1QC6A

Evh1 domain from ena/vasp-like protein in complex with acta peptide
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
113
structure length
108
Chain Sequence
b'MSEQSICQARASVMVYDDTSKKWVPIKFSRINIYHNTASSTFRVVGVKLQDQQVVINYSIVKGLKYNQATPTFHQWRDARQVYGLNFASKEEATTFSNAMLFALNIMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EVH1 DOMAIN FROM ENA/VASP-LIKE PROTEIN
publication title Structure of EVH1, a novel proline-rich ligand-binding module involved in cytoskeletal dynamics and neural function
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein
total genus 20
structure length 108
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1qc6A00
1KZGA 4HB2B 4HAZB 4WVFB 1V61A 5JP4A 4HAUB 3A8QA 1U2BA 2Z0QA 1PLSA 1NTYA 1K5DB 1DDWA 2D9XA 5LOPB 3BJIA 4HAXB 4HB3B 1EGXA 5DH9B 3OANA 4EJNA 3GYOA 3HK0A 4NY0A 1TXDA 3DXCA 3ODOA 2YT0A 2Y8FA 4DBBA 3U7DA 2MDXA 4KHAA 3M1IB 5HE1A 1FHWA 1U29A 4K81A 1FOEA 3SO6A 4D0NB 1MK7B 5J3TA 2NZ8B 1FGYA 3T06A 3AJ4A 1WI1A 4TYZA 5DHFB 1SGHA 4A6KA 5JLJB 5KQ4A 5HE2A 2L1CA 1PMSA 2DHJA 2GCJA 2ELBA 2DHIA 2EMSA 2KCJA 2NMBA 4MT7A 2N23A 3SNHA 1UNRA 2Q13A 1QC6A 3FEHA 2FJLA 2W2XC 2I5CA 4IAPA 1I7AA 5D3XA 3KY9A 1TJ6A 2CODA 3ULBA 2D9WA 1OMWA 5KQ1A 1XD4A 2YF0A 4KVGB 1X86A 1EVHA 1XKEA 1I2HA 4DX8A 5DI9B 1DBHA 2UVMA 4HDQA 3KSYA 2COAA 4ZRJA 4A6FB 1W1GA 2ELAA 2OTXA 2P0FA 2Z0PA 2J59M 2DYNA 1NU2A 5D27A 1MIZB 2UZRA 5D3YA 3AU4A 4Z2MB 1E5WA 4NSWA 1ZSQA 1SHCA 5D3VA 2DX5A 2HTHB 3ULCA 3KRWA 1FHOA 1PFJA 1WVHA 2DLWA 3FSSA 1EF1A 1MK9B 3O96A 4GPTB 3TO1A 4ZRIA 4P7IA 2YVCA 2Y8GA 4MY6A 4DX90 1XCGA 3KZ1A 3TW1A 1NI2A 1KZ7A 1UNPA 2I1JA 3PVUA 2VSZA 1OY2A 3PVLA 1MKEA 3AU5A 2M38A 2DA0A 1OQNA 4K17A 5FI1A 2W2XD 3ODWA 2EC1A 2RNRB 2X18A 2DFKA 2YT1A 4GMVA 2H7DA 1Z87A 5FI0A 5J3YA 1FGZA 2IFSA 1FB8A 1J0WA 1H4RA 2V76A 3QIJA 2HE7A 5CLQB 2J0JA 4A6FA 2I5FA 3PSCA 5J3QA 4HB0B 3V5WA 5GOWB 2D9YA 4GN1A 4CHJA 1XODA 4HATB 1AWEA 1FAOA 3DXEA 2J0KA 4HAYB 2K2JA 4GXBA 2L2IA 1WGQA 2RVBB 1DDVA 3P6AA 3PG7A 4F7GA 2Y7BA 2COCA 1V89A 1Y19B 4Y94A 3D8EA 1J19A 4WJ7A 2BCJA 3WYFB 1H10A 1MIXA 4GMXB 3TCAA 4IOYX 2EJ8A 1WJMA 4C0AA 1U5DA 1V5MA 2GCLA 2RGNB 4HDOA 1P6SA 2I1KA 1KI1B 1EAZA 2D4QA 1B55A 2JP2A 4CYEA 2D11A 2MWNB 3TFMA 2DTCA 2YRYA 2Z0OA 4PNKA 1XX0A 1DYNA 2EMTA 3A98B 1X11A 1U5EA 2ROZB 1X1GA 3PVWA 4CHMA 3IVFA 3KRXA 4DXAB 3F0WA 2CY4A 1UEFA 2DKQA 4YL8A 1K5GB 4K2PA 2YS5A 3PZDA 4MK0A 2DHKA 1WG7A 4EMOA 1BTNA 2GJYA 2N0YA 1BAKA 1ZVRA 4HAWB 2QKLA 1M7RA 3RCPA 3WA0A 3FM8C 2CRFA 1LW3A 2MFQA 1V88A 3U8ZA 3CXBB 3ZDTA 1U5GA 2R0DA 1AQCA 1P5TA 1X05A 4TKNA 2DN6A 2VKIA 1ISNA 3PEGA 1X1FA 1W1DA 3BINA 2K2UA 3LJUX 2DKPA 3PP2A 3F5RA 5HE3A 5JHHA 3HW2B 4HHVA 1V5PA 4A5KA 2RSGA 4KAXB 1UNQA 2CY5A 1U27A 3P7ZA 5C5BA 2YSZA 4K2OA 3SUZA 2COFA 4HAVB 2KGXB 3VIAA 2AL6A 4YONA 2XQNM 4PQ0A 4B6HA 3D8DA 3QBVB 3QWMA 3CIKA 5JHGA 2DYQA 1ZC4B 2P0DA 1LB1A 2G35A 2D10A 1RRPB 1XR0B 1UPQA 4IFSA 5LONB 2UZSA 4L6EA 4F7UP 5D3WA 3G9WA 2OQBA 3NSUA 2H7EA 5EFXA 4EKUA 2AEHA 4BBKA 1Y5OA 3DXDA 4F7HA 2P0HA 1ZC3B 2D2QA 3A8PA 2YS1A 2PZ1A 1WGUA 2LOZA 2ROVA 2LG1A 2M14A 2GS0A 1V5UA 2R09A 1GG3A 4GZUA 1W1HA 2ZPYA 5C5BB 1DDMA 1MAIA 4Z2NA 1GC7A 3SYXA 2D9ZA 5C6RA 2ADZA 1QQGA 2W2WA 3GYPA 1WJ1A 1ZM0A 3ML4A 2MKRA 2IYBA 3VOQA 5C16A 4H8SA 1RJ2A 1GC6A 1DROA 3HQCA 5DIFB 3X23A 3UZTA 5C79A 2D9VA 2J0MA 2RLOA 5KCVA 2VRWB 1FHXA 3ZVRA 4HB4B 1P3RA 2LKOA 1MPHA 1UPRA 5CLLB 2LOXA 2RUKB 2K00A 1M7EA 2CAYA 2LULA 2LYDA 2E2XA 5HE0A 1U5FA 4KHBB 1Q67A 3TVVA 4A6HA 4KHOA 2QKMA 3MPXA 2KUPA 3D8FA 2P8VA 3N7CA 5DHAB 1BTKA 3SV1A 5L81A 2YS3A 4XWXA 4ZRKA 3ODXA 1TQZA 3MDBC 1IRSA 4WSFA 2DX1A 1BWNA 1NTVA 1N3HA
chains in the Genus database with same CATH superfamily
1KZGA 4HB2B 4HAZB 4WVFB 2RRFA 1V61A 5JP4A 4HAUB 3A8QA 1U2BA 2Z0QA 5LG4B 1PLSA 1NTYA 2K49A 2GUMA 1K5DB 1DDWA 2D9XA 5LOPB 3BJIA 4HAXB 4HB3B 1EGXA 2Z4DA 5DH9B 3OANA 4CSQA 4EJNA 3GYOA 3HK0A 4NY0A 1TXDA 3DXCA 3ODOA 2YT0A 2Y8FA 4DBBA 3U7DA 3FVCA 3HSAA 2MDXA 4KHAA 3M1IB 5HE1A 4GOUA 1FHWA 1U29A 4K81A 1FOEA 3SO6A 4D0NB 1MK7B 5J3TA 2NZ8B 1FGYA 3T06A 3AJ4A 1WI1A 4TYZA 2FJUB 5DHFB 1SGHA 4A6KA 5JLJB 5KQ4A 5HE2A 2L1CA 1PMSA 2DHJA 2GCJA 2ELBA 2DHIA 2EMSA 2KCJA 2NMBA 4MT7A 2N23A 3SNHA 1UNRA 2Q13A 1QC6A 3FEHA 2FJLA 2W2XC 2I5CA 4IAPA 1I7AA 5D3XA 3KY9A 1TJ6A 2CODA 3ULBA 2D9WA 1OMWA 5KQ1A 1XD4A 2YF0A 4KVGB 3NW8A 1X86A 1EVHA 1XKEA 1I2HA 3DCXA 4DX8A 4D6WA 5DI9B 1DBHA 2UVMA 4HDQA 2ZKMX 3KSYA 2COAA 4ZRJA 4A6FB 1W1GA 2ELAA 2OTXA 2P0FA 2Z0PA 4HSIA 2J59M 2DYNA 1NU2A 5D27A 1MIZB 2UZRA 5D3YA 3AU4A 4Z2MB 2Z59A 1E5WA 4NSWA 1ZSQA 1SHCA 5D3VA 2DX5A 2HTHB 3ULCA 3KRWA 2NBVA 1FHOA 1PFJA 1WVHA 2DLWA 3FSSA 1EF1A 1MK9B 3O96A 4GPTB 3TO1A 4ZRIA 4P7IA 2YVCA 2Y8GA 4MY6A 4DX90 1XCGA 3KZ1A 3TW1A 1NI2A 1KZ7A 1UNPA 2I1JA 2KR0A 3PVUA 2VSZA 1OY2A 3PVLA 1MKEA 3AU5A 2M38A 2DA0A 1OQNA 4K17A 2KUQA 5FI1A 2W2XD 5I2MA 3ODWA 2EC1A 2RNRB 2X18A 2DFKA 2YT1A 4GMVA 2H7DA 3U12A 1Z87A 5FI0A 5J3YA 1FGZA 2IFSA 1FB8A 1J0WA 1H4RA 2V76A 3QIJA 2HE7A 5CLQB 2J0JA 4A6FA 2I5FA 3PSCA 5J3QA 1MI1A 4HB0B 3V5WA 5GOWB 2D9YA 4GN1A 4CHJA 1XODA 4HATB 1AWEA 1FAOA 3DXEA 2J0KA 4HAYB 2K2JA 4GXBA 2L2IA 1WGQA 2RVBB 1DDVA 3P6AA 2Z14A 3PG7A 4F7GA 2Y7BA 2COCA 1V89A 1Y19B 4Y94A 3D8EA 1J19A 4WJ7A 2BCJA 3WYFB 1H10A 3HIEA 1MIXA 4GMXB 2R2YA 3TCAA 4IOYX 2EJ8A 1WJMA 4C0AA 1U5DA 1V5MA 2GCLA 2RGNB 5I2SA 4HDOA 1P6SA 2I1KA 1KI1B 1EAZA 2KIEA 2D4QA 1B55A 2JP2A 4CYEA 2D11A 2MWNB 3TFMA 2DTCA 2YRYA 2Z0OA 4PNKA 1XX0A 1DYNA 2EMTA 3A98B 1ZYIA 1X11A 1U5EA 2ROZB 1X1GA 3PVWA 4CHMA 3IVFA 3KRXA 4DXAB 3F0WA 2CY4A 1UEFA 2DKQA 5M4YB 4YL8A 1K5GB 4K2PA 2YS5A 3PZDA 2KIGA 3OHMB 4MK0A 2DHKA 1WG7A 4EMOA 1BTNA 2GJYA 2N0YA 2Z13A 1BAKA 1ZVRA 4HAWB 2QKLA 1M7RA 3RCPA 3WA0A 3FM8C 2CRFA 1LW3A 2MFQA 1V88A 3U8ZA 3CXBB 3ZDTA 1U5GA 2R0DA 1AQCA 1P5TA 3B77A 1X05A 4TKNA 2DN6A 2VKIA 4OSNA 1ISNA 3PEGA 1X1FA 1W1DA 3BINA 2K2UA 3LJUX 2DKPA 3PP2A 3F5RA 5HE3A 4QJ4B 5JHHA 3HW2B 4HHVA 1V5PA 4A5KA 2RSGA 4KAXB 1UNQA 2CY5A 1U27A 3P7ZA 4QXAB 2YSZA 5C5BA 4K2OA 3SUZA 2COFA 4HAVB 2KGXB 5IRSA 3VIAA 2AL6A 4YONA 2XQNM 4PQ0A 4B6HA 3D8DA 3QBVB 3QWMA 3CIKA 5JHGA 2DYQA 1ZC4B 2P0DA 1LB1A 2G35A 2D10A 2K8EA 1RRPB 1XR0B 1UPQA 4IFSA 5LONB 2UZSA 4L6EA 4F7UP 5D3WA 3G9WA 2OQBA 2H7EA 3NSUA 5EFXA 4EKUA 2AEHA 4BBKA 1Y5OA 3DXDA 4F7HA 2P0HA 2YT2A 1ZC3B 2D2QA 3A8PA 2YS1A 2PZ1A 1WGUA 2LOZA 2ROVA 2LG1A 2M14A 2GS0A 4L1RA 3NWDA 1V5UA 2R09A 1GG3A 3NWAA 4GZUA 4KHBA 1W1HA 2ZPYA 5C5BB 1DDMA 1MAIA 4Z2NA 1GC7A 3SYXA 2D9ZA 5C6RA 3A58A 2ADZA 4OT1A 1QQGA 2W2WA 3GYPA 1WJ1A 1ZM0A 3ML4A 4QJ3B 2MKRA 4DIXA 2IYBA 3VOQA 5C16A 4H8SA 1RJ2A 1GC6A 1DROA 3HQCA 5DIFB 3X23A 3UZTA 5C79A 2D9VA 2J0MA 2RLOA 3NWFA 5KCVA 2VRWB 1FHXA 3ZVRA 4HB4B 1P3RA 2LKOA 1MPHA 1UPRA 5CLLB 2LOXA 2RUKB 2K00A 1M7EA 2CAYA 2LULA 2LYDA 2E2XA 5HE0A 1U5FA 4KHBB 1Q67A 3TVVA 4A6HA 4KHOA 4QJ5B 2QKMA 3MPXA 2KUPA 3D8FA 2P8VA 3N7CA 5DHAB 1BTKA 3SV1A 1T77A 5L81A 2YS3A 4XWXA 4ZRKA 3ODXA 1TQZA 3MDBC 1IRSA 4WSFA 4GNKB 2DX1A 1BWNA 1NTVA 1N3HA
chains in the Genus database with same CATH topology
1KZGA 4HB2B 4HAZB 4WVFB 1V61A 5JP4A 4HAUB 3A8QA 1U2BA 2Z0QA 1PLSA 1NTYA 1K5DB 1DDWA 2D9XA 5LOPB 3BJIA 4HAXB 4HB3B 1EGXA 5DH9B 3OANA 4EJNA 3GYOA 3HK0A 4NY0A 1TXDA 3DXCA 3ODOA 2YT0A 2Y8FA 4DBBA 3U7DA 2MDXA 4KHAA 3M1IB 5HE1A 1FHWA 1U29A 4K81A 1FOEA 3SO6A 4D0NB 1MK7B 5J3TA 2NZ8B 1FGYA 3T06A 3AJ4A 1WI1A 4TYZA 5DHFB 1SGHA 4A6KA 5JLJB 5KQ4A 5HE2A 2L1CA 1PMSA 2DHJA 2GCJA 2ELBA 2DHIA 2EMSA 2KCJA 2NMBA 4MT7A 2N23A 3SNHA 1UNRA 2Q13A 1QC6A 3FEHA 2FJLA 2W2XC 2I5CA 4IAPA 1I7AA 5D3XA 3KY9A 1TJ6A 2CODA 3ULBA 2D9WA 1OMWA 5KQ1A 1XD4A 2YF0A 4KVGB 1X86A 1EVHA 1XKEA 1I2HA 4DX8A 5DI9B 1DBHA 2UVMA 4HDQA 3KSYA 2COAA 4ZRJA 4A6FB 1W1GA 2ELAA 2OTXA 2P0FA 2Z0PA 2J59M 2DYNA 1NU2A 5D27A 1MIZB 2UZRA 5D3YA 3AU4A 4Z2MB 1E5WA 4NSWA 1ZSQA 1SHCA 5D3VA 2DX5A 2HTHB 3ULCA 3KRWA 1FHOA 1PFJA 1WVHA 2DLWA 3FSSA 1EF1A 1MK9B 3O96A 4GPTB 3TO1A 4ZRIA 4P7IA 2YVCA 2Y8GA 4MY6A 4DX90 1XCGA 3KZ1A 3TW1A 1NI2A 1KZ7A 1UNPA 2I1JA 3PVUA 2VSZA 1OY2A 3PVLA 1MKEA 3AU5A 2M38A 2DA0A 1OQNA 4K17A 5FI1A 2W2XD 3ODWA 2EC1A 2RNRB 2X18A 2DFKA 2YT1A 4GMVA 2H7DA 1Z87A 5FI0A 5J3YA 1FGZA 2IFSA 1FB8A 1J0WA 1H4RA 2V76A 3QIJA 2HE7A 5CLQB 2J0JA 4A6FA 2I5FA 3PSCA 5J3QA 4HB0B 3V5WA 5GOWB 2D9YA 4GN1A 4CHJA 1XODA 4HATB 1AWEA 1FAOA 3DXEA 2J0KA 4HAYB 2K2JA 4GXBA 2L2IA 1WGQA 2RVBB 1DDVA 3P6AA 3PG7A 4F7GA 2Y7BA 2COCA 1V89A 1Y19B 4Y94A 3D8EA 1J19A 4WJ7A 2BCJA 3WYFB 1H10A 1MIXA 4GMXB 3TCAA 4IOYX 2EJ8A 1WJMA 4C0AA 1U5DA 1V5MA 2GCLA 2RGNB 4HDOA 1P6SA 2I1KA 1KI1B 1EAZA 2D4QA 1B55A 2JP2A 4CYEA 2D11A 2MWNB 3TFMA 2DTCA 2YRYA 2Z0OA 4PNKA 1XX0A 1DYNA 2EMTA 3A98B 1X11A 1U5EA 2ROZB 1X1GA 3PVWA 4CHMA 3IVFA 3KRXA 4DXAB 3F0WA 2CY4A 1UEFA 2DKQA 4YL8A 1K5GB 4K2PA 2YS5A 3PZDA 4MK0A 2DHKA 1WG7A 4EMOA 1BTNA 2GJYA 2N0YA 1BAKA 1ZVRA 4HAWB 2QKLA 1M7RA 3RCPA 3WA0A 3FM8C 2CRFA 1LW3A 2MFQA 1V88A 3U8ZA 3CXBB 3ZDTA 1U5GA 2R0DA 1AQCA 1P5TA 1X05A 4TKNA 2DN6A 2VKIA 1ISNA 3PEGA 1X1FA 1W1DA 3BINA 2K2UA 3LJUX 2DKPA 3PP2A 3F5RA 5HE3A 5JHHA 3HW2B 4HHVA 1V5PA 4A5KA 2RSGA 4KAXB 1UNQA 2CY5A 1U27A 3P7ZA 5C5BA 2YSZA 4K2OA 3SUZA 2COFA 4HAVB 2KGXB 3VIAA 2AL6A 4YONA 2XQNM 4PQ0A 4B6HA 3D8DA 3QBVB 3QWMA 3CIKA 5JHGA 2DYQA 1ZC4B 2P0DA 1LB1A 2G35A 2D10A 1RRPB 1XR0B 1UPQA 4IFSA 5LONB 2UZSA 4L6EA 4F7UP 5D3WA 3G9WA 2OQBA 3NSUA 2H7EA 5EFXA 4EKUA 2AEHA 4BBKA 1Y5OA 3DXDA 4F7HA 2P0HA 1ZC3B 2D2QA 3A8PA 2YS1A 2PZ1A 1WGUA 2LOZA 2ROVA 2LG1A 2M14A 2GS0A 1V5UA 2R09A 1GG3A 4GZUA 1W1HA 2ZPYA 5C5BB 1DDMA 1MAIA 4Z2NA 1GC7A 3SYXA 2D9ZA 5C6RA 2ADZA 1QQGA 2W2WA 3GYPA 1WJ1A 1ZM0A 3ML4A 2MKRA 2IYBA 3VOQA 5C16A 4H8SA 1RJ2A 1GC6A 1DROA 3HQCA 5DIFB 3X23A 3UZTA 5C79A 2D9VA 2J0MA 2RLOA 5KCVA 2VRWB 1FHXA 3ZVRA 4HB4B 1P3RA 2LKOA 1MPHA 1UPRA 5CLLB 2LOXA 2RUKB 2K00A 1M7EA 2CAYA 2LULA 2LYDA 2E2XA 5HE0A 1U5FA 4KHBB 1Q67A 3TVVA 4A6HA 4KHOA 2QKMA 3MPXA 2KUPA 3D8FA 2P8VA 3N7CA 5DHAB 1BTKA 3SV1A 5L81A 2YS3A 4XWXA 4ZRKA 3ODXA 1TQZA 3MDBC 1IRSA 4WSFA 2DX1A 1BWNA 1NTVA 1N3HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KZG A;  4HB2 B;  4HAZ B;  4WVF B;  1V61 A;  5JP4 A;  4HAU B;  3A8Q A;  1U2B A;  2Z0Q A;  1PLS A;  1NTY A;  1K5D B;  1DDW A;  2D9X A;  5LOP B;  3BJI A;  4HAX B;  4HB3 B;  1EGX A;  5DH9 B;  3OAN A;  4EJN A;  3GYO A;  3HK0 A;  4NY0 A;  1TXD A;  3DXC A;  3ODO A;  2YT0 A;  2Y8F A;  4DBB A;  3U7D A;  2MDX A;  4KHA A;  3M1I B;  5HE1 A;  1FHW A;  1U29 A;  4K81 A;  1FOE A;  3SO6 A;  4D0N B;  1MK7 B;  5J3T A;  2NZ8 B;  1FGY A;  3T06 A;  3AJ4 A;  1WI1 A;  4TYZ A;  5DHF B;  1SGH A;  4A6K A;  5JLJ B;  5KQ4 A;  5HE2 A;  2L1C A;  1PMS A;  2DHJ A;  2GCJ A;  2ELB A;  2DHI A;  2EMS A;  2KCJ A;  2NMB A;  4MT7 A;  2N23 A;  3SNH A;  1UNR A;  2Q13 A;  1QC6 A;  3FEH A;  2FJL A;  2W2X C;  2I5C A;  4IAP A;  1I7A A;  5D3X A;  3KY9 A;  1TJ6 A;  2COD A;  3ULB A;  2D9W A;  1OMW A;  5KQ1 A;  1XD4 A;  2YF0 A;  4KVG B;  1X86 A;  1EVH A;  1XKE A;  1I2H A;  4DX8 A;  5DI9 B;  1DBH A;  2UVM A;  4HDQ A;  3KSY A;  2COA A;  4ZRJ A;  4A6F B;  1W1G A;  2ELA A;  2OTX A;  2P0F A;  2Z0P A;  2J59 M;  2DYN A;  1NU2 A;  5D27 A;  1MIZ B;  2UZR A;  5D3Y A;  3AU4 A;  4Z2M B;  1E5W A;  4NSW A;  1ZSQ A;  1SHC A;  5D3V A;  2DX5 A;  2HTH B;  3ULC A;  3KRW A;  1FHO A;  1PFJ A;  1WVH A;  2DLW A;  3FSS A;  1EF1 A;  1MK9 B;  3O96 A;  4GPT B;  3TO1 A;  4ZRI A;  4P7I A;  2YVC A;  2Y8G A;  4MY6 A;  4DX9 0;  1XCG A;  3KZ1 A;  3TW1 A;  1NI2 A;  1KZ7 A;  1UNP A;  2I1J A;  3PVU A;  2VSZ A;  1OY2 A;  3PVL A;  1MKE A;  3AU5 A;  2M38 A;  2DA0 A;  1OQN A;  4K17 A;  5FI1 A;  2W2X D;  3ODW A;  2EC1 A;  2RNR B;  2X18 A;  2DFK A;  2YT1 A;  4GMV A;  2H7D A;  1Z87 A;  5FI0 A;  5J3Y A;  1FGZ A;  2IFS A;  1FB8 A;  1J0W A;  1H4R A;  2V76 A;  3QIJ A;  2HE7 A;  5CLQ B;  2J0J A;  4A6F A;  2I5F A;  3PSC A;  5J3Q A;  4HB0 B;  3V5W A;  5GOW B;  2D9Y A;  4GN1 A;  4CHJ A;  1XOD A;  4HAT B;  1AWE A;  1FAO A;  3DXE A;  2J0K A;  4HAY B;  2K2J A;  4GXB A;  2L2I A;  1WGQ A;  2RVB B;  1DDV A;  3P6A A;  3PG7 A;  4F7G A;  2Y7B A;  2COC A;  1V89 A;  1Y19 B;  4Y94 A;  3D8E A;  1J19 A;  4WJ7 A;  2BCJ A;  3WYF B;  1H10 A;  1MIX A;  4GMX B;  3TCA A;  4IOY X;  2EJ8 A;  1WJM A;  4C0A A;  1U5D A;  1V5M A;  2GCL A;  2RGN B;  4HDO A;  1P6S A;  2I1K A;  1KI1 B;  1EAZ A;  2D4Q A;  1B55 A;  2JP2 A;  4CYE A;  2D11 A;  2MWN B;  3TFM A;  2DTC A;  2YRY A;  2Z0O A;  4PNK A;  1XX0 A;  1DYN A;  2EMT A;  3A98 B;  1X11 A;  1U5E A;  2ROZ B;  1X1G A;  3PVW A;  4CHM A;  3IVF A;  3KRX A;  4DXA B;  3F0W A;  2CY4 A;  1UEF A;  2DKQ A;  4YL8 A;  1K5G B;  4K2P A;  2YS5 A;  3PZD A;  4MK0 A;  2DHK A;  1WG7 A;  4EMO A;  1BTN A;  2GJY A;  2N0Y A;  1BAK A;  1ZVR A;  4HAW B;  2QKL A;  1M7R A;  3RCP A;  3WA0 A;  3FM8 C;  2CRF A;  1LW3 A;  2MFQ A;  1V88 A;  3U8Z A;  3CXB B;  3ZDT A;  1U5G A;  2R0D A;  1AQC A;  1P5T A;  1X05 A;  4TKN A;  2DN6 A;  2VKI A;  1ISN A;  3PEG A;  1X1F A;  1W1D A;  3BIN A;  2K2U A;  3LJU X;  2DKP A;  3PP2 A;  3F5R A;  5HE3 A;  5JHH A;  3HW2 B;  4HHV A;  1V5P A;  4A5K A;  2RSG A;  4KAX B;  1UNQ A;  2CY5 A;  1U27 A;  3P7Z A;  5C5B A;  2YSZ A;  4K2O A;  3SUZ A;  2COF A;  4HAV B;  2KGX B;  3VIA A;  2AL6 A;  4YON A;  2XQN M;  4PQ0 A;  4B6H A;  3D8D A;  3QBV B;  3QWM A;  3CIK A;  5JHG A;  2DYQ A;  1ZC4 B;  2P0D A;  1LB1 A;  2G35 A;  2D10 A;  1RRP B;  1XR0 B;  1UPQ A;  4IFS A;  5LON B;  2UZS A;  4L6E A;  4F7U P;  5D3W A;  3G9W A;  2OQB A;  3NSU A;  2H7E A;  5EFX A;  4EKU A;  2AEH A;  4BBK A;  1Y5O A;  3DXD A;  4F7H A;  2P0H A;  1ZC3 B;  2D2Q A;  3A8P A;  2YS1 A;  2PZ1 A;  1WGU A;  2LOZ A;  2ROV A;  2LG1 A;  2M14 A;  2GS0 A;  1V5U A;  2R09 A;  1GG3 A;  4GZU A;  1W1H A;  2ZPY A;  5C5B B;  1DDM A;  1MAI A;  4Z2N A;  1GC7 A;  3SYX A;  2D9Z A;  5C6R A;  2ADZ A;  1QQG A;  2W2W A;  3GYP A;  1WJ1 A;  1ZM0 A;  3ML4 A;  2MKR A;  2IYB A;  3VOQ A;  5C16 A;  4H8S A;  1RJ2 A;  1GC6 A;  1DRO A;  3HQC A;  5DIF B;  3X23 A;  3UZT A;  5C79 A;  2D9V A;  2J0M A;  2RLO A;  5KCV A;  2VRW B;  1FHX A;  3ZVR A;  4HB4 B;  1P3R A;  2LKO A;  1MPH A;  1UPR A;  5CLL B;  2LOX A;  2RUK B;  2K00 A;  1M7E A;  2CAY A;  2LUL A;  2LYD A;  2E2X A;  5HE0 A;  1U5F A;  4KHB B;  1Q67 A;  3TVV A;  4A6H A;  4KHO A;  2QKM A;  3MPX A;  2KUP A;  3D8F A;  2P8V A;  3N7C A;  5DHA B;  1BTK A;  3SV1 A;  5L81 A;  2YS3 A;  4XWX A;  4ZRK A;  3ODX A;  1TQZ A;  3MDB C;  1IRS A;  4WSF A;  2DX1 A;  1BWN A;  1NTV A;  1N3H A; 
#chains in the Genus database with same CATH topology
 1KZG A;  4HB2 B;  4HAZ B;  4WVF B;  2RRF A;  1V61 A;  5JP4 A;  4HAU B;  3A8Q A;  1U2B A;  2Z0Q A;  5LG4 B;  1PLS A;  1NTY A;  2K49 A;  2GUM A;  1K5D B;  1DDW A;  2D9X A;  5LOP B;  3BJI A;  4HAX B;  4HB3 B;  1EGX A;  2Z4D A;  5DH9 B;  3OAN A;  4CSQ A;  4EJN A;  3GYO A;  3HK0 A;  4NY0 A;  1TXD A;  3DXC A;  3ODO A;  2YT0 A;  2Y8F A;  4DBB A;  3U7D A;  3FVC A;  3HSA A;  2MDX A;  4KHA A;  3M1I B;  5HE1 A;  4GOU A;  1FHW A;  1U29 A;  4K81 A;  1FOE A;  3SO6 A;  4D0N B;  1MK7 B;  5J3T A;  2NZ8 B;  1FGY A;  3T06 A;  3AJ4 A;  1WI1 A;  4TYZ A;  2FJU B;  5DHF B;  1SGH A;  4A6K A;  5JLJ B;  5KQ4 A;  5HE2 A;  2L1C A;  1PMS A;  2DHJ A;  2GCJ A;  2ELB A;  2DHI A;  2EMS A;  2KCJ A;  2NMB A;  4MT7 A;  2N23 A;  3SNH A;  1UNR A;  2Q13 A;  1QC6 A;  3FEH A;  2FJL A;  2W2X C;  2I5C A;  4IAP A;  1I7A A;  5D3X A;  3KY9 A;  1TJ6 A;  2COD A;  3ULB A;  2D9W A;  1OMW A;  5KQ1 A;  1XD4 A;  2YF0 A;  4KVG B;  3NW8 A;  1X86 A;  1EVH A;  1XKE A;  1I2H A;  3DCX A;  4DX8 A;  4D6W A;  5DI9 B;  1DBH A;  2UVM A;  4HDQ A;  2ZKM X;  3KSY A;  2COA A;  4ZRJ A;  4A6F B;  1W1G A;  2ELA A;  2OTX A;  2P0F A;  2Z0P A;  4HSI A;  2J59 M;  2DYN A;  1NU2 A;  5D27 A;  1MIZ B;  2UZR A;  5D3Y A;  3AU4 A;  4Z2M B;  2Z59 A;  1E5W A;  4NSW A;  1ZSQ A;  1SHC A;  5D3V A;  2DX5 A;  2HTH B;  3ULC A;  3KRW A;  2NBV A;  1FHO A;  1PFJ A;  1WVH A;  2DLW A;  3FSS A;  1EF1 A;  1MK9 B;  3O96 A;  4GPT B;  3TO1 A;  4ZRI A;  4P7I A;  2YVC A;  2Y8G A;  4MY6 A;  4DX9 0;  1XCG A;  3KZ1 A;  3TW1 A;  1NI2 A;  1KZ7 A;  1UNP A;  2I1J A;  2KR0 A;  3PVU A;  2VSZ A;  1OY2 A;  3PVL A;  1MKE A;  3AU5 A;  2M38 A;  2DA0 A;  1OQN A;  4K17 A;  2KUQ A;  5FI1 A;  2W2X D;  5I2M A;  3ODW A;  2EC1 A;  2RNR B;  2X18 A;  2DFK A;  2YT1 A;  4GMV A;  2H7D A;  3U12 A;  1Z87 A;  5FI0 A;  5J3Y A;  1FGZ A;  2IFS A;  1FB8 A;  1J0W A;  1H4R A;  2V76 A;  3QIJ A;  2HE7 A;  5CLQ B;  2J0J A;  4A6F A;  2I5F A;  3PSC A;  5J3Q A;  1MI1 A;  4HB0 B;  3V5W A;  5GOW B;  2D9Y A;  4GN1 A;  4CHJ A;  1XOD A;  4HAT B;  1AWE A;  1FAO A;  3DXE A;  2J0K A;  4HAY B;  2K2J A;  4GXB A;  2L2I A;  1WGQ A;  2RVB B;  1DDV A;  3P6A A;  2Z14 A;  3PG7 A;  4F7G A;  2Y7B A;  2COC A;  1V89 A;  1Y19 B;  4Y94 A;  3D8E A;  1J19 A;  4WJ7 A;  2BCJ A;  3WYF B;  1H10 A;  3HIE A;  1MIX A;  4GMX B;  2R2Y A;  3TCA A;  4IOY X;  2EJ8 A;  1WJM A;  4C0A A;  1U5D A;  1V5M A;  2GCL A;  2RGN B;  5I2S A;  4HDO A;  1P6S A;  2I1K A;  1KI1 B;  1EAZ A;  2KIE A;  2D4Q A;  1B55 A;  2JP2 A;  4CYE A;  2D11 A;  2MWN B;  3TFM A;  2DTC A;  2YRY A;  2Z0O A;  4PNK A;  1XX0 A;  1DYN A;  2EMT A;  3A98 B;  1ZYI A;  1X11 A;  1U5E A;  2ROZ B;  1X1G A;  3PVW A;  4CHM A;  3IVF A;  3KRX A;  4DXA B;  3F0W A;  2CY4 A;  1UEF A;  2DKQ A;  5M4Y B;  4YL8 A;  1K5G B;  4K2P A;  2YS5 A;  3PZD A;  2KIG A;  3OHM B;  4MK0 A;  2DHK A;  1WG7 A;  4EMO A;  1BTN A;  2GJY A;  2N0Y A;  2Z13 A;  1BAK A;  1ZVR A;  4HAW B;  2QKL A;  1M7R A;  3RCP A;  3WA0 A;  3FM8 C;  2CRF A;  1LW3 A;  2MFQ A;  1V88 A;  3U8Z A;  3CXB B;  3ZDT A;  1U5G A;  2R0D A;  1AQC A;  1P5T A;  3B77 A;  1X05 A;  4TKN A;  2DN6 A;  2VKI A;  4OSN A;  1ISN A;  3PEG A;  1X1F A;  1W1D A;  3BIN A;  2K2U A;  3LJU X;  2DKP A;  3PP2 A;  3F5R A;  5HE3 A;  4QJ4 B;  5JHH A;  3HW2 B;  4HHV A;  1V5P A;  4A5K A;  2RSG A;  4KAX B;  1UNQ A;  2CY5 A;  1U27 A;  3P7Z A;  4QXA B;  2YSZ A;  5C5B A;  4K2O A;  3SUZ A;  2COF A;  4HAV B;  2KGX B;  5IRS A;  3VIA A;  2AL6 A;  4YON A;  2XQN M;  4PQ0 A;  4B6H A;  3D8D A;  3QBV B;  3QWM A;  3CIK A;  5JHG A;  2DYQ A;  1ZC4 B;  2P0D A;  1LB1 A;  2G35 A;  2D10 A;  2K8E A;  1RRP B;  1XR0 B;  1UPQ A;  4IFS A;  5LON B;  2UZS A;  4L6E A;  4F7U P;  5D3W A;  3G9W A;  2OQB A;  2H7E A;  3NSU A;  5EFX A;  4EKU A;  2AEH A;  4BBK A;  1Y5O A;  3DXD A;  4F7H A;  2P0H A;  2YT2 A;  1ZC3 B;  2D2Q A;  3A8P A;  2YS1 A;  2PZ1 A;  1WGU A;  2LOZ A;  2ROV A;  2LG1 A;  2M14 A;  2GS0 A;  4L1R A;  3NWD A;  1V5U A;  2R09 A;  1GG3 A;  3NWA A;  4GZU A;  4KHB A;  1W1H A;  2ZPY A;  5C5B B;  1DDM A;  1MAI A;  4Z2N A;  1GC7 A;  3SYX A;  2D9Z A;  5C6R A;  3A58 A;  2ADZ A;  4OT1 A;  1QQG A;  2W2W A;  3GYP A;  1WJ1 A;  1ZM0 A;  3ML4 A;  4QJ3 B;  2MKR A;  4DIX A;  2IYB A;  3VOQ A;  5C16 A;  4H8S A;  1RJ2 A;  1GC6 A;  1DRO A;  3HQC A;  5DIF B;  3X23 A;  3UZT A;  5C79 A;  2D9V A;  2J0M A;  2RLO A;  3NWF A;  5KCV A;  2VRW B;  1FHX A;  3ZVR A;  4HB4 B;  1P3R A;  2LKO A;  1MPH A;  1UPR A;  5CLL B;  2LOX A;  2RUK B;  2K00 A;  1M7E A;  2CAY A;  2LUL A;  2LYD A;  2E2X A;  5HE0 A;  1U5F A;  4KHB B;  1Q67 A;  3TVV A;  4A6H A;  4KHO A;  4QJ5 B;  2QKM A;  3MPX A;  2KUP A;  3D8F A;  2P8V A;  3N7C A;  5DHA B;  1BTK A;  3SV1 A;  1T77 A;  5L81 A;  2YS3 A;  4XWX A;  4ZRK A;  3ODX A;  1TQZ A;  3MDB C;  1IRS A;  4WSF A;  4GNK B;  2DX1 A;  1BWN A;  1NTV A;  1N3H A; 
#chains in the Genus database with same CATH homology
 1KZG A;  4HB2 B;  4HAZ B;  4WVF B;  1V61 A;  5JP4 A;  4HAU B;  3A8Q A;  1U2B A;  2Z0Q A;  1PLS A;  1NTY A;  1K5D B;  1DDW A;  2D9X A;  5LOP B;  3BJI A;  4HAX B;  4HB3 B;  1EGX A;  5DH9 B;  3OAN A;  4EJN A;  3GYO A;  3HK0 A;  4NY0 A;  1TXD A;  3DXC A;  3ODO A;  2YT0 A;  2Y8F A;  4DBB A;  3U7D A;  2MDX A;  4KHA A;  3M1I B;  5HE1 A;  1FHW A;  1U29 A;  4K81 A;  1FOE A;  3SO6 A;  4D0N B;  1MK7 B;  5J3T A;  2NZ8 B;  1FGY A;  3T06 A;  3AJ4 A;  1WI1 A;  4TYZ A;  5DHF B;  1SGH A;  4A6K A;  5JLJ B;  5KQ4 A;  5HE2 A;  2L1C A;  1PMS A;  2DHJ A;  2GCJ A;  2ELB A;  2DHI A;  2EMS A;  2KCJ A;  2NMB A;  4MT7 A;  2N23 A;  3SNH A;  1UNR A;  2Q13 A;  1QC6 A;  3FEH A;  2FJL A;  2W2X C;  2I5C A;  4IAP A;  1I7A A;  5D3X A;  3KY9 A;  1TJ6 A;  2COD A;  3ULB A;  2D9W A;  1OMW A;  5KQ1 A;  1XD4 A;  2YF0 A;  4KVG B;  1X86 A;  1EVH A;  1XKE A;  1I2H A;  4DX8 A;  5DI9 B;  1DBH A;  2UVM A;  4HDQ A;  3KSY A;  2COA A;  4ZRJ A;  4A6F B;  1W1G A;  2ELA A;  2OTX A;  2P0F A;  2Z0P A;  2J59 M;  2DYN A;  1NU2 A;  5D27 A;  1MIZ B;  2UZR A;  5D3Y A;  3AU4 A;  4Z2M B;  1E5W A;  4NSW A;  1ZSQ A;  1SHC A;  5D3V A;  2DX5 A;  2HTH B;  3ULC A;  3KRW A;  1FHO A;  1PFJ A;  1WVH A;  2DLW A;  3FSS A;  1EF1 A;  1MK9 B;  3O96 A;  4GPT B;  3TO1 A;  4ZRI A;  4P7I A;  2YVC A;  2Y8G A;  4MY6 A;  4DX9 0;  1XCG A;  3KZ1 A;  3TW1 A;  1NI2 A;  1KZ7 A;  1UNP A;  2I1J A;  3PVU A;  2VSZ A;  1OY2 A;  3PVL A;  1MKE A;  3AU5 A;  2M38 A;  2DA0 A;  1OQN A;  4K17 A;  5FI1 A;  2W2X D;  3ODW A;  2EC1 A;  2RNR B;  2X18 A;  2DFK A;  2YT1 A;  4GMV A;  2H7D A;  1Z87 A;  5FI0 A;  5J3Y A;  1FGZ A;  2IFS A;  1FB8 A;  1J0W A;  1H4R A;  2V76 A;  3QIJ A;  2HE7 A;  5CLQ B;  2J0J A;  4A6F A;  2I5F A;  3PSC A;  5J3Q A;  4HB0 B;  3V5W A;  5GOW B;  2D9Y A;  4GN1 A;  4CHJ A;  1XOD A;  4HAT B;  1AWE A;  1FAO A;  3DXE A;  2J0K A;  4HAY B;  2K2J A;  4GXB A;  2L2I A;  1WGQ A;  2RVB B;  1DDV A;  3P6A A;  3PG7 A;  4F7G A;  2Y7B A;  2COC A;  1V89 A;  1Y19 B;  4Y94 A;  3D8E A;  1J19 A;  4WJ7 A;  2BCJ A;  3WYF B;  1H10 A;  1MIX A;  4GMX B;  3TCA A;  4IOY X;  2EJ8 A;  1WJM A;  4C0A A;  1U5D A;  1V5M A;  2GCL A;  2RGN B;  4HDO A;  1P6S A;  2I1K A;  1KI1 B;  1EAZ A;  2D4Q A;  1B55 A;  2JP2 A;  4CYE A;  2D11 A;  2MWN B;  3TFM A;  2DTC A;  2YRY A;  2Z0O A;  4PNK A;  1XX0 A;  1DYN A;  2EMT A;  3A98 B;  1X11 A;  1U5E A;  2ROZ B;  1X1G A;  3PVW A;  4CHM A;  3IVF A;  3KRX A;  4DXA B;  3F0W A;  2CY4 A;  1UEF A;  2DKQ A;  4YL8 A;  1K5G B;  4K2P A;  2YS5 A;  3PZD A;  4MK0 A;  2DHK A;  1WG7 A;  4EMO A;  1BTN A;  2GJY A;  2N0Y A;  1BAK A;  1ZVR A;  4HAW B;  2QKL A;  1M7R A;  3RCP A;  3WA0 A;  3FM8 C;  2CRF A;  1LW3 A;  2MFQ A;  1V88 A;  3U8Z A;  3CXB B;  3ZDT A;  1U5G A;  2R0D A;  1AQC A;  1P5T A;  1X05 A;  4TKN A;  2DN6 A;  2VKI A;  1ISN A;  3PEG A;  1X1F A;  1W1D A;  3BIN A;  2K2U A;  3LJU X;  2DKP A;  3PP2 A;  3F5R A;  5HE3 A;  5JHH A;  3HW2 B;  4HHV A;  1V5P A;  4A5K A;  2RSG A;  4KAX B;  1UNQ A;  2CY5 A;  1U27 A;  3P7Z A;  5C5B A;  2YSZ A;  4K2O A;  3SUZ A;  2COF A;  4HAV B;  2KGX B;  3VIA A;  2AL6 A;  4YON A;  2XQN M;  4PQ0 A;  4B6H A;  3D8D A;  3QBV B;  3QWM A;  3CIK A;  5JHG A;  2DYQ A;  1ZC4 B;  2P0D A;  1LB1 A;  2G35 A;  2D10 A;  1RRP B;  1XR0 B;  1UPQ A;  4IFS A;  5LON B;  2UZS A;  4L6E A;  4F7U P;  5D3W A;  3G9W A;  2OQB A;  3NSU A;  2H7E A;  5EFX A;  4EKU A;  2AEH A;  4BBK A;  1Y5O A;  3DXD A;  4F7H A;  2P0H A;  1ZC3 B;  2D2Q A;  3A8P A;  2YS1 A;  2PZ1 A;  1WGU A;  2LOZ A;  2ROV A;  2LG1 A;  2M14 A;  2GS0 A;  1V5U A;  2R09 A;  1GG3 A;  4GZU A;  1W1H A;  2ZPY A;  5C5B B;  1DDM A;  1MAI A;  4Z2N A;  1GC7 A;  3SYX A;  2D9Z A;  5C6R A;  2ADZ A;  1QQG A;  2W2W A;  3GYP A;  1WJ1 A;  1ZM0 A;  3ML4 A;  2MKR A;  2IYB A;  3VOQ A;  5C16 A;  4H8S A;  1RJ2 A;  1GC6 A;  1DRO A;  3HQC A;  5DIF B;  3X23 A;  3UZT A;  5C79 A;  2D9V A;  2J0M A;  2RLO A;  5KCV A;  2VRW B;  1FHX A;  3ZVR A;  4HB4 B;  1P3R A;  2LKO A;  1MPH A;  1UPR A;  5CLL B;  2LOX A;  2RUK B;  2K00 A;  1M7E A;  2CAY A;  2LUL A;  2LYD A;  2E2X A;  5HE0 A;  1U5F A;  4KHB B;  1Q67 A;  3TVV A;  4A6H A;  4KHO A;  2QKM A;  3MPX A;  2KUP A;  3D8F A;  2P8V A;  3N7C A;  5DHA B;  1BTK A;  3SV1 A;  5L81 A;  2YS3 A;  4XWX A;  4ZRK A;  3ODX A;  1TQZ A;  3MDB C;  1IRS A;  4WSF A;  2DX1 A;  1BWN A;  1NTV A;  1N3H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...