1QBQA

Structure of rat farnesyl protein transferase complexed with a cvim peptide and alpha-hydroxyfarnesylphosphonic acid.
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
312
structure length
312
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of farnesyl protein transferase complexed with a CaaX peptide and farnesyl diphosphate analogue
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords FPT ALPHA-SUBUNIT
total genus 118
structure length 312
sequence length 312
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 1999-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1qbqA00
1LD8A 3HXFA 3DSWA 4YDOA 4EHMA 3HXCA 1N95A 3PZ3A 3Q73A 3DSSA 3Q7FA 3EU5A 1DCEA 1O1SA 1QBQA 1TNBA 1N4RA 3E34A 1LD7A 1SA5A 1O5MA 3Q79A 1N94A 1O1TA 3DSTA 2H6HA 4GTQA 1NL4A 4LNBA 3C72A 1KZPA 4GTSA 4GTOA 3HXEA 2R2LA 1O1RA 3DSXA 3KSLA 3KSQA 1MZCA 1TNOA 1N9AA 1TN6A 1FPPA 1NI1A 3E30A 1N4QA 3DSVA 3Q7AA 3HXBA 2F0YA 4GTMA 1JCSA 1S63A 4GTPA 1S64A 3SFXA 1X81A 3DRAA 4GTRA 3Q75A 1KZOA 2H6FA 2IEJA 3DPYA 3PZ1A 4MBGA 1D8DA 1TNUA 1JCQA 3EUVA 2BEDA 1SA4A 4YDEA 1FT2A 1D8EA 4LNGA 4GTTA 3Q78A 2H6GA 3DSUA 3E37A 4GTVA 1LTXA 1TNYA 1JCRA 1TN8A 2ZIRA 3E33A 2H6IA 1TNZA 3PZ2A 3HXDA 1N4SA 3E32A 3PZ4A 4L9PA 1TN7A 1N4PA 2ZISA 3SFYA 1FT1A
chains in the Genus database with same CATH superfamily
3HHMA 4YDOA 1HS6A 4MKTA 3ASNE 5AENA 4C0MA 2BKGA 3TWXA 3DSSA 5KCMA 3SGHA 3SD5A 2XPYA 3FU3A 3PVLA 2XEEA 1O1TA 3DSTA 4CYMD 2PM7A 1Y8MA 3ZGQA 5CEAA 4HFGA 4U0SA 4AXHA 3RJVA 2M63A 4FJYA 3Q9NC 3PUKA 1DNPA 3FTVA 1E8XA 4JVSA 5KJKA 4UWKA 4GTPA 1S64A 3AS5A 4GTRA 3OTNA 2FEZA 3T9KA 3ZHEA 4J6IA 1YYHA 4G25A 5LCWJ 4TRQA 1KT0A 3CVWA 3ZKJA 4AY6A 1D8EA 2L6JA 4RSYA 4F53A 3KS2A 1B89A 3GW4A 2R59A 4PS7A 4KVOA 5AQAA 4Q69A 4HOUA 3PE3A 4E85A 2DVWA 3AG2E 3ZPJA 2HR2A 3FP3A 3L16A 5CECB 1V54E 3LDZA 3R9AB 2GRQB 3IXEA 5E76A 1H19A 3JQ0A 4EECA 3CV0A 3DSWA 4G8KA 2J9QA 3Q73A 2X6HA 4DLOA 3EU5A 3E34A 3T8KA 5JJTA 4TXPA 4HB5A 2FO7A 5EIDA 4XKBA 1IKND 3HXEA 2R2LA 3ZRHA 3UT7A 3GZ1A 3RKVA 2WXPA 3SF4A 4WWNA 2VTBB 4LEUA 4FLHA 3BQOA 4GZ6A 2WXMA 1XNFA 3MV3B 3ASOE 2BEDA 2KBXA 2CFZA 3CVLA 4NQ0A 1DCQA 2UY1B 4N3AA 1OY3D 2XS8A 2RFAA 4JC8A 2J8SD 5ENSD 3J5PA 2GRPB 3MKQB 3C3QA 2H6IA 1TNZA 5IY5E 4JPSA 2P58C 2XEHA 3PNTB 2EIKE 5G05C 1HZ4A 3LY9A 2IO3C 4GZ3A 2QYJA 4FJZA 3CSTA 4WNFA 1HU3A 3EIQC 2YINA 3E4BA 1ZU2A 2P9LG 5G2NA 5FTPA 1FVFA 4HLEA 4U8HA 5LP0A 4JHJA 4JL0A 5JMND 4XI0A 3D9PA 4UI9K 1TYQG 1MQSA 2B6CA 3I3NA 4A3TA 2RFMA 3FEXA 1DVPA 1FPPA 5AAOA 2MHKA 1WG0A 4P29A 4LUNU 2WQ7A 4ABNA 4G26A 3FTUA 2VGYA 3K9IA 3WXXA 4DX7D 3UT8A 1UG3A 3FU6A 1KZOA 4Q94A 5CHEE 1S70B 3VLDA 3ZU7B 3TWWA 4WNEA 4KVMA 4PDXA 1AP7A 4G8LA 2DIWA 2X6KA 4O1OA 2PZIA 4DX6D 2H6GA 5AQ9A 4CDNA 3LCAA 1HE8A 3CHRA 3FUIA 3E33A 3D9HA 1TR4A 3HXDA 5BPPA 2GRNB 2VSNA 3FULA 3PZ4A 4BFRA 3CK7A 1ZB1A 3RAUA 4B8AA 1SZ9A 4EHMA 4EZKA 5G04C 3PZ3A 5BT1A 2FI7A 4JHRA 4B93B 4PH4B 4GA2A 3CGHA 3L22A 4GZ5A 3CHOA 2F8YA 5ENPD 4GPMA 2FO1E 1D9SA 2MRIA 3ZEFA 2AJAA 3FUNA 1UN8A 4BETA 3MX3A 2PL2A 1NI1A 4K5AB 3SHFA 5ENQD 2XENA 1EF1C 2V4LA 4GTMA 3PH0C 3MEKA 4URKA 5JHBA 4TXQA 1X81A 4ILHB 2MOWA 3JXIA 3TG5A 2NC9A 3CK8A 1E8YA 4HNAD 2XPZA 3VTXA 4J8DA 2PQNA 4XZ4A 3FTWA 2LO6A 1H0AA 3D9OA 3Q78A 2F37A 3UTMA 1UOHA 3TAXA 4LG6A 3AS8A 2CHZA 3PEUB 2EILE 5ENNA 3SBTB 4AM9A 3LXUX 2X3MA 4K03A 2BF0X 4N5QA 2KCLA 3FY4A 5AJLA 3LJNA 2IONA 4HRNA 5CRUA 2ZISA 4WNGA 2IY0C 3FUMA 1JUQA 3ZXPA 3ASDA 2RKKA 3L08A 2IJGX 2XPIA 3EHRA 4CGWA 1KT1A 1HX8A 2X6FA 1S0PA 4G1TA 3CEQA 3CVQA 4DK5A 5CMWA 1BI8B 4HBDA 2X38A 2Y3AA 1E7UA 4PUCA 3CKCA 2WXJA 1IXVA 3RU0A 2OCCE 3AG4E 2LSVA 2VGXB 4APOA 2ZGGA 4ATGA 2I6HA 3LYAA 4WAFA 2F0YA 4FHKA 3IV0A 3OXGA 1JCSA 3C98A 3QJZA 3DXMG 3FUKA 3V31A 1XGWA 4FA6A 3MZLB 2E2EA 2NXPA 3D9KA 2XGMA 2OEWA 3ZW3A 1TEZA 3TXNA 2OVBA 4DI3A 5D66A 4Y6CA 3S7BA 1BD8A 1WAO1 1EPUA 4FULA 4LNGA 4WUYA 3G2VA 4NURA 3D9NA 3DBSA 3NBNB 4BTBA 2LXLA 3RRNB 5LCWC 2AXVA 3SNXA 2IO2C 4UQZA 3JCKC 4KT6B 4CDRA 3ZNGA 3Q49B 2L0IA 3G2UA 5HI7A 1MX2A 3B95A 3HXCA 2KXPC 2KCVA 4NRHB 3Q7FA 4BX8A 3LPZA 3P2BA 3AS4A 3D9JA 4B89A 3PE4A 4K0RA 2DZNA 5JHAA 1HXIA 1ELKA 2C0MA 4DX1A 2XZTG 4ZFHA 2FF4A 4YNDA 2Y4TA 1HO8A 3KEAA 2VGXA 3ZYLA 3ASGA 2A5EA 2WM9A 3UKUG 1MX6A 2WXNA 4I6JA 5EIBE 3SO8A 2PM6A 4D10C 3Q75A 2IF4A 4V3IA 5KWDA 4F1PA 1JCQA 2VSYA 4HOTA 4A1GA 4GA0A 3U64A 4TXRA 5LX8A 3RIBA 2MYOA 1EYHA 3ML9A 2QY7A 1JWGA 3RO2A 5BXUA 3SBSA 5FQ4A 2C0LA 3LKUA 4I9EA 3FH5A 4H7XA 3Q4AB 4GMJA 3U9WA 3PZ2A 3UUXA 5EX0A 1RW2A 3O48A 3FUFA 2B0OE 2LXMA 2YQ8A 4YVOA 3BUAA 1N54A 4JW1A 3UT4A 1FVHA 5T3RA 3PREA 4MLPA 4KBQA 5EILA 3TWVA 2CHXA 1A17A 4N2QA 3FUDA 1SA5A 4XE0A 3PS6A 3MYVA 3SQVA 2VTBA 3SY2A 1NA0A 3CR3A 4I1OB 2IFUA 1N11A 3QWPA 1Z3YA 3FUHA 1UJKA 4BSXA 1N9AA 5CERB 1EDUA 3QB2A 2ILRA 1TN6A 3NOCD 4IRUA 3JYSA 4AV7A 2LAIA 3HG0D 4M3OA 2EIME 4RG9A 2H6FA 3PZ1A 4UI9C 4WWPA 1GW6A 1HFAA 3CQCB 4YDYA 3Q15A 1Z3XA 3NZUA 4R7LA 3TWQA 2YHCA 2WXQA 4EBAG 3L13A 5AYWD 4F6RD 2XS1A 4HRMB 3ENEA 2ZIRA 3FUJA 3EJNA 2GW1A 5FIOA 2KM4A 4XEIG 1Y6IA 4J7WA 4L1BA 3QKYA 2NYJA 4EPZA 1TN7A 1N4PA 2I1KA 2EINE 1OCRE 3T5VA 3KEZA 5T8IA 1Q2ZA 4ATZD 4DX5D 2KATA 1OWOA 4B0ZA 4DLQA 4GCNA 2YHEA 2Y1LE 4GCOA 3AG1E 4YVQC 5BV1A 4L7TA 3CHSA 2J09A 1N94A 3NB2A 2NSZA 3SI5A 3CIAA 3CVVA 1K3ZD 4JD2G 1WDYA 4LNUD 4U07A 5FQ6A 1MYOA 3QK0A 3VLFA 1TJFA 4A1SA 3C3RA 5FWQA 1DC2A 3Q9UC 4CDMA 4GMLA 1NA3A 4A55A 5B3SE 4ZHBA 4F1SA 3QWWA 4ME2A 1INZA 1UN9A 1MHQA 4N39A 2GGFA 2I2OA 2IEJA 4CRWA 3EHQA 4F7AA 2J4DA 3NAWA 5JJ7A 4KXKB 1E96B 2BKKB 2GRRB 4AEZC 4I2ZA 1QNFA 3B7TA 2FBNA 4N3BA 2L9BA 2BUGA 1YCSB 2WXLA 2PNNA 5ARFA 4RQIA 5EN5D 2DWZA 4CEMA 2P9PG 5CCMA 3PUJA 2XHEA 3QAQA 5AQBA 5FQ7A 4U7EB 1E8WA 3D9IA 1U3CA 3SFYA 2CFUA 3ZVVA 3UKRG 3HXFA 2R05A 4U95D 3EHMA 3ULEG 4DPRA 5CEDB 2XZDG 4AJWA 3TWTA 4KYOB 1MJ0A 3UMVA 3IBEA 4FP7A 1ELWA 4IYPA 2I1JA 3Q79A 4LERA 3C72A 2Y69E 2J4BA 1PAQA 3R7RA 3CKBA 4APFA 4RVBA 4A63B 1QZ2A 3IHVA 1KLXA 3AU5A 2XCCA 3L82A 2UY1A 3B7RL 3FWVA 3SFXA 3W9GA 3TGOA 3FUEA 3RRMB 3ZUVB 3APFA 5A7DB 4B94A 3UQ3A 1FT2A 2KC7A 5J08A 4FHJA 1G3NB 1OCZE 3U3WA 2OV8A 2R03A 3TXMA 4G11A 3EDTB 2WB2A 1TN8A 2XCBA 3LY7A 3UPVA 4I2WA 3S7FA 2IOSA 3FTXA 3MJWA 2WQ6A 4GAAA 4GMRA 2WXIA 4JEHA 2P9SG 4U63A 5C1DA 5ANLA 4G23A 4HOQA 4AOFA 1NP7A 4Y6WA 4FU3A 3AJIA 2OOEA 2QC9A 2WXKA 2WPVA 1DCEA 3ZYQA 4ANVA 3DEPA 4BEPA 2VSOE 4U8YD 2F8XK 3MKRA 2A4ZA 3VTYA 2Y4UA 2IOLA 3LVQE 1TNOA 2RD0A 1N4QA 1OCCE 4JEUA 4XX5A 4I17A 2JABA 3V79K 2XGOA 4GZDA 3TL5A 4ILIA 4U04A 5C2YA 4ANUA 1N0RA 3DRAA 3NOGD 5FINA 4J8YA 4FADA 1K1AA 3WG7E 2HO1A 5ENOD 2EIJE 4ANXA 4CGVA 2WXRA 2ETCA 3DPDA 2AWIA 4KZ0A 1WY6A 3MGBA 3P1UA 5HRYA 5JJ6A 4YDWA 5FZQA 2EQXA 4IULA 2LAHA 4JHKA 4UWGA 4TUMA 3IKOB 3Q5MA 3D9MA 4DX2A 3ESLA 3GYZA 4L9PA 4HORA 3ABME 5CBOA 2J49A 3SFZA 4IN3B 3LY8A 3UI2A 3UM2A 1BU9A 1PY1A 3QNKA 1N95A 3UIPC 1N4RA 4DJAA 3B7UX 4AVXA 3DXKG 1LD7A 2AXUA 4C0EA 2KCKA 2J07A 1IHBA 4H7YA 5EX3A 1O1RA 1OWMA 2V0PA 3QOUA 4GYWA 4OYSA 3FTYA 3ISMC 2IU1A 3HXBA 5CCLA 5G04J 4UUCA 2JLBA 2KZTB 1S63A 4DRXE 1IHGA 4JA9A 2V5QC 3R9MA 2HYZA 2I9CA 2XQ0A 3G2SA 5HS0A 5AQ7A 4Z68A 1OT8A 1PC2A 3JUIA 1SA4A 4YDEA 3S7DA 3TG4A 3BU8A 4BY6A 1W3BA 4BT8A 2WXFA 4KMOA 4GTTA 4RLYA 2ZGDA 4LRZA 5M72A 3UINC 3TWUA 4C9BB 3E37A 5KNHD 4AIFA 1JCRA 2V5FA 3W9FA 1IYGA 1SVXA 2P9UG 3ULYA 3QWVA 4CZ2D 5EDSA 5HQ8A 2JEKA 3LEWA 4L2LA 3BEEA 3V2OA 3AAAC 5LOZA 1L5JA 1RZ4A 3APCA 3PRZA 2WVIA 3CHPA 1O1SA 2AW6A 3L17A 3JUEA 2ETBA 3ZIMA 2Q7FA 4HQDA 4E6HA 5AN8A 5FZRA 3ASHA 4GTOA 2WQHA 3ZFWA 4CCAA 3T8MA 4NIKA 3URZA 4JXTA 3PNLB 4L2YA 3ASFA 4XI9A 1ELRA 1HF8A 3L54A 3QC1A 3ZYKA 2CHWA 1K8KG 4DUIA 5KBAA 2PQRA 1OXJA 4OAUC 4MBGA 4GPKA 2CG2A 4I1MA 5AARA 3FH7A 3PDNA 4GU5A 3CQGB 2OEVA 5G05J 4HXIA 4JZYA 3HRAA 3OXFA 3I4GA 2P9NG 4HOSA 2FULA 2ONDA 3QDNA 2VSXE 5E75A 2P9KG 1SQMA 2CG3A 3MCXA 4HVBA 3G2TA 1OCOE 5B1AE 5ANRA 3RK6A 2DCPA 1HG5A 4M7CA 1K1BA 3U4TA 3CSFA 4AY5A 4PS8A 2L0TB 2X6JA 4EQFA 2QFCA 3HVEB 4HLLA 4ANWA 3I5PA 3NF1A 2GRMA 5KJMA 3ONKA 1QBQA 3FEYA 3IHYA 3QARA 4BT9A 4ILGA 4OVVA 3L9TA 1YA0A 1N0QA 1NL4A 3B13A 1KZPA 4HS2A 4GTSA 5FT9A 3KSQA 4X8QA 2V4HC 1NFIE 2QYUA 2P2CP 2YNQA 1IQRA 3DSVA 3ESKA 3Q7AA 4OVUA 4UI9J 2R5SA 2DBAA 2WXOA 4BWRA 4A3VA 1YMPA 3LVRE 4W9RA 1BI7B 3DPYA 5KJLA 3EHNA 4AP2A 5G55A 3UIOC 1BPOA 3L6AA 2R17C 3C3OA 1X5BA 3N71A 2OVFA 2AVPA 1H6OA 3MA5A 4RG6A 3MV2B 1VDYA 5KNGA 1OWLA 1V55E 1U3DA 3GZ2A 4N2SA 5BW8C 1UW4B 1HG2A 3DWLG 3HIZA 1TJCA 3RRUA 4N3CA 2AXZA 2WXHA 4U8VD 4J8FA 3CVXA 3NZSA 1N4SA 3E32A 4J8SA 2HE0A 5ARGA 3EIJA 3DEOA 3KAEA 3HYMB 1N52A 3ABLE 4DI4A 1LD8A 1AWCB 3R7QA 2LSUA 4J8EA 5BNWA 3CHQA 3FU0A 5HKPA 3TJPA 2WXGA 4TV3A 2GRLA 3C5RA 5AIJA 3FTSA 1TNBA 4PS3A 3FU5A 3V30A 4LCTA 5EYLA 3UM1A 2H6HA 3ZXSA 1BLXB 4GTQA 1H2TC 4G2VA 1OWNA 2XRYA 3NQPA 3O4ZA 3EU9A 3ZYMA 4QQIA 4B8CB 2ZXWE 3GZSA 3E30A 4I9CA 2RG8A 2ZU6B 3CK9A 1KPSB 3AU4A 3MKQA 3LJ3A 3U66A 4F3VA 4I43A 4JA7A 2VGEA 5EYPF 1HH8A 4BX9A 4UQYA 3CVNA 5KJNA 5LFAA 4TUUA 3AG3E 3CVUA 3PEVB 5ENRD 2WMNA 5CBNA 3DSUA 3IEGA 4WWOA 1OUVA 5CMYA 5FZSA 1LTXA 2XGSA 2A5UA 1OWPA 4XIFA 2DZOA 4EZLA 3RO3A 4QFVA 1ZBPA 1E7VA 5D0QD 1U2VG 2Y0BG 3ULQA 5BXOA 4G24A 3FHEA 4BESA 2XEVA 4CT4A 4NACA 1QYMA 3LS8A 5FJYA 3CVYA 3B7BA 2X6IA 4I6GA 5ITZF 3UXGA 3JXJA 3TWSA 2QZAA 4K5CA 4KZCA 4EZJA 1Z6TA 5DIZA 3T5XA 1JPLA 1A5EA 5CRVA 4BSZB 2IQCA 5FQ8A 2DYRE 3KSLA 4WNDA 1MZCA 3UM0A 4BERA 4GYYA 1LF8A 5B1BE 5D2MC 2HM8A 1H2VC 4ACLA 4I1AA 5A23A 4HI9A 4O60A 3B7SA 3D9LA 2L6BA 1D8DA 5J90A 5DBKA 3ABKE 3J5QB 3F6QA 5AJDA 3PZDA 4GZCA 3CLJA 2J08A 4J0UA 4FLBA 3CHMA 3V2XA 4UWFA 3ONLA 3ZHEB 1P5QA 2VYIA 1H6PA 2C2LA 2LUHA 2V8SE 2VQ2A 1NZNA 5T4YA 4BTAA 1H6KA 4UQXA 4UWLA 1IQUA 5ENTD 1FT1A 4CT0A 3BG0B 4U0UA 4JB8P 1E90A 3FFLA 1WM5A 3OAWA 1SW6A 4XKCA 3ZN3A 5BUZA 4Q96A 3Q47B 3BG1B 2LNIA 1SZAA 2BTDA 5A6CA 1O5MA 3OXLA 4L23A 1MX4A 2GROB 3TWRA 2XRZA 4LNBA 1QQEA 3D3MA 2P9IG 4O6FA 3DSXA 2UWJG 5D0OD 4LSZE 3FH8A 2ETAA 4MRUA 4U96D 4U0ZA 4EBAA 5H7PA 4N5CA 4ACKA 3KD7A 3SZ7A 4HRLA 2DYSE 4O1PA 1TNUA 4GA1A 5BV0A 3X2QE 3HVEA 3JQ1A 3EUVA 3ML8A 5EKQD 3S2AA 4GYOA 3CVPA 4GB9A 4I6EA 1H2UA 2KZTA 1JWFA 4UWHA 4MS6A 3FDHA 3I4RB 4HI8A 4C48B 1UJJA 4GTVA 1TNYA 2E0IA 3UM3A 2WMOA 1E8ZA 1FCHA 3HDXA 2R02A 3G2WA 3VLEA 2VJ8A 3FTZA 4K5BA 5JA4D 3APDA 1Z5SC 3S7JA 4FC8A 3RSEG 4OAVB 3UX4A
chains in the Genus database with same CATH topology
1LD8A 3HXFA 3DSWA 4YDOA 4EHMA 3HXCA 1N95A 3PZ3A 3Q73A 3DSSA 3Q7FA 3EU5A 1DCEA 1O1SA 1QBQA 1TNBA 1N4RA 3E34A 1LD7A 1SA5A 1O5MA 3Q79A 1N94A 1O1TA 3DSTA 2H6HA 4GTQA 1NL4A 4LNBA 3C72A 1KZPA 4GTSA 4GTOA 3HXEA 2R2LA 1O1RA 3DSXA 3KSLA 3KSQA 1MZCA 1TNOA 1N9AA 1TN6A 1FPPA 1NI1A 3E30A 1N4QA 3DSVA 3Q7AA 3HXBA 2F0YA 4GTMA 1JCSA 1S63A 4GTPA 1S64A 3SFXA 1X81A 3DRAA 4GTRA 3Q75A 1KZOA 2H6FA 2IEJA 3DPYA 3PZ1A 4MBGA 1D8DA 1TNUA 1JCQA 3EUVA 2BEDA 1SA4A 4YDEA 1FT2A 1D8EA 4LNGA 4GTTA 3Q78A 2H6GA 3DSUA 3E37A 4GTVA 1LTXA 1TNYA 1JCRA 1TN8A 2ZIRA 3E33A 2H6IA 1TNZA 3PZ2A 3HXDA 1N4SA 3E32A 3PZ4A 4L9PA 1TN7A 1N4PA 2ZISA 3SFYA 1FT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LD8 A;  3HXF A;  3DSW A;  4YDO A;  4EHM A;  3HXC A;  1N95 A;  3PZ3 A;  3Q73 A;  3DSS A;  3Q7F A;  3EU5 A;  1DCE A;  1O1S A;  1QBQ A;  1TNB A;  1N4R A;  3E34 A;  1LD7 A;  1SA5 A;  1O5M A;  3Q79 A;  1N94 A;  1O1T A;  3DST A;  2H6H A;  4GTQ A;  1NL4 A;  4LNB A;  3C72 A;  1KZP A;  4GTS A;  4GTO A;  3HXE A;  2R2L A;  1O1R A;  3DSX A;  3KSL A;  3KSQ A;  1MZC A;  1TNO A;  1N9A A;  1TN6 A;  1FPP A;  1NI1 A;  3E30 A;  1N4Q A;  3DSV A;  3Q7A A;  3HXB A;  2F0Y A;  4GTM A;  1JCS A;  1S63 A;  4GTP A;  1S64 A;  3SFX A;  1X81 A;  3DRA A;  4GTR A;  3Q75 A;  1KZO A;  2H6F A;  2IEJ A;  3DPY A;  3PZ1 A;  4MBG A;  1D8D A;  1TNU A;  1JCQ A;  3EUV A;  2BED A;  1SA4 A;  4YDE A;  1FT2 A;  1D8E A;  4LNG A;  4GTT A;  3Q78 A;  2H6G A;  3DSU A;  3E37 A;  4GTV A;  1LTX A;  1TNY A;  1JCR A;  1TN8 A;  2ZIR A;  3E33 A;  2H6I A;  1TNZ A;  3PZ2 A;  3HXD A;  1N4S A;  3E32 A;  3PZ4 A;  4L9P A;  1TN7 A;  1N4P A;  2ZIS A;  3SFY A;  1FT1 A; 
#chains in the Genus database with same CATH topology
 3HHM A;  4YDO A;  1HS6 A;  4MKT A;  3ASN E;  5AEN A;  4C0M A;  2BKG A;  3TWX A;  3DSS A;  5KCM A;  3SGH A;  3SD5 A;  2XPY A;  3FU3 A;  3PVL A;  2XEE A;  1O1T A;  3DST A;  4CYM D;  2PM7 A;  1Y8M A;  3ZGQ A;  5CEA A;  4HFG A;  4U0S A;  4AXH A;  3RJV A;  2M63 A;  4FJY A;  3Q9N C;  3PUK A;  1DNP A;  3FTV A;  1E8X A;  4JVS A;  5KJK A;  4UWK A;  4GTP A;  1S64 A;  3AS5 A;  4GTR A;  3OTN A;  2FEZ A;  3T9K A;  3ZHE A;  4J6I A;  1YYH A;  4G25 A;  5LCW J;  4TRQ A;  1KT0 A;  3CVW A;  3ZKJ A;  4AY6 A;  1D8E A;  2L6J A;  4RSY A;  4F53 A;  3KS2 A;  1B89 A;  3GW4 A;  2R59 A;  4PS7 A;  4KVO A;  5AQA A;  4Q69 A;  4HOU A;  3PE3 A;  4E85 A;  2DVW A;  3AG2 E;  3ZPJ A;  2HR2 A;  3FP3 A;  3L16 A;  5CEC B;  1V54 E;  3LDZ A;  3R9A B;  2GRQ B;  3IXE A;  5E76 A;  1H19 A;  3JQ0 A;  4EEC A;  3CV0 A;  3DSW A;  4G8K A;  2J9Q A;  3Q73 A;  2X6H A;  4DLO A;  3EU5 A;  3E34 A;  3T8K A;  5JJT A;  4TXP A;  4HB5 A;  2FO7 A;  5EID A;  4XKB A;  1IKN D;  3HXE A;  2R2L A;  3ZRH A;  3UT7 A;  3GZ1 A;  3RKV A;  2WXP A;  3SF4 A;  4WWN A;  2VTB B;  4LEU A;  4FLH A;  3BQO A;  4GZ6 A;  2WXM A;  1XNF A;  3MV3 B;  3ASO E;  2BED A;  2KBX A;  2CFZ A;  3CVL A;  4NQ0 A;  1DCQ A;  2UY1 B;  4N3A A;  1OY3 D;  2XS8 A;  2RFA A;  4JC8 A;  2J8S D;  5ENS D;  3J5P A;  2GRP B;  3MKQ B;  3C3Q A;  2H6I A;  1TNZ A;  5IY5 E;  4JPS A;  2P58 C;  2XEH A;  3PNT B;  2EIK E;  5G05 C;  1HZ4 A;  3LY9 A;  2IO3 C;  4GZ3 A;  2QYJ A;  4FJZ A;  3CST A;  4WNF A;  1HU3 A;  3EIQ C;  2YIN A;  3E4B A;  1ZU2 A;  2P9L G;  5G2N A;  5FTP A;  1FVF A;  4HLE A;  4U8H A;  5LP0 A;  4JHJ A;  4JL0 A;  5JMN D;  4XI0 A;  3D9P A;  4UI9 K;  1TYQ G;  1MQS A;  2B6C A;  3I3N A;  4A3T A;  2RFM A;  3FEX A;  1DVP A;  1FPP A;  5AAO A;  2MHK A;  1WG0 A;  4P29 A;  4LUN U;  2WQ7 A;  4ABN A;  4G26 A;  3FTU A;  2VGY A;  3K9I A;  3WXX A;  4DX7 D;  3UT8 A;  1UG3 A;  3FU6 A;  1KZO A;  4Q94 A;  5CHE E;  1S70 B;  3VLD A;  3ZU7 B;  3TWW A;  4WNE A;  4KVM A;  4PDX A;  1AP7 A;  4G8L A;  2DIW A;  2X6K A;  4O1O A;  2PZI A;  4DX6 D;  2H6G A;  5AQ9 A;  4CDN A;  3LCA A;  1HE8 A;  3CHR A;  3FUI A;  3E33 A;  3D9H A;  1TR4 A;  3HXD A;  5BPP A;  2GRN B;  2VSN A;  3FUL A;  3PZ4 A;  4BFR A;  3CK7 A;  1ZB1 A;  3RAU A;  4B8A A;  1SZ9 A;  4EHM A;  4EZK A;  5G04 C;  3PZ3 A;  5BT1 A;  2FI7 A;  4JHR A;  4B93 B;  4PH4 B;  4GA2 A;  3CGH A;  3L22 A;  4GZ5 A;  3CHO A;  2F8Y A;  5ENP D;  4GPM A;  2FO1 E;  1D9S A;  2MRI A;  3ZEF A;  2AJA A;  3FUN A;  1UN8 A;  4BET A;  3MX3 A;  2PL2 A;  1NI1 A;  4K5A B;  3SHF A;  5ENQ D;  2XEN A;  1EF1 C;  2V4L A;  4GTM A;  3PH0 C;  3MEK A;  4URK A;  5JHB A;  4TXQ A;  1X81 A;  4ILH B;  2MOW A;  3JXI A;  3TG5 A;  2NC9 A;  3CK8 A;  1E8Y A;  4HNA D;  2XPZ A;  3VTX A;  4J8D A;  2PQN A;  4XZ4 A;  3FTW A;  2LO6 A;  1H0A A;  3D9O A;  3Q78 A;  2F37 A;  3UTM A;  1UOH A;  3TAX A;  4LG6 A;  3AS8 A;  2CHZ A;  3PEU B;  2EIL E;  5ENN A;  3SBT B;  4AM9 A;  3LXU X;  2X3M A;  4K03 A;  2BF0 X;  4N5Q A;  2KCL A;  3FY4 A;  5AJL A;  3LJN A;  2ION A;  4HRN A;  5CRU A;  2ZIS A;  4WNG A;  2IY0 C;  3FUM A;  1JUQ A;  3ZXP A;  3ASD A;  2RKK A;  3L08 A;  2IJG X;  2XPI A;  3EHR A;  4CGW A;  1KT1 A;  1HX8 A;  2X6F A;  1S0P A;  4G1T A;  3CEQ A;  3CVQ A;  4DK5 A;  5CMW A;  1BI8 B;  4HBD A;  2X38 A;  2Y3A A;  1E7U A;  4PUC A;  3CKC A;  2WXJ A;  1IXV A;  3RU0 A;  2OCC E;  3AG4 E;  2LSV A;  2VGX B;  4APO A;  2ZGG A;  4ATG A;  2I6H A;  3LYA A;  4WAF A;  2F0Y A;  4FHK A;  3IV0 A;  3OXG A;  1JCS A;  3C98 A;  3QJZ A;  3DXM G;  3FUK A;  3V31 A;  1XGW A;  4FA6 A;  3MZL B;  2E2E A;  2NXP A;  3D9K A;  2XGM A;  2OEW A;  3ZW3 A;  1TEZ A;  3TXN A;  2OVB A;  4DI3 A;  5D66 A;  4Y6C A;  3S7B A;  1BD8 A;  1WAO 1;  1EPU A;  4FUL A;  4LNG A;  4WUY A;  3G2V A;  4NUR A;  3D9N A;  3DBS A;  3NBN B;  4BTB A;  2LXL A;  3RRN B;  5LCW C;  2AXV A;  3SNX A;  2IO2 C;  4UQZ A;  3JCK C;  4KT6 B;  4CDR A;  3ZNG A;  3Q49 B;  2L0I A;  3G2U A;  5HI7 A;  1MX2 A;  3B95 A;  3HXC A;  2KXP C;  2KCV A;  4NRH B;  3Q7F A;  4BX8 A;  3LPZ A;  3P2B A;  3AS4 A;  3D9J A;  4B89 A;  3PE4 A;  4K0R A;  2DZN A;  5JHA A;  1HXI A;  1ELK A;  2C0M A;  4DX1 A;  2XZT G;  4ZFH A;  2FF4 A;  4YND A;  2Y4T A;  1HO8 A;  3KEA A;  2VGX A;  3ZYL A;  3ASG A;  2A5E A;  2WM9 A;  3UKU G;  1MX6 A;  2WXN A;  4I6J A;  5EIB E;  3SO8 A;  2PM6 A;  4D10 C;  3Q75 A;  2IF4 A;  4V3I A;  5KWD A;  4F1P A;  1JCQ A;  2VSY A;  4HOT A;  4A1G A;  4GA0 A;  3U64 A;  4TXR A;  5LX8 A;  3RIB A;  2MYO A;  1EYH A;  3ML9 A;  2QY7 A;  1JWG A;  3RO2 A;  5BXU A;  3SBS A;  5FQ4 A;  2C0L A;  3LKU A;  4I9E A;  3FH5 A;  4H7X A;  3Q4A B;  4GMJ A;  3U9W A;  3PZ2 A;  3UUX A;  5EX0 A;  1RW2 A;  3O48 A;  3FUF A;  2B0O E;  2LXM A;  2YQ8 A;  4YVO A;  3BUA A;  1N54 A;  4JW1 A;  3UT4 A;  1FVH A;  5T3R A;  3PRE A;  4MLP A;  4KBQ A;  5EIL A;  3TWV A;  2CHX A;  1A17 A;  4N2Q A;  3FUD A;  1SA5 A;  4XE0 A;  3PS6 A;  3MYV A;  3SQV A;  2VTB A;  3SY2 A;  1NA0 A;  3CR3 A;  4I1O B;  2IFU A;  1N11 A;  3QWP A;  1Z3Y A;  3FUH A;  1UJK A;  4BSX A;  1N9A A;  5CER B;  1EDU A;  3QB2 A;  2ILR A;  1TN6 A;  3NOC D;  4IRU A;  3JYS A;  4AV7 A;  2LAI A;  3HG0 D;  4M3O A;  2EIM E;  4RG9 A;  2H6F A;  3PZ1 A;  4UI9 C;  4WWP A;  1GW6 A;  1HFA A;  3CQC B;  4YDY A;  3Q15 A;  1Z3X A;  3NZU A;  4R7L A;  3TWQ A;  2YHC A;  2WXQ A;  4EBA G;  3L13 A;  5AYW D;  4F6R D;  2XS1 A;  4HRM B;  3ENE A;  2ZIR A;  3FUJ A;  3EJN A;  2GW1 A;  5FIO A;  2KM4 A;  4XEI G;  1Y6I A;  4J7W A;  4L1B A;  3QKY A;  2NYJ A;  4EPZ A;  1TN7 A;  1N4P A;  2I1K A;  2EIN E;  1OCR E;  3T5V A;  3KEZ A;  5T8I A;  1Q2Z A;  4ATZ D;  4DX5 D;  2KAT A;  1OWO A;  4B0Z A;  4DLQ A;  4GCN A;  2YHE A;  2Y1L E;  4GCO A;  3AG1 E;  4YVQ C;  5BV1 A;  4L7T A;  3CHS A;  2J09 A;  1N94 A;  3NB2 A;  2NSZ A;  3SI5 A;  3CIA A;  3CVV A;  1K3Z D;  4JD2 G;  1WDY A;  4LNU D;  4U07 A;  5FQ6 A;  1MYO A;  3QK0 A;  3VLF A;  1TJF A;  4A1S A;  3C3R A;  5FWQ A;  1DC2 A;  3Q9U C;  4CDM A;  4GML A;  1NA3 A;  4A55 A;  5B3S E;  4ZHB A;  4F1S A;  3QWW A;  4ME2 A;  1INZ A;  1UN9 A;  1MHQ A;  4N39 A;  2GGF A;  2I2O A;  2IEJ A;  4CRW A;  3EHQ A;  4F7A A;  2J4D A;  3NAW A;  5JJ7 A;  4KXK B;  1E96 B;  2BKK B;  2GRR B;  4AEZ C;  4I2Z A;  1QNF A;  3B7T A;  2FBN A;  4N3B A;  2L9B A;  2BUG A;  1YCS B;  2WXL A;  2PNN A;  5ARF A;  4RQI A;  5EN5 D;  2DWZ A;  4CEM A;  2P9P G;  5CCM A;  3PUJ A;  2XHE A;  3QAQ A;  5AQB A;  5FQ7 A;  4U7E B;  1E8W A;  3D9I A;  1U3C A;  3SFY A;  2CFU A;  3ZVV A;  3UKR G;  3HXF A;  2R05 A;  4U95 D;  3EHM A;  3ULE G;  4DPR A;  5CED B;  2XZD G;  4AJW A;  3TWT A;  4KYO B;  1MJ0 A;  3UMV A;  3IBE A;  4FP7 A;  1ELW A;  4IYP A;  2I1J A;  3Q79 A;  4LER A;  3C72 A;  2Y69 E;  2J4B A;  1PAQ A;  3R7R A;  3CKB A;  4APF A;  4RVB A;  4A63 B;  1QZ2 A;  3IHV A;  1KLX A;  3AU5 A;  2XCC A;  3L82 A;  2UY1 A;  3B7R L;  3FWV A;  3SFX A;  3W9G A;  3TGO A;  3FUE A;  3RRM B;  3ZUV B;  3APF A;  5A7D B;  4B94 A;  3UQ3 A;  1FT2 A;  2KC7 A;  5J08 A;  4FHJ A;  1G3N B;  1OCZ E;  3U3W A;  2OV8 A;  2R03 A;  3TXM A;  4G11 A;  3EDT B;  2WB2 A;  1TN8 A;  2XCB A;  3LY7 A;  3UPV A;  4I2W A;  3S7F A;  2IOS A;  3FTX A;  3MJW A;  2WQ6 A;  4GAA A;  4GMR A;  2WXI A;  4JEH A;  2P9S G;  4U63 A;  5C1D A;  5ANL A;  4G23 A;  4HOQ A;  4AOF A;  1NP7 A;  4Y6W A;  4FU3 A;  3AJI A;  2OOE A;  2QC9 A;  2WXK A;  2WPV A;  1DCE A;  3ZYQ A;  4ANV A;  3DEP A;  4BEP A;  2VSO E;  4U8Y D;  2F8X K;  3MKR A;  2A4Z A;  3VTY A;  2Y4U A;  2IOL A;  3LVQ E;  1TNO A;  2RD0 A;  1N4Q A;  1OCC E;  4JEU A;  4XX5 A;  4I17 A;  2JAB A;  3V79 K;  2XGO A;  4GZD A;  3TL5 A;  4ILI A;  4U04 A;  5C2Y A;  4ANU A;  1N0R A;  3DRA A;  3NOG D;  5FIN A;  4J8Y A;  4FAD A;  1K1A A;  3WG7 E;  2HO1 A;  5ENO D;  2EIJ E;  4ANX A;  4CGV A;  2WXR A;  2ETC A;  3DPD A;  2AWI A;  4KZ0 A;  1WY6 A;  3MGB A;  3P1U A;  5HRY A;  5JJ6 A;  4YDW A;  5FZQ A;  2EQX A;  4IUL A;  2LAH A;  4JHK A;  4UWG A;  4TUM A;  3IKO B;  3Q5M A;  3D9M A;  4DX2 A;  3ESL A;  3GYZ A;  4L9P A;  4HOR A;  3ABM E;  5CBO A;  2J49 A;  3SFZ A;  4IN3 B;  3LY8 A;  3UI2 A;  3UM2 A;  1BU9 A;  1PY1 A;  3QNK A;  1N95 A;  3UIP C;  1N4R A;  4DJA A;  3B7U X;  4AVX A;  3DXK G;  1LD7 A;  2AXU A;  4C0E A;  2KCK A;  2J07 A;  1IHB A;  4H7Y A;  5EX3 A;  1O1R A;  1OWM A;  2V0P A;  3QOU A;  4GYW A;  4OYS A;  3FTY A;  3ISM C;  2IU1 A;  3HXB A;  5CCL A;  5G04 J;  4UUC A;  2JLB A;  2KZT B;  1S63 A;  4DRX E;  1IHG A;  4JA9 A;  2V5Q C;  3R9M A;  2HYZ A;  2I9C A;  2XQ0 A;  3G2S A;  5HS0 A;  5AQ7 A;  4Z68 A;  1OT8 A;  1PC2 A;  3JUI A;  1SA4 A;  4YDE A;  3S7D A;  3TG4 A;  3BU8 A;  4BY6 A;  1W3B A;  4BT8 A;  2WXF A;  4KMO A;  4GTT A;  4RLY A;  2ZGD A;  4LRZ A;  5M72 A;  3UIN C;  3TWU A;  4C9B B;  3E37 A;  5KNH D;  4AIF A;  1JCR A;  2V5F A;  3W9F A;  1IYG A;  1SVX A;  2P9U G;  3ULY A;  3QWV A;  4CZ2 D;  5EDS A;  5HQ8 A;  2JEK A;  3LEW A;  4L2L A;  3BEE A;  3V2O A;  3AAA C;  5LOZ A;  1L5J A;  1RZ4 A;  3APC A;  3PRZ A;  2WVI A;  3CHP A;  1O1S A;  2AW6 A;  3L17 A;  3JUE A;  2ETB A;  3ZIM A;  2Q7F A;  4HQD A;  4E6H A;  5AN8 A;  5FZR A;  3ASH A;  4GTO A;  2WQH A;  3ZFW A;  4CCA A;  3T8M A;  4NIK A;  3URZ A;  4JXT A;  3PNL B;  4L2Y A;  3ASF A;  4XI9 A;  1ELR A;  1HF8 A;  3L54 A;  3QC1 A;  3ZYK A;  2CHW A;  1K8K G;  4DUI A;  5KBA A;  2PQR A;  1OXJ A;  4OAU C;  4MBG A;  4GPK A;  2CG2 A;  4I1M A;  5AAR A;  3FH7 A;  3PDN A;  4GU5 A;  3CQG B;  2OEV A;  5G05 J;  4HXI A;  4JZY A;  3HRA A;  3OXF A;  3I4G A;  2P9N G;  4HOS A;  2FUL A;  2OND A;  3QDN A;  2VSX E;  5E75 A;  2P9K G;  1SQM A;  2CG3 A;  3MCX A;  4HVB A;  3G2T A;  1OCO E;  5B1A E;  5ANR A;  3RK6 A;  2DCP A;  1HG5 A;  4M7C A;  1K1B A;  3U4T A;  3CSF A;  4AY5 A;  4PS8 A;  2L0T B;  2X6J A;  4EQF A;  2QFC A;  3HVE B;  4HLL A;  4ANW A;  3I5P A;  3NF1 A;  2GRM A;  5KJM A;  3ONK A;  1QBQ A;  3FEY A;  3IHY A;  3QAR A;  4BT9 A;  4ILG A;  4OVV A;  3L9T A;  1YA0 A;  1N0Q A;  1NL4 A;  3B13 A;  1KZP A;  4HS2 A;  4GTS A;  5FT9 A;  3KSQ A;  4X8Q A;  2V4H C;  1NFI E;  2QYU A;  2P2C P;  2YNQ A;  1IQR A;  3DSV A;  3ESK A;  3Q7A A;  4OVU A;  4UI9 J;  2R5S A;  2DBA A;  2WXO A;  4BWR A;  4A3V A;  1YMP A;  3LVR E;  4W9R A;  1BI7 B;  3DPY A;  5KJL A;  3EHN A;  4AP2 A;  5G55 A;  3UIO C;  1BPO A;  3L6A A;  2R17 C;  3C3O A;  1X5B A;  3N71 A;  2OVF A;  2AVP A;  1H6O A;  3MA5 A;  4RG6 A;  3MV2 B;  1VDY A;  5KNG A;  1OWL A;  1V55 E;  1U3D A;  3GZ2 A;  4N2S A;  5BW8 C;  1UW4 B;  1HG2 A;  3DWL G;  3HIZ A;  1TJC A;  3RRU A;  4N3C A;  2AXZ A;  2WXH A;  4U8V D;  4J8F A;  3CVX A;  3NZS A;  1N4S A;  3E32 A;  4J8S A;  2HE0 A;  5ARG A;  3EIJ A;  3DEO A;  3KAE A;  3HYM B;  1N52 A;  3ABL E;  4DI4 A;  1LD8 A;  1AWC B;  3R7Q A;  2LSU A;  4J8E A;  5BNW A;  3CHQ A;  3FU0 A;  5HKP A;  3TJP A;  2WXG A;  4TV3 A;  2GRL A;  3C5R A;  5AIJ A;  3FTS A;  1TNB A;  4PS3 A;  3FU5 A;  3V30 A;  4LCT A;  5EYL A;  3UM1 A;  2H6H A;  3ZXS A;  1BLX B;  4GTQ A;  1H2T C;  4G2V A;  1OWN A;  2XRY A;  3NQP A;  3O4Z A;  3EU9 A;  3ZYM A;  4QQI A;  4B8C B;  2ZXW E;  3GZS A;  3E30 A;  4I9C A;  2RG8 A;  2ZU6 B;  3CK9 A;  1KPS B;  3AU4 A;  3MKQ A;  3LJ3 A;  3U66 A;  4F3V A;  4I43 A;  4JA7 A;  2VGE A;  5EYP F;  1HH8 A;  4BX9 A;  4UQY A;  3CVN A;  5KJN A;  5LFA A;  4TUU A;  3AG3 E;  3CVU A;  3PEV B;  5ENR D;  2WMN A;  5CBN A;  3DSU A;  3IEG A;  4WWO A;  1OUV A;  5CMY A;  5FZS A;  1LTX A;  2XGS A;  2A5U A;  1OWP A;  4XIF A;  2DZO A;  4EZL A;  3RO3 A;  4QFV A;  1ZBP A;  1E7V A;  5D0Q D;  1U2V G;  2Y0B G;  3ULQ A;  5BXO A;  4G24 A;  3FHE A;  4BES A;  2XEV A;  4CT4 A;  4NAC A;  1QYM A;  3LS8 A;  5FJY A;  3CVY A;  3B7B A;  2X6I A;  4I6G A;  5ITZ F;  3UXG A;  3JXJ A;  3TWS A;  2QZA A;  4K5C A;  4KZC A;  4EZJ A;  1Z6T A;  5DIZ A;  3T5X A;  1JPL A;  1A5E A;  5CRV A;  4BSZ B;  2IQC A;  5FQ8 A;  2DYR E;  3KSL A;  4WND A;  1MZC A;  3UM0 A;  4BER A;  4GYY A;  1LF8 A;  5B1B E;  5D2M C;  2HM8 A;  1H2V C;  4ACL A;  4I1A A;  5A23 A;  4HI9 A;  4O60 A;  3B7S A;  3D9L A;  2L6B A;  1D8D A;  5J90 A;  5DBK A;  3ABK E;  3J5Q B;  3F6Q A;  5AJD A;  3PZD A;  4GZC A;  3CLJ A;  2J08 A;  4J0U A;  4FLB A;  3CHM A;  3V2X A;  4UWF A;  3ONL A;  3ZHE B;  1P5Q A;  2VYI A;  1H6P A;  2C2L A;  2LUH A;  2V8S E;  2VQ2 A;  1NZN A;  5T4Y A;  4BTA A;  1H6K A;  4UQX A;  4UWL A;  1IQU A;  5ENT D;  1FT1 A;  4CT0 A;  3BG0 B;  4U0U A;  4JB8 P;  1E90 A;  3FFL A;  1WM5 A;  3OAW A;  1SW6 A;  4XKC A;  3ZN3 A;  5BUZ A;  4Q96 A;  3Q47 B;  3BG1 B;  2LNI A;  1SZA A;  2BTD A;  5A6C A;  1O5M A;  3OXL A;  4L23 A;  1MX4 A;  2GRO B;  3TWR A;  2XRZ A;  4LNB A;  1QQE A;  3D3M A;  2P9I G;  4O6F A;  3DSX A;  2UWJ G;  5D0O D;  4LSZ E;  3FH8 A;  2ETA A;  4MRU A;  4U96 D;  4U0Z A;  4EBA A;  5H7P A;  4N5C A;  4ACK A;  3KD7 A;  3SZ7 A;  4HRL A;  2DYS E;  4O1P A;  1TNU A;  4GA1 A;  5BV0 A;  3X2Q E;  3HVE A;  3JQ1 A;  3EUV A;  3ML8 A;  5EKQ D;  3S2A A;  4GYO A;  3CVP A;  4GB9 A;  4I6E A;  1H2U A;  2KZT A;  1JWF A;  4UWH A;  4MS6 A;  3FDH A;  3I4R B;  4HI8 A;  4C48 B;  1UJJ A;  4GTV A;  1TNY A;  2E0I A;  3UM3 A;  2WMO A;  1E8Z A;  1FCH A;  3HDX A;  2R02 A;  3G2W A;  3VLE A;  2VJ8 A;  3FTZ A;  4K5B A;  5JA4 D;  3APD A;  1Z5S C;  3S7J A;  4FC8 A;  3RSE G;  4OAV B;  3UX4 A; 
#chains in the Genus database with same CATH homology
 1LD8 A;  3HXF A;  3DSW A;  4YDO A;  4EHM A;  3HXC A;  1N95 A;  3PZ3 A;  3Q73 A;  3DSS A;  3Q7F A;  3EU5 A;  1DCE A;  1O1S A;  1QBQ A;  1TNB A;  1N4R A;  3E34 A;  1LD7 A;  1SA5 A;  1O5M A;  3Q79 A;  1N94 A;  1O1T A;  3DST A;  2H6H A;  4GTQ A;  1NL4 A;  4LNB A;  3C72 A;  1KZP A;  4GTS A;  4GTO A;  3HXE A;  2R2L A;  1O1R A;  3DSX A;  3KSL A;  3KSQ A;  1MZC A;  1TNO A;  1N9A A;  1TN6 A;  1FPP A;  1NI1 A;  3E30 A;  1N4Q A;  3DSV A;  3Q7A A;  3HXB A;  2F0Y A;  4GTM A;  1JCS A;  1S63 A;  4GTP A;  1S64 A;  3SFX A;  1X81 A;  3DRA A;  4GTR A;  3Q75 A;  1KZO A;  2H6F A;  2IEJ A;  3DPY A;  3PZ1 A;  4MBG A;  1D8D A;  1TNU A;  1JCQ A;  3EUV A;  2BED A;  1SA4 A;  4YDE A;  1FT2 A;  1D8E A;  4LNG A;  4GTT A;  3Q78 A;  2H6G A;  3DSU A;  3E37 A;  4GTV A;  1LTX A;  1TNY A;  1JCR A;  1TN8 A;  2ZIR A;  3E33 A;  2H6I A;  1TNZ A;  3PZ2 A;  3HXD A;  1N4S A;  3E32 A;  3PZ4 A;  4L9P A;  1TN7 A;  1N4P A;  2ZIS A;  3SFY A;  1FT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...