1QBQA

Structure of rat farnesyl protein transferase complexed with a cvim peptide and alpha-hydroxyfarnesylphosphonic acid.
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
312
structure length
312
Chain Sequence
b'FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FPT ALPHA-SUBUNIT
publication title Crystal structure of farnesyl protein transferase complexed with a CaaX peptide and farnesyl diphosphate analogue
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 118
structure length 312
sequence length 312
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 1999-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1qbqA00
1FT2A 3EUVA 2F0YA 3DRAA 3KSQA 3PZ3A 3Q7AA 2IEJA 1TN6A 3SFYA 3C72A 1QBQA 3PZ2A 1TNUA 3HXEA 1N4SA 2H6GA 3Q79A 1N9AA 1LD8A 2H6IA 3DSUA 3HXCA 2H6HA 4YDEA 4GTMA 3SFXA 1LTXA 1N95A 1SA4A 3DSXA 3PZ1A 2H6FA 1O5MA 1TN7A 2ZIRA 2BEDA 3HXBA 4GTSA 1O1SA 3HXFA 1SA5A 4GTPA 4GTVA 4MBGA 3HXDA 3DSSA 3Q7FA 1KZPA 1FT1A 4L9PA 3DSVA 3Q75A 1D8EA 1N4QA 1MZCA 4GTTA 4YDOA 1NI1A 1TNYA 4GTQA 1O1RA 3E30A 4GTOA 4GTRA 1FPPA 3DPYA 1JCQA 1S64A 3DSTA 3E33A 1TNZA 1TNBA 3KSLA 1JCSA 1TN8A 3Q73A 1N94A 3E37A 1DCEA 3EU5A 1LD7A 3PZ4A 4LNBA 1NL4A 2ZISA 3Q78A 1TNOA 1O1TA 1N4RA 3E32A 1X81A 1N4PA 1D8DA 1KZOA 1S63A 4LNGA 2R2LA 1JCRA 3E34A 4EHMA 3DSWA
chains in the Genus database with same CATH superfamily
1FT2A 3EUVA 4CT0A 3R9MA 3FUHA 2IEJA 5BW8C 5E76A 2DCPA 3FTVA 2FI7A 3LY9A 4LUNU 2DIWA 1IXVA 4ILHB 2WXHA 2IOSA 3MX3A 5CCMA 4A63B 4UI9K 3SFXA 3CVQA 1IQUA 3ABME 3T9KA 3FP3A 4AJWA 3ULQA 4A1GA 2OV8A 3LVRE 2WXIA 1QNFA 4ILGA 4EPZA 2C0MA 3CKBA 4FLHA 3UTMA 4GCOA 4L2LA 1N11A 2JLBA 2C2LA 4N5QA 3PUKA 4HRLA 3DSVA 1D8EA 1MZCA 4DJAA 3DXKG 1E8XA 2J9QA 5CMYA 4GMJA 2AWIA 4M7CA 4CRWA 3CHSA 2OOEA 3FTYA 5FWQA 4G25A 1H2TC 1OCZE 4L7TA 4JEHA 1BU9A 4GA0A 1UOHA 3V2OA 2WVIA 3D9OA 5G55A 4OAVB 1UW4B 3OXGA 1TN8A 2EIKE 1N94A 1IHGA 3ZEFA 1U3CA 3D9IA 3TJPA 3AS8A 2WB2A 2ZISA 3OTNA 3T8MA 3UKUG 4L1BA 2R17C 3CK8A 4XZ4A 3QK0A 1Z5SC 2YQ8A 3SF4A 5A6CA 3FDHA 2ZGDA 4XI0A 3RSEG 2P9LG 4MRUA 3PNTB 1QBQA 3HXEA 3LPZA 1E96B 3U4TA 3FHEA 2L0TB 4YVQC 4I1MA 5G05J 5BV0A 3RAUA 2VGXA 2ZIRA 5EYPF 3B13A 3LS8A 3PDNA 3ENEA 1SA5A 3URZA 2IO3C 2L0IA 3SD5A 2GRLA 4FADA 4U07A 2VTBA 4DPRA 4U8HA 1HU3A 1AP7A 3LDZA 5ITZF 5B1AE 5EX0A 4DRXE 1IKND 5KNHD 4GTOA 5JA4D 3C3OA 3CQGB 5EN5D 3CK9A 1E8ZA 5AYWD 2V5QC 3NZUA 2GRRB 4K03A 1VDYA 3FUKA 3ZFWA 5ANRA 2LSVA 3MEKA 4JC8A 2P9UG 3SNXA 1MYOA 2R59A 5B3SE 2HE0A 4KXKB 2EQXA 4MLPA 2XEEA 5CEAA 3APCA 3QKYA 4N39A 4PH4B 2IO2C 1HX8A 1TN6A 4WNEA 3EIQC 3R7RA 2ZU6B 2MHKA 3PZ2A 3S7FA 1N9AA 4HBDA 3HXCA 3FUJA 4AOFA 4TV3A 3TXNA 1N52A 1MX6A 2GRNB 2XEVA 1H6OA 4UI9C 3P2BA 1E7VA 4EZKA 3OXFA 3SZ7A 2BKKB 2Q7FA 4X8QA 5FQ4A 4DLOA 4G2VA 1N0RA 1S0PA 2GGFA 3TWSA 3CR3A 2XGSA 2WXMA 3CV0A 4KZ0A 4DX7D 3FFLA 1JPLA 4EBAG 4HQDA 3BUAA 3BQOA 4HLLA 4JEUA 3FH7A 4U96D 1Z3XA 2VGYA 4U8VD 4Y6CA 2KZTA 1OWMA 3UKRG 3DSTA 2LNIA 5D0OD 4U04A 5ENRD 3SGHA 4NACA 3Q73A 3OAWA 2GRQB 3S2AA 4L23A 4N2QA 3EDTB 2LXLA 2WXKA 2VJ8A 2M63A 3ESLA 2NSZA 3Q4AB 2FO1E 2EINE 4BEPA 2XPIA 1MX2A 1A17A 4APFA 3L9TA 5ENNA 1JCRA 3L17A 3FUDA 3Q7AA 4DX2A 4CZ2D 1ZBPA 4WWPA 2VTBB 4J8YA 4D10C 2VSYA 2I6HA 2P9KG 4C48B 3UXGA 4UQZA 4F1SA 2GRMA 2Y4TA 4GA1A 5FQ7A 3DSUA 1BPOA 5AQBA 1BD8A 2LUHA 4AY6A 2HYZA 2Y0BG 3Q47B 3FUNA 1PY1A 5FQ6A 1HG2A 4B8CB 1BI7B 2AJAA 4Y6WA 3MCXA 3RRNB 2FF4A 5AARA 3AS5A 4V3IA 1EF1C 3VLFA 3ZYQA 1AWCB 1V54E 2Y1LE 4L9PA 1H0AA 2RFMA 4C9BB 4A3TA 4RQIA 4XX5A 5FTPA 3IHVA 4B93B 4URKA 4GTRA 3AG3E 2CHZA 4O1PA 3V31A 5CEDB 4ILIA 3U9WA 3UM3A 5KBAA 1RZ4A 4TUMA 1KT1A 2X3MA 2BF0X 3Q9UC 4K0RA 1ZB1A 3CHRA 3L82A 4H7YA 4N3BA 2QZAA 3EU5A 5KJNA 3ZGQA 5M72A 2WQHA 3L22A 5AAOA 5BNWA 3LYAA 3CVVA 4JXTA 3ASOE 1HO8A 5AJDA 2NYJA 1QYMA 4JA9A 3PZ3A 3JUEA 4GYWA 5FZQA 3CEQA 2WXPA 3CVNA 3BG0B 1OXJA 2XCBA 3ULEG 3I4GA 1YYHA 4YDEA 2KZTB 3UT4A 3GZSA 4XE0A 3ZN3A 4KT6B 4NQ0A 1TN7A 4XKBA 5EIDA 3V79K 4UWFA 3SY2A 3F6QA 3K9IA 3G2UA 3ZXPA 3UM2A 4Q94A 3CVLA 5HS0A 1KZPA 2P2CP 4RG9A 3BEEA 3PREA 4GAAA 1TYQG 2PM6A 4J7WA 3CHOA 3MKQB 1OWOA 3UM0A 5EX3A 4HI9A 5BUZA 2ONDA 1OT8A 2X6JA 4KZCA 4JPSA 3QARA 1OUVA 3EIJA 3SBSA 3ZRHA 4U7EB 3JXJA 3LVQE 4HOUA 2Y3AA 4HRNA 5AQ9A 3D9JA 5DIZA 1NZNA 4ANUA 3FH8A 4G8KA 4YNDA 3T5XA 3MZLB 2Y4UA 4G24A 3RRUA 3QWPA 1U2VG 2DWZA 2KBXA 2KM4A 3ZPJA 3KSQA 1K3ZD 2OCCE 4L2YA 3OXLA 4GCNA 4LERA 1N4SA 2B0OE 3Q79A 4PUCA 3SFZA 2WXOA 2J07A 4BY6A 3J5QB 4U0UA 3ASFA 2JABA 4TXRA 3KAEA 1QZ2A 4U63A 4U0SA 2UY1A 1IQRA 4HFGA 3QB2A 2XHEA 5FIOA 4RLYA 5ARFA 1XNFA 3Q7FA 1YCSB 4G23A 2QC9A 5ARGA 3PEUB 4EZLA 1HZ4A 1LF8A 4UQXA 5FQ8A 1TNBA 4TXPA 1HF8A 2LXMA 3ESKA 4JHKA 3ZVVA 1LD7A 3PZ4A 1NL4A 3TWUA 3KD7A 1PAQA 3Q78A 2OVBA 1O1TA 2NC9A 2WXFA 1DNPA 4IN3B 1V55E 5KJKA 5T4YA 4K5BA 2R2LA 2P9NG 4I9CA 3FTWA 3N71A 3APFA 4O1OA 4PS7A 2IONA 4N2SA 4KMOA 3ZHEB 3LXUX 3FUFA 2NXPA 4UWKA 1LD8A 2HM8A 3QWVA 3ZIMA 3TWWA 1OCRE 3B7RL 1LTXA 4LG6A 4I2ZA 5C2YA 3JYSA 3LCAA 3AG4E 3X2QE 2DVWA 4FU3A 5LCWC 1O1SA 1OWLA 5JJ7A 2MYOA 4GTVA 3L13A 2AXUA 2QY7A 4HXIA 4E6HA 3RRMB 4HI8A 3S7BA 4U8YD 2GROB 1N4QA 3G2VA 1HS6A 3FUIA 2V5FA 3DEOA 1DCQA 3T8KA 3PE4A 5CECB 1S64A 3GZ2A 3B7UX 1E90A 4CDRA 1WDYA 3IKOB 1FCHA 1TNZA 1H2UA 2WPVA 3EHRA 2KCKA 5FINA 4I43A 2WQ7A 3LY7A 3NOGD 2UY1B 1IHBA 4A55A 3KEAA 3FUEA 5LFAA 3ZNGA 4BFRA 5EKQD 3L08A 3AS4A 3SQVA 1JWGA 1SVXA 3DEPA 1OCOE 4GU5A 4C0MA 2R03A 2VYIA 3PUJA 1NA3A 3B7BA 3QDNA 3ABKE 2X6HA 3JQ1A 1N95A 4TXQA 4UWLA 2RG8A 3FTXA 3VLDA 4F6RD 3UPVA 3PS6A 4AIFA 4HNAD 3U64A 1UG3A 3HDXA 2XZDG 5CRUA 4ATGA 3L16A 3HXDA 1UN8A 2CFZA 4IRUA 2WXQA 3HIZA 3IXEA 3HHMA 3L6AA 1A5EA 1MJ0A 3E30A 1H6KA 2AXZA 5J08A 3UIPC 4P29A 3PE3A 1N54A 2J49A 4YDWA 4UQYA 5CERB 3E33A 4YDYA 4AP2A 4WAFA 4Q96A 3D3MA 3C98A 5KJLA 3PRZA 3ZYLA 2ZXWE 3ABLE 2V4HC 2WM9A 3QOUA 1BI8B 4YVOA 3TWVA 3AG1E 1YMPA 4ABNA 4RG6A 1S63A 4FHJA 4LNGA 4EQFA 3E34A 2LAIA 3LEWA 2WXNA 2BTDA 4BESA 1ZU2A 4I17A 3B7TA 1H2VC 3S7JA 3DRAA 1NP7A 2VGXB 1TNUA 1P5QA 5ENTD 2PM7A 3O48A 1TJFA 1O5MA 3ZYMA 2F8XK 2DZOA 4I2WA 3FWVA 1OY3D 2YHCA 3BG1B 4GTSA 5C1DA 4JL0A 2FO7A 5JJ6A 2R5SA 3Q75A 2IF4A 4WUYA 3MJWA 5AQAA 4KVOA 3DWLG 4N5CA 3APDA 2DBAA 5AJLA 5AQ7A 4WNDA 2RFAA 5KWDA 2QYUA 5FJYA 2IOLA 3LY8A 1QQEA 5BXUA 3U66A 2RKKA 3FULA 5DBKA 3CSTA 5BXOA 4DUIA 3EHNA 3U3WA 1WM5A 5JMND 3GYZA 3FTZA 4TRQA 2VQ2A 3JCKC 4B8AA 3ZKJA 4AVXA 1EYHA 1UJKA 3SFYA 1Y6IA 4WWNA 3BU8A 2XS1A 3VLEA 3S7DA 5EIBE 4AXHA 1FVFA 2CG2A 2J08A 4U0ZA 2XPYA 4A1SA 2KCLA 1E8YA 3NQPA 3CVWA 5D66A 2E2EA 2I1JA 4FJYA 2F37A 4ANVA 4FHKA 2QYJA 2EILE 1KLXA 1SZ9A 4HOTA 3D9PA 4J8EA 4CYMD 4XEIG 2FULA 4GMRA 4FC8A 4J0UA 2EIJE 1OWPA 1Y8MA 2LSUA 3Q9NC 3NB2A 3KS2A 4CCAA 4GTQA 5LX8A 5FT9A 4Z68A 5LCWJ 1FPPA 3DPYA 5HKPA 3ZU7B 1ELWA 2FEZA 3UI2A 1XGWA 4PS8A 1K8KG 3C3RA 2UWJG 2BUGA 2X6FA 3HVEA 3NOCD 3CVPA 5BV1A 5KCMA 3JUIA 3UUXA 4OAUC 2IJGX 2V0PA 1D9SA 5ANLA 2WMOA 1X81A 3CSFA 3IHYA 2XZTG 4J6IA 4EZJA 2EIME 2C0LA 2YNQA 4EHMA 4J8SA 4J8FA 3JQ0A 4DLQA 1TEZA 3CVYA 4JHJA 4G8LA 2ZGGA 3ASNE 3C72A 3CQCB 4GZ3A 2H6GA 3VTXA 4B0ZA 2CHWA 3C3QA 5JJTA 2J4BA 3PVLA 3KEZA 2ETAA 4HS2A 5HI7A 3ASGA 3PH0C 3PZ1A 4XKCA 2IY0C 2CFUA 5JHAA 2DYSE 2P9SG 5D0QD 2A5UA 5J90A 4OYSA 2L6JA 4FULA 1JWFA 2GRPB 4WNFA 5HRYA 4GPKA 3EHQA 2V8SE 5EDSA 4M3OA 4B89A 4CEMA 1TNYA 3HRAA 4DI3A 1SW6A 4DI4A 3I5PA 4GZ5A 4ANWA 3KSLA 5BT1A 3E37A 2MRIA 4UI9J 3FY4A 2QFCA 4HRMB 4KBQA 1PC2A 2XEHA 2PZIA 4I6JA 2P9IG 4EBAA 4GMLA 3CHMA 3MGBA 1KZOA 3L54A 4ATZD 4GYOA 3IBEA 4JD2G 3CVUA 4JB8P 2F0YA 4NIKA 5CMWA 5CRVA 4BT8A 3ISMC 1EPUA 2PQNA 4F7AA 3D9HA 2H6HA 1WG0A 2ETBA 4AV7A 3G2WA 3QC1A 3UINC 3CHPA 4AEZC 2WXJA 3HVEB 2XGOA 1H19A 3MYVA 4FLBA 1N0QA 5FZSA 3R9AB 2HR2A 4J8DA 4MBGA 3DSSA 2VGEA 1TR4A 3EJNA 1HXIA 2VSXE 2B6CA 1NFIE 2X38A 4BTAA 4JHRA 1W3BA 5G2NA 3QNKA 4E85A 4I6EA 4O6FA 4K5CA 4GZDA 1YA0A 3B7SA 3IV0A 3ZXSA 4Q69A 4CGWA 4XI9A 4APOA 3ML8A 1DCEA 4G1TA 3IEGA 4BWRA 3Q5MA 5AN8A 5G04C 4W9RA 3TG5A 2XCCA 4H7XA 1N4RA 2AVPA 5A23A 3T5VA 4N3CA 1Q2ZA 3RU0A 2AXVA 3D9LA 4GYYA 4I1OB 3DSWA 3PNLB 1Z6TA 5FZRA 3VTYA 1ELRA 5CBOA 4UWGA 1DC2A 2KC7A 2CG3A 4GPMA 2X6IA 3MA5A 3UQ3A 4KYOB 4N3AA 5D2MC 5A7DB 2MOWA 3GZ1A 1JUQA 3G2TA 2JEKA 3RKVA 4DX1A 2J4DA 1UJJA 1L5JA 5JHBA 1MHQA 5E75A 1E7UA 2P58C 5BPPA 3ZYKA 3QAQA 2BEDA 3EU9A 3HXBA 3D9NA 4GTPA 2Y69E 4R7LA 3ONLA 1NA0A 2R05A 2KCVA 3ONKA 3CIAA 4GTTA 4YDOA 3UX4A 1O1RA 2HO1A 1MX4A 3FU5A 2PNNA 2J09A 3UM1A 4HORA 2ILRA 2X6KA 2XS8A 4NRHB 4GZ6A 4CDNA 5H7PA 2LO6A 3HG0D 4BX9A 4CGVA 2I1KA 5AENA 3CLJA 3UIOC 4CT4A 3RO3A 2ETCA 4UWHA 2WXRA 5CBNA 3NF1A 2VSOE 3DXMG 4ACKA 1ELKA 5EYLA 2DZNA 3AG2E 5KNGA 4ME2A 2XRZA 4F3VA 3G2SA 4RSYA 2H6IA 1IYGA 1BLXB 2YHEA 5ENQD 3TWRA 3W9GA 2IU1A 3DSXA 2E0IA 1E8WA 3ULYA 3UT7A 2A5EA 4LRZA 4BX8A 3AJIA 1B89A 4IYPA 4K5AB 3HXFA 3I3NA 3E4BA 3TG4A 5ENSD 4LEUA 4F53A 1WAO1 1FT1A 1HG5A 2PL2A 3FTUA 1NI1A 4C0EA 4JZYA 3DBSA 4HOSA 2YINA 2KATA 3UT8A 3WXXA 2RD0A 3CK7A 3MV3B 2XPZA 1DVPA 3V30A 2IFUA 3MKQA 1SQMA 3FUMA 4CDMA 2AW6A 1TNOA 1OCCE 2XQ0A 2PQRA 3D9MA 3E32A 4BSZB 2GW1A 4XIFA 2KXPC 4AM9A 4QFVA 4MKTA 2IQCA 4GZCA 4ACLA 5G05C 4MS6A 5KJMA 4IULA 3J5PA 1K1BA 4AY5A 1KT0A 2WQ6A 3TWTA 4FP7A 3ASDA 1U3DA 2BKGA 3CKCA 1K1AA 4LSZE 2WXGA 4BETA 1X5BA 2J8SD 4U95D 3WG7E 2OVFA 1SA4A 5ENOD 3FH5A 2H6FA 3CVXA 3CGHA 4PDXA 3I4RB 3TL5A 1G3NB 4DX5D 4GB9A 3NZSA 1GW6A 3MV2B 5T8IA 3EHMA 3FU6A 2F8YA 2XRYA 3SO8A 4JVSA 3ZW3A 4TUUA 4ANXA 3CHQA 2XENA 2P9PG 2I9CA 1WY6A 2L9BA 2OEWA 4QQIA 5EILA 1FVHA 3Q15A 3QWWA 2OEVA 3Q49B 4UUCA 4I6GA 3AU5A 3HYMB 1HE8A 3FU0A 4HVBA 4I9EA 3ASHA 5AIJA 2L6BA 4OVUA 3NAWA 2FBNA 4LNBA 3P1UA 3D9KA 1HFAA 4LNUD 4BSXA 3C5RA 2CHXA 3V2XA 1D8DA 4NURA 5CHEE 5LP0A 3TXMA 3LJNA 4JA7A 5LOZA 1MQSA 4B94A 4DX6D 1HH8A 4DK5A 4BT9A 4HOQA 3SBTB 5G04J 2A4ZA 2I2OA 4ZFHA 3RIBA 3FEYA 4G26A 2XGMA 3AU4A 3TGOA 5HQ8A 4OVVA 4GA2A 1OWNA 4GTMA 3LKUA 5CCLA 4F1PA 3ZHEA 4ZHBA 1INZA 2VSNA 3FU3A 3LJ3A 4HLEA 4BERA 3R7QA 3AAAC 3W9FA 2R02A 3UMVA 4WNGA 1EDUA 1Z3YA 3ZUVB 4BTBA 3RJVA 1KPSB 4A3VA 4KVMA 2WXLA 3ML9A 3GW4A 3FEXA 4WWOA 2V4LA 4RVBA 2WMNA 4I1AA 5B1BE 1TJCA 3NBNB 3PZDA 5ENPD 3JXIA 1JCQA 5IY5E 1SZAA 4JW1A 4G11A 3RK6A 3B95A 3SHFA 3TWQA 1RW2A 2DYRE 4LCTA 2LAHA 3QJZA 4PS3A 1JCSA 4O60A 4FJZA 3DPDA 3TWXA 3MKRA 3TAXA 1N4PA 4EECA 4HB5A 3FTSA 4FA6A 1H6PA 3PEVB 3O4ZA 3RO2A 1S70B 5T3RA 1UN9A 3SI5A
chains in the Genus database with same CATH topology
1FT2A 3EUVA 2F0YA 3DRAA 3KSQA 3PZ3A 3Q7AA 2IEJA 1TN6A 3SFYA 3C72A 1QBQA 3PZ2A 1TNUA 3HXEA 1N4SA 2H6GA 3Q79A 1N9AA 1LD8A 2H6IA 3DSUA 3HXCA 2H6HA 4YDEA 4GTMA 3SFXA 1LTXA 1N95A 1SA4A 3DSXA 3PZ1A 2H6FA 1O5MA 1TN7A 2ZIRA 2BEDA 3HXBA 4GTSA 1O1SA 3HXFA 1SA5A 4GTPA 4GTVA 4MBGA 3HXDA 3DSSA 3Q7FA 1KZPA 1FT1A 4L9PA 3DSVA 3Q75A 1D8EA 1N4QA 1MZCA 4GTTA 4YDOA 1NI1A 1TNYA 4GTQA 1O1RA 3E30A 4GTOA 4GTRA 1FPPA 3DPYA 1JCQA 1S64A 3DSTA 3E33A 1TNZA 1TNBA 3KSLA 1JCSA 1TN8A 3Q73A 1N94A 3E37A 1DCEA 3EU5A 1LD7A 3PZ4A 4LNBA 1NL4A 2ZISA 3Q78A 1TNOA 1O1TA 1N4RA 3E32A 1X81A 1N4PA 1D8DA 1KZOA 1S63A 4LNGA 2R2LA 1JCRA 3E34A 4EHMA 3DSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FT2 A;  3EUV A;  2F0Y A;  3DRA A;  3KSQ A;  3PZ3 A;  3Q7A A;  2IEJ A;  1TN6 A;  3SFY A;  3C72 A;  1QBQ A;  3PZ2 A;  1TNU A;  3HXE A;  1N4S A;  2H6G A;  3Q79 A;  1N9A A;  1LD8 A;  2H6I A;  3DSU A;  3HXC A;  2H6H A;  4YDE A;  4GTM A;  3SFX A;  1LTX A;  1N95 A;  1SA4 A;  3DSX A;  3PZ1 A;  2H6F A;  1O5M A;  1TN7 A;  2ZIR A;  2BED A;  3HXB A;  4GTS A;  1O1S A;  3HXF A;  1SA5 A;  4GTP A;  4GTV A;  4MBG A;  3HXD A;  3DSS A;  3Q7F A;  1KZP A;  1FT1 A;  4L9P A;  3DSV A;  3Q75 A;  1D8E A;  1N4Q A;  1MZC A;  4GTT A;  4YDO A;  1NI1 A;  1TNY A;  4GTQ A;  1O1R A;  3E30 A;  4GTO A;  4GTR A;  1FPP A;  3DPY A;  1JCQ A;  1S64 A;  3DST A;  3E33 A;  1TNZ A;  1TNB A;  3KSL A;  1JCS A;  1TN8 A;  3Q73 A;  1N94 A;  3E37 A;  1DCE A;  3EU5 A;  1LD7 A;  3PZ4 A;  4LNB A;  1NL4 A;  2ZIS A;  3Q78 A;  1TNO A;  1O1T A;  1N4R A;  3E32 A;  1X81 A;  1N4P A;  1D8D A;  1KZO A;  1S63 A;  4LNG A;  2R2L A;  1JCR A;  3E34 A;  4EHM A;  3DSW A; 
#chains in the Genus database with same CATH topology
 1FT2 A;  3EUV A;  4CT0 A;  3R9M A;  3FUH A;  2IEJ A;  5BW8 C;  5E76 A;  2DCP A;  3FTV A;  2FI7 A;  3LY9 A;  4LUN U;  2DIW A;  1IXV A;  4ILH B;  2WXH A;  2IOS A;  3MX3 A;  5CCM A;  4A63 B;  4UI9 K;  3SFX A;  3CVQ A;  1IQU A;  3ABM E;  3T9K A;  3FP3 A;  4AJW A;  3ULQ A;  4A1G A;  2OV8 A;  3LVR E;  2WXI A;  1QNF A;  4ILG A;  4EPZ A;  2C0M A;  3CKB A;  4FLH A;  3UTM A;  4GCO A;  4L2L A;  1N11 A;  2JLB A;  2C2L A;  4N5Q A;  3PUK A;  4HRL A;  3DSV A;  1D8E A;  1MZC A;  4DJA A;  3DXK G;  1E8X A;  2J9Q A;  5CMY A;  4GMJ A;  2AWI A;  4M7C A;  4CRW A;  3CHS A;  2OOE A;  3FTY A;  5FWQ A;  4G25 A;  1H2T C;  1OCZ E;  4L7T A;  4JEH A;  1BU9 A;  4GA0 A;  1UOH A;  3V2O A;  2WVI A;  3D9O A;  5G55 A;  4OAV B;  1UW4 B;  3OXG A;  1TN8 A;  2EIK E;  1N94 A;  1IHG A;  3ZEF A;  1U3C A;  3D9I A;  3TJP A;  3AS8 A;  2WB2 A;  2ZIS A;  3OTN A;  3T8M A;  3UKU G;  4L1B A;  2R17 C;  3CK8 A;  4XZ4 A;  3QK0 A;  1Z5S C;  2YQ8 A;  3SF4 A;  5A6C A;  3FDH A;  2ZGD A;  4XI0 A;  3RSE G;  2P9L G;  4MRU A;  3PNT B;  1QBQ A;  3HXE A;  3LPZ A;  1E96 B;  3U4T A;  3FHE A;  2L0T B;  4YVQ C;  4I1M A;  5G05 J;  5BV0 A;  3RAU A;  2VGX A;  2ZIR A;  5EYP F;  3B13 A;  3LS8 A;  3PDN A;  3ENE A;  1SA5 A;  3URZ A;  2IO3 C;  2L0I A;  3SD5 A;  2GRL A;  4FAD A;  4U07 A;  2VTB A;  4DPR A;  4U8H A;  1HU3 A;  1AP7 A;  3LDZ A;  5ITZ F;  5B1A E;  5EX0 A;  4DRX E;  1IKN D;  5KNH D;  4GTO A;  5JA4 D;  3C3O A;  3CQG B;  5EN5 D;  3CK9 A;  1E8Z A;  5AYW D;  2V5Q C;  3NZU A;  2GRR B;  4K03 A;  1VDY A;  3FUK A;  3ZFW A;  5ANR A;  2LSV A;  3MEK A;  4JC8 A;  2P9U G;  3SNX A;  1MYO A;  2R59 A;  5B3S E;  2HE0 A;  4KXK B;  2EQX A;  4MLP A;  2XEE A;  5CEA A;  3APC A;  3QKY A;  4N39 A;  4PH4 B;  2IO2 C;  1HX8 A;  1TN6 A;  4WNE A;  3EIQ C;  3R7R A;  2ZU6 B;  2MHK A;  3PZ2 A;  3S7F A;  1N9A A;  4HBD A;  3HXC A;  3FUJ A;  4AOF A;  4TV3 A;  3TXN A;  1N52 A;  1MX6 A;  2GRN B;  2XEV A;  1H6O A;  4UI9 C;  3P2B A;  1E7V A;  4EZK A;  3OXF A;  3SZ7 A;  2BKK B;  2Q7F A;  4X8Q A;  5FQ4 A;  4DLO A;  4G2V A;  1N0R A;  1S0P A;  2GGF A;  3TWS A;  3CR3 A;  2XGS A;  2WXM A;  3CV0 A;  4KZ0 A;  4DX7 D;  3FFL A;  1JPL A;  4EBA G;  4HQD A;  3BUA A;  3BQO A;  4HLL A;  4JEU A;  3FH7 A;  4U96 D;  1Z3X A;  2VGY A;  4U8V D;  4Y6C A;  2KZT A;  1OWM A;  3UKR G;  3DST A;  2LNI A;  5D0O D;  4U04 A;  5ENR D;  3SGH A;  4NAC A;  3Q73 A;  3OAW A;  2GRQ B;  3S2A A;  4L23 A;  4N2Q A;  3EDT B;  2LXL A;  2WXK A;  2VJ8 A;  2M63 A;  3ESL A;  2NSZ A;  3Q4A B;  2FO1 E;  2EIN E;  4BEP A;  2XPI A;  1MX2 A;  1A17 A;  4APF A;  3L9T A;  5ENN A;  1JCR A;  3L17 A;  3FUD A;  3Q7A A;  4DX2 A;  4CZ2 D;  1ZBP A;  4WWP A;  2VTB B;  4J8Y A;  4D10 C;  2VSY A;  2I6H A;  2P9K G;  4C48 B;  3UXG A;  4UQZ A;  4F1S A;  2GRM A;  2Y4T A;  4GA1 A;  5FQ7 A;  3DSU A;  1BPO A;  5AQB A;  1BD8 A;  2LUH A;  4AY6 A;  2HYZ A;  2Y0B G;  3Q47 B;  3FUN A;  1PY1 A;  5FQ6 A;  1HG2 A;  4B8C B;  1BI7 B;  2AJA A;  4Y6W A;  3MCX A;  3RRN B;  2FF4 A;  5AAR A;  3AS5 A;  4V3I A;  1EF1 C;  3VLF A;  3ZYQ A;  1AWC B;  1V54 E;  2Y1L E;  4L9P A;  1H0A A;  2RFM A;  4C9B B;  4A3T A;  4RQI A;  4XX5 A;  5FTP A;  3IHV A;  4B93 B;  4URK A;  4GTR A;  3AG3 E;  2CHZ A;  4O1P A;  3V31 A;  5CED B;  4ILI A;  3U9W A;  3UM3 A;  5KBA A;  1RZ4 A;  4TUM A;  1KT1 A;  2X3M A;  2BF0 X;  3Q9U C;  4K0R A;  1ZB1 A;  3CHR A;  3L82 A;  4H7Y A;  4N3B A;  2QZA A;  3EU5 A;  5KJN A;  3ZGQ A;  5M72 A;  2WQH A;  3L22 A;  5AAO A;  5BNW A;  3LYA A;  3CVV A;  4JXT A;  3ASO E;  1HO8 A;  5AJD A;  2NYJ A;  1QYM A;  4JA9 A;  3PZ3 A;  3JUE A;  4GYW A;  5FZQ A;  3CEQ A;  2WXP A;  3CVN A;  3BG0 B;  1OXJ A;  2XCB A;  3ULE G;  3I4G A;  1YYH A;  4YDE A;  2KZT B;  3UT4 A;  3GZS A;  4XE0 A;  3ZN3 A;  4KT6 B;  4NQ0 A;  1TN7 A;  4XKB A;  5EID A;  3V79 K;  4UWF A;  3SY2 A;  3F6Q A;  3K9I A;  3G2U A;  3ZXP A;  3UM2 A;  4Q94 A;  3CVL A;  5HS0 A;  1KZP A;  2P2C P;  4RG9 A;  3BEE A;  3PRE A;  4GAA A;  1TYQ G;  2PM6 A;  4J7W A;  3CHO A;  3MKQ B;  1OWO A;  3UM0 A;  5EX3 A;  4HI9 A;  5BUZ A;  2OND A;  1OT8 A;  2X6J A;  4KZC A;  4JPS A;  3QAR A;  1OUV A;  3EIJ A;  3SBS A;  3ZRH A;  4U7E B;  3JXJ A;  3LVQ E;  4HOU A;  2Y3A A;  4HRN A;  5AQ9 A;  3D9J A;  5DIZ A;  1NZN A;  4ANU A;  3FH8 A;  4G8K A;  4YND A;  3T5X A;  3MZL B;  2Y4U A;  4G24 A;  3RRU A;  3QWP A;  1U2V G;  2DWZ A;  2KBX A;  2KM4 A;  3ZPJ A;  3KSQ A;  1K3Z D;  2OCC E;  4L2Y A;  3OXL A;  4GCN A;  4LER A;  1N4S A;  2B0O E;  3Q79 A;  4PUC A;  3SFZ A;  2WXO A;  2J07 A;  4BY6 A;  3J5Q B;  4U0U A;  3ASF A;  2JAB A;  4TXR A;  3KAE A;  1QZ2 A;  4U63 A;  4U0S A;  2UY1 A;  1IQR A;  4HFG A;  3QB2 A;  2XHE A;  5FIO A;  4RLY A;  5ARF A;  1XNF A;  3Q7F A;  1YCS B;  4G23 A;  2QC9 A;  5ARG A;  3PEU B;  4EZL A;  1HZ4 A;  1LF8 A;  4UQX A;  5FQ8 A;  1TNB A;  4TXP A;  1HF8 A;  2LXM A;  3ESK A;  4JHK A;  3ZVV A;  1LD7 A;  3PZ4 A;  1NL4 A;  3TWU A;  3KD7 A;  1PAQ A;  3Q78 A;  2OVB A;  1O1T A;  2NC9 A;  2WXF A;  1DNP A;  4IN3 B;  1V55 E;  5KJK A;  5T4Y A;  4K5B A;  2R2L A;  2P9N G;  4I9C A;  3FTW A;  3N71 A;  3APF A;  4O1O A;  4PS7 A;  2ION A;  4N2S A;  4KMO A;  3ZHE B;  3LXU X;  3FUF A;  2NXP A;  4UWK A;  1LD8 A;  2HM8 A;  3QWV A;  3ZIM A;  3TWW A;  1OCR E;  3B7R L;  1LTX A;  4LG6 A;  4I2Z A;  5C2Y A;  3JYS A;  3LCA A;  3AG4 E;  3X2Q E;  2DVW A;  4FU3 A;  5LCW C;  1O1S A;  1OWL A;  5JJ7 A;  2MYO A;  4GTV A;  3L13 A;  2AXU A;  2QY7 A;  4HXI A;  4E6H A;  3RRM B;  4HI8 A;  3S7B A;  4U8Y D;  2GRO B;  1N4Q A;  3G2V A;  1HS6 A;  3FUI A;  2V5F A;  3DEO A;  1DCQ A;  3T8K A;  3PE4 A;  5CEC B;  1S64 A;  3GZ2 A;  3B7U X;  1E90 A;  4CDR A;  1WDY A;  3IKO B;  1FCH A;  1TNZ A;  1H2U A;  2WPV A;  3EHR A;  2KCK A;  5FIN A;  4I43 A;  2WQ7 A;  3LY7 A;  3NOG D;  2UY1 B;  1IHB A;  4A55 A;  3KEA A;  3FUE A;  5LFA A;  3ZNG A;  4BFR A;  5EKQ D;  3L08 A;  3AS4 A;  3SQV A;  1JWG A;  1SVX A;  3DEP A;  1OCO E;  4GU5 A;  4C0M A;  2R03 A;  2VYI A;  3PUJ A;  1NA3 A;  3B7B A;  3QDN A;  3ABK E;  2X6H A;  3JQ1 A;  1N95 A;  4TXQ A;  4UWL A;  2RG8 A;  3FTX A;  3VLD A;  4F6R D;  3UPV A;  3PS6 A;  4AIF A;  4HNA D;  3U64 A;  1UG3 A;  3HDX A;  2XZD G;  5CRU A;  4ATG A;  3L16 A;  3HXD A;  1UN8 A;  2CFZ A;  4IRU A;  2WXQ A;  3HIZ A;  3IXE A;  3HHM A;  3L6A A;  1A5E A;  1MJ0 A;  3E30 A;  1H6K A;  2AXZ A;  5J08 A;  3UIP C;  4P29 A;  3PE3 A;  1N54 A;  2J49 A;  4YDW A;  4UQY A;  5CER B;  3E33 A;  4YDY A;  4AP2 A;  4WAF A;  4Q96 A;  3D3M A;  3C98 A;  5KJL A;  3PRZ A;  3ZYL A;  2ZXW E;  3ABL E;  2V4H C;  2WM9 A;  3QOU A;  1BI8 B;  4YVO A;  3TWV A;  3AG1 E;  1YMP A;  4ABN A;  4RG6 A;  1S63 A;  4FHJ A;  4LNG A;  4EQF A;  3E34 A;  2LAI A;  3LEW A;  2WXN A;  2BTD A;  4BES A;  1ZU2 A;  4I17 A;  3B7T A;  1H2V C;  3S7J A;  3DRA A;  1NP7 A;  2VGX B;  1TNU A;  1P5Q A;  5ENT D;  2PM7 A;  3O48 A;  1TJF A;  1O5M A;  3ZYM A;  2F8X K;  2DZO A;  4I2W A;  3FWV A;  1OY3 D;  2YHC A;  3BG1 B;  4GTS A;  5C1D A;  4JL0 A;  2FO7 A;  5JJ6 A;  2R5S A;  3Q75 A;  2IF4 A;  4WUY A;  3MJW A;  5AQA A;  4KVO A;  3DWL G;  4N5C A;  3APD A;  2DBA A;  5AJL A;  5AQ7 A;  4WND A;  2RFA A;  5KWD A;  2QYU A;  5FJY A;  2IOL A;  3LY8 A;  1QQE A;  5BXU A;  3U66 A;  2RKK A;  3FUL A;  5DBK A;  3CST A;  5BXO A;  4DUI A;  3EHN A;  3U3W A;  1WM5 A;  5JMN D;  3GYZ A;  3FTZ A;  4TRQ A;  2VQ2 A;  3JCK C;  4B8A A;  3ZKJ A;  4AVX A;  1EYH A;  1UJK A;  3SFY A;  1Y6I A;  4WWN A;  3BU8 A;  2XS1 A;  3VLE A;  3S7D A;  5EIB E;  4AXH A;  1FVF A;  2CG2 A;  2J08 A;  4U0Z A;  2XPY A;  4A1S A;  2KCL A;  1E8Y A;  3NQP A;  3CVW A;  5D66 A;  2E2E A;  2I1J A;  4FJY A;  2F37 A;  4ANV A;  4FHK A;  2QYJ A;  2EIL E;  1KLX A;  1SZ9 A;  4HOT A;  3D9P A;  4J8E A;  4CYM D;  4XEI G;  2FUL A;  4GMR A;  4FC8 A;  4J0U A;  2EIJ E;  1OWP A;  1Y8M A;  2LSU A;  3Q9N C;  3NB2 A;  3KS2 A;  4CCA A;  4GTQ A;  5LX8 A;  5FT9 A;  4Z68 A;  5LCW J;  1FPP A;  3DPY A;  5HKP A;  3ZU7 B;  1ELW A;  2FEZ A;  3UI2 A;  1XGW A;  4PS8 A;  1K8K G;  3C3R A;  2UWJ G;  2BUG A;  2X6F A;  3HVE A;  3NOC D;  3CVP A;  5BV1 A;  5KCM A;  3JUI A;  3UUX A;  4OAU C;  2IJG X;  2V0P A;  1D9S A;  5ANL A;  2WMO A;  1X81 A;  3CSF A;  3IHY A;  2XZT G;  4J6I A;  4EZJ A;  2EIM E;  2C0L A;  2YNQ A;  4EHM A;  4J8S A;  4J8F A;  3JQ0 A;  4DLQ A;  1TEZ A;  3CVY A;  4JHJ A;  4G8L A;  2ZGG A;  3ASN E;  3C72 A;  3CQC B;  4GZ3 A;  2H6G A;  3VTX A;  4B0Z A;  2CHW A;  3C3Q A;  5JJT A;  2J4B A;  3PVL A;  3KEZ A;  2ETA A;  4HS2 A;  5HI7 A;  3ASG A;  3PH0 C;  3PZ1 A;  4XKC A;  2IY0 C;  2CFU A;  5JHA A;  2DYS E;  2P9S G;  5D0Q D;  2A5U A;  5J90 A;  4OYS A;  2L6J A;  4FUL A;  1JWF A;  2GRP B;  4WNF A;  5HRY A;  4GPK A;  3EHQ A;  2V8S E;  5EDS A;  4M3O A;  4B89 A;  4CEM A;  1TNY A;  3HRA A;  4DI3 A;  1SW6 A;  4DI4 A;  3I5P A;  4GZ5 A;  4ANW A;  3KSL A;  5BT1 A;  3E37 A;  2MRI A;  4UI9 J;  3FY4 A;  2QFC A;  4HRM B;  4KBQ A;  1PC2 A;  2XEH A;  2PZI A;  4I6J A;  2P9I G;  4EBA A;  4GML A;  3CHM A;  3MGB A;  1KZO A;  3L54 A;  4ATZ D;  4GYO A;  3IBE A;  4JD2 G;  3CVU A;  4JB8 P;  2F0Y A;  4NIK A;  5CMW A;  5CRV A;  4BT8 A;  3ISM C;  1EPU A;  2PQN A;  4F7A A;  3D9H A;  2H6H A;  1WG0 A;  2ETB A;  4AV7 A;  3G2W A;  3QC1 A;  3UIN C;  3CHP A;  4AEZ C;  2WXJ A;  3HVE B;  2XGO A;  1H19 A;  3MYV A;  4FLB A;  1N0Q A;  5FZS A;  3R9A B;  2HR2 A;  4J8D A;  4MBG A;  3DSS A;  2VGE A;  1TR4 A;  3EJN A;  1HXI A;  2VSX E;  2B6C A;  1NFI E;  2X38 A;  4BTA A;  4JHR A;  1W3B A;  5G2N A;  3QNK A;  4E85 A;  4I6E A;  4O6F A;  4K5C A;  4GZD A;  1YA0 A;  3B7S A;  3IV0 A;  3ZXS A;  4Q69 A;  4CGW A;  4XI9 A;  4APO A;  3ML8 A;  1DCE A;  4G1T A;  3IEG A;  4BWR A;  3Q5M A;  5AN8 A;  5G04 C;  4W9R A;  3TG5 A;  2XCC A;  4H7X A;  1N4R A;  2AVP A;  5A23 A;  3T5V A;  4N3C A;  1Q2Z A;  3RU0 A;  2AXV A;  3D9L A;  4GYY A;  4I1O B;  3DSW A;  3PNL B;  1Z6T A;  5FZR A;  3VTY A;  1ELR A;  5CBO A;  4UWG A;  1DC2 A;  2KC7 A;  2CG3 A;  4GPM A;  2X6I A;  3MA5 A;  3UQ3 A;  4KYO B;  4N3A A;  5D2M C;  5A7D B;  2MOW A;  3GZ1 A;  1JUQ A;  3G2T A;  2JEK A;  3RKV A;  4DX1 A;  2J4D A;  1UJJ A;  1L5J A;  5JHB A;  1MHQ A;  5E75 A;  1E7U A;  2P58 C;  5BPP A;  3ZYK A;  3QAQ A;  2BED A;  3EU9 A;  3HXB A;  3D9N A;  4GTP A;  2Y69 E;  4R7L A;  3ONL A;  1NA0 A;  2R05 A;  2KCV A;  3ONK A;  3CIA A;  4GTT A;  4YDO A;  3UX4 A;  1O1R A;  2HO1 A;  1MX4 A;  3FU5 A;  2PNN A;  2J09 A;  3UM1 A;  4HOR A;  2ILR A;  2X6K A;  2XS8 A;  4NRH B;  4GZ6 A;  4CDN A;  5H7P A;  2LO6 A;  3HG0 D;  4BX9 A;  4CGV A;  2I1K A;  5AEN A;  3CLJ A;  3UIO C;  4CT4 A;  3RO3 A;  2ETC A;  4UWH A;  2WXR A;  5CBN A;  3NF1 A;  2VSO E;  3DXM G;  4ACK A;  1ELK A;  5EYL A;  2DZN A;  3AG2 E;  5KNG A;  4ME2 A;  2XRZ A;  4F3V A;  3G2S A;  4RSY A;  2H6I A;  1IYG A;  1BLX B;  2YHE A;  5ENQ D;  3TWR A;  3W9G A;  2IU1 A;  3DSX A;  2E0I A;  1E8W A;  3ULY A;  3UT7 A;  2A5E A;  4LRZ A;  4BX8 A;  3AJI A;  1B89 A;  4IYP A;  4K5A B;  3HXF A;  3I3N A;  3E4B A;  3TG4 A;  5ENS D;  4LEU A;  4F53 A;  1WAO 1;  1FT1 A;  1HG5 A;  2PL2 A;  3FTU A;  1NI1 A;  4C0E A;  4JZY A;  3DBS A;  4HOS A;  2YIN A;  2KAT A;  3UT8 A;  3WXX A;  2RD0 A;  3CK7 A;  3MV3 B;  2XPZ A;  1DVP A;  3V30 A;  2IFU A;  3MKQ A;  1SQM A;  3FUM A;  4CDM A;  2AW6 A;  1TNO A;  1OCC E;  2XQ0 A;  2PQR A;  3D9M A;  3E32 A;  4BSZ B;  2GW1 A;  4XIF A;  2KXP C;  4AM9 A;  4QFV A;  4MKT A;  2IQC A;  4GZC A;  4ACL A;  5G05 C;  4MS6 A;  5KJM A;  4IUL A;  3J5P A;  1K1B A;  4AY5 A;  1KT0 A;  2WQ6 A;  3TWT A;  4FP7 A;  3ASD A;  1U3D A;  2BKG A;  3CKC A;  1K1A A;  4LSZ E;  2WXG A;  4BET A;  1X5B A;  2J8S D;  4U95 D;  3WG7 E;  2OVF A;  1SA4 A;  5ENO D;  3FH5 A;  2H6F A;  3CVX A;  3CGH A;  4PDX A;  3I4R B;  3TL5 A;  1G3N B;  4DX5 D;  4GB9 A;  3NZS A;  1GW6 A;  3MV2 B;  5T8I A;  3EHM A;  3FU6 A;  2F8Y A;  2XRY A;  3SO8 A;  4JVS A;  3ZW3 A;  4TUU A;  4ANX A;  3CHQ A;  2XEN A;  2P9P G;  2I9C A;  1WY6 A;  2L9B A;  2OEW A;  4QQI A;  5EIL A;  1FVH A;  3Q15 A;  3QWW A;  2OEV A;  3Q49 B;  4UUC A;  4I6G A;  3AU5 A;  3HYM B;  1HE8 A;  3FU0 A;  4HVB A;  4I9E A;  3ASH A;  5AIJ A;  2L6B A;  4OVU A;  3NAW A;  2FBN A;  4LNB A;  3P1U A;  3D9K A;  1HFA A;  4LNU D;  4BSX A;  3C5R A;  2CHX A;  3V2X A;  1D8D A;  4NUR A;  5CHE E;  5LP0 A;  3TXM A;  3LJN A;  4JA7 A;  5LOZ A;  1MQS A;  4B94 A;  4DX6 D;  1HH8 A;  4DK5 A;  4BT9 A;  4HOQ A;  3SBT B;  5G04 J;  2A4Z A;  2I2O A;  4ZFH A;  3RIB A;  3FEY A;  4G26 A;  2XGM A;  3AU4 A;  3TGO A;  5HQ8 A;  4OVV A;  4GA2 A;  1OWN A;  4GTM A;  3LKU A;  5CCL A;  4F1P A;  3ZHE A;  4ZHB A;  1INZ A;  2VSN A;  3FU3 A;  3LJ3 A;  4HLE A;  4BER A;  3R7Q A;  3AAA C;  3W9F A;  2R02 A;  3UMV A;  4WNG A;  1EDU A;  1Z3Y A;  3ZUV B;  4BTB A;  3RJV A;  1KPS B;  4A3V A;  4KVM A;  2WXL A;  3ML9 A;  3GW4 A;  3FEX A;  4WWO A;  2V4L A;  4RVB A;  2WMN A;  4I1A A;  5B1B E;  1TJC A;  3NBN B;  3PZD A;  5ENP D;  3JXI A;  1JCQ A;  5IY5 E;  1SZA A;  4JW1 A;  4G11 A;  3RK6 A;  3B95 A;  3SHF A;  3TWQ A;  1RW2 A;  2DYR E;  4LCT A;  2LAH A;  3QJZ A;  4PS3 A;  1JCS A;  4O60 A;  4FJZ A;  3DPD A;  3TWX A;  3MKR A;  3TAX A;  1N4P A;  4EEC A;  4HB5 A;  3FTS A;  4FA6 A;  1H6P A;  3PEV B;  3O4Z A;  3RO2 A;  1S70 B;  5T3R A;  1UN9 A;  3SI5 A; 
#chains in the Genus database with same CATH homology
 1FT2 A;  3EUV A;  2F0Y A;  3DRA A;  3KSQ A;  3PZ3 A;  3Q7A A;  2IEJ A;  1TN6 A;  3SFY A;  3C72 A;  1QBQ A;  3PZ2 A;  1TNU A;  3HXE A;  1N4S A;  2H6G A;  3Q79 A;  1N9A A;  1LD8 A;  2H6I A;  3DSU A;  3HXC A;  2H6H A;  4YDE A;  4GTM A;  3SFX A;  1LTX A;  1N95 A;  1SA4 A;  3DSX A;  3PZ1 A;  2H6F A;  1O5M A;  1TN7 A;  2ZIR A;  2BED A;  3HXB A;  4GTS A;  1O1S A;  3HXF A;  1SA5 A;  4GTP A;  4GTV A;  4MBG A;  3HXD A;  3DSS A;  3Q7F A;  1KZP A;  1FT1 A;  4L9P A;  3DSV A;  3Q75 A;  1D8E A;  1N4Q A;  1MZC A;  4GTT A;  4YDO A;  1NI1 A;  1TNY A;  4GTQ A;  1O1R A;  3E30 A;  4GTO A;  4GTR A;  1FPP A;  3DPY A;  1JCQ A;  1S64 A;  3DST A;  3E33 A;  1TNZ A;  1TNB A;  3KSL A;  1JCS A;  1TN8 A;  3Q73 A;  1N94 A;  3E37 A;  1DCE A;  3EU5 A;  1LD7 A;  3PZ4 A;  4LNB A;  1NL4 A;  2ZIS A;  3Q78 A;  1TNO A;  1O1T A;  1N4R A;  3E32 A;  1X81 A;  1N4P A;  1D8D A;  1KZO A;  1S63 A;  4LNG A;  2R2L A;  1JCR A;  3E34 A;  4EHM A;  3DSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...