1XTBA 4IQ8A 3TOSA 4XIGS 3WLJA 1QG2A 5A71A 3SHFA 8ADHA 4Q05A 3FR8A 4I4LA 1Y82A 1SKUA 1T25A 1WA5A 3JAKB 1GV1A 1NN0A 3O0TA 5IZCA 3W9SA 3Q8WA 5A7GA 5I9IA 2NU7B 5BURA 3MWDA 2CXXA 1D0IA 5AJYA 1LSUA 1YL5A 2F3PA 2PWZA 1SOUA 4IIJB 1DSSG 3ILHA 1N2CE 4ES6A 2P79A 3U60B 4IIEA 3IJ5A 5DRYA 2A0KA 4RA6B 1DKMA 2RGCA 2BFOA 3A05A 2H31A 2ZPTX 2HTEA 2G0AA 2C2OA 1CJCA 4Q16A 1GUAA 3CUEF 1W8DA 3ADPA 4DLLA 1SIUA 1YL6A 4TTPA 4P3PA 6LDHA 2AQ8A 3IAHA 4X64B 4DC1A 4AAYA 1JHMA 4C3VA 5LOVA 1JE0A 4K7JA 3NBQA 2P5YA 3EPPA 4MRRA 2Z0MA 2POQX 1PJ4A 4LC9A 1ML3A 5E7MA 3VV2A 4P7BA 3Q7PA 5CMLA 1UXGA 2WSMA 4IIHA 4XCXA 1V96A 1I9GA 1UXJA 3C43A 3FCCA 4BVAA 1YZHA 5FHQA 1LQUA 5FI0B 3K8YA 1NLYA 2OG1A 5DH9A 4WH0A 1MOQA 4FOTA 3A31A 2DY0A 1OT3A 3JATB 1QRRA 1RR6A 1TJ3A 5A3JA 3PF9A 2OGUA 3UF0A 3HE3A 1R6VA 4RACA 4FWIB 4RK6A 3SLKA 2VF2A 3DDNA 3UMRA 4AL4A 1U2DC 1SRQA 4HD8A 3SE0A 1E3DA 4B3DA 1UK9A 2AF4C 1JEAA 3MAGA 1P19A 4UE6A 3Q40A 4Z2YA 3GEGA 3TJRA 4DR3B 2P91A 3PWZA 1FXUA 3CJRA 3VX4A 4JVLA 3VKGA 1M2WA 3TG8A 3CKKA 3KXIA 2GO7A 4CNBA 3A2MA 1GTVA 3G6KA 2K2WA 1F0KA 4R2KA 4Y6RA 2IIPA 1VKRA 3D02A 4H15A 4TWRA 5DGIA 3DOCA 3RRNA 5L3QA 1AUOA 4JFAA 3W5HA 3IMCA 4LCJA 2ZJ5A 4QTZA 5TRTA 1V5WA 2UZ1A 1E61A 4HUJA 2XXJA 1D4FA 2II6A 3K92A 4G4SO 4G1EB 3TRJA 4DLRA 3P2EA 4QQFA 3MLAA 2UAGA 4TL8A 4WXRA 2D1YA 2PY6A 3VSAA 2QRLA 1KWGA 4AMZA 1MT0A 2DAPA 2DKOA 3BE4A 1SVLA 4E4RA 2OENG 3F90A 5LN1A 3AKEA 4MV1A 2O2IA 3CX3A 5TEWA 1KMHA 3BTOA 3MIIA 4G2NA 4F1KA 4NJEB 5ESDA 4C21A 3BSFA 3K9QO 1H93A 1XKXA 3L0OA 3FFBA 1OPRA 2VJMB 3OQPA 4MW6A 3BILA 1KU0A 3D7SA 3MJCA 2IEBA 1CBUA 2O5RA 1G3QA 4LOJA 5AI5A 5HK8A 3LA8A 3ZCTA 1T2UA 1XZJA 4N8EA 5U4XA 4ND8A 3DV0A 4GUAA 4HNRA 4XLTA 4GI1A 4R1MA 2GN2A 4RHEA 4KGXA 2A9RA 5K3FA 1XO1A 1ZIOA 2ZVQX 4G9EA 4X8LA 3T4EA 1CDZA 3FOZA 2CXOA 5CLFA 3DQZA 4FMBB 4JY7A 3MF4A 1FP4A 3EXFA 1RRMA 1XR3A 2C88A 4JP2A 4Q1EA 3ZY6A 2FZGA 3NOOA 2QM3A 2BFFB 4AMGA 1X7WB 1C7JA 4PONA 4XGRA 2J5RA 2BJHA 4JLSA 3V7NA 2FJ0A 2IYEA 1BDIA 5ENDA 3B6MA 2WE8A 4TMYA 4BN5A 3QA9A 3T1TA 2SBTA 1KQOA 1YAJA 3AVWA 3M5WA 2O06A 2OBBA 1AZWA 1L4LA 1R6UA 3GAAA 3HKCB 3IURA 4YFYA 2ZAGA 3UMMA 4OA5A 4YCMA 4JBLA 2QP4A 4D0RA 4RMJA 3VX3A 4O4JA 2BF4A 2GD1O 1TCAA 2UYOA 4MIYA 3W2HA 3TNFA 1L3IA 3SP1A 1IZZA 2VP5A 3CUKA 3NYQA 4ZGGA 5BUZA 5KNDA 3G8DA 5EVCA 2FPGA 4AROA 5G41A 5F77A 1KOGA 3WRVA 1BU5A 4N3BA 3PP8A 5JYBA 3RFFA 1WMDA 4M8SA 3W78A 4EJSC 4LYAA 4Q93A 5KQSA 1VJDA 2NO1A 4NATA 4KXFB 2V54A 5J2UF 4ID3A 1O8CA 1W52X 1JN0A 1W4CA 2DF8A 2O0KA 1M33A 1RQNA 1JEQB 2OOSA 3H8SA 3KQPA 3H8VA 1QYRA 2ZSEA 3ILVA 2XVMA 4FTWA 4B4OA 4UTZA 4BUZA 2HWUA 1Z5GA 2EP8A 1EEHA 3MRTA 4Q4CA 4Z9YA 1KBQA 4Z3KA 3B3GA 1C1HA 1L5RA 3OZWA 4C7OB 1O4WA 2Q5CA 1GZ4A 4RDCA 1RXVA 3ANTA 4EFKA 5EJ6A 2QF7A 2VYNA 1BOOA 4EGAA 1CNEA 4R0NA 2CV2A 3MMSA 3W5VA 4OGGA 5HIIA 1H6BA 2CMHA 2NZJA 2AZXA 2BJWA 4KOEC 2FRDC 1QGUB 4K0KB 3HVJA 1ZXXA 2WUGA 3PZRA 1PJBA 2LKCA 4UPVA 4DM3A 4Z1MA 1OLSA 5BMVF 5C8VA 2H6EA 2GD0A 1KZ4A 3MS2A 1AS3A 5FF9A 2OXTA 4AS2A 4EPTA 2CNLA 1XYYA 1W96A 4JLBA 4GPBA 2CXNA 2ZRMA 3CZ4A 3J81k 3DTNA 3WJ2A 2FN3A 1L5VA 3SSMA 2G1PA 1YUMA 1Z0DA 3L02A 1V8DA 3IHLA 3ODPA 5EP4A 1HK7A 3E58A 5G4KA 4FHCA 5CAEB 1ISRA 3A2NA 1P2FA 3H1GA 3IPCA 3TLEA 1JR3A 1IBCA 2QTTA 1Z7BA 2FKNA 2GI4A 3QPAA 1SGWA 4ITRC 1XLVA 4CLXA 5B55A 2Z6UA 1UKEA 1UJCA 2QLBA 1JSCA 3OLCX 5ECGC 1CHDA 3JQAA 4ATNA 1G3IA 1DGQA 3SYKA 1ODCA 1GPUA 2XQVA 5BR7A 1HV8A 2WU1A 4G1BA 3ZDYB 4QKQA 4Z7OB 2WUFA 2FVYA 1NRWA 3OSZA 4DMGA 1AHIA 2RCYA 1ZH0A 3CCBA 2JG3A 4AJJA 4HDKA 2KM1A 4ZHQF 4BVKA 3G5LA 2Y93A 4XCQA 1KXZA 1JMVA 2OXCA 4FIZA 1FYEA 2O2EA 1O97D 4YRRA 2RHTA 5EC8A 2W11A 2F1KA 4BP8A 4C78A 4XD7D 4KNYA 3E1KA 4A2QA 1C3OB 1XZDA 4G0YA 1FP7A 2JI9A 2VS1A 2C3PA 3CU5A 3JQQA 3V8RA 1XNQB 1I10A 4I46A 3MWLA 1ECPA 1FYFA 3L1HA 4MPDA 5BN5A 2IS6A 1CUVA 4K6OA 1EGHA 1Z7YA 3RRJA 1CEYA 2HJHA 3QLTA 4RYLA 2OHIA 1HNNA 2VHUA 2VTBB 4WNAA 3ZKWA 4C6RA 2UV8A 1RCFA 1PK9A 3AF0A 2ANCA 4RF4A 1XJQA 4RZ2A 5T5QA 1G7TA 1BG6A 2CK3D 2COKA 2NUPB 4ZANA 2W2XA 3GT0A 1NJGA 3PKZA 2GFHA 1LZKA 1M34E 3ABZA 4BE4A 4X0EA 4J9VA 1X87A 1L4KA 5C51B 2C7BA 2E18A 1ZICA 4A6PA 4DCMA 2ERCA 4OIMA 2IELA 3ILSA 4QM6A 3KFXA 4ACBA 4R9SA 1Q50A 4RY2A 4W5WA 5EINA 2ZULA 2WFLB 3SQDA 3ETHA 5FBRB 5KOHA 4O1HA 1FUUA 3H9UA 5D5PA 4C22A 3SM9A 1KWKA 1MABA 2VA9A 3IDAA 2PQMA 1EGMB 3EAQA 4OATA 5H9VA 2XZTA 4F6LA 3G6WA 1XHEA 4C30A 2QAGB 5IU6A 5TQJA 5KU1A 4BQPA 1QH8A 3DNMA 3F9CA 3IQIX 4KPUA 4RK7A 4Q15A 4HB4A 1LSOA 3KO8A 1XQ6A 1X94A 2BFMA 5F5NA 3UXMA 4BX9A 5T8KC 3H9BA 4MIOA 1AMNA 3DB1A 4EY3A 1EXNA 2JDIA 4H7IA 3Q6NA 1GKLA 3BE5A 1W9HA 3RVJA 1Y3FE 1ZY2A 3KYBA 3QF7A 4GLBA 4MEBA 4UUQA 1DG9A 2JC3A 5DWDA 3N86A 3O8BA 3ANMA 3ZDRA 5BUQA 2YFHA 3T15A 2Q5QA 5KAMA 1ADFA 1DQZA 1ZVJA 4DZRA 1UJ5A 1PG0A 2I0FA 4NBWA 2CMFA 5KJEA 3BB1A 5M04A 4EHAA 1G8KA 1I3LA 2BELA 3U3MA 1ECLA 2X23A 2C78A 2H1LA 1F38A 1D2RA 1KI8A 1IJBA 2PH1A 2ADFA 4QGGA 5ALTA 3C5WP 2M6RA 1O77A 2GZAA 3QF4A 5B58T 3VKUA 4NCIA 4F4FA 2BFAA 1YTLA 1I6WA 1PEDA 3QY9A 1YBHA 3TPZA 2I34A 2JBWA 3LD9A 4QGFA 4LYEA 2CCJA 2DLDA 4X6LA 2NSJA 2W70A 3ZE1B 4XX0B 3RQSA 4NV1A 1UUFA 3E4CA 1NP3A 1RJ9B 3OO0A 4DG5A 1KI6A 4OU4A 5FH9A 1V7PC 4IDFA 2YR0A 4O2AB 4F45A 2XCTB 2NTNA 2QHXA 1VECA 1LX7A 2JF0A 3ETDA 7MDHA 5T67A 2X2FA 2XRZA 4FX5A 4MB0A 4OQPA 1J99A 4QYIB 5EJ4A 4MUXA 3THYA 3QEOA 2QUHA 3UAWA 2EW2A 3DMHA 4QUKA 2OLJA 5FDFA 3NETA 2C7OA 1WSBA 3H05A 3KT3A 2CJWB 5HFAA 3KYDA 2O8CA 5KYYB 2KX7A 1YFJA 1DJQA 2OY0A 1N8TA 4LK2A 5ESWA 3EOZA 2B61A 4PCAA 2G5GX 3VHXB 5LQKA 2AFIB 3AR3A 2VATA 2Q50A 2O5EA 2FJUA 1NT2A 2IVZA 4K26A 3D1LA 3PA8A 4NFLA 5ARBA 4G5XA 4MI1A 1JBQA 2EX1A 4JIMA 4TWJA 4AUNA 2J9FA 4BJ1A 3RVDA 3EBLA 4F04A 5B57C 5AW8A 4MGHA 4PSVA 1V16A 3GV0A 4LDNA 3I0NA 3HBLA 2YBDA 3U0BA 1EUZA 4F8YA 3PR2B 2DPYA 5CB4B 5KSZA 4ZJPA 2D4AA 1I3CA 1P39A 2C20A 4GPEA 1DIBA 1HM5A 3A28A 2D5LA 4WTOA 4AIIA 2RGXA 5ALUA 5LB4A 1ID8A 1T8PA 4KUHA 3VUEA 1TM7E 2J09A 1VKNA 3AI7A 4DYVA 2JLYA 4C88A 1NAHA 3AY3A 2O19A 3T4PA 3AW8A 5ERXA 3UG7A 3MMPA 2OPBA 3O75A 4HNAB 2PUBA 1U0JA 2CGEA 4FYVA 4F2HA 5HUJA 1JKMA 1L5KA 1X86B 5CLJA 2PXHA 3VH4A 3EC2A 5CK4A 3M2TA 1PQWA 2OAQ1 3RNLA 3SZUA 3VMMA 4D3YA 5DSTA 4XQEA 2ZU6A 4NE7A 4I8XA 1RCUA 4X6YA 3V7UA 1BRMA 4DCPA 4FEGA 4DRXA 3HB4X 2IX3A 1UWCA 5A5FA 4QT0A 1DRKA 1QE3A 4AZWA 4B9AA 3UFXA 4O1MA 1JQEA 1JLRA 1K92A 1X7WA 3E3OA 4OHRA 1ZQ1A 3WHPA 3KE9A 9ABPA 1WG8A 3K96A 1LPMA 2OILA 4NQRA 3B8HA 3NS7A 1A77A 2NZXA 4AY5A 2ZT5A 1R6BX 3PUIA 1OXUA 3QKUA 3BICA 1AB5A 3HEAA 4OI1A 5KO2A 1BOFA 2O1XA 1T2FA 3S4YA 4BX0A 5AVOA 1N5RA 2OV3A 1TMKA 3NW9A 4B6GA 1RWXA 2DQSA 5FJJA 5TF0A 4DWWA 2UZIR 3DYVA 1W6RA 4MGYR 4XPIB 3JQ8B 3R77A 2WKPA 3PFKA 2QXYA 4MW2A 4G9GA 4RSMA 2X2EA 1N3BA 4LWPA 3KJQA 5CPBA 4ODIA 3F7TA 4D3FA 4N48A 4WFKA 1DCKA 5DTMA 3W0LB 2Q6OA 3P9PA 1M6VA 2YYYA 1MF7A 3H16A 1ESNA 1MDFA 1DX9A 3MUNA 1YCGA 1ZI9A 2G4LA 3KFLA 4G1UC 4K1LA 1U7WA 3R7DA 3VC3A 5K03A 2Y1LA 3HWX1 3RUPA 1JEQA 1A8QA 1ZWKA 3ET4A 4P0QB 3DOHA 2Q5EA 4MMZB 2B8TA 4TKMA 3HBJA 1FFGA 5BWMA 1JR3E 1V71A 2XUGA 4XASA 3T41A 2Q27A 3OQ6A 3PHJA 4OTZA 2BM1A 3KCQA 2O48X 3G1WA 3KELA 3NKLA 4HNQA 4Q4LA 3U0VA 2EKQA 4L0MA 3UV6A 4Y98A 2BRUA 2ONCA 4JODA 4MVJF 4B6JA 7ABPA 4I1IA 1E1CB 2O1WA 4QNNA 5HKOA 3HL0A 4F9FA 2FP3A 4QBIA 4QVGA 4GMXA 4F84A 2ACEA 4KP7A 4NFYA 2N1MA 1OBFO 2ISSD 2VP3A 1XP8A 2QRGA 1KERA 3F67A 3MS7A 1JHOA 3JZAA 3FI9A 3KUUA 2QMZA 2ZRGA 3ABRB 4JGIA 4OAQA 1RRPA 5GVRA 1WAMA 5HQ3B 4NNJA 3K3PA 1GCAA 3C3EA 3OQBA 2YYZA 2YFYA 2IF0A 2FSVC 2WAAA 3HPQA 4L5AA 3I4FA 3EMBA 2V58A 3MINA 3Q98A 4RLHA 4UATA 2PD4A 4R01A 1C4WA 4GS5A 4F5ZA 4I4TB 1J0DA 1FX1A 2XB8A 3U81A 2IY7A 1GJRA 1F9EA 3WGLA 2J07A 3RJ9A 3I3SR 2JL1A 4O2LA 2ZREA 4U8HA 2MCFA 2D8AA 1E2MA 4J0DA 5BQPA 2Z1NA 3QE2A 4NCKA 3Q0EA 1HORA 5KPDA 3ER9A 4G25A 4KB5A 3TINA 3FKQA 1IDN1 3O4HA 1ZUNB 3OFJA 4OY3A 3I04A 1YRAA 1JNXX 1M10A 4OFBA 1BFUA 1T1RA 1U9JA 5DXJA 1UPBA 1L7QA 4BQRA 1HDCA 5D5QA 5BWCA 4L8GA 3VDRA 5JDIA 2H00A 2P2YA 3E84A 3NNSA 4MHSA 1BQEA 2QL9A 4LZWA 4D4GA 3DV0B 1E1YA 5AVYA 1AE1A 4D82A 3LLMA 2RGUA 5L3SB 2MHCA 2PT5A 2ODEA 4KDEA 1FRVA 2HBZA 3O3CA 5IVKA 1QGDA 1EUYA 4NK5A 2ATEA 4CF7A 2P2DA 4ZYYA 1MU0A 1RJDA 1STOA 2GZ3A 2WD7A 3DM5A 4IDDA 4KYIB 2QMUA 3IB3A 3LZCA 1D1PA 5DU2A 2BJVA 2MWMA 5AUQA 3RRMA 3A8TA 2ZB7A 4B46A 3OZFA 3S8YA 5AJZA 4PX5A 2RI1A 3HKDB 3IA2A 1P9LA 3QVOA 4XGNA 1KS2A 3EG9B 4K5QA 5SZKB 3LQQA 2J32A 4UW9A 4BRUA 1KMHB 5A0VA 2E3JA 3N28A 1P4HA 4EG5A 2ZSIA 1G59A 3GL9A 5LZ7A 3RVPA 3H4MA 2BMFA 4DIEA 4ZVOA 1JHRA 4NK4A 3U61B 1BXRB 5J58A 2O6LA 1L8LA 3OT1A 3KTAB 5LZ4A 1QGAA 4CEIB 2J0UA 5HGXA 1M8KA 4BUJA 1JAIA 4H3VA 3FCEA 2XCIA 2C8KA 4QU0A 1I5OA 2Q1SA 4H4EA 1RHQA 4GM0A 3TR6A 2TMKA 2VHYA 1TU3A 2OCYC 2FZWA 3OMLA 4FFBB 1P4SA 4Y9RA 3UMGA 3ZLVA 4PHCA 1TD9A 4IRMA 3ZGLA 3ZCQA 4CI9A 3VZCA 3PUJA 1XEAA 1DAGA 1LX6A 1TA4A 4PWZA 3HDGA 1KJJA 3AERB 4RXTA 2REQB 4L4XA 2YNMC 1FNNA 1QB7A 2Q21A 3IJPA 4V0QA 3WIDA 1RXIA 2JZOA 4DDMA 4EI8A 2QTHA 4HQFA 5DYNA 5C1PA 1LPNA 1SBZA 3L06A 3N0TA 1Y37A 5FBKA 1LBTA 2EDCA 2X4GA 2XNSA 1WZCA 5ALYA 5E2AA 2CL6X 4LXQA 5CLGA 1LK5A 4ZO7A 5ED4A 4MO2A 3B8EA 2X41A 3GX1A 2G71A 3MM4A 1QIKA 3E9YA 5EZSA 4DCVA 1X3LA 1PV4A 4FE3A 3QI7A 1ENOA 2O0MA 3DLIA 4G5GA 2ZUDA 4M0CA 2XCLA 3TLXA 1JR6A 4M0LA 1W88B 4HFRA 3BXPA 2ZJBA 3G5UA 4FW9A 1DC7A 1T5SA 1RWKA 4HZIA 4PHGA 5JZMA 4LRQA 4QHSA 3BC1A 3PXDA 2VT3A 5EIWA 4C3OB 4TYWA 5LU9A 1IUNA 5BT9A 4Z9FA 1QCDA 4RPJA 3H99A 1JR2A 1V0JA 2QL6A 4C7KA 3IB6A 1QK5A 4KQCA 3QM1A 3RRFA 3NP7A 1JQ5A 3X1DA 3A4VA 3QF4B 2HJVA 3QX8A 4B7XA 1OE0A 2AL7A 3IUPA 5AM3A 1JNYA 3KKNA 1NAIA 5DCUA 3A1WA 3M9XA 5EKDA 4UE2A 1CCWA 1MBZA 3QUCA 1IBKB 2Q0QA 3LBFA 4XR4A 4E46A 2VDOB 2EQBA 2AT1A 3GIWA 3OESA 3VV3A 1UAAA 2ILTA 1M2FA 3HCWA 3L8EA 1NLMA 2BGRA 3ZHBA 1WZEA 2L69A 2R7AA 1X1RA 2G1UA 3WP0A 3IBGA 2CY0A 4LHYA 5CTAA 1V7CA 2CL7X 1THZA 2JGIA 3WHLA 2CLIB 1M6YA 1Z0ZA 1JJAA 1IRIA 5A3SA 1B74A 4KN5A 1GDTA 4CU5A 3IAS1 5YASA 2O50A 4G3XA 5B2FA 3BJEA 3KYDB 4FDUA 4Y1RA 1XU4A 2Z4TA 3TMKA 3AKZA 4JR0A 2FXVA 4Z0PA 2EFCB 3DWEX 3LQRA 5TPWA 5DBEX 2N47A 2NYAA 3PPYA 4DR4B 4XA8A 5FLXA 3KSAC 1GL7A 4D9NA 4KV7A 2Z83A 1JHXA 5K6RA 4IIGA 1EDBA 4LCEA 3HUTA 3NIWA 3ZLJA 1VJ0A 2B36A 1NU8A 2VJNA 5HS6A 1YQGA 2RHDA 3PV0A 3K4QA 5C5CA 3B78A 4YRAA 3EIXA 2Q2QA 3T0IA 1ZD1A 2WT8A 2H1FA 4N0DA 3HS3A 3F6CA 2X9VA 1TTPB 2C84A 2R4TA 3FSEA 1PJZA 1QG6A 4RV9A 3V48A 3L7MA 5SYAA 1A1SA 5HVNA 1C3JA 4IICA 2PMCA 5AO9A 2QB5A 1PEYA 1KORA 4YTEA 3I5XA 2R6R1 2NO4A 2VXCA 2PXXA 2Y92A 2G8LA 3BUSA 4QXQA 1K0UA 1N2EA 2HHAA 5DCYA 3P9KA 5HNKA 3GLUA 3VYWA 3L8YA 1YT5A 4K8OA 4EW6A 5ALEA 1EP2B 4EO4A 1P4RA 2QYTA 3A37A 2EAUA 1T15A 2IEGA 3AIMA 2FK8A 3PFNA 4INZA 5D5HA 2RKOA 4JASB 5ILGA 1DDOA 4AZ3B 2ZYVX 3I6BA 1W47A 3NHMA 1DX6A 4XVRA 4DJAA 1FJHA 1XKQA 5FNVB 2WP8J 4RL6A 4B6EA 3GMTA 1SIOA 1M0TA 4MJ7A 5FWXB 1H4VB 4H7EA 3ZE8A 1PYGA 2J5QA 2FPRA 4EB8A 1X13A 1HT2E 1TKRA 2IXFA 2MIIA 1XHFA 1P5FA 2ZJYA 1AOXA 4TKVA 1AGPA 1JWBB 2PMFA 3GCGA 4HVLA 1IMOA 1O2DA 1YU6A 2NACA 3LWNA 5C7IO 1CZUA 2MSNA 4QQNA 3L7OA 2QRVA 5D3KA 5E95A 1I2ZA 3ZIAD 2PUJA 3SVZA 4G26A 3W2EA 1ULSA 3I1JA 5KJFA 5CT4A 2HK6A 2KQUA 3BDAA 3E70C 3OCWA 4GL4A 4HGPA 2BFCA 3STWA 1A71A 1HYBA 1YR8A 4TWBA 2BTOA 2PZBA 3O2QB 4IX9A 3BORA 1NNUA 1OR8A 1CY2A 2Q5OA 1G6Q1 2VBFA 1HZZA 1QV7A 3H9EO 1RQGA 3EYAA 4IHQA 3E1GA 4B2PA 4KWCA 1P60A 1OGIA 1FVOA 1SVUA 4U7HA 3EFEA 3ZY2A 4HEJA 1KJQA 5DP1A 3FYTA 3AWIA 2HNAA 2AG5A 1KY5A 2AMJA 2DPXA 4JD5A 4DDKA 3JRXA 5E3HA 1I94B 4LGYA 4LF6B 1VIVA 1FFXA 1VSVA 4YRFA 1UK7A 1SCUB 4S1VA 1FS4A 1Q3KA 1XCOA 3TMYA 3N2GB 2O8VA 5CA0F 4DV1B 4EY4A 5DX1A 1XPJA 3LPLA 2QD5A 3WV4A 4LECA 1G9SA 4D02A 1N6LA 2DYKA 3B85A 1XTZA 1FTSA 2B4AA 4YXWA 5BSVA 2ZJ8A 3STUA 3J7AC 4JJAA 1X7HA 2PLNA 2HA7A 3BQ9A 1MGOA 2VBGA 1C7EA 1NMQA 2J59A 1YQEA 2QSJA 3B1JA 4KWTA 5HDQA 4CKZA 4LJRA 4KE8A 3ZW9A 3N1UA 3CKMA 2R6AA 5BV8A 4YP6A 2ZIWB 2R2GA 3NBXX 5F7OA 5BR1A 4BTEA 2IZOA 2P9YA 4F4JA 3BFKA 4CM8A 5JMOA 3TNYA 2D2EA 5DNCA 1P7WA 3TQQA 3DMNA 1QHNA 2RIRA 4QBGB 2YWGA 5BSMA 3ZW7A 4DMMA 3NHUA 5DGXA 2OCXA 1XLUA 3SC3A 3R9XA 2ZRPA 4O4IF 4QLBA 2QRJA 2OPHA 4MUFA 2IXTA 1WL8A 1IOWA 3BFVA 3D64A 2PA0A 3EGIA 4G63A 4V0ME 1TM3E 4JI1B 3T06B 3VAZA 2NIPA 2CHVA 2BY4A 3L01A 1BE6A 1T0UA 3W3AH 1P2BA 2QX6A 2IKQA 1II8B 2NUAA 3PE6A 1OV4A 2HGZA 3PNSA 3HCPA 4QQ8A 3UA3A 4A8JC 4ABTA 1CUSA 2FCAA 2MMCA 3HO8A 5HKBA 2NP7A 5EJ5A 1BD3A 4JU9A 3F4LA 3QPVA 1UJMA 2WAOA 3PC8A 5ADWA 2DOKA 2FTKE 4Z2AA 3ZKWB 4GPTA 4GP9A 4BQEA 3L40A 1P2VA 2QM0A 4UUPA 4DADA 3AYXB 2NPFA 4EECA 2IH5A 1DV2A 3GCXA 3D0OA 4TOIA 3K4PA 1XPOA 3ZZMA 3HWSA 3ZY3A 3I2KA 4N82A 5DB4A 3LNTA 2WSLA 1H0RA 2JGDA 1T0HB 1U7XA 3EG9A 4D2IA 4ENWA 5JT1A 2OLEA 3AOEA 2OGSA 2HPVA 1B43A 2FWAA 1M0SA 2YXLA 3BRWA 1TYDE 2FGJA 2FZ5A 3LYUA 4HPWA 3GCDA 4OJQA 2E2WA 3BB3A 4R6XA 2QDXA 4BMXA 3X2FA 3GOHA 1WR8A 2XYHA 3QFTA 4PLWA 3TOZA 3D3KA 3WB9A 1X0VA 2CLEB 2FPMA 1P62B 1NWCA 2I55A 1ORTA 1QG4A 2VHTA 3FCXA 3GW8A 4CT0A 2IEAA 2B8WA 1NXQA 4WKPA 1WY5A 2J7PD 4NZZA 1ABBA 3HA5A 4G8BA 1CQJA 5GMOA 4MR8B 2X8BA 1F5NA 2XDQA 2R6ZA 3TUJC 4BKPA 1LKZA 4WSOA 3I5UA 1JU4A 5ETJA 3TIIA 1V4NA 2ODAA 5HR5A 4UEQA 4NYJR 2GEVA 4BZZA 4E88A 1JDZA 2C5BA 2P65A 3T7IA 3V00A 5JD6A 1UBSB 1Z15A 2A0YA 2IPAB 2NSLA 3IQHX 1BU8A 4LDRA 4MUMA 1OFHA 4NS4A 1GWNA 1JDBC 4N7RA 5EYPA 1QYXA 5HEKA 2Q9CA 3MG9A 5FTLA 4IW3B 1PR0A 4ETWA 1A82A 1G19A 2ON6A 2FW9A 3OEED 1NDUA 2C8VA 5AHKA 4J1TA 5K8IA 1N7JA 4AZSA 1V43A 2WQZA 5EXSA 3GFGA 2O8CB 2YY7A 2AHOA 3EPKA 4YREA 7GPBA 1NOKA 3HJHA 4H59A 1AKYA 1R0XA 3X1XA 1VA4A 1A7KA 4HRXA 5AVWA 5HM6A 4EY5A 1ZPDA 3B52X 3L6UA 1CULC 2VHEA 3RC1A 2C3UA 2X0NA 3C97A 4YK7A 3K6KA 4LKRA 1QCZA 1W34A 3A9WA 3DC7A 4LZLA 4O4IB 4E5DA 2I91A 2A9KA 4Z7QB 5CVUA 2XZPA 3B36A 1A4UA 3INTA 3MOGA 4RCYA 3RLIA 3CRW1 5KVSA 2V0GA 4I9GA 1VI6A 3HWRA 3AU9A 1Q95A 2CDCA 3GGGA 3HXPA 4RX1A 4UVIA 3GGJA 4WVLA 4KJXA 4YLEA 3KAQA 3EPLA 1QHFA 3F8TA 3CRZA 1T8TA 1TYCA 4ZAGA 5SV2A 3TQCA 4AC9A 4J91A 3WLMA 4YCCA 4OAOA 5H82A 3QVGA 3JAWA 3GFTA 1TC2A 3OEHA 1V47A 4Q9JA 3ZCRA 1XEXB 1TZMA 1JLMA 2O9JA 3BCUA 4G5FA 4ZPJA 3JYHA 3WYEA 4Y18A 1CLUA 1VL8A 4HAVA 1OB5A 2OWEA 5BN4A 2JGRA 1O3YA 4Q1VA 1TYZA 2AMLA 1I5EA 1IQ0A 4DJFC 2HU5A 4HDKB 4YB8A 3VDMA 3ZUPA 3VOAA 2QPTA 5JDCC 1JG4A 1ULZA 3R2JA 3LT1A 3WFZA 1Y5IA 3FVQA 2OAEA 1UQUA 1Y8ZA 3IBYA 3OP1A 2FMXA 1NKTA 3QMPA 2MDTA 3A4TA 4PO3X 5IDYA 5HOQA 2O4CA 4N1AA 4TLMB 1UMKA 4XE5A 3SYTA 5I7WA 5HHTA 2G9NA 2W4MA 5IYZB 3PVCA 1RI4A 1ZESA 4IQFA 4RPKA 1BXRA 2IGBA 1DBWA 2FMUA 4QA9A 4UBMA 3I8SA 1PNQA 4M87A 5AKIA 2O0HA 3S2FA 3Q2KA 2H54A 1D7AA 4DIDA 3F46A 1WTCA 2QRUA 3IQDB 1OBVA 2NQ8A 4GX5A 5FAXA 2G25A 1T1IA 1V3VA 1GVNB 2AJLI 1DRVA 1JKIA 1N2HA 4J3FA 1Y8QB 4PZEA 1O1YA 4RV5A 1V11B 5B37A 4NZOA 4X62B 2NTEA 3PYLA 1HO3A 1SUAA 4ANFA 3HR7A 4CIVA 1Z17A 1PFQA 1KE1A 4YUZA 2GEKA 3RM3A 3THWA 4CHTA 3DTVA 4QAJA 3NNDA 4UVGA 1Z8FA 3PE3A 4MVXA 2ETXA 4QDUA 1RRKA 4DSUA 2YKGA 2FEKA 2ZWMA 4JJ6A 4LF8B 1YS6A 2YOHA 5L3RA 3RYTC 1N57A 1QYWA 2FR0A 1SVKA 3ULKA 1T1JA 4NV3A 2XBUA 4TXLA 3ILXA 4M21A 3IOEA 2JCYA 2WYUA 8ABPA 3NBKA 4B4VA 4D56A 2GJ4A 4ZPXA 5EPEA 2EIXA 4KMOA 1HE8B 2NZUG 3IEUA 2FDXA 3LQFA 1XD2B 1YZYA 1ISIA 5IDQA 1G5RA 4ETIA 4TMTA 1TZCA 3MYRA 2HJGA 2XHEA 4RGQA 4YRCA 4Q1AA 1WETA 2GILA 3CUYA 2VZEA 3HU3A 1F6BA 2HOQA 1KZ7B 1XJ0A 5C31A 1VOTA 1RU3A 4FK8A 3IKMB 5HJ2A 4M9XA 3KTAA 2W0MA 4HWKA 3TF5A 2FW1A 1T4GA 1Q7GA 4MDEA 1YCFA 5BY2A 1Q77A 3L4EA 1XG5A 4OU5A 4ENQA 1TO2E 3KB2A 1VL2A 4MUAA 3A4IA 1KK0A 2XF2A 1YSCA 1SCNE 2PUCA 3I12A 4LRYA 5JE8A 1OF1A 1NY6A 4GH5A 4GZ5A 4UBJA 2GUGA 4XDGA 1RYNA 4CV0A 2RAUA 5IWAB 2C4MA 3LAWA 1M34A 3DEYX 3KPJA 4GWLA 4NU0A 4WCVA 5DEIA 4UOEA 4FFOA 1W1IA 1WOMA 4G0ZA 4BO7A 4ZYLA 3KHKA 1YBMA 1WMEA 4F96A 1YVDA 2D5IA 3I1IA 1D4AA 3OO1A 1V9LA 1WXDA 1X7XA 4M38A 1JZTA 3R5SA 1EG2A 2HGSA 2OP0A 5IN5A 1CKEA 5J59A 3OOEA 3K72B 1OAKA 5TPWB 1ZIDA 1GR0A 2ZSDA 3V33A 5INTA 5ALHA 4YT4A 2W2LA 3V2UA 4II7A 1BHO1 3FRJA 1AUQA 1AKTA 1VLMA 4Q47A 1P8JA 3L4BC 2Z08A 1Z45A 3O8LA 1SCJA 3P9QA 3UCXA 5FUWA 3ZWVA 4GD3Q 4KFTA 4M0FA 4TPKA 3WLPA 4B7CA 1XI2A 3ZHSA 3O9ZA 1W0CA 5EZYB 1HKUA 1QH0A 3G2HA 4RVOA 1Q1BA 3V4OA 3HM9A 2CWWA 2D1FA 4J4HA 2XMQA 4YP7A 5KZMB 5HW0A 3FX2A 1SG0A 2GPAA 3MBIA 1EM6A 5TGZA 3VU3A 4IJKA 1AUVA 1YI0A 5A4FS 1EUDA 2K87A 5K2MA 5A4AA 2FH5B 2J0UB 4CLDA 1P6XA 3QJGA 3QFRA 1LH0A 4GGPA 4RD0A 1VYHA 4HWSA 1KYTA 3Q8XB 1AN9A 1E6MA 1LWNA 3A27A 1ONNA 3BREA 4LSWA 4NR0A 4EO7A 4QG3A 5H4HA 1R8SA 3FCUB 4BNVA 4IFEA 4R2JA 1E60A 2I6QA 1KI4A 3NTLA 3M81A 3UEOA 2EHJA 2J48A 2IZ7A 2X1VA 1XCGB 3HDJA 4M9ZA 3O4FA 4S04A 3PTLA 2I2AA 4OJMX 2ONZA 3D3EA 2AV6A 2OBMA 1O95A 1QHGA 3BH0A 4O0LA 1SO8A 1GGMA 3HSSA 5EHGA 2EHDA 2PXCA 3M6XA 3WLSA 4MCJA 4QARA 4BGIA 3IMGA 1CUJA 2XD9A 2WHYA 4IOKA 4RTLA 2UKDA 4B32A 3GEHA 2OESA 3QFSA 5B1SA 2ZRFA 4DV2B 3R1IA 1I2MA 2F62A 2O6HA 2G70A 1H0HA 5EJ2A 3DXFA 2CDBA 3NTRA 3LM8A 3OTQA 1NG9A 1ETUA 1T9GS 2SKCA 3ZPXA 3VVLA 2YXNA 2BHNA 1DPGA 1SUBA 4M0KA 1GPJA 1IULA 2ECOA 4PZ0A 1YOVB 3ZU5A 4A10A 1WMFA 3K70B 4ZK6A 5EHNA 3T1VA 1AS2A 1DS6A 2C54A 3QX7A 4X3CA 4C05A 5EQFA 3IEVA 3T35A 5IKMA 6AT1A 3LOUA 5JZVA 1UKVY 1JILA 1QR6A 2GNPA 2F00A 3O82A 1RACA 3MD0A 3C7CB 4GP7A 3V2IA 5A4IS 3FDFA 3E1SA 1SBNE 4MVYA 4BLSA 2IDKA 3LVRE 2X8WA 4Q9LA 1T9KA 2A7XA 4BX3A 5GPBA 5KWVA 1DP4A 1NHWA 3H9QA 2CHQA 4LJ9A 5E9JA 1G18A 1VSBA 1U8TA 1UBRS 2CXHA 1T26A 2NTYC 2JLRA 3M1IA 4M1EA 4RW0A 3Q3VA 4HXYA 4D8XA 3SC2A 5IAGA 3CLRC 2V7XA 1OXMA 4ZCTA 1MIOA 4US0R 4KWIA 3K8QA 5GVSA 4XYLA 2A58A 1E3IA 3IKLA 2R6JA 3AO0B 2GEBA 4LY3A 3G2IA 3KU4A 1ZISA 3LKVA 1XAIA 4LDQA 4WXYB 1DIGA 2AI3A 4AKEA 3PQEA 2WYIA 1S96A 3EIFA 5FUMA 4C0QC 3STHA 1XWWA 2FI1A 5DSZA 4F3CA 5LP6F 1GYQA 2W93A 2GRAA 2W48A 3HVUA 3O8OB 4YBRA 1Z2NX 4P7KA 4B43A 4EMSA 5LP1A 2ZTVA 2R0QC 1YDEA 2HL6A 1KIAA 4DCNA 4WN9B 1X42A 1IZ0A 1ID1A 1EZ4A 3TAUA 1U4SA 3KJGA 3OFSA 2NO5A 1EQ2A 4EHHA 1B6TA 5HZHA 3SMQA 4DA6A 1TF5A 1YXMA 3B1KA 1W0KA 4LF7B 3ETEA 3QUTA 4N7MA 1VHJA 2JLXA 3RVMA 4KFUA 4Y1EA 5JSZB 5LYJB 2H29A 2IKSA 2J5XA 1HDYA 3AV0B 3KC2A 4HGYA 4EX6A 2WZCA 2QS9A 3AU8A 3PFHA 4PGHA 4ZREA 4PAQA 3WOVA 4Y2JA 4EI2A 3RS5A 1G20A 1HMYA 4HP8A 2EBFX 2VZ8A 3DEKA 4LBYA 2HIHA 2GS9A 1XRRA 4RUKA 4HQ6A 4K87A 5B1HA 1TF2A 3T3IA 1RM4A 2QVLA 4QREA 4Y2YA 3TRDA 3X3HA 3K35A 4YCLA 3GRUA 4MO9A 4BKOA 1N7HA 1M9NA 1VXOA 4R8MA 4U7WA 2I8CA 1WUTA 4E0BA 5K01A 2W2VA 3LHSA 4XAQA 3NIFB 5HFNA 3WLKX 3K32A 1QDLB 2Q3FA 5KTRA 2NSDA 2VDPB 2BDTA 2ZU0C 3V46A 5LQNA 2ERXA 3F9RA 3ZHCA 2OFPA 4JT9A 1XA0A 2ZIXA 3T7EA 3TK1A 1KEEA 1Y81A 2WTMA 3SEZA 1RIFA 1YBAA 5CH8A 1YH3A 2P4HX 4QWWA 2IUSA 4IV5A 1EFTA 4H08A 4RKWA 1RJEA 4ALKA 4R54A 4X63A 1FP2A 1PT6A 1KL7A 4UHBA 2IZ0A 5H80A 1M1XB 5EJIA 3ZNQA 4GWKA 3U09A 1R66A 3QKIA 3TBFA 3MUEA 3OX3A 1C7IA 5J5VA 3AI3A 5FWNA 1EFHA 4G65A 2JHAA 2VTBA 1JSRA 4DV0B 2C83A 1E5XA 2W6ZA 3EXEB 3ZS8A 3K0CC 4C5BA 1Y7HA 3R23A 4OBBA 1T10A 1ZGAA 4JSTA 5CHEA 3G0IA 1D2HA 1KO1A 1VBNA 3R76A 3UY4A 2O54A 1L5FA 1Z13A 5C7YA 3N70A 1TW2A 5K0FA 1OFGA 2ZWIA 1HDRA 4LY9A 1II8A 1YIDA 3LT5A 1MGPA 3X1MA 4IR7A 1IXRC 1UT8A 3P26A 2H18A 5KTMA 1ZMRA 3ELYA 3BZBA 3PENA 5HKKA 3ACBA 2XRFA 1CIVA 5LUAA 2B5OA 1E1RD 1VRCA 2D7CA 3NJ4A 4HRVA 1YL7A 5GONB 5DGDA 3EQ2A 3SQNA 1WSAA 3S70A 3GFVA 1T0JB 1Y4ZA 3FYUC 3KKEA 5H3CA 1YBVA 1L1EA 1BHQ1 3SVLA 1OFTA 4FKMA 4GC9A 3UXEA 4UMDA 1Q2UA 5FLEX 5KX5A 5FPQA 2KW5A 3O2NA 2OCPA 3D8BA 3EDCA 4L9AA 1D2AA 1CS0B 2REOA 3HC7A 4XWGA 3EXHA 1Q2XA 3GPDG 5FP0A 2PYIA 2GHRA 1BH6A 3TDKA 2C7RA 1FRNA 1I1HA 1FW8A 1JSZA 3TLJA 1XX6A 5B2ZA 1UL1X 5EJAA 5J43A 4O2BB 2QUZA 3PICA 2JIZA 3OEYA 4DSOA 4EB6A 3IUQA 3KJEA 1WVGA 4CKXA 1YHZA 1YWGO 3EGCA 4ZQFA 3D2LA 3H1FA 5L51A 3JVDA 1FSSA 3W06A 1UZLA 5JYDA 1I6LA 2PQ2A 4K9KA 1H3NA 1N9GB 2BFNA 4PLFA 3U6BA 2QZ4A 1PUJA 2NXNA 4U7TB 2YVQA 1S3FA 5DFAA 1CERA 2FWBA 1RJFA 2H59A 2QVCA 1JLHA 1T8RA 1KEWA 2FV8A 2O07A 5IS2A 2OKGA 1AZLA 3MGGA 4I1SA 2W4IA 2VDJA 3TM4A 1QIFA 2YJ4A 2C82A 3C5HA 3HZRA 3TRKA 1VMKA 4BJ6A 3MILA 4F4IA 4G0PA 1PS9A 5BN3A 4YRIA 3HJCA 2CSUA 3F6YA 5C52B 3HB5X 3FHCB 2M98A 1VKJA 3L8DA 4OOFA 1QVAA 4QXAA 3V97A 1OLUB 1U8EA 1UKZA 2I6FA 1FMTA 1I0ZA 1P74A 1WDKA 2ACWA 2PPVA 3HRHA 3MJTA 4J0HA 3GF4A 5DOVA 2QA5A 5F52A 1NLZA 1JI3A 3FUTA 4KXYA 4CM8B 2ZPAA 1FFCA 1R6DA 3GRKA 5HKAA 1M5UA 5LQJA 2ZJ2A 4E2FA 2G9QA 4WW0A 2KE5A 4O4IA 2OQVA 5CRIA 3WR5A 5F7ZA 3ROPA 1KYIA 1XV5A 1JL3A 4RF3A 4QBFA 5EI5A 4BNDB 5BWBA 4RD4A 5BUSA 3C3PA 3OCXA 3GBVA 3NNNA 4XXHA 3N8HA 3NBZC 2D1TA 3K6JA 3KZVA 2Q4DA 2QG9A 4F2GA 3H17A 3CT4A 5D01A 1F06A 1R0CA 1KJ9A 3CUSA 4CBVA 2X6RA 4KXWA 3MHTA 1X8LA 2P0YA 3B13B 2HREA 3PEVA 4F60A 4NJOA 1HFJA 1WDTA 1VCIA 4MWBA 3WK5A 1KYXA 3L18A 5BMVA 1PJSA 1FNDA 5IX8A 1GLNA 1OH5A 1KVTA 3KZNA 3MTAA 2HH9A 1D2CA 3IE0A 4LXTA 5J9FA 4GVLA 4R84A 2GKOA 2Q2VA 4ILEA 2FFAA 5IC4A 3HBNA 2G1AA 2PGLA 3KU1A 3GT4A 2GEJA 4TTTS 1GADO 5HIMA 3JR7A 3SM3A 4CCWA 4Y3UA 3B1XA 1XCJA 4RABA 5KNCH 2IYFA 3MELA 4AB1A 4GVPA 2PR2A 1YKGA 2O2YA 4KQIA 4R6WA 3EASA 3QXXA 4N03A 4G1FA 4X5OA 5DHTA 3ST7A 3TOCA 4AXBA 5CVDA 3VHRA 2B94A 3A9UA 2C2MA 2G9RA 4JB2A 5CYGA 4WLEA 3WLEA 5IPFA 4DR1B 2FX5A 2HA4A 4R05A 1GCIA 2AJDA 5CX4A 1WKVA 4KXLA 4G9BA 3O84A 3F3KA 4Q00A 3G7SA 3Q7QA 4ALJA 2V5VA 4Q19A 4CF5A 3VR6D 3ICQB 2PTHA 3EUFA 1XL1A 4ZAVA 1FBTA 2G0TA 3N2LA 3DJYA 1EINA 1FNBA 3IVMA 1CJUC 3NP9A 4QIHA 3IVAA 4RHYA 3RBAA 4WBNF 3ISJA 2P2LA 1VGVA 1PLKA 4ZEXA 4YR7A 2AEMA 2VHXA 2O7SA 3M49A 5CHYA 4D45A 1KK2A 3IMKA 3V8BA 1JEOA 5HWSA 3AHHA 4WK2B 5TEVA 4BN4A 5TS3A 4OHFA 5L3QB 2I67A 5LWQA 3FTFA 5JPCA 3SQXA 3O38A 1R8YA 3PPXA 3HXKA 2GPYA 1Q3TA 5ALFA 2LCFA 3SMVA 3UFBA 1SCDA 2B4RO 2C7PA 2AN9A 1BIFA 3WK7A 5BRJA 4MV6A 2J85A 3GLFA 2OCLA 4W9RA 3RC7A 3ND7A 2NGRA 2FPWA 3B5JA 1N0VC 1UOPA 3FUWA 3O95A 1NVMB 2WJPA 2FPPA 1WO8A 3LK7A 5DM70 4KSCA 2VH5R 1LJLA 5ALOA 1KDYA 2L2QA 3H5IA 4LMPA 4K9LA 2A84A 2YJ6A 1WPXA 4ZEWA 3VKVA 3HXQA 3GLIA 2XUOA 3FBGA 4EWLA 3ML1A 2OD7A 3CLUD 4I81A 1NXWA 2E4VA 2W6CX 3RYIB 3WGZA 4RL4A 4BZWA 3A0RB 1N6IA 2R8BA 1LBSA 2XMRA 3MB8A 3OOYA 4WASA 1MVLA 4PZ9A 3ROFA 3UMCA 2EWVA 1E69A 3WK4A 4AMYA 4Q66C 1GQYA 3DL7A 1KFJB 3LUPA 1Y89A 1NMXA 5EFZA 4ZEMA 3VSEA 1GO2A 1ZU5A 3VPHA 5LNK6 3UWPA 5HQTA 4U6SA 3QLEA 5B3JC 1ZJ4A 3KQSA 4TROA 3QELB 4DNFA 1CIPA 4BKMA 1YTUA 4Z1MD 3IUEA 4I2VA 1QUFA 5AQ1A 4XM2A 4NG4A 2BBSA 4EX7A 1SR8A 4Z4EA 1Q19A 3MS4A 1JEJA 5BOSA 1CFZA 5G0SA 1F2UB 1Y5MA 3KFVA 4E03A 5JNRA 3KPYA 5EHIA 3D8RA 2GARA 1DLIA 5T4EA 1O5IA 2JLWA 2CXRA 2XA9A 3A14A 3HP1A 1N6KA 1MENA 1TLFA 1TRHA 2WG2A 1ABEA 4YRPA 3P7MA 2YASA 3PNQA 3THOA 5EZYA 3HCRA 1K86A 4N9QA 1C2TA 3D2AA 4YONB 3LQ2A 2WHQA 4KX5A 4OXYA 3LFTA 4A2CA 2ASVA 1DARA 2AYZA 2ZI3A 3O4VA 2V5UA 4ZARA 3GARA 1ZD9A 3FMFA 2ZI9A 1WUJS 3IAEA 5IVDA 5DCLA 3E9EA 3Q9UA 5HFJA 3TNDA 4BWVA 1W36C 4MVJG 5KWJA 1D1TA 3FUUA 2JGKA 3FZYA 1J0CA 1JAXA 1K4KA 3PIDA 4PO8A 4X1OA 1KFKB 2LDBA 3K8ZA 1FXWA 1FJ2A 1E5TA 3AXTA 4OXQA 3HV0A 5TNXA 5AK4A 3R3ZA 3WKEA 1QRSA 3IXQA 2AZTA 1KVQA 1C1DA 1S89A 1AKVA 2CHUA 4PHHA 4RANA 2WHXA 3Q4GA 2F9LA 4YFVA 1P3Y1 1RSZA 4C7MA 3GJ8A 5KVAA 5L9AA 1E20A 1B2RA 1L9KA 2QGNA 4WCFC 5AW4A 3O3MB 4A8PA 1JVNA 1U3CA 1K4YA 4X7BA 1UH5A 4S1NA 2H1VA 3V7YA 4A5OA 3RRXA 3OSUA 4RVFA 4D4KA 4NG5A 1XNRB 1H2WA 4WY5A 2DPLA 2GCPA 2CLFB 2IYLD 4FT4A 4H6VA 4U1RA 3N0XA 4RM2A 2B35A 3AHEA 3ICOA 4E5KA 4F9EA 5JH7F 3N8IA