1QC6A

Evh1 domain from ena/vasp-like protein in complex with acta peptide
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
113
structure length
108
Chain Sequence
MSEQSICQARASVMVYDDTSKKWVPIKFSRINIYHNTASSTFRVVGVKLQDQQVVINYSIVKGLKYNQATPTFHQWRDARQVYGLNFASKEEATTFSNAMLFALNIMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of EVH1, a novel proline-rich ligand-binding module involved in cytoskeletal dynamics and neural function
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein
molecule keywords EVH1 DOMAIN FROM ENA/VASP-LIKE PROTEIN
total genus 20
structure length 108
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1qc6A00
1XX0A 4K81A 2J0MA 4L6EA 3KRWA 2COFA 5LONB 1U5DA 1WG7A 1WGQA 4DBBA 3F0WA 2FJLA 1MIZB 2M38A 1H10A 1QQGA 1X1GA 4Y94A 1ZVRA 4DX8A 1X05A 2EJ8A 1V5UA 2N23A 2LOXA 3VOQA 4HDQA 1XODA 2NZ8B 3N7CA 2MDXA 1B55A 3TW1A 4HAUB 4HAWB 5D3YA 2LG1A 1WJMA 4CYEA 2AL6A 1V61A 1BTKA 1BWNA 3HK0A 5J3YA 5EFXA 2YS5A 1ZC3B 4BBKA 1U2BA 4MK0A 2MWNB 1Z87A 1MK9B 4HDOA 1P6SA 2H7DA 1DDWA 1U5EA 2DA0A 3OANA 4HATB 4F7GA 2XQNM 1U5FA 1NI2A 2D2QA 3PEGA 3U8ZA 2Y7BA 3TCAA 2CY4A 2GCJA 4IAPA 5KQ4A 2DHKA 2D10A 5D3VA 1DROA 2ROVA 5C16A 4MT7A 2I1JA 2ADZA 3CIKA 3UZTA 4A5KA 5KQ1A 1MAIA 4IOYX 5C5BA 1E5WA 3QWMA 2DN6A 2ZPYA 1LW3A 3GYPA 4K17A 3KZ1A 2R0DA 2DX1A 4HAVB 3D8DA 4HB2B 1OQNA 2RGNB 1KI1B 1Y19B 2ELBA 2UVMA 4KHAA 1FAOA 3PSCA 3ZVRA 1UPQA 1FHOA 4PNKA 1FGYA 4HAXB 2Y8GA 4A6FB 4GMXB 2HTHB 2L2IA 1GC7A 2P8VA 3O96A 3ULCA 2J59M 2I5CA 5DHFB 2QKLA 3ODWA 3AU4A 1WGUA 1WI1A 2BCJA 2K00A 3DXDA 1WJ1A 5GOWB 5JHHA 2GS0A 2IYBA 2YT1A 5HE0A 1N3HA 3PVLA 1J0WA 1DDMA 5JLJB 1I7AA 2VRWB 5J3TA 4F7HA 1SHCA 3PG7A 5FI1A 1P3RA 2EMSA 4ZRJA 4KHBB 3D8EA 5CLQB 1K5GB 2DKQA 3TO1A 4NSWA 3A8QA 5L81A 2X18A 2M14A 2K2UA 1EF1A 4HB4B 4GXBA 2L1CA 2D4QA 4MY6A 2I1KA 3RCPA 1AQCA 2P0HA 4HAZB 2D11A 4DX90 2MFQA 1XCGA 5CLLB 2LOZA 3PZDA 2EC1A 1FOEA 3A8PA 3HQCA 4GPTB 3LJUX 4YL8A 2E2XA 2J0KA 3TFMA 3ZDTA 4KAXB 1AWEA 2YSZA 1KZ7A 1FB8A 1SGHA 1U27A 3V5WA 2DTCA 2P0DA 1RRPB 5DI9B 4TKNA 1PFJA 1NU2A 3BINA 2COCA 4A6HA 2COAA 2ELAA 4D0NB 3AU5A 5HE1A 3GYOA 4Z2MB 1PMSA 4IFSA 5LOPB 2HE7A 1RJ2A 3FEHA 2UZRA 3IVFA 5DHAB 4HAYB 2J0JA 1UPRA 4HB0B 2CRFA 2Y8FA 4NY0A 1V5MA 1DDVA 3BJIA 5C6RA 4A6KA 1ISNA 2IFSA 2ROZB 4P7IA 4CHJA 2D9VA 1FGZA 2DX5A 4H8SA 4ZRIA 4A6FA 3U7DA 2DYQA 5D27A 1ZSQA 2R09A 2H7EA 4ZRKA 1MK7B 4EJNA 1GG3A 4KVGB 1TXDA 1IRSA 2LYDA 2Q13A 1V5PA 2D9YA 1PLSA 1ZM0A 4F7UP 2YF0A 3PVUA 3CXBB 2N0YA 1V89A 1XKEA 1TJ6A 4HB3B 2KUPA 2G35A 2GJYA 2RLOA 1OY2A 4KHOA 1MKEA 4EMOA 2YT0A 5D3XA 1NTVA 3PP2A 2UZSA 2RSGA 4WJ7A 2JP2A 1FHXA 5DIFB 3AJ4A 1W1DA 2Z0PA 2P0FA 1OMWA 3MDBC 2DHIA 3PVWA 3P6AA 2Z0QA 1P5TA 2K2JA 4CHMA 4GMVA 5C5BB 1XD4A 2OTXA 3ODXA 2VKIA 5DH9B 2QKMA 4GZUA 2I5FA 1H4RA 4EKUA 4Z2NA 2GCLA 2W2XC 1BAKA 1I2HA 2D9WA 3MPXA 3DXEA 3SUZA 1UNRA 1U5GA 2YRYA 3KRXA 3ULBA 1X11A 2MKRA 1XR0B 1M7EA 2DFKA 1QC6A 2V76A 1W1HA 3SV1A 2EMTA 1NTYA 3T06A 3FM8C 2KGXB 3G9WA 2OQBA 4WVFB 2RNRB 2YS1A 3VIAA 1ZC4B 2AEHA 2W2WA 3WYFB 3WA0A 2YS3A 1WVHA 1LB1A 1K5DB 2CAYA 3F5RA 4XWXA 2D9ZA 1GC6A 4K2PA 3NSUA 4TYZA 2PZ1A 3KSYA 1Q67A 4HHVA 4WSFA 2DKPA 3QBVB 2KCJA 2CODA 1W1GA 1EAZA 5J3QA 2D9XA 5FI0A 3SYXA 2DYNA 1EGXA 2RVBB 4K2OA 3SNHA 4PQ0A 4DXAB 5D3WA 1DBHA 1TQZA 3TVVA 1BTNA 2DHJA 2NMBA 1M7RA 3M1IB 1J19A 3P7ZA 1UNQA 2RUKB 2LKOA 1X1FA 3SO6A 1MIXA 3KY9A 2Z0OA 3FSSA 1V88A 5HE3A 1Y5OA 1X86A 1KZGA 5C79A 3A98B 5HE2A 2CY5A 5KCVA 2VSZA 1DYNA 1MPHA 2W2XD 5JHGA 1EVHA 1UEFA 2DLWA 3QIJA 2LULA 3D8FA 2YVCA 3ODOA 3X23A 1U29A 5JP4A 3HW2B 3ML4A 4C0AA 4GN1A 1UNPA 3DXCA 4YONA 4B6HA 1FHWA
chains in the Genus database with same CATH superfamily
1XX0A 4K81A 2J0MA 4QXAB 4L6EA 3KRWA 2COFA 5LONB 1U5DA 1WG7A 1WGQA 4DBBA 3F0WA 2FJLA 1MIZB 2M38A 4GOUA 1H10A 1QQGA 4QJ3B 1X1GA 4Y94A 1ZVRA 4DX8A 1X05A 2EJ8A 2GUMA 1V5UA 4QJ4B 4GNKB 2N23A 2LOXA 3VOQA 4HDQA 1XODA 2NZ8B 3N7CA 5M4YB 2MDXA 1B55A 3TW1A 4HAUB 4HAWB 5D3YA 2LG1A 1WJMA 2K49A 4CYEA 2AL6A 1V61A 1BTKA 1BWNA 3HK0A 5J3YA 5EFXA 2YS5A 1ZC3B 4BBKA 1U2BA 4MK0A 2MWNB 1Z87A 1MK9B 4HDOA 1P6SA 2H7DA 1DDWA 1U5EA 2DA0A 3OANA 4HATB 4F7GA 2XQNM 1U5FA 1NI2A 2D2QA 1ZYIA 3PEGA 3U8ZA 2Y7BA 3TCAA 2CY4A 2GCJA 4IAPA 5KQ4A 2DHKA 2D10A 5D3VA 1DROA 1MI1A 2ROVA 5C16A 4MT7A 2I1JA 2ADZA 3CIKA 3UZTA 4A5KA 5KQ1A 1MAIA 4IOYX 5C5BA 1E5WA 3QWMA 2DN6A 2ZPYA 1LW3A 3GYPA 4K17A 3KZ1A 2R0DA 2DX1A 5I2MA 4HAVB 3D8DA 3OHMB 4D6WA 4HB2B 1OQNA 2RGNB 1KI1B 1Y19B 2ELBA 2UVMA 4KHAA 1FAOA 3PSCA 3ZVRA 1UPQA 1FHOA 4PNKA 1FGYA 3FVCA 4HAXB 2Y8GA 4A6FB 4GMXB 2HTHB 2L2IA 1GC7A 2P8VA 3A58A 3O96A 3ULCA 2J59M 2I5CA 5DHFB 2QKLA 3ODWA 3AU4A 1WGUA 1WI1A 2RRFA 2BCJA 2K00A 3DXDA 1WJ1A 5GOWB 5JHHA 3HSAA 2GS0A 2IYBA 2YT1A 5HE0A 1N3HA 3PVLA 1J0WA 1DDMA 5JLJB 1I7AA 2VRWB 5J3TA 4F7HA 1SHCA 3PG7A 5FI1A 1P3RA 2EMSA 4ZRJA 4KHBB 3D8EA 5CLQB 3NWFA 1K5GB 2DKQA 3TO1A 4NSWA 3A8QA 5L81A 2X18A 2M14A 2K2UA 1EF1A 4HB4B 4GXBA 2L1CA 2D4QA 4MY6A 2I1KA 3RCPA 1AQCA 2P0HA 4HAZB 2D11A 4DX90 2MFQA 2NBVA 1XCGA 5CLLB 2LOZA 3B77A 5I2SA 3PZDA 2EC1A 1FOEA 3A8PA 3HQCA 4GPTB 4KHBA 4L1RA 3LJUX 4YL8A 2E2XA 2J0KA 3TFMA 3ZDTA 4KAXB 2YT2A 1AWEA 2YSZA 1KZ7A 1FB8A 1SGHA 1U27A 3V5WA 2DTCA 2P0DA 1RRPB 5DI9B 4TKNA 1PFJA 1NU2A 2ZKMX 2COCA 3BINA 4A6HA 2Z14A 2COAA 2ELAA 4D0NB 3AU5A 5HE1A 3GYOA 4Z2MB 1PMSA 4IFSA 5LOPB 2HE7A 1RJ2A 3FEHA 2UZRA 3IVFA 5DHAB 4HAYB 2J0JA 4QJ5B 1UPRA 4HB0B 2CRFA 2Y8FA 2K8EA 4NY0A 1V5MA 1DDVA 3BJIA 5C6RA 4A6KA 1ISNA 2IFSA 2ROZB 4P7IA 4CHJA 2D9VA 1FGZA 2DX5A 4H8SA 4ZRIA 4A6FA 3U7DA 2DYQA 5D27A 1ZSQA 2R09A 2H7EA 4ZRKA 1MK7B 4EJNA 1GG3A 4KVGB 1TXDA 1IRSA 4OSNA 2LYDA 2Q13A 2KR0A 1V5PA 2D9YA 2FJUB 1PLSA 1ZM0A 4F7UP 2YF0A 3PVUA 3CXBB 2N0YA 1V89A 1XKEA 1TJ6A 4HB3B 2KUPA 2G35A 2GJYA 2RLOA 1OY2A 4KHOA 1MKEA 4EMOA 2YT0A 5D3XA 1NTVA 3PP2A 2UZSA 2RSGA 2Z4DA 4WJ7A 2JP2A 1FHXA 5DIFB 5IRSA 3AJ4A 1W1DA 2Z0PA 3DCXA 3U12A 2P0FA 1OMWA 3MDBC 2DHIA 3PVWA 3P6AA 2Z0QA 1P5TA 2K2JA 4CHMA 4GMVA 5C5BB 1XD4A 2OTXA 3ODXA 2VKIA 5DH9B 2QKMA 4GZUA 2I5FA 1H4RA 4EKUA 2Z13A 4Z2NA 2GCLA 2W2XC 1BAKA 1I2HA 2D9WA 2R2YA 3MPXA 3DXEA 3SUZA 1UNRA 1U5GA 2YRYA 3KRXA 3ULBA 1X11A 2MKRA 1XR0B 3NWDA 3NWAA 1M7EA 2DFKA 1QC6A 2V76A 1W1HA 3SV1A 2EMTA 1NTYA 3T06A 3FM8C 2KGXB 3G9WA 2OQBA 4WVFB 2RNRB 2YS1A 3VIAA 1ZC4B 2AEHA 2W2WA 3WYFB 3WA0A 2YS3A 1WVHA 1LB1A 5LG4B 1K5DB 2CAYA 2KUQA 3F5RA 4XWXA 2D9ZA 1GC6A 4K2PA 3NSUA 4TYZA 2PZ1A 3KSYA 1Q67A 4HHVA 4WSFA 2DKPA 3QBVB 4CSQA 2KCJA 2CODA 1W1GA 1EAZA 5J3QA 2D9XA 5FI0A 3SYXA 2DYNA 4OT1A 1EGXA 2RVBB 4K2OA 3SNHA 1T77A 4PQ0A 4DXAB 5D3WA 1DBHA 1TQZA 3TVVA 1BTNA 2DHJA 3HIEA 2NMBA 2Z59A 1M7RA 3M1IB 1J19A 3P7ZA 1UNQA 2RUKB 2LKOA 2KIEA 1X1FA 3SO6A 1MIXA 3KY9A 2Z0OA 3FSSA 1V88A 5HE3A 1Y5OA 1X86A 1KZGA 5C79A 4DIXA 3A98B 5HE2A 2CY5A 5KCVA 2VSZA 1DYNA 1MPHA 2W2XD 2KIGA 5JHGA 4HSIA 1EVHA 1UEFA 2DLWA 3QIJA 2LULA 3D8FA 2YVCA 3NW8A 3ODOA 3X23A 1U29A 5JP4A 3HW2B 3ML4A 4C0AA 4GN1A 1UNPA 3DXCA 4YONA 4B6HA 1FHWA
chains in the Genus database with same CATH topology
1XX0A 4K81A 2J0MA 4L6EA 3KRWA 2COFA 5LONB 1U5DA 1WG7A 1WGQA 4DBBA 3F0WA 2FJLA 1MIZB 2M38A 1H10A 1QQGA 1X1GA 4Y94A 1ZVRA 4DX8A 1X05A 2EJ8A 1V5UA 2N23A 2LOXA 3VOQA 4HDQA 1XODA 2NZ8B 3N7CA 2MDXA 1B55A 3TW1A 4HAUB 4HAWB 5D3YA 2LG1A 1WJMA 4CYEA 2AL6A 1V61A 1BTKA 1BWNA 3HK0A 5J3YA 5EFXA 2YS5A 1ZC3B 4BBKA 1U2BA 4MK0A 2MWNB 1Z87A 1MK9B 4HDOA 1P6SA 2H7DA 1DDWA 1U5EA 2DA0A 3OANA 4HATB 4F7GA 2XQNM 1U5FA 1NI2A 2D2QA 3PEGA 3U8ZA 2Y7BA 3TCAA 2CY4A 2GCJA 4IAPA 5KQ4A 2DHKA 2D10A 5D3VA 1DROA 2ROVA 5C16A 4MT7A 2I1JA 2ADZA 3CIKA 3UZTA 4A5KA 5KQ1A 1MAIA 4IOYX 5C5BA 1E5WA 3QWMA 2DN6A 2ZPYA 1LW3A 3GYPA 4K17A 3KZ1A 2R0DA 2DX1A 4HAVB 3D8DA 4HB2B 1OQNA 2RGNB 1KI1B 1Y19B 2ELBA 2UVMA 4KHAA 1FAOA 3PSCA 3ZVRA 1UPQA 1FHOA 4PNKA 1FGYA 4HAXB 2Y8GA 4A6FB 4GMXB 2HTHB 2L2IA 1GC7A 2P8VA 3O96A 3ULCA 2J59M 2I5CA 5DHFB 2QKLA 3ODWA 3AU4A 1WGUA 1WI1A 2BCJA 2K00A 3DXDA 1WJ1A 5GOWB 5JHHA 2GS0A 2IYBA 2YT1A 5HE0A 1N3HA 3PVLA 1J0WA 1DDMA 5JLJB 1I7AA 2VRWB 5J3TA 4F7HA 1SHCA 3PG7A 5FI1A 1P3RA 2EMSA 4ZRJA 4KHBB 3D8EA 5CLQB 1K5GB 2DKQA 3TO1A 4NSWA 3A8QA 5L81A 2X18A 2M14A 2K2UA 1EF1A 4HB4B 4GXBA 2L1CA 2D4QA 4MY6A 2I1KA 3RCPA 1AQCA 2P0HA 4HAZB 2D11A 4DX90 2MFQA 1XCGA 5CLLB 2LOZA 3PZDA 2EC1A 1FOEA 3A8PA 3HQCA 4GPTB 3LJUX 4YL8A 2E2XA 2J0KA 3TFMA 3ZDTA 4KAXB 1AWEA 2YSZA 1KZ7A 1FB8A 1SGHA 1U27A 3V5WA 2DTCA 2P0DA 1RRPB 5DI9B 4TKNA 1PFJA 1NU2A 3BINA 2COCA 4A6HA 2COAA 2ELAA 4D0NB 3AU5A 5HE1A 3GYOA 4Z2MB 1PMSA 4IFSA 5LOPB 2HE7A 1RJ2A 3FEHA 2UZRA 3IVFA 5DHAB 4HAYB 2J0JA 1UPRA 4HB0B 2CRFA 2Y8FA 4NY0A 1V5MA 1DDVA 3BJIA 5C6RA 4A6KA 1ISNA 2IFSA 2ROZB 4P7IA 4CHJA 2D9VA 1FGZA 2DX5A 4H8SA 4ZRIA 4A6FA 3U7DA 2DYQA 5D27A 1ZSQA 2R09A 2H7EA 4ZRKA 1MK7B 4EJNA 1GG3A 4KVGB 1TXDA 1IRSA 2LYDA 2Q13A 1V5PA 2D9YA 1PLSA 1ZM0A 4F7UP 2YF0A 3PVUA 3CXBB 2N0YA 1V89A 1XKEA 1TJ6A 4HB3B 2KUPA 2G35A 2GJYA 2RLOA 1OY2A 4KHOA 1MKEA 4EMOA 2YT0A 5D3XA 1NTVA 3PP2A 2UZSA 2RSGA 4WJ7A 2JP2A 1FHXA 5DIFB 3AJ4A 1W1DA 2Z0PA 2P0FA 1OMWA 3MDBC 2DHIA 3PVWA 3P6AA 2Z0QA 1P5TA 2K2JA 4CHMA 4GMVA 5C5BB 1XD4A 2OTXA 3ODXA 2VKIA 5DH9B 2QKMA 4GZUA 2I5FA 1H4RA 4EKUA 4Z2NA 2GCLA 2W2XC 1BAKA 1I2HA 2D9WA 3MPXA 3DXEA 3SUZA 1UNRA 1U5GA 2YRYA 3KRXA 3ULBA 1X11A 2MKRA 1XR0B 1M7EA 2DFKA 1QC6A 2V76A 1W1HA 3SV1A 2EMTA 1NTYA 3T06A 3FM8C 2KGXB 3G9WA 2OQBA 4WVFB 2RNRB 2YS1A 3VIAA 1ZC4B 2AEHA 2W2WA 3WYFB 3WA0A 2YS3A 1WVHA 1LB1A 1K5DB 2CAYA 3F5RA 4XWXA 2D9ZA 1GC6A 4K2PA 3NSUA 4TYZA 2PZ1A 3KSYA 1Q67A 4HHVA 4WSFA 2DKPA 3QBVB 2KCJA 2CODA 1W1GA 1EAZA 5J3QA 2D9XA 5FI0A 3SYXA 2DYNA 1EGXA 2RVBB 4K2OA 3SNHA 4PQ0A 4DXAB 5D3WA 1DBHA 1TQZA 3TVVA 1BTNA 2DHJA 2NMBA 1M7RA 3M1IB 1J19A 3P7ZA 1UNQA 2RUKB 2LKOA 1X1FA 3SO6A 1MIXA 3KY9A 2Z0OA 3FSSA 1V88A 5HE3A 1Y5OA 1X86A 1KZGA 5C79A 3A98B 5HE2A 2CY5A 5KCVA 2VSZA 1DYNA 1MPHA 2W2XD 5JHGA 1EVHA 1UEFA 2DLWA 3QIJA 2LULA 3D8FA 2YVCA 3ODOA 3X23A 1U29A 5JP4A 3HW2B 3ML4A 4C0AA 4GN1A 1UNPA 3DXCA 4YONA 4B6HA 1FHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XX0 A;  4K81 A;  2J0M A;  4L6E A;  3KRW A;  2COF A;  5LON B;  1U5D A;  1WG7 A;  1WGQ A;  4DBB A;  3F0W A;  2FJL A;  1MIZ B;  2M38 A;  1H10 A;  1QQG A;  1X1G A;  4Y94 A;  1ZVR A;  4DX8 A;  1X05 A;  2EJ8 A;  1V5U A;  2N23 A;  2LOX A;  3VOQ A;  4HDQ A;  1XOD A;  2NZ8 B;  3N7C A;  2MDX A;  1B55 A;  3TW1 A;  4HAU B;  4HAW B;  5D3Y A;  2LG1 A;  1WJM A;  4CYE A;  2AL6 A;  1V61 A;  1BTK A;  1BWN A;  3HK0 A;  5J3Y A;  5EFX A;  2YS5 A;  1ZC3 B;  4BBK A;  1U2B A;  4MK0 A;  2MWN B;  1Z87 A;  1MK9 B;  4HDO A;  1P6S A;  2H7D A;  1DDW A;  1U5E A;  2DA0 A;  3OAN A;  4HAT B;  4F7G A;  2XQN M;  1U5F A;  1NI2 A;  2D2Q A;  3PEG A;  3U8Z A;  2Y7B A;  3TCA A;  2CY4 A;  2GCJ A;  4IAP A;  5KQ4 A;  2DHK A;  2D10 A;  5D3V A;  1DRO A;  2ROV A;  5C16 A;  4MT7 A;  2I1J A;  2ADZ A;  3CIK A;  3UZT A;  4A5K A;  5KQ1 A;  1MAI A;  4IOY X;  5C5B A;  1E5W A;  3QWM A;  2DN6 A;  2ZPY A;  1LW3 A;  3GYP A;  4K17 A;  3KZ1 A;  2R0D A;  2DX1 A;  4HAV B;  3D8D A;  4HB2 B;  1OQN A;  2RGN B;  1KI1 B;  1Y19 B;  2ELB A;  2UVM A;  4KHA A;  1FAO A;  3PSC A;  3ZVR A;  1UPQ A;  1FHO A;  4PNK A;  1FGY A;  4HAX B;  2Y8G A;  4A6F B;  4GMX B;  2HTH B;  2L2I A;  1GC7 A;  2P8V A;  3O96 A;  3ULC A;  2J59 M;  2I5C A;  5DHF B;  2QKL A;  3ODW A;  3AU4 A;  1WGU A;  1WI1 A;  2BCJ A;  2K00 A;  3DXD A;  1WJ1 A;  5GOW B;  5JHH A;  2GS0 A;  2IYB A;  2YT1 A;  5HE0 A;  1N3H A;  3PVL A;  1J0W A;  1DDM A;  5JLJ B;  1I7A A;  2VRW B;  5J3T A;  4F7H A;  1SHC A;  3PG7 A;  5FI1 A;  1P3R A;  2EMS A;  4ZRJ A;  4KHB B;  3D8E A;  5CLQ B;  1K5G B;  2DKQ A;  3TO1 A;  4NSW A;  3A8Q A;  5L81 A;  2X18 A;  2M14 A;  2K2U A;  1EF1 A;  4HB4 B;  4GXB A;  2L1C A;  2D4Q A;  4MY6 A;  2I1K A;  3RCP A;  1AQC A;  2P0H A;  4HAZ B;  2D11 A;  4DX9 0;  2MFQ A;  1XCG A;  5CLL B;  2LOZ A;  3PZD A;  2EC1 A;  1FOE A;  3A8P A;  3HQC A;  4GPT B;  3LJU X;  4YL8 A;  2E2X A;  2J0K A;  3TFM A;  3ZDT A;  4KAX B;  1AWE A;  2YSZ A;  1KZ7 A;  1FB8 A;  1SGH A;  1U27 A;  3V5W A;  2DTC A;  2P0D A;  1RRP B;  5DI9 B;  4TKN A;  1PFJ A;  1NU2 A;  3BIN A;  2COC A;  4A6H A;  2COA A;  2ELA A;  4D0N B;  3AU5 A;  5HE1 A;  3GYO A;  4Z2M B;  1PMS A;  4IFS A;  5LOP B;  2HE7 A;  1RJ2 A;  3FEH A;  2UZR A;  3IVF A;  5DHA B;  4HAY B;  2J0J A;  1UPR A;  4HB0 B;  2CRF A;  2Y8F A;  4NY0 A;  1V5M A;  1DDV A;  3BJI A;  5C6R A;  4A6K A;  1ISN A;  2IFS A;  2ROZ B;  4P7I A;  4CHJ A;  2D9V A;  1FGZ A;  2DX5 A;  4H8S A;  4ZRI A;  4A6F A;  3U7D A;  2DYQ A;  5D27 A;  1ZSQ A;  2R09 A;  2H7E A;  4ZRK A;  1MK7 B;  4EJN A;  1GG3 A;  4KVG B;  1TXD A;  1IRS A;  2LYD A;  2Q13 A;  1V5P A;  2D9Y A;  1PLS A;  1ZM0 A;  4F7U P;  2YF0 A;  3PVU A;  3CXB B;  2N0Y A;  1V89 A;  1XKE A;  1TJ6 A;  4HB3 B;  2KUP A;  2G35 A;  2GJY A;  2RLO A;  1OY2 A;  4KHO A;  1MKE A;  4EMO A;  2YT0 A;  5D3X A;  1NTV A;  3PP2 A;  2UZS A;  2RSG A;  4WJ7 A;  2JP2 A;  1FHX A;  5DIF B;  3AJ4 A;  1W1D A;  2Z0P A;  2P0F A;  1OMW A;  3MDB C;  2DHI A;  3PVW A;  3P6A A;  2Z0Q A;  1P5T A;  2K2J A;  4CHM A;  4GMV A;  5C5B B;  1XD4 A;  2OTX A;  3ODX A;  2VKI A;  5DH9 B;  2QKM A;  4GZU A;  2I5F A;  1H4R A;  4EKU A;  4Z2N A;  2GCL A;  2W2X C;  1BAK A;  1I2H A;  2D9W A;  3MPX A;  3DXE A;  3SUZ A;  1UNR A;  1U5G A;  2YRY A;  3KRX A;  3ULB A;  1X11 A;  2MKR A;  1XR0 B;  1M7E A;  2DFK A;  1QC6 A;  2V76 A;  1W1H A;  3SV1 A;  2EMT A;  1NTY A;  3T06 A;  3FM8 C;  2KGX B;  3G9W A;  2OQB A;  4WVF B;  2RNR B;  2YS1 A;  3VIA A;  1ZC4 B;  2AEH A;  2W2W A;  3WYF B;  3WA0 A;  2YS3 A;  1WVH A;  1LB1 A;  1K5D B;  2CAY A;  3F5R A;  4XWX A;  2D9Z A;  1GC6 A;  4K2P A;  3NSU A;  4TYZ A;  2PZ1 A;  3KSY A;  1Q67 A;  4HHV A;  4WSF A;  2DKP A;  3QBV B;  2KCJ A;  2COD A;  1W1G A;  1EAZ A;  5J3Q A;  2D9X A;  5FI0 A;  3SYX A;  2DYN A;  1EGX A;  2RVB B;  4K2O A;  3SNH A;  4PQ0 A;  4DXA B;  5D3W A;  1DBH A;  1TQZ A;  3TVV A;  1BTN A;  2DHJ A;  2NMB A;  1M7R A;  3M1I B;  1J19 A;  3P7Z A;  1UNQ A;  2RUK B;  2LKO A;  1X1F A;  3SO6 A;  1MIX A;  3KY9 A;  2Z0O A;  3FSS A;  1V88 A;  5HE3 A;  1Y5O A;  1X86 A;  1KZG A;  5C79 A;  3A98 B;  5HE2 A;  2CY5 A;  5KCV A;  2VSZ A;  1DYN A;  1MPH A;  2W2X D;  5JHG A;  1EVH A;  1UEF A;  2DLW A;  3QIJ A;  2LUL A;  3D8F A;  2YVC A;  3ODO A;  3X23 A;  1U29 A;  5JP4 A;  3HW2 B;  3ML4 A;  4C0A A;  4GN1 A;  1UNP A;  3DXC A;  4YON A;  4B6H A;  1FHW A; 
#chains in the Genus database with same CATH topology
 1XX0 A;  4K81 A;  2J0M A;  4QXA B;  4L6E A;  3KRW A;  2COF A;  5LON B;  1U5D A;  1WG7 A;  1WGQ A;  4DBB A;  3F0W A;  2FJL A;  1MIZ B;  2M38 A;  4GOU A;  1H10 A;  1QQG A;  4QJ3 B;  1X1G A;  4Y94 A;  1ZVR A;  4DX8 A;  1X05 A;  2EJ8 A;  2GUM A;  1V5U A;  4QJ4 B;  4GNK B;  2N23 A;  2LOX A;  3VOQ A;  4HDQ A;  1XOD A;  2NZ8 B;  3N7C A;  5M4Y B;  2MDX A;  1B55 A;  3TW1 A;  4HAU B;  4HAW B;  5D3Y A;  2LG1 A;  1WJM A;  2K49 A;  4CYE A;  2AL6 A;  1V61 A;  1BTK A;  1BWN A;  3HK0 A;  5J3Y A;  5EFX A;  2YS5 A;  1ZC3 B;  4BBK A;  1U2B A;  4MK0 A;  2MWN B;  1Z87 A;  1MK9 B;  4HDO A;  1P6S A;  2H7D A;  1DDW A;  1U5E A;  2DA0 A;  3OAN A;  4HAT B;  4F7G A;  2XQN M;  1U5F A;  1NI2 A;  2D2Q A;  1ZYI A;  3PEG A;  3U8Z A;  2Y7B A;  3TCA A;  2CY4 A;  2GCJ A;  4IAP A;  5KQ4 A;  2DHK A;  2D10 A;  5D3V A;  1DRO A;  1MI1 A;  2ROV A;  5C16 A;  4MT7 A;  2I1J A;  2ADZ A;  3CIK A;  3UZT A;  4A5K A;  5KQ1 A;  1MAI A;  4IOY X;  5C5B A;  1E5W A;  3QWM A;  2DN6 A;  2ZPY A;  1LW3 A;  3GYP A;  4K17 A;  3KZ1 A;  2R0D A;  2DX1 A;  5I2M A;  4HAV B;  3D8D A;  3OHM B;  4D6W A;  4HB2 B;  1OQN A;  2RGN B;  1KI1 B;  1Y19 B;  2ELB A;  2UVM A;  4KHA A;  1FAO A;  3PSC A;  3ZVR A;  1UPQ A;  1FHO A;  4PNK A;  1FGY A;  3FVC A;  4HAX B;  2Y8G A;  4A6F B;  4GMX B;  2HTH B;  2L2I A;  1GC7 A;  2P8V A;  3A58 A;  3O96 A;  3ULC A;  2J59 M;  2I5C A;  5DHF B;  2QKL A;  3ODW A;  3AU4 A;  1WGU A;  1WI1 A;  2RRF A;  2BCJ A;  2K00 A;  3DXD A;  1WJ1 A;  5GOW B;  5JHH A;  3HSA A;  2GS0 A;  2IYB A;  2YT1 A;  5HE0 A;  1N3H A;  3PVL A;  1J0W A;  1DDM A;  5JLJ B;  1I7A A;  2VRW B;  5J3T A;  4F7H A;  1SHC A;  3PG7 A;  5FI1 A;  1P3R A;  2EMS A;  4ZRJ A;  4KHB B;  3D8E A;  5CLQ B;  3NWF A;  1K5G B;  2DKQ A;  3TO1 A;  4NSW A;  3A8Q A;  5L81 A;  2X18 A;  2M14 A;  2K2U A;  1EF1 A;  4HB4 B;  4GXB A;  2L1C A;  2D4Q A;  4MY6 A;  2I1K A;  3RCP A;  1AQC A;  2P0H A;  4HAZ B;  2D11 A;  4DX9 0;  2MFQ A;  2NBV A;  1XCG A;  5CLL B;  2LOZ A;  3B77 A;  5I2S A;  3PZD A;  2EC1 A;  1FOE A;  3A8P A;  3HQC A;  4GPT B;  4KHB A;  4L1R A;  3LJU X;  4YL8 A;  2E2X A;  2J0K A;  3TFM A;  3ZDT A;  4KAX B;  2YT2 A;  1AWE A;  2YSZ A;  1KZ7 A;  1FB8 A;  1SGH A;  1U27 A;  3V5W A;  2DTC A;  2P0D A;  1RRP B;  5DI9 B;  4TKN A;  1PFJ A;  1NU2 A;  2ZKM X;  2COC A;  3BIN A;  4A6H A;  2Z14 A;  2COA A;  2ELA A;  4D0N B;  3AU5 A;  5HE1 A;  3GYO A;  4Z2M B;  1PMS A;  4IFS A;  5LOP B;  2HE7 A;  1RJ2 A;  3FEH A;  2UZR A;  3IVF A;  5DHA B;  4HAY B;  2J0J A;  4QJ5 B;  1UPR A;  4HB0 B;  2CRF A;  2Y8F A;  2K8E A;  4NY0 A;  1V5M A;  1DDV A;  3BJI A;  5C6R A;  4A6K A;  1ISN A;  2IFS A;  2ROZ B;  4P7I A;  4CHJ A;  2D9V A;  1FGZ A;  2DX5 A;  4H8S A;  4ZRI A;  4A6F A;  3U7D A;  2DYQ A;  5D27 A;  1ZSQ A;  2R09 A;  2H7E A;  4ZRK A;  1MK7 B;  4EJN A;  1GG3 A;  4KVG B;  1TXD A;  1IRS A;  4OSN A;  2LYD A;  2Q13 A;  2KR0 A;  1V5P A;  2D9Y A;  2FJU B;  1PLS A;  1ZM0 A;  4F7U P;  2YF0 A;  3PVU A;  3CXB B;  2N0Y A;  1V89 A;  1XKE A;  1TJ6 A;  4HB3 B;  2KUP A;  2G35 A;  2GJY A;  2RLO A;  1OY2 A;  4KHO A;  1MKE A;  4EMO A;  2YT0 A;  5D3X A;  1NTV A;  3PP2 A;  2UZS A;  2RSG A;  2Z4D A;  4WJ7 A;  2JP2 A;  1FHX A;  5DIF B;  5IRS A;  3AJ4 A;  1W1D A;  2Z0P A;  3DCX A;  3U12 A;  2P0F A;  1OMW A;  3MDB C;  2DHI A;  3PVW A;  3P6A A;  2Z0Q A;  1P5T A;  2K2J A;  4CHM A;  4GMV A;  5C5B B;  1XD4 A;  2OTX A;  3ODX A;  2VKI A;  5DH9 B;  2QKM A;  4GZU A;  2I5F A;  1H4R A;  4EKU A;  2Z13 A;  4Z2N A;  2GCL A;  2W2X C;  1BAK A;  1I2H A;  2D9W A;  2R2Y A;  3MPX A;  3DXE A;  3SUZ A;  1UNR A;  1U5G A;  2YRY A;  3KRX A;  3ULB A;  1X11 A;  2MKR A;  1XR0 B;  3NWD A;  3NWA A;  1M7E A;  2DFK A;  1QC6 A;  2V76 A;  1W1H A;  3SV1 A;  2EMT A;  1NTY A;  3T06 A;  3FM8 C;  2KGX B;  3G9W A;  2OQB A;  4WVF B;  2RNR B;  2YS1 A;  3VIA A;  1ZC4 B;  2AEH A;  2W2W A;  3WYF B;  3WA0 A;  2YS3 A;  1WVH A;  1LB1 A;  5LG4 B;  1K5D B;  2CAY A;  2KUQ A;  3F5R A;  4XWX A;  2D9Z A;  1GC6 A;  4K2P A;  3NSU A;  4TYZ A;  2PZ1 A;  3KSY A;  1Q67 A;  4HHV A;  4WSF A;  2DKP A;  3QBV B;  4CSQ A;  2KCJ A;  2COD A;  1W1G A;  1EAZ A;  5J3Q A;  2D9X A;  5FI0 A;  3SYX A;  2DYN A;  4OT1 A;  1EGX A;  2RVB B;  4K2O A;  3SNH A;  1T77 A;  4PQ0 A;  4DXA B;  5D3W A;  1DBH A;  1TQZ A;  3TVV A;  1BTN A;  2DHJ A;  3HIE A;  2NMB A;  2Z59 A;  1M7R A;  3M1I B;  1J19 A;  3P7Z A;  1UNQ A;  2RUK B;  2LKO A;  2KIE A;  1X1F A;  3SO6 A;  1MIX A;  3KY9 A;  2Z0O A;  3FSS A;  1V88 A;  5HE3 A;  1Y5O A;  1X86 A;  1KZG A;  5C79 A;  4DIX A;  3A98 B;  5HE2 A;  2CY5 A;  5KCV A;  2VSZ A;  1DYN A;  1MPH A;  2W2X D;  2KIG A;  5JHG A;  4HSI A;  1EVH A;  1UEF A;  2DLW A;  3QIJ A;  2LUL A;  3D8F A;  2YVC A;  3NW8 A;  3ODO A;  3X23 A;  1U29 A;  5JP4 A;  3HW2 B;  3ML4 A;  4C0A A;  4GN1 A;  1UNP A;  3DXC A;  4YON A;  4B6H A;  1FHW A; 
#chains in the Genus database with same CATH homology
 1XX0 A;  4K81 A;  2J0M A;  4L6E A;  3KRW A;  2COF A;  5LON B;  1U5D A;  1WG7 A;  1WGQ A;  4DBB A;  3F0W A;  2FJL A;  1MIZ B;  2M38 A;  1H10 A;  1QQG A;  1X1G A;  4Y94 A;  1ZVR A;  4DX8 A;  1X05 A;  2EJ8 A;  1V5U A;  2N23 A;  2LOX A;  3VOQ A;  4HDQ A;  1XOD A;  2NZ8 B;  3N7C A;  2MDX A;  1B55 A;  3TW1 A;  4HAU B;  4HAW B;  5D3Y A;  2LG1 A;  1WJM A;  4CYE A;  2AL6 A;  1V61 A;  1BTK A;  1BWN A;  3HK0 A;  5J3Y A;  5EFX A;  2YS5 A;  1ZC3 B;  4BBK A;  1U2B A;  4MK0 A;  2MWN B;  1Z87 A;  1MK9 B;  4HDO A;  1P6S A;  2H7D A;  1DDW A;  1U5E A;  2DA0 A;  3OAN A;  4HAT B;  4F7G A;  2XQN M;  1U5F A;  1NI2 A;  2D2Q A;  3PEG A;  3U8Z A;  2Y7B A;  3TCA A;  2CY4 A;  2GCJ A;  4IAP A;  5KQ4 A;  2DHK A;  2D10 A;  5D3V A;  1DRO A;  2ROV A;  5C16 A;  4MT7 A;  2I1J A;  2ADZ A;  3CIK A;  3UZT A;  4A5K A;  5KQ1 A;  1MAI A;  4IOY X;  5C5B A;  1E5W A;  3QWM A;  2DN6 A;  2ZPY A;  1LW3 A;  3GYP A;  4K17 A;  3KZ1 A;  2R0D A;  2DX1 A;  4HAV B;  3D8D A;  4HB2 B;  1OQN A;  2RGN B;  1KI1 B;  1Y19 B;  2ELB A;  2UVM A;  4KHA A;  1FAO A;  3PSC A;  3ZVR A;  1UPQ A;  1FHO A;  4PNK A;  1FGY A;  4HAX B;  2Y8G A;  4A6F B;  4GMX B;  2HTH B;  2L2I A;  1GC7 A;  2P8V A;  3O96 A;  3ULC A;  2J59 M;  2I5C A;  5DHF B;  2QKL A;  3ODW A;  3AU4 A;  1WGU A;  1WI1 A;  2BCJ A;  2K00 A;  3DXD A;  1WJ1 A;  5GOW B;  5JHH A;  2GS0 A;  2IYB A;  2YT1 A;  5HE0 A;  1N3H A;  3PVL A;  1J0W A;  1DDM A;  5JLJ B;  1I7A A;  2VRW B;  5J3T A;  4F7H A;  1SHC A;  3PG7 A;  5FI1 A;  1P3R A;  2EMS A;  4ZRJ A;  4KHB B;  3D8E A;  5CLQ B;  1K5G B;  2DKQ A;  3TO1 A;  4NSW A;  3A8Q A;  5L81 A;  2X18 A;  2M14 A;  2K2U A;  1EF1 A;  4HB4 B;  4GXB A;  2L1C A;  2D4Q A;  4MY6 A;  2I1K A;  3RCP A;  1AQC A;  2P0H A;  4HAZ B;  2D11 A;  4DX9 0;  2MFQ A;  1XCG A;  5CLL B;  2LOZ A;  3PZD A;  2EC1 A;  1FOE A;  3A8P A;  3HQC A;  4GPT B;  3LJU X;  4YL8 A;  2E2X A;  2J0K A;  3TFM A;  3ZDT A;  4KAX B;  1AWE A;  2YSZ A;  1KZ7 A;  1FB8 A;  1SGH A;  1U27 A;  3V5W A;  2DTC A;  2P0D A;  1RRP B;  5DI9 B;  4TKN A;  1PFJ A;  1NU2 A;  3BIN A;  2COC A;  4A6H A;  2COA A;  2ELA A;  4D0N B;  3AU5 A;  5HE1 A;  3GYO A;  4Z2M B;  1PMS A;  4IFS A;  5LOP B;  2HE7 A;  1RJ2 A;  3FEH A;  2UZR A;  3IVF A;  5DHA B;  4HAY B;  2J0J A;  1UPR A;  4HB0 B;  2CRF A;  2Y8F A;  4NY0 A;  1V5M A;  1DDV A;  3BJI A;  5C6R A;  4A6K A;  1ISN A;  2IFS A;  2ROZ B;  4P7I A;  4CHJ A;  2D9V A;  1FGZ A;  2DX5 A;  4H8S A;  4ZRI A;  4A6F A;  3U7D A;  2DYQ A;  5D27 A;  1ZSQ A;  2R09 A;  2H7E A;  4ZRK A;  1MK7 B;  4EJN A;  1GG3 A;  4KVG B;  1TXD A;  1IRS A;  2LYD A;  2Q13 A;  1V5P A;  2D9Y A;  1PLS A;  1ZM0 A;  4F7U P;  2YF0 A;  3PVU A;  3CXB B;  2N0Y A;  1V89 A;  1XKE A;  1TJ6 A;  4HB3 B;  2KUP A;  2G35 A;  2GJY A;  2RLO A;  1OY2 A;  4KHO A;  1MKE A;  4EMO A;  2YT0 A;  5D3X A;  1NTV A;  3PP2 A;  2UZS A;  2RSG A;  4WJ7 A;  2JP2 A;  1FHX A;  5DIF B;  3AJ4 A;  1W1D A;  2Z0P A;  2P0F A;  1OMW A;  3MDB C;  2DHI A;  3PVW A;  3P6A A;  2Z0Q A;  1P5T A;  2K2J A;  4CHM A;  4GMV A;  5C5B B;  1XD4 A;  2OTX A;  3ODX A;  2VKI A;  5DH9 B;  2QKM A;  4GZU A;  2I5F A;  1H4R A;  4EKU A;  4Z2N A;  2GCL A;  2W2X C;  1BAK A;  1I2H A;  2D9W A;  3MPX A;  3DXE A;  3SUZ A;  1UNR A;  1U5G A;  2YRY A;  3KRX A;  3ULB A;  1X11 A;  2MKR A;  1XR0 B;  1M7E A;  2DFK A;  1QC6 A;  2V76 A;  1W1H A;  3SV1 A;  2EMT A;  1NTY A;  3T06 A;  3FM8 C;  2KGX B;  3G9W A;  2OQB A;  4WVF B;  2RNR B;  2YS1 A;  3VIA A;  1ZC4 B;  2AEH A;  2W2W A;  3WYF B;  3WA0 A;  2YS3 A;  1WVH A;  1LB1 A;  1K5D B;  2CAY A;  3F5R A;  4XWX A;  2D9Z A;  1GC6 A;  4K2P A;  3NSU A;  4TYZ A;  2PZ1 A;  3KSY A;  1Q67 A;  4HHV A;  4WSF A;  2DKP A;  3QBV B;  2KCJ A;  2COD A;  1W1G A;  1EAZ A;  5J3Q A;  2D9X A;  5FI0 A;  3SYX A;  2DYN A;  1EGX A;  2RVB B;  4K2O A;  3SNH A;  4PQ0 A;  4DXA B;  5D3W A;  1DBH A;  1TQZ A;  3TVV A;  1BTN A;  2DHJ A;  2NMB A;  1M7R A;  3M1I B;  1J19 A;  3P7Z A;  1UNQ A;  2RUK B;  2LKO A;  1X1F A;  3SO6 A;  1MIX A;  3KY9 A;  2Z0O A;  3FSS A;  1V88 A;  5HE3 A;  1Y5O A;  1X86 A;  1KZG A;  5C79 A;  3A98 B;  5HE2 A;  2CY5 A;  5KCV A;  2VSZ A;  1DYN A;  1MPH A;  2W2X D;  5JHG A;  1EVH A;  1UEF A;  2DLW A;  3QIJ A;  2LUL A;  3D8F A;  2YVC A;  3ODO A;  3X23 A;  1U29 A;  5JP4 A;  3HW2 B;  3ML4 A;  4C0A A;  4GN1 A;  1UNP A;  3DXC A;  4YON A;  4B6H A;  1FHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...