1QBQA

Structure of rat farnesyl protein transferase complexed with a cvim peptide and alpha-hydroxyfarnesylphosphonic acid.
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
312
structure length
312
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of farnesyl protein transferase complexed with a CaaX peptide and farnesyl diphosphate analogue
pubmed doi rcsb
molecule keywords FPT ALPHA-SUBUNIT
source organism Rattus norvegicus
molecule tags Transferase
total genus 118
structure length 312
sequence length 312
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 1999-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1qbqA00
4GTQA 1LD8A 1DCEA 1N94A 1QBQA 3SFXA 3E30A 2R2LA 3Q75A 1JCRA 3KSLA 3HXCA 2BEDA 3E34A 3DRAA 3DPYA 4EHMA 3Q7AA 1O1RA 3E37A 1O5MA 3PZ3A 1S64A 2ZISA 1TN8A 3DSUA 2ZIRA 3DSWA 2H6IA 1LTXA 4LNGA 2F0YA 3DSSA 2H6GA 3Q79A 2H6HA 3PZ1A 1S63A 1FT2A 4GTMA 1TNZA 3HXFA 3SFYA 1N4QA 4GTOA 2H6FA 3PZ2A 4MBGA 4GTPA 1TNUA 3HXEA 3C72A 1N4RA 3EU5A 1X81A 3PZ4A 1LD7A 3HXDA 2IEJA 1N9AA 1TNYA 1FPPA 4L9PA 1D8DA 1TNBA 4GTVA 1SA5A 1O1TA 1N4SA 1N95A 1SA4A 3Q78A 3EUVA 4LNBA 1TN7A 4YDOA 3HXBA 3DSVA 1NL4A 1N4PA 3DSXA 3E33A 1KZOA 3Q7FA 3DSTA 1NI1A 3KSQA 1FT1A 1MZCA 1D8EA 3E32A 3Q73A 1O1SA 1JCSA 4GTRA 1TNOA 1TN6A 4YDEA 1KZPA 4GTSA 4GTTA 1JCQA
chains in the Genus database with same CATH superfamily
4F53A 4A63B 4DRXE 1WG0A 2VSNA 3T5VA 2XRYA 3FTVA 4DX5D 1U2VG 4MKTA 4H7YA 4TUUA 3D3MA 3FUIA 4Q96A 4TXQA 5D0QD 4OVVA 2ZISA 1HG5A 5LX8A 4GYOA 3DEPA 4F7AA 2P9NG 2NXPA 2PZIA 1E8WA 5FTPA 2LXLA 1RW2A 2AXVA 1OWLA 3PZ2A 3CGHA 2ZU6B 3NZSA 3ENEA 1N4RA 5EYLA 2LXMA 3MYVA 3IEGA 3RSEG 2P9SG 4K5CA 2MOWA 4R7LA 2AWIA 2Y69E 3AS5A 4HOUA 5EYPF 4HB5A 1KPSB 2LNIA 4KVOA 2DYRE 3L82A 5CCMA 3L6AA 4FP7A 4RVBA 1UJKA 3TWWA 4UWGA 4WNDA 2KXPC 3MGBA 4MRUA 2CG3A 3GZSA 4YDYA 2RFMA 2FF4A 1TNOA 1E8ZA 1OWPA 3FUDA 4C48B 4OYSA 4F1SA 3AG2E 4GYWA 3JXIA 3ONKA 2AW6A 2P2CP 3UKUG 4UQYA 3E30A 4CEMA 2OV8A 2X6HA 1H6KA 4Q94A 3D9PA 3APDA 3DBSA 3ML8A 3LJNA 3Q47B 1DC2A 3DEOA 3TWTA 4BTAA 2L0IA 1EF1C 4PS7A 1JWFA 2HR2A 3FUEA 3JQ1A 2GW1A 4MBGA 4AEZC 3G2WA 3UM2A 4TXRA 4A3VA 4CDMA 4PUCA 4U7EB 3S7JA 1IQRA 4KVMA 4EZKA 3G2VA 4BEPA 2ETCA 3UPVA 2IU1A 2DYSE 3APFA 4GTVA 2WPVA 1HX8A 4ME2A 4RG9A 4WNFA 1E7UA 4APFA 2VSXE 2DCPA 4UQZA 3J5PA 2WMOA 4N2QA 3MV3B 3ASNE 4A55A 3TWVA 4LNUD 5KCMA 5ENTD 4O1PA 5J90A 4RSYA 4G25A 4GZ6A 1MYOA 1QNFA 3IHYA 5EX3A 3I4GA 2VTBA 3MZLB 3PE4A 1IHGA 3LPZA 3NBNB 2OEVA 2XGSA 4KMOA 3TGOA 1DNPA 2BUGA 4BT8A 2FEZA 1HZ4A 4FC8A 5ENRD 4C9BB 3G2TA 2KZTB 4LSZE 3DRAA 2IF4A 3N71A 2UWJG 4CYMD 2MYOA 4Y6WA 4LEUA 2LSVA 3ML9A 2CFUA 3DSSA 2WXRA 4CCAA 3SQVA 1Y6IA 2X6JA 3CV0A 3NB2A 5FINA 2I6HA 5FQ7A 4BTBA 1OWOA 3U9WA 5FQ4A 2RFAA 2WXOA 4XI0A 3MX3A 4CDRA 4DLOA 2PQNA 1ZU2A 2P9LG 2R17C 1FPPA 4AOFA 1D8DA 5FQ6A 4HI8A 1QZ2A 2EIME 2WXMA 2I9CA 1MJ0A 4JW1A 3FDHA 5JJTA 4XIFA 2Y4TA 3WG7E 3L9TA 3ZFWA 2EIKE 4NACA 2IO3C 1KLXA 3NOGD 3TWXA 4XKBA 3CKCA 2X6KA 5D66A 1HO8A 3HVEA 3ZRHA 4AJWA 4ATGA 4LCTA 4V3IA 4Q69A 1JUQA 5D0OD 3CHOA 3P2BA 4L1BA 4A3TA 3ZYLA 5ENNA 5HRYA 3DWLG 4DUIA 1S0PA 2WQ6A 3TXNA 2WMNA 3HYMB 1S70B 4BY6A 3VTYA 4J0UA 1S64A 3RIBA 5LCWC 4WUYA 3LVRE 1JWGA 3G2UA 4TUMA 4YDWA 3R7RA 3SFZA 3SNXA 4J6IA 3CSTA 3BG0B 3FTUA 1HS6A 4NIKA 1H2UA 3CHQA 2WXJA 2XEVA 3X2QE 1H6PA 3ZYMA 3LEWA 1Q2ZA 2OCCE 4ANWA 3HIZA 3EHNA 1E8XA 1N95A 2WXLA 4BSXA 4G2VA 2KC7A 2FI7A 1MQSA 5T4YA 1NL4A 1U3CA 3HRAA 3E33A 2J09A 4JZYA 1DVPA 4C0MA 1N0RA 3TJPA 2DZNA 4U0ZA 1NA0A 1SVXA 2E2EA 5CBNA 3JXJA 3P1UA 3V2OA 1DCEA 4F3VA 3SGHA 4KT6B 4EPZA 5AAOA 2VYIA 3CHRA 5AQ7A 2YQ8A 3B7SA 2R2LA 2C0LA 2ILRA 4GYYA 4BX8A 3QAQA 2P58C 1OT8A 4O1OA 3FU6A 3IBEA 3U3WA 1P5QA 5D2MC 1YMPA 2WXHA 3Q49B 1PC2A 5G55A 2GRPB 2QZAA 1YYHA 2VSYA 4EQFA 2QFCA 3CLJA 4GCNA 2BTDA 4JA9A 3MKRA 4DX7D 3FEXA 2J49A 5BXUA 1Y8MA 4GTPA 5C1DA 4I1MA 5G05C 3C3RA 4DLQA 2WXKA 3TG5A 4PDXA 4F6RD 5E75A 1NZNA 4EECA 3ABKE 4JC8A 3FTSA 2IFUA 1TNBA 3S7BA 2LO6A 3CKBA 4GPMA 1OWNA 3EHMA 3TWSA 2UY1B 3QWPA 3W9FA 4N5QA 2FBNA 3KAEA 3Q15A 3FUJA 2PQRA 1WAO1 4G8KA 3RKVA 3HDXA 3NAWA 1KZPA 3O4ZA 4J7WA 4GTQA 3FTXA 3ZU7B 3FY4A 4UWLA 3OXGA 4U95D 2X3MA 4J8SA 4C0EA 4HOQA 3EDTB 1TYQG 5LCWJ 2BEDA 3DPDA 3RRMB 3ESKA 4JA7A 2BKGA 3ZIMA 2H6HA 2WVIA 4G11A 4IYPA 4B89A 1OY3D 3B13A 4GTMA 4JHJA 4YNDA 2R03A 3V31A 5JJ7A 3FH5A 5CEDB 2GRRB 3C5RA 2V8SE 3FUHA 5ENPD 1MHQA 3LJ3A 4NQ0A 5CECB 3CVLA 3ASGA 5T8IA 2X6FA 2WQ7A 3LXUX 3E4BA 1O1TA 4YDOA 3FULA 1PAQA 4N3BA 5FT9A 3Q7FA 5ENSD 5EIBE 4I9EA 1D9SA 5AJDA 3JQ0A 4CRWA 4U8VD 4AV7A 2QYJA 4I2WA 3VTXA 5JMND 4XZ4A 3FH7A 2XHEA 5G04J 2Y1LE 4MS6A 4GTSA 4JEUA 1IHBA 4ABNA 3FUFA 2F8YA 3OXFA 3V30A 1UJJA 3ABME 3C3QA 5B1BE 4JEHA 1OCCE 3Q75A 2XGOA 2V0PA 4UUCA 2XS1A 3CVXA 3AG4E 1K1AA 3C3OA 4U63A 5AARA 4ATZD 1E7VA 2XRZA 4M7CA 2J08A 2AXZA 3ZNGA 4A1GA 4EBAA 3TWQA 5ITZF 2BF0X 2ZIRA 4U0UA 2KCVA 3RRUA 1KT1A 1Z3YA 4WWNA 5E76A 4H7XA 3CQCB 2DWZA 2AVPA 5EKQD 3T8KA 5ENOD 5G05J 3PRZA 2YHEA 4U04A 3PS6A 3D9KA 1A17A 1E96B 3EU5A 5AJLA 4ILHB 4N3CA 4N5CA 2VQ2A 1SZ9A 3AU5A 4PS3A 3B95A 1UW4B 3VLEA 3PEVB 1SA5A 3D9HA 4DX6D 4HNAD 2A5EA 4DX1A 4FA6A 2P9PG 4GZ5A 3EU9A 3Q5MA 1FT1A 2CFZA 1MZCA 4MLPA 2EIJE 3ZGQA 4HVBA 3ZYQA 4HI9A 1EDUA 5B3SE 5CBOA 2R05A 2MHKA 3MEKA 2XPYA 2ONDA 4GPKA 3SO8A 2C0MA 2JLBA 1ZB1A 2GRNB 3I4RB 1TR4A 2XZDG 3LY9A 4FLHA 5FQ8A 3UIOC 3BU8A 1WDYA 3DPYA 4HQDA 3SF4A 4O6FA 3PZ3A 4Y6CA 5KJKA 3CIAA 3R9MA 3T8MA 4O60A 1MX2A 4FADA 4B0ZA 4CT4A 4L2YA 3S7FA 1BU9A 3Q4AB 3MJWA 2J9QA 2AXUA 3D9NA 3FH8A 1TNUA 4WWOA 5ANLA 5KNGA 3UT8A 3T9KA 5HKPA 1N0QA 2P9KG 1LD7A 4RLYA 4G8LA 2M63A 2HO1A 3SY2A 1ZBPA 5LP0A 1SA4A 2R02A 4E6HA 3PNLB 5CERB 1NA3A 2WQHA 3DSVA 1HU3A 4ANVA 2A4ZA 2XCBA 3S2AA 2I1JA 4N39A 3E32A 2DVWA 3PVLA 1K8KG 5J08A 5BNWA 3CVUA 3DXMG 3TXMA 2WXPA 5FZQA 4X8QA 3QWVA 1RZ4A 3QDNA 3QARA 2DIWA 1UN9A 1K1BA 2CHZA 3TWRA 4UWFA 4E85A 3RO3A 3ULYA 5KWDA 4EHMA 3J5QB 3GZ1A 1HG2A 3CVNA 4DJAA 3DSWA 3ZHEB 3T5XA 4OVUA 2F37A 5HS0A 4I2ZA 3PE3A 3L16A 4ILIA 1FT2A 2PNNA 3CVWA 2C2LA 3PNTB 4LERA 2KCLA 3HXFA 3LDZA 1HF8A 2IJGX 4CGWA 3PH0C 3ASFA 5DIZA 1WY6A 3FEYA 5BUZA 4URKA 2WXQA 3RJVA 3NF1A 5JJ6A 3CEQA 4U07A 3ASHA 3ZKJA 3SD5A 2IEJA 3Q9UC 3WXXA 1N54A 4U96D 1ELKA 4GMLA 4FULA 4BSZB 2VGEA 5HI7A 3QK0A 2ETAA 3LY8A 4FJZA 5A6CA 3FFLA 1H2TC 2IQCA 2LAHA 3MKQB 1NI1A 2JEKA 1X5BA 2F8XK 1N11A 4XI9A 4B93B 2CG2A 5G2NA 3FUMA 2L6JA 3UXGA 1K3ZD 3CVYA 4JD2G 3BEEA 4GZ3A 4AXHA 2LSUA 3PDNA 2EINE 3SFXA 3AU4A 5AIJA 4J8EA 4IRUA 1JCRA 3GZ2A 3IV0A 5DBKA 3E34A 3VLDA 1AWCB 1O5MA 2X6IA 3ZPJA 3B7TA 5G04C 2H6IA 2F0YA 4UI9K 3IHVA 4I9CA 1DCQA 4HRLA 4AIFA 3ESLA 3U4TA 3CHPA 1UOHA 4JVSA 2RD0A 3U64A 5JA4D 3ABLE 4PH4B 3ZYKA 4L2LA 3UM0A 5KJNA 5AN8A 3ZXSA 4K5AB 1IKND 5T3RA 4FHKA 1H0AA 3UM1A 1MX4A 3EIJA 1TEZA 4UI9C 1KT0A 2L9BA 3QC1A 2WXGA 5FJYA 4JL0A 1E90A 5EX0A 3Q78A 2IOSA 4KBQA 3TAXA 3JYSA 4DI3A 1Z6TA 4ILGA 2VJ8A 4UWHA 5JHBA 2WB2A 4ANUA 2QYUA 2GRQB 4ACKA 3D9JA 3UMVA 2A5UA 3BQOA 1Z5SC 2B0OE 2V4HC 4K5BA 4APOA 4CZ2D 1TJCA 1A5EA 3FUKA 3UINC 2EILE 1QBQA 2J4DA 4I1AA 4WAFA 3OXLA 4J8YA 3SBTB 4TXPA 5CRVA 5CCLA 5A7DB 3R7QA 3E37A 1GW6A 3W9GA 4AY5A 4JHKA 2HM8A 3AG3E 3MCXA 3UIPC 2H6GA 4L23A 4NRHB 1H6OA 3F6QA 4AY6A 3ZVVA 2E0IA 3PZ1A 3HVEB 4UQXA 1E8YA 3FUNA 4FJYA 2XPZA 5BPPA 2QY7A 4HRNA 3RO2A 2I2OA 1BI7B 3AS4A 2Y0BG 3EUVA 2KZTA 1U3DA 3UTMA 3TWUA 3V2XA 5BV0A 3EHRA 2YINA 1KZOA 3DSTA 2R59A 4BFRA 3PEUB 3L22A 2I1KA 4BERA 3ULQA 3JUIA 3FU0A 2KCKA 2QC9A 1O1SA 5M72A 4YDEA 1TN6A 3CHSA 2B6CA 2WM9A 2J8SD 4GZDA 4DX2A 3FTYA 3AG1E 1JCQA 3CHMA 4J8DA 3RRNB 3UI2A 3EJNA 3VLFA 1B89A 4KYOB 4B8CB 5BT1A 1HE8A 3AS8A 4GA2A 2XZTG 1XNFA 2GRMA 3Q7AA 1OCRE 1TN8A 4IULA 3BUAA 3IKOB 4ZFHA 3K9IA 1UG3A 5AQAA 2KBXA 4PS8A 3CK8A 5KJMA 4I6EA 5FZRA 2JABA 3SFYA 4I6GA 4TV3A 3ZN3A 1EPUA 3RU0A 2J07A 3UX4A 2V5QC 4WWPA 3CK7A 3C72A 5BV1A 3ZHEA 4UI9J 3SZ7A 4WNEA 1QQEA 3D9LA 1NP7A 2CHWA 3U66A 2XEEA 5LFAA 4HS2A 1TN7A 3CR3A 3HXBA 3LVQE 1OCZE 2KATA 3QB2A 1D8EA 1HXIA 3KD7A 2RKKA 4KZCA 4U0SA 5ENQD 4GA0A 1NFIE 5FIOA 3EIQC 3KEZA 4GTRA 4K0RA 4GTTA 2RG8A 2LAIA 5FZSA 3MKQA 3ZUVB 3UT4A 1AP7A 3UQ3A 4XEIG 5ARGA 4JXTA 2VSOE 4HOSA 3B7BA 5BXOA 3LYAA 4U8YD 4GCOA 3QOUA 3SBSA 3HXCA 3HG0D 4HORA 4GAAA 5CHEE 3FWVA 4D10C 3PZDA 4UWKA 3FHEA 2GROB 4JPSA 5IY5E 3B7UX 2FO7A 4G23A 1YCSB 3D9IA 2AJAA 3CVPA 1L5JA 1HFAA 4GTOA 4YVQC 4F1PA 3LY7A 4KXKB 1TJFA 1X81A 2LUHA 4HOTA 5LOZA 3KS2A 5AQ9A 4EBAG 5EN5D 4OAUC 2J4BA 3NZUA 4RQIA 3O48A 4W9RA 3JUEA 4G24A 2VGYA 4L9PA 2BKKB 2OVFA 2VGXB 1EYHA 4LNBA 2ZGDA 3CSFA 2ETBA 1LF8A 3I3NA 3L17A 3CVQA 4GMRA 1N4PA 1MX6A 3UKRG 2Y4UA 4GMJA 3KEAA 1BLXB 3QKYA 1N52A 3Q73A 4BT9A 3RK6A 2XQ0A 1OCOE 4WNGA 3D9MA 5EIDA 4RG6A 4B94A 3ASDA 5ARFA 1FCHA 1V55E 3PREA 4FLBA 2XEHA 4M3OA 1LD8A 4BESA 3ASOE 4N2SA 3AAAC 4TRQA 4ZHBA 1ELRA 1XGWA 2FULA 2L0TB 3FP3A 1BI8B 4CT0A 2UY1A 3EHQA 1Z3XA 3R9AB 3FTWA 4KZ0A 3CK9A 3S7DA 1LTXA 4LNGA 5CMWA 3Q79A 3QNKA 2PL2A 2V4LA 1S63A 4XX5A 4DK5A 1N4QA 2YHCA 2WXIA 4I1OB 1IXVA 5AYWD 5C2YA 3HXEA 5CEAA 1IQUA 1BD8A 4JHRA 2XPIA 5EILA 1H19A 3TG4A 4EZLA 5KJLA 3PZ4A 5EDSA 1N9AA 1SZAA 4HRMB 1TNYA 2PM6A 5FWQA 4LRZA 2X38A 1SQMA 1N4SA 3BG1B 4JB8P 3LKUA 3DSXA 5H7PA 3KSQA 2XGMA 3GYZA 2IOLA 4AM9A 2GRLA 4J8FA 1WM5A 1W3BA 1FVHA 4XE0A 3ZEFA 4YVOA 3L54A 3OAWA 2KM4A 1N94A 5CMYA 3URZA 2IY0C 3MV2B 4NURA 3UM3A 3L08A 2HYZA 3C98A 4HBDA 4FU3A 2ZGGA 3LS8A 1O1RA 2OVBA 4U8HA 2IO2C 2NSZA 4GA1A 5HQ8A 3DSUA 3LCAA 4AVXA 5KBAA 4GZCA 3TL5A 1H2VC 5BW8C 2XS8A 1OXJA 4BX9A 5B1AE 5KNHD 3SI5A 4IN3B 1SW6A 3MA5A 3DXKG 2DZOA 3B7RL 2CHXA 5ANRA 4BETA 3FTZA 4Z68A 1VDYA 1G3NB 4G26A 3OTNA 1JPLA 2VTBB 4I43A 3RAUA 3G2SA 2HE0A 2FO1E 4K03A 2XENA 4HLEA 4XKCA 4P29A 4I17A 3UUXA 4N3AA 3PUKA 1IYGA 4EZJA 3I5PA 4A1SA 2V5FA 2Q7FA 1V54E 5AENA 3JCKC 4GB9A 4HXIA 2P9UG 1BPOA 4G1TA 2IONA 4AP2A 4I6JA 4B8AA 3FU3A 2YNQA 3KSLA 3Q9NC 2ZXWE 2L6BA 3CQGB 4QFVA 2NC9A 2EQXA 3PUJA 2OEWA 2P9IG 1OUVA 3NQPA 5CRUA 3HHMA 3CVVA 2PM7A 3IXEA 1UN8A 2DBAA 2WXNA 2XCCA 3AJIA 1TNZA 3UT7A 1FVFA 3D9OA 4OAVB 5A23A 3V79K 4ANXA 2H6FA 4ACLA 2Y3AA 3ZXPA 3ONLA 3SHFA 4CDNA 4GU5A 3L13A 1YA0A 4FHJA 3ISMC 3HXDA 1INZA 2WXFA 4QQIA 3ULEG 2R5SA 4LUNU 1OWMA 1QYMA 3ZW3A 3QJZA 1ELWA 4DI4A 3FU5A 2GGFA 2NYJA 4CGVA 1HH8A 4L7TA 4LG6A 2OOEA 1PY1A 2MRIA 3APCA 4HLLA 4BWRA 3NOCD 2VGXA 1JCSA 5JHAA 3GW4A 5AQBA 3QWWA 4HFGA 4DPRA
chains in the Genus database with same CATH topology
4GTQA 1LD8A 1DCEA 1N94A 1QBQA 3SFXA 3E30A 2R2LA 3Q75A 1JCRA 3KSLA 3HXCA 2BEDA 3E34A 3DRAA 3DPYA 4EHMA 3Q7AA 1O1RA 3E37A 1O5MA 3PZ3A 1S64A 2ZISA 1TN8A 3DSUA 2ZIRA 3DSWA 2H6IA 1LTXA 4LNGA 2F0YA 3DSSA 2H6GA 3Q79A 2H6HA 3PZ1A 1S63A 1FT2A 4GTMA 1TNZA 3HXFA 3SFYA 1N4QA 4GTOA 2H6FA 3PZ2A 4MBGA 4GTPA 1TNUA 3HXEA 3C72A 1N4RA 3EU5A 1X81A 3PZ4A 1LD7A 3HXDA 2IEJA 1N9AA 1TNYA 1FPPA 4L9PA 1D8DA 1TNBA 4GTVA 1SA5A 1O1TA 1N4SA 1N95A 1SA4A 3Q78A 3EUVA 4LNBA 1TN7A 4YDOA 3HXBA 3DSVA 1NL4A 1N4PA 3DSXA 3E33A 1KZOA 3Q7FA 3DSTA 1NI1A 3KSQA 1FT1A 1MZCA 1D8EA 3E32A 3Q73A 1O1SA 1JCSA 4GTRA 1TNOA 1TN6A 4YDEA 1KZPA 4GTSA 4GTTA 1JCQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTQ A;  1LD8 A;  1DCE A;  1N94 A;  1QBQ A;  3SFX A;  3E30 A;  2R2L A;  3Q75 A;  1JCR A;  3KSL A;  3HXC A;  2BED A;  3E34 A;  3DRA A;  3DPY A;  4EHM A;  3Q7A A;  1O1R A;  3E37 A;  1O5M A;  3PZ3 A;  1S64 A;  2ZIS A;  1TN8 A;  3DSU A;  2ZIR A;  3DSW A;  2H6I A;  1LTX A;  4LNG A;  2F0Y A;  3DSS A;  2H6G A;  3Q79 A;  2H6H A;  3PZ1 A;  1S63 A;  1FT2 A;  4GTM A;  1TNZ A;  3HXF A;  3SFY A;  1N4Q A;  4GTO A;  2H6F A;  3PZ2 A;  4MBG A;  4GTP A;  1TNU A;  3HXE A;  3C72 A;  1N4R A;  3EU5 A;  1X81 A;  3PZ4 A;  1LD7 A;  3HXD A;  2IEJ A;  1N9A A;  1TNY A;  1FPP A;  4L9P A;  1D8D A;  1TNB A;  4GTV A;  1SA5 A;  1O1T A;  1N4S A;  1N95 A;  1SA4 A;  3Q78 A;  3EUV A;  4LNB A;  1TN7 A;  4YDO A;  3HXB A;  3DSV A;  1NL4 A;  1N4P A;  3DSX A;  3E33 A;  1KZO A;  3Q7F A;  3DST A;  1NI1 A;  3KSQ A;  1FT1 A;  1MZC A;  1D8E A;  3E32 A;  3Q73 A;  1O1S A;  1JCS A;  4GTR A;  1TNO A;  1TN6 A;  4YDE A;  1KZP A;  4GTS A;  4GTT A;  1JCQ A; 
#chains in the Genus database with same CATH topology
 4F53 A;  4A63 B;  4DRX E;  1WG0 A;  2VSN A;  3T5V A;  2XRY A;  3FTV A;  4DX5 D;  1U2V G;  4MKT A;  4H7Y A;  4TUU A;  3D3M A;  3FUI A;  4Q96 A;  4TXQ A;  5D0Q D;  4OVV A;  2ZIS A;  1HG5 A;  5LX8 A;  4GYO A;  3DEP A;  4F7A A;  2P9N G;  2NXP A;  2PZI A;  1E8W A;  5FTP A;  2LXL A;  1RW2 A;  2AXV A;  1OWL A;  3PZ2 A;  3CGH A;  2ZU6 B;  3NZS A;  3ENE A;  1N4R A;  5EYL A;  2LXM A;  3MYV A;  3IEG A;  3RSE G;  2P9S G;  4K5C A;  2MOW A;  4R7L A;  2AWI A;  2Y69 E;  3AS5 A;  4HOU A;  5EYP F;  4HB5 A;  1KPS B;  2LNI A;  4KVO A;  2DYR E;  3L82 A;  5CCM A;  3L6A A;  4FP7 A;  4RVB A;  1UJK A;  3TWW A;  4UWG A;  4WND A;  2KXP C;  3MGB A;  4MRU A;  2CG3 A;  3GZS A;  4YDY A;  2RFM A;  2FF4 A;  1TNO A;  1E8Z A;  1OWP A;  3FUD A;  4C48 B;  4OYS A;  4F1S A;  3AG2 E;  4GYW A;  3JXI A;  3ONK A;  2AW6 A;  2P2C P;  3UKU G;  4UQY A;  3E30 A;  4CEM A;  2OV8 A;  2X6H A;  1H6K A;  4Q94 A;  3D9P A;  3APD A;  3DBS A;  3ML8 A;  3LJN A;  3Q47 B;  1DC2 A;  3DEO A;  3TWT A;  4BTA A;  2L0I A;  1EF1 C;  4PS7 A;  1JWF A;  2HR2 A;  3FUE A;  3JQ1 A;  2GW1 A;  4MBG A;  4AEZ C;  3G2W A;  3UM2 A;  4TXR A;  4A3V A;  4CDM A;  4PUC A;  4U7E B;  3S7J A;  1IQR A;  4KVM A;  4EZK A;  3G2V A;  4BEP A;  2ETC A;  3UPV A;  2IU1 A;  2DYS E;  3APF A;  4GTV A;  2WPV A;  1HX8 A;  4ME2 A;  4RG9 A;  4WNF A;  1E7U A;  4APF A;  2VSX E;  2DCP A;  4UQZ A;  3J5P A;  2WMO A;  4N2Q A;  3MV3 B;  3ASN E;  4A55 A;  3TWV A;  4LNU D;  5KCM A;  5ENT D;  4O1P A;  5J90 A;  4RSY A;  4G25 A;  4GZ6 A;  1MYO A;  1QNF A;  3IHY A;  5EX3 A;  3I4G A;  2VTB A;  3MZL B;  3PE4 A;  1IHG A;  3LPZ A;  3NBN B;  2OEV A;  2XGS A;  4KMO A;  3TGO A;  1DNP A;  2BUG A;  4BT8 A;  2FEZ A;  1HZ4 A;  4FC8 A;  5ENR D;  4C9B B;  3G2T A;  2KZT B;  4LSZ E;  3DRA A;  2IF4 A;  3N71 A;  2UWJ G;  4CYM D;  2MYO A;  4Y6W A;  4LEU A;  2LSV A;  3ML9 A;  2CFU A;  3DSS A;  2WXR A;  4CCA A;  3SQV A;  1Y6I A;  2X6J A;  3CV0 A;  3NB2 A;  5FIN A;  2I6H A;  5FQ7 A;  4BTB A;  1OWO A;  3U9W A;  5FQ4 A;  2RFA A;  2WXO A;  4XI0 A;  3MX3 A;  4CDR A;  4DLO A;  2PQN A;  1ZU2 A;  2P9L G;  2R17 C;  1FPP A;  4AOF A;  1D8D A;  5FQ6 A;  4HI8 A;  1QZ2 A;  2EIM E;  2WXM A;  2I9C A;  1MJ0 A;  4JW1 A;  3FDH A;  5JJT A;  4XIF A;  2Y4T A;  3WG7 E;  3L9T A;  3ZFW A;  2EIK E;  4NAC A;  2IO3 C;  1KLX A;  3NOG D;  3TWX A;  4XKB A;  3CKC A;  2X6K A;  5D66 A;  1HO8 A;  3HVE A;  3ZRH A;  4AJW A;  4ATG A;  4LCT A;  4V3I A;  4Q69 A;  1JUQ A;  5D0O D;  3CHO A;  3P2B A;  4L1B A;  4A3T A;  3ZYL A;  5ENN A;  5HRY A;  3DWL G;  4DUI A;  1S0P A;  2WQ6 A;  3TXN A;  2WMN A;  3HYM B;  1S70 B;  4BY6 A;  3VTY A;  4J0U A;  1S64 A;  3RIB A;  5LCW C;  4WUY A;  3LVR E;  1JWG A;  3G2U A;  4TUM A;  4YDW A;  3R7R A;  3SFZ A;  3SNX A;  4J6I A;  3CST A;  3BG0 B;  3FTU A;  1HS6 A;  4NIK A;  1H2U A;  3CHQ A;  2WXJ A;  2XEV A;  3X2Q E;  1H6P A;  3ZYM A;  3LEW A;  1Q2Z A;  2OCC E;  4ANW A;  3HIZ A;  3EHN A;  1E8X A;  1N95 A;  2WXL A;  4BSX A;  4G2V A;  2KC7 A;  2FI7 A;  1MQS A;  5T4Y A;  1NL4 A;  1U3C A;  3HRA A;  3E33 A;  2J09 A;  4JZY A;  1DVP A;  4C0M A;  1N0R A;  3TJP A;  2DZN A;  4U0Z A;  1NA0 A;  1SVX A;  2E2E A;  5CBN A;  3JXJ A;  3P1U A;  3V2O A;  1DCE A;  4F3V A;  3SGH A;  4KT6 B;  4EPZ A;  5AAO A;  2VYI A;  3CHR A;  5AQ7 A;  2YQ8 A;  3B7S A;  2R2L A;  2C0L A;  2ILR A;  4GYY A;  4BX8 A;  3QAQ A;  2P58 C;  1OT8 A;  4O1O A;  3FU6 A;  3IBE A;  3U3W A;  1P5Q A;  5D2M C;  1YMP A;  2WXH A;  3Q49 B;  1PC2 A;  5G55 A;  2GRP B;  2QZA A;  1YYH A;  2VSY A;  4EQF A;  2QFC A;  3CLJ A;  4GCN A;  2BTD A;  4JA9 A;  3MKR A;  4DX7 D;  3FEX A;  2J49 A;  5BXU A;  1Y8M A;  4GTP A;  5C1D A;  4I1M A;  5G05 C;  3C3R A;  4DLQ A;  2WXK A;  3TG5 A;  4PDX A;  4F6R D;  5E75 A;  1NZN A;  4EEC A;  3ABK E;  4JC8 A;  3FTS A;  2IFU A;  1TNB A;  3S7B A;  2LO6 A;  3CKB A;  4GPM A;  1OWN A;  3EHM A;  3TWS A;  2UY1 B;  3QWP A;  3W9F A;  4N5Q A;  2FBN A;  3KAE A;  3Q15 A;  3FUJ A;  2PQR A;  1WAO 1;  4G8K A;  3RKV A;  3HDX A;  3NAW A;  1KZP A;  3O4Z A;  4J7W A;  4GTQ A;  3FTX A;  3ZU7 B;  3FY4 A;  4UWL A;  3OXG A;  4U95 D;  2X3M A;  4J8S A;  4C0E A;  4HOQ A;  3EDT B;  1TYQ G;  5LCW J;  2BED A;  3DPD A;  3RRM B;  3ESK A;  4JA7 A;  2BKG A;  3ZIM A;  2H6H A;  2WVI A;  4G11 A;  4IYP A;  4B89 A;  1OY3 D;  3B13 A;  4GTM A;  4JHJ A;  4YND A;  2R03 A;  3V31 A;  5JJ7 A;  3FH5 A;  5CED B;  2GRR B;  3C5R A;  2V8S E;  3FUH A;  5ENP D;  1MHQ A;  3LJ3 A;  4NQ0 A;  5CEC B;  3CVL A;  3ASG A;  5T8I A;  2X6F A;  2WQ7 A;  3LXU X;  3E4B A;  1O1T A;  4YDO A;  3FUL A;  1PAQ A;  4N3B A;  5FT9 A;  3Q7F A;  5ENS D;  5EIB E;  4I9E A;  1D9S A;  5AJD A;  3JQ0 A;  4CRW A;  4U8V D;  4AV7 A;  2QYJ A;  4I2W A;  3VTX A;  5JMN D;  4XZ4 A;  3FH7 A;  2XHE A;  5G04 J;  2Y1L E;  4MS6 A;  4GTS A;  4JEU A;  1IHB A;  4ABN A;  3FUF A;  2F8Y A;  3OXF A;  3V30 A;  1UJJ A;  3ABM E;  3C3Q A;  5B1B E;  4JEH A;  1OCC E;  3Q75 A;  2XGO A;  2V0P A;  4UUC A;  2XS1 A;  3CVX A;  3AG4 E;  1K1A A;  3C3O A;  4U63 A;  5AAR A;  4ATZ D;  1E7V A;  2XRZ A;  4M7C A;  2J08 A;  2AXZ A;  3ZNG A;  4A1G A;  4EBA A;  3TWQ A;  5ITZ F;  2BF0 X;  2ZIR A;  4U0U A;  2KCV A;  3RRU A;  1KT1 A;  1Z3Y A;  4WWN A;  5E76 A;  4H7X A;  3CQC B;  2DWZ A;  2AVP A;  5EKQ D;  3T8K A;  5ENO D;  5G05 J;  3PRZ A;  2YHE A;  4U04 A;  3PS6 A;  3D9K A;  1A17 A;  1E96 B;  3EU5 A;  5AJL A;  4ILH B;  4N3C A;  4N5C A;  2VQ2 A;  1SZ9 A;  3AU5 A;  4PS3 A;  3B95 A;  1UW4 B;  3VLE A;  3PEV B;  1SA5 A;  3D9H A;  4DX6 D;  4HNA D;  2A5E A;  4DX1 A;  4FA6 A;  2P9P G;  4GZ5 A;  3EU9 A;  3Q5M A;  1FT1 A;  2CFZ A;  1MZC A;  4MLP A;  2EIJ E;  3ZGQ A;  4HVB A;  3ZYQ A;  4HI9 A;  1EDU A;  5B3S E;  5CBO A;  2R05 A;  2MHK A;  3MEK A;  2XPY A;  2OND A;  4GPK A;  3SO8 A;  2C0M A;  2JLB A;  1ZB1 A;  2GRN B;  3I4R B;  1TR4 A;  2XZD G;  3LY9 A;  4FLH A;  5FQ8 A;  3UIO C;  3BU8 A;  1WDY A;  3DPY A;  4HQD A;  3SF4 A;  4O6F A;  3PZ3 A;  4Y6C A;  5KJK A;  3CIA A;  3R9M A;  3T8M A;  4O60 A;  1MX2 A;  4FAD A;  4B0Z A;  4CT4 A;  4L2Y A;  3S7F A;  1BU9 A;  3Q4A B;  3MJW A;  2J9Q A;  2AXU A;  3D9N A;  3FH8 A;  1TNU A;  4WWO A;  5ANL A;  5KNG A;  3UT8 A;  3T9K A;  5HKP A;  1N0Q A;  2P9K G;  1LD7 A;  4RLY A;  4G8L A;  2M63 A;  2HO1 A;  3SY2 A;  1ZBP A;  5LP0 A;  1SA4 A;  2R02 A;  4E6H A;  3PNL B;  5CER B;  1NA3 A;  2WQH A;  3DSV A;  1HU3 A;  4ANV A;  2A4Z A;  2XCB A;  3S2A A;  2I1J A;  4N39 A;  3E32 A;  2DVW A;  3PVL A;  1K8K G;  5J08 A;  5BNW A;  3CVU A;  3DXM G;  3TXM A;  2WXP A;  5FZQ A;  4X8Q A;  3QWV A;  1RZ4 A;  3QDN A;  3QAR A;  2DIW A;  1UN9 A;  1K1B A;  2CHZ A;  3TWR A;  4UWF A;  4E85 A;  3RO3 A;  3ULY A;  5KWD A;  4EHM A;  3J5Q B;  3GZ1 A;  1HG2 A;  3CVN A;  4DJA A;  3DSW A;  3ZHE B;  3T5X A;  4OVU A;  2F37 A;  5HS0 A;  4I2Z A;  3PE3 A;  3L16 A;  4ILI A;  1FT2 A;  2PNN A;  3CVW A;  2C2L A;  3PNT B;  4LER A;  2KCL A;  3HXF A;  3LDZ A;  1HF8 A;  2IJG X;  4CGW A;  3PH0 C;  3ASF A;  5DIZ A;  1WY6 A;  3FEY A;  5BUZ A;  4URK A;  2WXQ A;  3RJV A;  3NF1 A;  5JJ6 A;  3CEQ A;  4U07 A;  3ASH A;  3ZKJ A;  3SD5 A;  2IEJ A;  3Q9U C;  3WXX A;  1N54 A;  4U96 D;  1ELK A;  4GML A;  4FUL A;  4BSZ B;  2VGE A;  5HI7 A;  3QK0 A;  2ETA A;  3LY8 A;  4FJZ A;  5A6C A;  3FFL A;  1H2T C;  2IQC A;  2LAH A;  3MKQ B;  1NI1 A;  2JEK A;  1X5B A;  2F8X K;  1N11 A;  4XI9 A;  4B93 B;  2CG2 A;  5G2N A;  3FUM A;  2L6J A;  3UXG A;  1K3Z D;  3CVY A;  4JD2 G;  3BEE A;  4GZ3 A;  4AXH A;  2LSU A;  3PDN A;  2EIN E;  3SFX A;  3AU4 A;  5AIJ A;  4J8E A;  4IRU A;  1JCR A;  3GZ2 A;  3IV0 A;  5DBK A;  3E34 A;  3VLD A;  1AWC B;  1O5M A;  2X6I A;  3ZPJ A;  3B7T A;  5G04 C;  2H6I A;  2F0Y A;  4UI9 K;  3IHV A;  4I9C A;  1DCQ A;  4HRL A;  4AIF A;  3ESL A;  3U4T A;  3CHP A;  1UOH A;  4JVS A;  2RD0 A;  3U64 A;  5JA4 D;  3ABL E;  4PH4 B;  3ZYK A;  4L2L A;  3UM0 A;  5KJN A;  5AN8 A;  3ZXS A;  4K5A B;  1IKN D;  5T3R A;  4FHK A;  1H0A A;  3UM1 A;  1MX4 A;  3EIJ A;  1TEZ A;  4UI9 C;  1KT0 A;  2L9B A;  3QC1 A;  2WXG A;  5FJY A;  4JL0 A;  1E90 A;  5EX0 A;  3Q78 A;  2IOS A;  4KBQ A;  3TAX A;  3JYS A;  4DI3 A;  1Z6T A;  4ILG A;  2VJ8 A;  4UWH A;  5JHB A;  2WB2 A;  4ANU A;  2QYU A;  2GRQ B;  4ACK A;  3D9J A;  3UMV A;  2A5U A;  3BQO A;  1Z5S C;  2B0O E;  2V4H C;  4K5B A;  4APO A;  4CZ2 D;  1TJC A;  1A5E A;  3FUK A;  3UIN C;  2EIL E;  1QBQ A;  2J4D A;  4I1A A;  4WAF A;  3OXL A;  4J8Y A;  3SBT B;  4TXP A;  5CRV A;  5CCL A;  5A7D B;  3R7Q A;  3E37 A;  1GW6 A;  3W9G A;  4AY5 A;  4JHK A;  2HM8 A;  3AG3 E;  3MCX A;  3UIP C;  2H6G A;  4L23 A;  4NRH B;  1H6O A;  3F6Q A;  4AY6 A;  3ZVV A;  2E0I A;  3PZ1 A;  3HVE B;  4UQX A;  1E8Y A;  3FUN A;  4FJY A;  2XPZ A;  5BPP A;  2QY7 A;  4HRN A;  3RO2 A;  2I2O A;  1BI7 B;  3AS4 A;  2Y0B G;  3EUV A;  2KZT A;  1U3D A;  3UTM A;  3TWU A;  3V2X A;  5BV0 A;  3EHR A;  2YIN A;  1KZO A;  3DST A;  2R59 A;  4BFR A;  3PEU B;  3L22 A;  2I1K A;  4BER A;  3ULQ A;  3JUI A;  3FU0 A;  2KCK A;  2QC9 A;  1O1S A;  5M72 A;  4YDE A;  1TN6 A;  3CHS A;  2B6C A;  2WM9 A;  2J8S D;  4GZD A;  4DX2 A;  3FTY A;  3AG1 E;  1JCQ A;  3CHM A;  4J8D A;  3RRN B;  3UI2 A;  3EJN A;  3VLF A;  1B89 A;  4KYO B;  4B8C B;  5BT1 A;  1HE8 A;  3AS8 A;  4GA2 A;  2XZT G;  1XNF A;  2GRM A;  3Q7A A;  1OCR E;  1TN8 A;  4IUL A;  3BUA A;  3IKO B;  4ZFH A;  3K9I A;  1UG3 A;  5AQA A;  2KBX A;  4PS8 A;  3CK8 A;  5KJM A;  4I6E A;  5FZR A;  2JAB A;  3SFY A;  4I6G A;  4TV3 A;  3ZN3 A;  1EPU A;  3RU0 A;  2J07 A;  3UX4 A;  2V5Q C;  4WWP A;  3CK7 A;  3C72 A;  5BV1 A;  3ZHE A;  4UI9 J;  3SZ7 A;  4WNE A;  1QQE A;  3D9L A;  1NP7 A;  2CHW A;  3U66 A;  2XEE A;  5LFA A;  4HS2 A;  1TN7 A;  3CR3 A;  3HXB A;  3LVQ E;  1OCZ E;  2KAT A;  3QB2 A;  1D8E A;  1HXI A;  3KD7 A;  2RKK A;  4KZC A;  4U0S A;  5ENQ D;  4GA0 A;  1NFI E;  5FIO A;  3EIQ C;  3KEZ A;  4GTR A;  4K0R A;  4GTT A;  2RG8 A;  2LAI A;  5FZS A;  3MKQ A;  3ZUV B;  3UT4 A;  1AP7 A;  3UQ3 A;  4XEI G;  5ARG A;  4JXT A;  2VSO E;  4HOS A;  3B7B A;  5BXO A;  3LYA A;  4U8Y D;  4GCO A;  3QOU A;  3SBS A;  3HXC A;  3HG0 D;  4HOR A;  4GAA A;  5CHE E;  3FWV A;  4D10 C;  3PZD A;  4UWK A;  3FHE A;  2GRO B;  4JPS A;  5IY5 E;  3B7U X;  2FO7 A;  4G23 A;  1YCS B;  3D9I A;  2AJA A;  3CVP A;  1L5J A;  1HFA A;  4GTO A;  4YVQ C;  4F1P A;  3LY7 A;  4KXK B;  1TJF A;  1X81 A;  2LUH A;  4HOT A;  5LOZ A;  3KS2 A;  5AQ9 A;  4EBA G;  5EN5 D;  4OAU C;  2J4B A;  3NZU A;  4RQI A;  3O48 A;  4W9R A;  3JUE A;  4G24 A;  2VGY A;  4L9P A;  2BKK B;  2OVF A;  2VGX B;  1EYH A;  4LNB A;  2ZGD A;  3CSF A;  2ETB A;  1LF8 A;  3I3N A;  3L17 A;  3CVQ A;  4GMR A;  1N4P A;  1MX6 A;  3UKR G;  2Y4U A;  4GMJ A;  3KEA A;  1BLX B;  3QKY A;  1N52 A;  3Q73 A;  4BT9 A;  3RK6 A;  2XQ0 A;  1OCO E;  4WNG A;  3D9M A;  5EID A;  4RG6 A;  4B94 A;  3ASD A;  5ARF A;  1FCH A;  1V55 E;  3PRE A;  4FLB A;  2XEH A;  4M3O A;  1LD8 A;  4BES A;  3ASO E;  4N2S A;  3AAA C;  4TRQ A;  4ZHB A;  1ELR A;  1XGW A;  2FUL A;  2L0T B;  3FP3 A;  1BI8 B;  4CT0 A;  2UY1 A;  3EHQ A;  1Z3X A;  3R9A B;  3FTW A;  4KZ0 A;  3CK9 A;  3S7D A;  1LTX A;  4LNG A;  5CMW A;  3Q79 A;  3QNK A;  2PL2 A;  2V4L A;  1S63 A;  4XX5 A;  4DK5 A;  1N4Q A;  2YHC A;  2WXI A;  4I1O B;  1IXV A;  5AYW D;  5C2Y A;  3HXE A;  5CEA A;  1IQU A;  1BD8 A;  4JHR A;  2XPI A;  5EIL A;  1H19 A;  3TG4 A;  4EZL A;  5KJL A;  3PZ4 A;  5EDS A;  1N9A A;  1SZA A;  4HRM B;  1TNY A;  2PM6 A;  5FWQ A;  4LRZ A;  2X38 A;  1SQM A;  1N4S A;  3BG1 B;  4JB8 P;  3LKU A;  3DSX A;  5H7P A;  3KSQ A;  2XGM A;  3GYZ A;  2IOL A;  4AM9 A;  2GRL A;  4J8F A;  1WM5 A;  1W3B A;  1FVH A;  4XE0 A;  3ZEF A;  4YVO A;  3L54 A;  3OAW A;  2KM4 A;  1N94 A;  5CMY A;  3URZ A;  2IY0 C;  3MV2 B;  4NUR A;  3UM3 A;  3L08 A;  2HYZ A;  3C98 A;  4HBD A;  4FU3 A;  2ZGG A;  3LS8 A;  1O1R A;  2OVB A;  4U8H A;  2IO2 C;  2NSZ A;  4GA1 A;  5HQ8 A;  3DSU A;  3LCA A;  4AVX A;  5KBA A;  4GZC A;  3TL5 A;  1H2V C;  5BW8 C;  2XS8 A;  1OXJ A;  4BX9 A;  5B1A E;  5KNH D;  3SI5 A;  4IN3 B;  1SW6 A;  3MA5 A;  3DXK G;  2DZO A;  3B7R L;  2CHX A;  5ANR A;  4BET A;  3FTZ A;  4Z68 A;  1VDY A;  1G3N B;  4G26 A;  3OTN A;  1JPL A;  2VTB B;  4I43 A;  3RAU A;  3G2S A;  2HE0 A;  2FO1 E;  4K03 A;  2XEN A;  4HLE A;  4XKC A;  4P29 A;  4I17 A;  3UUX A;  4N3A A;  3PUK A;  1IYG A;  4EZJ A;  3I5P A;  4A1S A;  2V5F A;  2Q7F A;  1V54 E;  5AEN A;  3JCK C;  4GB9 A;  4HXI A;  2P9U G;  1BPO A;  4G1T A;  2ION A;  4AP2 A;  4I6J A;  4B8A A;  3FU3 A;  2YNQ A;  3KSL A;  3Q9N C;  2ZXW E;  2L6B A;  3CQG B;  4QFV A;  2NC9 A;  2EQX A;  3PUJ A;  2OEW A;  2P9I G;  1OUV A;  3NQP A;  5CRU A;  3HHM A;  3CVV A;  2PM7 A;  3IXE A;  1UN8 A;  2DBA A;  2WXN A;  2XCC A;  3AJI A;  1TNZ A;  3UT7 A;  1FVF A;  3D9O A;  4OAV B;  5A23 A;  3V79 K;  4ANX A;  2H6F A;  4ACL A;  2Y3A A;  3ZXP A;  3ONL A;  3SHF A;  4CDN A;  4GU5 A;  3L13 A;  1YA0 A;  4FHJ A;  3ISM C;  3HXD A;  1INZ A;  2WXF A;  4QQI A;  3ULE G;  2R5S A;  4LUN U;  1OWM A;  1QYM A;  3ZW3 A;  3QJZ A;  1ELW A;  4DI4 A;  3FU5 A;  2GGF A;  2NYJ A;  4CGV A;  1HH8 A;  4L7T A;  4LG6 A;  2OOE A;  1PY1 A;  2MRI A;  3APC A;  4HLL A;  4BWR A;  3NOC D;  2VGX A;  1JCS A;  5JHA A;  3GW4 A;  5AQB A;  3QWW A;  4HFG A;  4DPR A; 
#chains in the Genus database with same CATH homology
 4GTQ A;  1LD8 A;  1DCE A;  1N94 A;  1QBQ A;  3SFX A;  3E30 A;  2R2L A;  3Q75 A;  1JCR A;  3KSL A;  3HXC A;  2BED A;  3E34 A;  3DRA A;  3DPY A;  4EHM A;  3Q7A A;  1O1R A;  3E37 A;  1O5M A;  3PZ3 A;  1S64 A;  2ZIS A;  1TN8 A;  3DSU A;  2ZIR A;  3DSW A;  2H6I A;  1LTX A;  4LNG A;  2F0Y A;  3DSS A;  2H6G A;  3Q79 A;  2H6H A;  3PZ1 A;  1S63 A;  1FT2 A;  4GTM A;  1TNZ A;  3HXF A;  3SFY A;  1N4Q A;  4GTO A;  2H6F A;  3PZ2 A;  4MBG A;  4GTP A;  1TNU A;  3HXE A;  3C72 A;  1N4R A;  3EU5 A;  1X81 A;  3PZ4 A;  1LD7 A;  3HXD A;  2IEJ A;  1N9A A;  1TNY A;  1FPP A;  4L9P A;  1D8D A;  1TNB A;  4GTV A;  1SA5 A;  1O1T A;  1N4S A;  1N95 A;  1SA4 A;  3Q78 A;  3EUV A;  4LNB A;  1TN7 A;  4YDO A;  3HXB A;  3DSV A;  1NL4 A;  1N4P A;  3DSX A;  3E33 A;  1KZO A;  3Q7F A;  3DST A;  1NI1 A;  3KSQ A;  1FT1 A;  1MZC A;  1D8E A;  3E32 A;  3Q73 A;  1O1S A;  1JCS A;  4GTR A;  1TNO A;  1TN6 A;  4YDE A;  1KZP A;  4GTS A;  4GTT A;  1JCQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...