1QC6A

Evh1 domain from ena/vasp-like protein in complex with acta peptide
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
113
structure length
108
Chain Sequence
MSEQSICQARASVMVYDDTSKKWVPIKFSRINIYHNTASSTFRVVGVKLQDQQVVINYSIVKGLKYNQATPTFHQWRDARQVYGLNFASKEEATTFSNAMLFALNIMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EVH1 DOMAIN FROM ENA/VASP-LIKE PROTEIN
publication title Structure of EVH1, a novel proline-rich ligand-binding module involved in cytoskeletal dynamics and neural function
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein
total genus 20
structure length 108
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1qc6A00
2ROVA 2D9XA 2J0JA 3PZDA 1OMWA 3MPXA 1Y5OA 1DROA 2YS3A 2I1JA 4Y94A 5C16A 4MK0A 5LOPB 1UNRA 1V5UA 3ZDTA 5DH9B 4EKUA 2K2JA 1U5DA 4KHAA 3ZVRA 3FEHA 3N7CA 1X1FA 3ULBA 4A6KA 2VKIA 4BBKA 2YT1A 1DDVA 5J3YA 1U29A 5KCVA 3CIKA 1H10A 2UZRA 1V5PA 5C5BB 5JHGA 2P0FA 1GG3A 4IAPA 4CHMA 3KSYA 4HAZB 1KZ7A 3OANA 4HAWB 3F5RA 4CHJA 4KHBB 3U7DA 1MK9B 2LKOA 3V5WA 2RVBB 3SO6A 2CY4A 2I5CA 1J0WA 2OQBA 1W1HA 2K2UA 1K5DB 1SHCA 3PG7A 1GC7A 4HDOA 3A8PA 3ODOA 3FSSA 2E2XA 2DHIA 2ELAA 3MDBC 2P8VA 1X86A 2HTHB 2CY5A 4H8SA 5C79A 3TCAA 1LW3A 4HB3B 1KI1B 3BINA 1PLSA 2GS0A 1XR0B 2COFA 1FHOA 1NTYA 1ISNA 2FJLA 2W2XC 1XKEA 2J0KA 4TKNA 1WG7A 2EC1A 2OTXA 4KAXB 2Y8FA 2D9VA 4XWXA 1FHWA 5HE0A 1WGUA 5FI0A 3HK0A 2Z0QA 5FI1A 3P7ZA 2J0MA 3ODXA 2D9YA 1WI1A 2RNRB 1KZGA 4MY6A 2DHJA 1IRSA 3DXCA 1V88A 3M1IB 1AWEA 3QBVB 5KQ1A 1BTKA 2X18A 2DKQA 2YS5A 4MT7A 2I1KA 3KRXA 3HQCA 3PVWA 4ZRJA 1PFJA 2P0HA 1FB8A 3D8FA 4CYEA 5JHHA 4HDQA 4L6EA 2DA0A 2BCJA 1ZC3B 1EVHA 1MKEA 2J59M 3U8ZA 2YRYA 2CODA 3SYXA 1PMSA 1TJ6A 2D4QA 3FM8C 1BTNA 5C6RA 4GZUA 5D3WA 4WJ7A 4YONA 1AQCA 3AU4A 5EFXA 1MPHA 2YT0A 3AJ4A 2QKLA 5J3QA 1I7AA 2CAYA 1BWNA 2DKPA 2RLOA 1WGQA 3CXBB 4HAXB 2DFKA 1M7RA 3GYOA 1TQZA 2RUKB 4DBBA 1H4RA 1MIXA 1XD4A 3P6AA 4HAYB 2GCLA 4PNKA 1V5MA 2D9ZA 3G9WA 2PZ1A 2I5FA 3QIJA 1Z87A 1LB1A 5GOWB 4A6FA 2UVMA 3TVVA 3NSUA 4F7GA 5DHAB 4NSWA 1V89A 1ZVRA 3SNHA 1RJ2A 3F0WA 3DXEA 1EF1A 1M7EA 1QC6A 3BJIA 2L2IA 5HE1A 1ZM0A 2W2XD 3TFMA 1NU2A 1U2BA 1UPQA 3QWMA 1UPRA 2M38A 4YL8A 2N23A 1X11A 1NTVA 3HW2B 2MFQA 2DN6A 3GYPA 5CLLB 2N0YA 4GXBA 2R0DA 1XODA 2XQNM 2H7EA 2GJYA 5DHFB 2G35A 4P7IA 2MWNB 2IFSA 3IVFA 5CLQB 2LOXA 3SV1A 2EMTA 1WJ1A 2ROZB 2YF0A 5LONB 4HAVB 4C0AA 1SGHA 2KGXB 1P6SA 2DTCA 2D2QA 2RGNB 2QKMA 3A8QA 4Z2NA 4HATB 4IOYX 2VSZA 1RRPB 1WVHA 1DDMA 2NMBA 4ZRIA 3WA0A 3RCPA 2EMSA 1BAKA 2EJ8A 2UZSA 3X23A 2DHKA 2NZ8B 1FGZA 4B6HA 2ADZA 1UNQA 4HB0B 4DX8A 1TXDA 3PSCA 2ZPYA 4EMOA 1NI2A 1GC6A 1FHXA 3SUZA 2DX5A 2R09A 2Z0OA 3O96A 4K2PA 5D3XA 4K81A 3DXDA 2LG1A 4A6FB 2DLWA 4DXAB 2D9WA 2YSZA 4F7UP 1U5FA 2V76A 3ML4A 4PQ0A 3VIAA 5DI9B 4TYZA 5JLJB 3UZTA 4GMXB 2AEHA 1W1DA 2HE7A 4Z2MB 2H7DA 2MKRA 2CRFA 3PEGA 1FGYA 1DYNA 1EAZA 4HAUB 4IFSA 3TW1A 3T06A 1OY2A 5D3VA 5DIFB 1ZC4B 5L81A 1UEFA 2M14A 3PVLA 5HE2A 1U5GA 5D27A 1ZSQA 2YVCA 4HHVA 3D8EA 3KY9A 3LJUX 4HB2B 4WSFA 2GCJA 2IYBA 2MDXA 2AL6A 2COAA 1WJMA 3ODWA 1EGXA 2D10A 1OQNA 2DYNA 3KZ1A 1W1GA 3D8DA 4ZRKA 3VOQA 4GPTB 2K00A 2COCA 3ULCA 5JP4A 3PVUA 4NY0A 4F7HA 2LULA 1P5TA 1MIZB 1X05A 4WVFB 1U27A 1Y19B 1B55A 2LYDA 2Z0PA 1I2HA 3AU5A 3KRWA 1J19A 5HE3A 1K5GB 4EJNA 4D0NB 1V61A 2W2WA 3PP2A 4K2OA 4HB4B 2JP2A 1QQGA 2KCJA 1DBHA 1Q67A 1E5WA 1MK7B 5C5BA 1FAOA 2D11A 2RSGA 4GMVA 4A5KA 1FOEA 2DYQA 2YS1A 4K17A 2L1CA 2Y8GA 4A6HA 2P0DA 1MAIA 4GN1A 4DX90 3TO1A 1UNPA 1XX0A 1U5EA 4KVGB 3A98B 1DDWA 2DX1A 5J3TA 2LOZA 1P3RA 2VRWB 1X1GA 5D3YA 4KHOA 1N3HA 5KQ4A 2ELBA 2Q13A 2Y7BA 2KUPA 3WYFB 1XCGA
chains in the Genus database with same CATH superfamily
2ROVA 2D9XA 2J0JA 3PZDA 1OMWA 3MPXA 1Y5OA 1DROA 2YS3A 2I1JA 4Y94A 5C16A 4MK0A 5LOPB 5LG4B 1UNRA 2K49A 1V5UA 3ZDTA 5DH9B 4EKUA 2K2JA 1U5DA 4GNKB 4KHAA 3ZVRA 3FEHA 3N7CA 1X1FA 3ULBA 4A6KA 2VKIA 4BBKA 2YT2A 2YT1A 1DDVA 4QJ4B 5J3YA 1U29A 5KCVA 3CIKA 1H10A 2UZRA 1V5PA 5C5BB 5JHGA 2P0FA 1GG3A 4IAPA 4CHMA 3KSYA 4HAZB 5IRSA 1KZ7A 3OANA 4HSIA 4HAWB 3F5RA 4CHJA 4KHBB 3U7DA 1MK9B 2LKOA 3V5WA 2RVBB 3SO6A 2CY4A 2I5CA 1J0WA 2OQBA 1W1HA 2K2UA 1K5DB 1SHCA 3PG7A 1GC7A 4HDOA 3A8PA 3ODOA 3FSSA 2E2XA 2DHIA 2ELAA 3MDBC 2NBVA 4QXAB 2P8VA 1X86A 2HTHB 2CY5A 4H8SA 5C79A 3HIEA 3TCAA 1LW3A 4HB3B 1KI1B 3BINA 1PLSA 2GS0A 1XR0B 2COFA 1FHOA 1NTYA 2R2YA 1ISNA 2FJLA 2W2XC 1XKEA 4QJ3B 2J0KA 4TKNA 1WG7A 2EC1A 2OTXA 4KAXB 2Y8FA 2D9VA 4XWXA 1FHWA 5HE0A 1WGUA 5FI0A 3HK0A 2Z0QA 3A58A 4QJ5B 5FI1A 3P7ZA 2J0MA 3ODXA 2D9YA 1WI1A 2RNRB 3NWDA 1KZGA 4MY6A 2DHJA 1IRSA 3DXCA 1V88A 3M1IB 1AWEA 3QBVB 5KQ1A 1BTKA 2X18A 2DKQA 2YS5A 2K8EA 4MT7A 2I1KA 3KRXA 3HQCA 3PVWA 4ZRJA 1PFJA 2P0HA 1FB8A 3D8FA 4CYEA 5JHHA 2Z4DA 4HDQA 3U12A 4L6EA 2DA0A 2BCJA 3NW8A 1ZC3B 1EVHA 1MKEA 2J59M 3U8ZA 2YRYA 2CODA 3SYXA 1PMSA 1TJ6A 2D4QA 3FM8C 1BTNA 5C6RA 4GZUA 5D3WA 4WJ7A 4YONA 1AQCA 3AU4A 5EFXA 1MPHA 2YT0A 3AJ4A 5I2MA 2QKLA 5J3QA 1I7AA 2CAYA 1BWNA 2DKPA 2RLOA 1WGQA 3CXBB 4HAXB 2DFKA 1M7RA 3GYOA 1TQZA 2RUKB 4DBBA 1H4RA 1MIXA 1XD4A 3P6AA 4HAYB 2GCLA 4PNKA 1V5MA 2D9ZA 3DCXA 3G9WA 2PZ1A 2I5FA 3QIJA 1Z87A 1LB1A 2KIEA 5GOWB 4A6FA 2UVMA 3TVVA 3NWAA 3NSUA 4F7GA 5DHAB 4NSWA 1V89A 1ZVRA 3SNHA 1RJ2A 3F0WA 3DXEA 1EF1A 1M7EA 1QC6A 3BJIA 2L2IA 5HE1A 1ZM0A 2KR0A 2W2XD 3TFMA 1NU2A 1U2BA 1UPQA 3QWMA 1UPRA 2M38A 4YL8A 2N23A 1X11A 1NTVA 3HW2B 2MFQA 2DN6A 3GYPA 5CLLB 2N0YA 2Z13A 4GXBA 2R0DA 1XODA 2XQNM 2H7EA 2GJYA 5DHFB 2G35A 4P7IA 2MWNB 2IFSA 3IVFA 2KIGA 5CLQB 2LOXA 3SV1A 4CSQA 2EMTA 2ZKMX 1WJ1A 2ROZB 2YF0A 5LONB 4HAVB 4C0AA 1SGHA 2KGXB 1P6SA 2DTCA 2D2QA 2RGNB 2QKMA 3A8QA 4Z2NA 4HATB 4IOYX 2VSZA 1RRPB 1WVHA 1DDMA 2NMBA 5M4YB 4ZRIA 3WA0A 3RCPA 2EMSA 1BAKA 2EJ8A 2UZSA 3X23A 2DHKA 2NZ8B 1FGZA 4B6HA 2ADZA 1UNQA 4HB0B 4DX8A 1TXDA 3PSCA 2ZPYA 4EMOA 1NI2A 1GC6A 1FHXA 3SUZA 2DX5A 2R09A 2Z0OA 3O96A 4K2PA 5D3XA 3B77A 4K81A 3DXDA 2LG1A 4A6FB 2DLWA 4DXAB 2D9WA 2YSZA 3FVCA 4F7UP 1U5FA 2V76A 3ML4A 4PQ0A 3VIAA 5DI9B 4TYZA 5JLJB 3UZTA 4GMXB 2AEHA 1W1DA 3NWFA 2HE7A 4Z2MB 2H7DA 2MKRA 2CRFA 3PEGA 1FGYA 1DYNA 1EAZA 4HAUB 4IFSA 3TW1A 3T06A 1OY2A 4L1RA 5D3VA 5DIFB 1ZC4B 5L81A 1UEFA 2M14A 3PVLA 1MI1A 5HE2A 1U5GA 5D27A 1ZSQA 2YVCA 4HHVA 3D8EA 3KY9A 3LJUX 4HB2B 4WSFA 2GCJA 2IYBA 2MDXA 3OHMB 2FJUB 2AL6A 2COAA 1WJMA 3ODWA 1EGXA 2D10A 1OQNA 2DYNA 2GUMA 3KZ1A 1W1GA 3D8DA 4ZRKA 3VOQA 4GPTB 2K00A 4OT1A 2COCA 3ULCA 5JP4A 3PVUA 4NY0A 4F7HA 2LULA 1P5TA 4OSNA 1MIZB 1X05A 4WVFB 1U27A 1Y19B 1B55A 2LYDA 2Z0PA 1I2HA 2RRFA 3AU5A 3KRWA 1J19A 5HE3A 1K5GB 4EJNA 4D0NB 1V61A 2W2WA 3PP2A 4K2OA 4HB4B 2JP2A 1QQGA 2KCJA 1DBHA 1Q67A 1E5WA 1MK7B 5C5BA 1FAOA 4GOUA 2D11A 2RSGA 4GMVA 4A5KA 1FOEA 2DYQA 2YS1A 4K17A 2L1CA 2Y8GA 4A6HA 3HSAA 2Z14A 2P0DA 1MAIA 4GN1A 4DX90 3TO1A 1UNPA 2KUQA 1XX0A 1U5EA 4KVGB 1ZYIA 2Z59A 4KHBA 3A98B 1DDWA 2DX1A 5J3TA 2LOZA 1P3RA 4DIXA 2VRWB 1X1GA 1T77A 5I2SA 4D6WA 5D3YA 4KHOA 1N3HA 5KQ4A 2ELBA 2Q13A 2Y7BA 2KUPA 3WYFB 1XCGA
chains in the Genus database with same CATH topology
2ROVA 2D9XA 2J0JA 3PZDA 1OMWA 3MPXA 1Y5OA 1DROA 2YS3A 2I1JA 4Y94A 5C16A 4MK0A 5LOPB 1UNRA 1V5UA 3ZDTA 5DH9B 4EKUA 2K2JA 1U5DA 4KHAA 3ZVRA 3FEHA 3N7CA 1X1FA 3ULBA 4A6KA 2VKIA 4BBKA 2YT1A 1DDVA 5J3YA 1U29A 5KCVA 3CIKA 1H10A 2UZRA 1V5PA 5C5BB 5JHGA 2P0FA 1GG3A 4IAPA 4CHMA 3KSYA 4HAZB 1KZ7A 3OANA 4HAWB 3F5RA 4CHJA 4KHBB 3U7DA 1MK9B 2LKOA 3V5WA 2RVBB 3SO6A 2CY4A 2I5CA 1J0WA 2OQBA 1W1HA 2K2UA 1K5DB 1SHCA 3PG7A 1GC7A 4HDOA 3A8PA 3ODOA 3FSSA 2E2XA 2DHIA 2ELAA 3MDBC 2P8VA 1X86A 2HTHB 2CY5A 4H8SA 5C79A 3TCAA 1LW3A 4HB3B 1KI1B 3BINA 1PLSA 2GS0A 1XR0B 2COFA 1FHOA 1NTYA 1ISNA 2FJLA 2W2XC 1XKEA 2J0KA 4TKNA 1WG7A 2EC1A 2OTXA 4KAXB 2Y8FA 2D9VA 4XWXA 1FHWA 5HE0A 1WGUA 5FI0A 3HK0A 2Z0QA 5FI1A 3P7ZA 2J0MA 3ODXA 2D9YA 1WI1A 2RNRB 1KZGA 4MY6A 2DHJA 1IRSA 3DXCA 1V88A 3M1IB 1AWEA 3QBVB 5KQ1A 1BTKA 2X18A 2DKQA 2YS5A 4MT7A 2I1KA 3KRXA 3HQCA 3PVWA 4ZRJA 1PFJA 2P0HA 1FB8A 3D8FA 4CYEA 5JHHA 4HDQA 4L6EA 2DA0A 2BCJA 1ZC3B 1EVHA 1MKEA 2J59M 3U8ZA 2YRYA 2CODA 3SYXA 1PMSA 1TJ6A 2D4QA 3FM8C 1BTNA 5C6RA 4GZUA 5D3WA 4WJ7A 4YONA 1AQCA 3AU4A 5EFXA 1MPHA 2YT0A 3AJ4A 2QKLA 5J3QA 1I7AA 2CAYA 1BWNA 2DKPA 2RLOA 1WGQA 3CXBB 4HAXB 2DFKA 1M7RA 3GYOA 1TQZA 2RUKB 4DBBA 1H4RA 1MIXA 1XD4A 3P6AA 4HAYB 2GCLA 4PNKA 1V5MA 2D9ZA 3G9WA 2PZ1A 2I5FA 3QIJA 1Z87A 1LB1A 5GOWB 4A6FA 2UVMA 3TVVA 3NSUA 4F7GA 5DHAB 4NSWA 1V89A 1ZVRA 3SNHA 1RJ2A 3F0WA 3DXEA 1EF1A 1M7EA 1QC6A 3BJIA 2L2IA 5HE1A 1ZM0A 2W2XD 3TFMA 1NU2A 1U2BA 1UPQA 3QWMA 1UPRA 2M38A 4YL8A 2N23A 1X11A 1NTVA 3HW2B 2MFQA 2DN6A 3GYPA 5CLLB 2N0YA 4GXBA 2R0DA 1XODA 2XQNM 2H7EA 2GJYA 5DHFB 2G35A 4P7IA 2MWNB 2IFSA 3IVFA 5CLQB 2LOXA 3SV1A 2EMTA 1WJ1A 2ROZB 2YF0A 5LONB 4HAVB 4C0AA 1SGHA 2KGXB 1P6SA 2DTCA 2D2QA 2RGNB 2QKMA 3A8QA 4Z2NA 4HATB 4IOYX 2VSZA 1RRPB 1WVHA 1DDMA 2NMBA 4ZRIA 3WA0A 3RCPA 2EMSA 1BAKA 2EJ8A 2UZSA 3X23A 2DHKA 2NZ8B 1FGZA 4B6HA 2ADZA 1UNQA 4HB0B 4DX8A 1TXDA 3PSCA 2ZPYA 4EMOA 1NI2A 1GC6A 1FHXA 3SUZA 2DX5A 2R09A 2Z0OA 3O96A 4K2PA 5D3XA 4K81A 3DXDA 2LG1A 4A6FB 2DLWA 4DXAB 2D9WA 2YSZA 4F7UP 1U5FA 2V76A 3ML4A 4PQ0A 3VIAA 5DI9B 4TYZA 5JLJB 3UZTA 4GMXB 2AEHA 1W1DA 2HE7A 4Z2MB 2H7DA 2MKRA 2CRFA 3PEGA 1FGYA 1DYNA 1EAZA 4HAUB 4IFSA 3TW1A 3T06A 1OY2A 5D3VA 5DIFB 1ZC4B 5L81A 1UEFA 2M14A 3PVLA 5HE2A 1U5GA 5D27A 1ZSQA 2YVCA 4HHVA 3D8EA 3KY9A 3LJUX 4HB2B 4WSFA 2GCJA 2IYBA 2MDXA 2AL6A 2COAA 1WJMA 3ODWA 1EGXA 2D10A 1OQNA 2DYNA 3KZ1A 1W1GA 3D8DA 4ZRKA 3VOQA 4GPTB 2K00A 2COCA 3ULCA 5JP4A 3PVUA 4NY0A 4F7HA 2LULA 1P5TA 1MIZB 1X05A 4WVFB 1U27A 1Y19B 1B55A 2LYDA 2Z0PA 1I2HA 3AU5A 3KRWA 1J19A 5HE3A 1K5GB 4EJNA 4D0NB 1V61A 2W2WA 3PP2A 4K2OA 4HB4B 2JP2A 1QQGA 2KCJA 1DBHA 1Q67A 1E5WA 1MK7B 5C5BA 1FAOA 2D11A 2RSGA 4GMVA 4A5KA 1FOEA 2DYQA 2YS1A 4K17A 2L1CA 2Y8GA 4A6HA 2P0DA 1MAIA 4GN1A 4DX90 3TO1A 1UNPA 1XX0A 1U5EA 4KVGB 3A98B 1DDWA 2DX1A 5J3TA 2LOZA 1P3RA 2VRWB 1X1GA 5D3YA 4KHOA 1N3HA 5KQ4A 2ELBA 2Q13A 2Y7BA 2KUPA 3WYFB 1XCGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ROV A;  2D9X A;  2J0J A;  3PZD A;  1OMW A;  3MPX A;  1Y5O A;  1DRO A;  2YS3 A;  2I1J A;  4Y94 A;  5C16 A;  4MK0 A;  5LOP B;  1UNR A;  1V5U A;  3ZDT A;  5DH9 B;  4EKU A;  2K2J A;  1U5D A;  4KHA A;  3ZVR A;  3FEH A;  3N7C A;  1X1F A;  3ULB A;  4A6K A;  2VKI A;  4BBK A;  2YT1 A;  1DDV A;  5J3Y A;  1U29 A;  5KCV A;  3CIK A;  1H10 A;  2UZR A;  1V5P A;  5C5B B;  5JHG A;  2P0F A;  1GG3 A;  4IAP A;  4CHM A;  3KSY A;  4HAZ B;  1KZ7 A;  3OAN A;  4HAW B;  3F5R A;  4CHJ A;  4KHB B;  3U7D A;  1MK9 B;  2LKO A;  3V5W A;  2RVB B;  3SO6 A;  2CY4 A;  2I5C A;  1J0W A;  2OQB A;  1W1H A;  2K2U A;  1K5D B;  1SHC A;  3PG7 A;  1GC7 A;  4HDO A;  3A8P A;  3ODO A;  3FSS A;  2E2X A;  2DHI A;  2ELA A;  3MDB C;  2P8V A;  1X86 A;  2HTH B;  2CY5 A;  4H8S A;  5C79 A;  3TCA A;  1LW3 A;  4HB3 B;  1KI1 B;  3BIN A;  1PLS A;  2GS0 A;  1XR0 B;  2COF A;  1FHO A;  1NTY A;  1ISN A;  2FJL A;  2W2X C;  1XKE A;  2J0K A;  4TKN A;  1WG7 A;  2EC1 A;  2OTX A;  4KAX B;  2Y8F A;  2D9V A;  4XWX A;  1FHW A;  5HE0 A;  1WGU A;  5FI0 A;  3HK0 A;  2Z0Q A;  5FI1 A;  3P7Z A;  2J0M A;  3ODX A;  2D9Y A;  1WI1 A;  2RNR B;  1KZG A;  4MY6 A;  2DHJ A;  1IRS A;  3DXC A;  1V88 A;  3M1I B;  1AWE A;  3QBV B;  5KQ1 A;  1BTK A;  2X18 A;  2DKQ A;  2YS5 A;  4MT7 A;  2I1K A;  3KRX A;  3HQC A;  3PVW A;  4ZRJ A;  1PFJ A;  2P0H A;  1FB8 A;  3D8F A;  4CYE A;  5JHH A;  4HDQ A;  4L6E A;  2DA0 A;  2BCJ A;  1ZC3 B;  1EVH A;  1MKE A;  2J59 M;  3U8Z A;  2YRY A;  2COD A;  3SYX A;  1PMS A;  1TJ6 A;  2D4Q A;  3FM8 C;  1BTN A;  5C6R A;  4GZU A;  5D3W A;  4WJ7 A;  4YON A;  1AQC A;  3AU4 A;  5EFX A;  1MPH A;  2YT0 A;  3AJ4 A;  2QKL A;  5J3Q A;  1I7A A;  2CAY A;  1BWN A;  2DKP A;  2RLO A;  1WGQ A;  3CXB B;  4HAX B;  2DFK A;  1M7R A;  3GYO A;  1TQZ A;  2RUK B;  4DBB A;  1H4R A;  1MIX A;  1XD4 A;  3P6A A;  4HAY B;  2GCL A;  4PNK A;  1V5M A;  2D9Z A;  3G9W A;  2PZ1 A;  2I5F A;  3QIJ A;  1Z87 A;  1LB1 A;  5GOW B;  4A6F A;  2UVM A;  3TVV A;  3NSU A;  4F7G A;  5DHA B;  4NSW A;  1V89 A;  1ZVR A;  3SNH A;  1RJ2 A;  3F0W A;  3DXE A;  1EF1 A;  1M7E A;  1QC6 A;  3BJI A;  2L2I A;  5HE1 A;  1ZM0 A;  2W2X D;  3TFM A;  1NU2 A;  1U2B A;  1UPQ A;  3QWM A;  1UPR A;  2M38 A;  4YL8 A;  2N23 A;  1X11 A;  1NTV A;  3HW2 B;  2MFQ A;  2DN6 A;  3GYP A;  5CLL B;  2N0Y A;  4GXB A;  2R0D A;  1XOD A;  2XQN M;  2H7E A;  2GJY A;  5DHF B;  2G35 A;  4P7I A;  2MWN B;  2IFS A;  3IVF A;  5CLQ B;  2LOX A;  3SV1 A;  2EMT A;  1WJ1 A;  2ROZ B;  2YF0 A;  5LON B;  4HAV B;  4C0A A;  1SGH A;  2KGX B;  1P6S A;  2DTC A;  2D2Q A;  2RGN B;  2QKM A;  3A8Q A;  4Z2N A;  4HAT B;  4IOY X;  2VSZ A;  1RRP B;  1WVH A;  1DDM A;  2NMB A;  4ZRI A;  3WA0 A;  3RCP A;  2EMS A;  1BAK A;  2EJ8 A;  2UZS A;  3X23 A;  2DHK A;  2NZ8 B;  1FGZ A;  4B6H A;  2ADZ A;  1UNQ A;  4HB0 B;  4DX8 A;  1TXD A;  3PSC A;  2ZPY A;  4EMO A;  1NI2 A;  1GC6 A;  1FHX A;  3SUZ A;  2DX5 A;  2R09 A;  2Z0O A;  3O96 A;  4K2P A;  5D3X A;  4K81 A;  3DXD A;  2LG1 A;  4A6F B;  2DLW A;  4DXA B;  2D9W A;  2YSZ A;  4F7U P;  1U5F A;  2V76 A;  3ML4 A;  4PQ0 A;  3VIA A;  5DI9 B;  4TYZ A;  5JLJ B;  3UZT A;  4GMX B;  2AEH A;  1W1D A;  2HE7 A;  4Z2M B;  2H7D A;  2MKR A;  2CRF A;  3PEG A;  1FGY A;  1DYN A;  1EAZ A;  4HAU B;  4IFS A;  3TW1 A;  3T06 A;  1OY2 A;  5D3V A;  5DIF B;  1ZC4 B;  5L81 A;  1UEF A;  2M14 A;  3PVL A;  5HE2 A;  1U5G A;  5D27 A;  1ZSQ A;  2YVC A;  4HHV A;  3D8E A;  3KY9 A;  3LJU X;  4HB2 B;  4WSF A;  2GCJ A;  2IYB A;  2MDX A;  2AL6 A;  2COA A;  1WJM A;  3ODW A;  1EGX A;  2D10 A;  1OQN A;  2DYN A;  3KZ1 A;  1W1G A;  3D8D A;  4ZRK A;  3VOQ A;  4GPT B;  2K00 A;  2COC A;  3ULC A;  5JP4 A;  3PVU A;  4NY0 A;  4F7H A;  2LUL A;  1P5T A;  1MIZ B;  1X05 A;  4WVF B;  1U27 A;  1Y19 B;  1B55 A;  2LYD A;  2Z0P A;  1I2H A;  3AU5 A;  3KRW A;  1J19 A;  5HE3 A;  1K5G B;  4EJN A;  4D0N B;  1V61 A;  2W2W A;  3PP2 A;  4K2O A;  4HB4 B;  2JP2 A;  1QQG A;  2KCJ A;  1DBH A;  1Q67 A;  1E5W A;  1MK7 B;  5C5B A;  1FAO A;  2D11 A;  2RSG A;  4GMV A;  4A5K A;  1FOE A;  2DYQ A;  2YS1 A;  4K17 A;  2L1C A;  2Y8G A;  4A6H A;  2P0D A;  1MAI A;  4GN1 A;  4DX9 0;  3TO1 A;  1UNP A;  1XX0 A;  1U5E A;  4KVG B;  3A98 B;  1DDW A;  2DX1 A;  5J3T A;  2LOZ A;  1P3R A;  2VRW B;  1X1G A;  5D3Y A;  4KHO A;  1N3H A;  5KQ4 A;  2ELB A;  2Q13 A;  2Y7B A;  2KUP A;  3WYF B;  1XCG A; 
#chains in the Genus database with same CATH topology
 2ROV A;  2D9X A;  2J0J A;  3PZD A;  1OMW A;  3MPX A;  1Y5O A;  1DRO A;  2YS3 A;  2I1J A;  4Y94 A;  5C16 A;  4MK0 A;  5LOP B;  5LG4 B;  1UNR A;  2K49 A;  1V5U A;  3ZDT A;  5DH9 B;  4EKU A;  2K2J A;  1U5D A;  4GNK B;  4KHA A;  3ZVR A;  3FEH A;  3N7C A;  1X1F A;  3ULB A;  4A6K A;  2VKI A;  4BBK A;  2YT2 A;  2YT1 A;  1DDV A;  4QJ4 B;  5J3Y A;  1U29 A;  5KCV A;  3CIK A;  1H10 A;  2UZR A;  1V5P A;  5C5B B;  5JHG A;  2P0F A;  1GG3 A;  4IAP A;  4CHM A;  3KSY A;  4HAZ B;  5IRS A;  1KZ7 A;  3OAN A;  4HSI A;  4HAW B;  3F5R A;  4CHJ A;  4KHB B;  3U7D A;  1MK9 B;  2LKO A;  3V5W A;  2RVB B;  3SO6 A;  2CY4 A;  2I5C A;  1J0W A;  2OQB A;  1W1H A;  2K2U A;  1K5D B;  1SHC A;  3PG7 A;  1GC7 A;  4HDO A;  3A8P A;  3ODO A;  3FSS A;  2E2X A;  2DHI A;  2ELA A;  3MDB C;  2NBV A;  4QXA B;  2P8V A;  1X86 A;  2HTH B;  2CY5 A;  4H8S A;  5C79 A;  3HIE A;  3TCA A;  1LW3 A;  4HB3 B;  1KI1 B;  3BIN A;  1PLS A;  2GS0 A;  1XR0 B;  2COF A;  1FHO A;  1NTY A;  2R2Y A;  1ISN A;  2FJL A;  2W2X C;  1XKE A;  4QJ3 B;  2J0K A;  4TKN A;  1WG7 A;  2EC1 A;  2OTX A;  4KAX B;  2Y8F A;  2D9V A;  4XWX A;  1FHW A;  5HE0 A;  1WGU A;  5FI0 A;  3HK0 A;  2Z0Q A;  3A58 A;  4QJ5 B;  5FI1 A;  3P7Z A;  2J0M A;  3ODX A;  2D9Y A;  1WI1 A;  2RNR B;  3NWD A;  1KZG A;  4MY6 A;  2DHJ A;  1IRS A;  3DXC A;  1V88 A;  3M1I B;  1AWE A;  3QBV B;  5KQ1 A;  1BTK A;  2X18 A;  2DKQ A;  2YS5 A;  2K8E A;  4MT7 A;  2I1K A;  3KRX A;  3HQC A;  3PVW A;  4ZRJ A;  1PFJ A;  2P0H A;  1FB8 A;  3D8F A;  4CYE A;  5JHH A;  2Z4D A;  4HDQ A;  3U12 A;  4L6E A;  2DA0 A;  2BCJ A;  3NW8 A;  1ZC3 B;  1EVH A;  1MKE A;  2J59 M;  3U8Z A;  2YRY A;  2COD A;  3SYX A;  1PMS A;  1TJ6 A;  2D4Q A;  3FM8 C;  1BTN A;  5C6R A;  4GZU A;  5D3W A;  4WJ7 A;  4YON A;  1AQC A;  3AU4 A;  5EFX A;  1MPH A;  2YT0 A;  3AJ4 A;  5I2M A;  2QKL A;  5J3Q A;  1I7A A;  2CAY A;  1BWN A;  2DKP A;  2RLO A;  1WGQ A;  3CXB B;  4HAX B;  2DFK A;  1M7R A;  3GYO A;  1TQZ A;  2RUK B;  4DBB A;  1H4R A;  1MIX A;  1XD4 A;  3P6A A;  4HAY B;  2GCL A;  4PNK A;  1V5M A;  2D9Z A;  3DCX A;  3G9W A;  2PZ1 A;  2I5F A;  3QIJ A;  1Z87 A;  1LB1 A;  2KIE A;  5GOW B;  4A6F A;  2UVM A;  3TVV A;  3NWA A;  3NSU A;  4F7G A;  5DHA B;  4NSW A;  1V89 A;  1ZVR A;  3SNH A;  1RJ2 A;  3F0W A;  3DXE A;  1EF1 A;  1M7E A;  1QC6 A;  3BJI A;  2L2I A;  5HE1 A;  1ZM0 A;  2KR0 A;  2W2X D;  3TFM A;  1NU2 A;  1U2B A;  1UPQ A;  3QWM A;  1UPR A;  2M38 A;  4YL8 A;  2N23 A;  1X11 A;  1NTV A;  3HW2 B;  2MFQ A;  2DN6 A;  3GYP A;  5CLL B;  2N0Y A;  2Z13 A;  4GXB A;  2R0D A;  1XOD A;  2XQN M;  2H7E A;  2GJY A;  5DHF B;  2G35 A;  4P7I A;  2MWN B;  2IFS A;  3IVF A;  2KIG A;  5CLQ B;  2LOX A;  3SV1 A;  4CSQ A;  2EMT A;  2ZKM X;  1WJ1 A;  2ROZ B;  2YF0 A;  5LON B;  4HAV B;  4C0A A;  1SGH A;  2KGX B;  1P6S A;  2DTC A;  2D2Q A;  2RGN B;  2QKM A;  3A8Q A;  4Z2N A;  4HAT B;  4IOY X;  2VSZ A;  1RRP B;  1WVH A;  1DDM A;  2NMB A;  5M4Y B;  4ZRI A;  3WA0 A;  3RCP A;  2EMS A;  1BAK A;  2EJ8 A;  2UZS A;  3X23 A;  2DHK A;  2NZ8 B;  1FGZ A;  4B6H A;  2ADZ A;  1UNQ A;  4HB0 B;  4DX8 A;  1TXD A;  3PSC A;  2ZPY A;  4EMO A;  1NI2 A;  1GC6 A;  1FHX A;  3SUZ A;  2DX5 A;  2R09 A;  2Z0O A;  3O96 A;  4K2P A;  5D3X A;  3B77 A;  4K81 A;  3DXD A;  2LG1 A;  4A6F B;  2DLW A;  4DXA B;  2D9W A;  2YSZ A;  3FVC A;  4F7U P;  1U5F A;  2V76 A;  3ML4 A;  4PQ0 A;  3VIA A;  5DI9 B;  4TYZ A;  5JLJ B;  3UZT A;  4GMX B;  2AEH A;  1W1D A;  3NWF A;  2HE7 A;  4Z2M B;  2H7D A;  2MKR A;  2CRF A;  3PEG A;  1FGY A;  1DYN A;  1EAZ A;  4HAU B;  4IFS A;  3TW1 A;  3T06 A;  1OY2 A;  4L1R A;  5D3V A;  5DIF B;  1ZC4 B;  5L81 A;  1UEF A;  2M14 A;  3PVL A;  1MI1 A;  5HE2 A;  1U5G A;  5D27 A;  1ZSQ A;  2YVC A;  4HHV A;  3D8E A;  3KY9 A;  3LJU X;  4HB2 B;  4WSF A;  2GCJ A;  2IYB A;  2MDX A;  3OHM B;  2FJU B;  2AL6 A;  2COA A;  1WJM A;  3ODW A;  1EGX A;  2D10 A;  1OQN A;  2DYN A;  2GUM A;  3KZ1 A;  1W1G A;  3D8D A;  4ZRK A;  3VOQ A;  4GPT B;  2K00 A;  4OT1 A;  2COC A;  3ULC A;  5JP4 A;  3PVU A;  4NY0 A;  4F7H A;  2LUL A;  1P5T A;  4OSN A;  1MIZ B;  1X05 A;  4WVF B;  1U27 A;  1Y19 B;  1B55 A;  2LYD A;  2Z0P A;  1I2H A;  2RRF A;  3AU5 A;  3KRW A;  1J19 A;  5HE3 A;  1K5G B;  4EJN A;  4D0N B;  1V61 A;  2W2W A;  3PP2 A;  4K2O A;  4HB4 B;  2JP2 A;  1QQG A;  2KCJ A;  1DBH A;  1Q67 A;  1E5W A;  1MK7 B;  5C5B A;  1FAO A;  4GOU A;  2D11 A;  2RSG A;  4GMV A;  4A5K A;  1FOE A;  2DYQ A;  2YS1 A;  4K17 A;  2L1C A;  2Y8G A;  4A6H A;  3HSA A;  2Z14 A;  2P0D A;  1MAI A;  4GN1 A;  4DX9 0;  3TO1 A;  1UNP A;  2KUQ A;  1XX0 A;  1U5E A;  4KVG B;  1ZYI A;  2Z59 A;  4KHB A;  3A98 B;  1DDW A;  2DX1 A;  5J3T A;  2LOZ A;  1P3R A;  4DIX A;  2VRW B;  1X1G A;  1T77 A;  5I2S A;  4D6W A;  5D3Y A;  4KHO A;  1N3H A;  5KQ4 A;  2ELB A;  2Q13 A;  2Y7B A;  2KUP A;  3WYF B;  1XCG A; 
#chains in the Genus database with same CATH homology
 2ROV A;  2D9X A;  2J0J A;  3PZD A;  1OMW A;  3MPX A;  1Y5O A;  1DRO A;  2YS3 A;  2I1J A;  4Y94 A;  5C16 A;  4MK0 A;  5LOP B;  1UNR A;  1V5U A;  3ZDT A;  5DH9 B;  4EKU A;  2K2J A;  1U5D A;  4KHA A;  3ZVR A;  3FEH A;  3N7C A;  1X1F A;  3ULB A;  4A6K A;  2VKI A;  4BBK A;  2YT1 A;  1DDV A;  5J3Y A;  1U29 A;  5KCV A;  3CIK A;  1H10 A;  2UZR A;  1V5P A;  5C5B B;  5JHG A;  2P0F A;  1GG3 A;  4IAP A;  4CHM A;  3KSY A;  4HAZ B;  1KZ7 A;  3OAN A;  4HAW B;  3F5R A;  4CHJ A;  4KHB B;  3U7D A;  1MK9 B;  2LKO A;  3V5W A;  2RVB B;  3SO6 A;  2CY4 A;  2I5C A;  1J0W A;  2OQB A;  1W1H A;  2K2U A;  1K5D B;  1SHC A;  3PG7 A;  1GC7 A;  4HDO A;  3A8P A;  3ODO A;  3FSS A;  2E2X A;  2DHI A;  2ELA A;  3MDB C;  2P8V A;  1X86 A;  2HTH B;  2CY5 A;  4H8S A;  5C79 A;  3TCA A;  1LW3 A;  4HB3 B;  1KI1 B;  3BIN A;  1PLS A;  2GS0 A;  1XR0 B;  2COF A;  1FHO A;  1NTY A;  1ISN A;  2FJL A;  2W2X C;  1XKE A;  2J0K A;  4TKN A;  1WG7 A;  2EC1 A;  2OTX A;  4KAX B;  2Y8F A;  2D9V A;  4XWX A;  1FHW A;  5HE0 A;  1WGU A;  5FI0 A;  3HK0 A;  2Z0Q A;  5FI1 A;  3P7Z A;  2J0M A;  3ODX A;  2D9Y A;  1WI1 A;  2RNR B;  1KZG A;  4MY6 A;  2DHJ A;  1IRS A;  3DXC A;  1V88 A;  3M1I B;  1AWE A;  3QBV B;  5KQ1 A;  1BTK A;  2X18 A;  2DKQ A;  2YS5 A;  4MT7 A;  2I1K A;  3KRX A;  3HQC A;  3PVW A;  4ZRJ A;  1PFJ A;  2P0H A;  1FB8 A;  3D8F A;  4CYE A;  5JHH A;  4HDQ A;  4L6E A;  2DA0 A;  2BCJ A;  1ZC3 B;  1EVH A;  1MKE A;  2J59 M;  3U8Z A;  2YRY A;  2COD A;  3SYX A;  1PMS A;  1TJ6 A;  2D4Q A;  3FM8 C;  1BTN A;  5C6R A;  4GZU A;  5D3W A;  4WJ7 A;  4YON A;  1AQC A;  3AU4 A;  5EFX A;  1MPH A;  2YT0 A;  3AJ4 A;  2QKL A;  5J3Q A;  1I7A A;  2CAY A;  1BWN A;  2DKP A;  2RLO A;  1WGQ A;  3CXB B;  4HAX B;  2DFK A;  1M7R A;  3GYO A;  1TQZ A;  2RUK B;  4DBB A;  1H4R A;  1MIX A;  1XD4 A;  3P6A A;  4HAY B;  2GCL A;  4PNK A;  1V5M A;  2D9Z A;  3G9W A;  2PZ1 A;  2I5F A;  3QIJ A;  1Z87 A;  1LB1 A;  5GOW B;  4A6F A;  2UVM A;  3TVV A;  3NSU A;  4F7G A;  5DHA B;  4NSW A;  1V89 A;  1ZVR A;  3SNH A;  1RJ2 A;  3F0W A;  3DXE A;  1EF1 A;  1M7E A;  1QC6 A;  3BJI A;  2L2I A;  5HE1 A;  1ZM0 A;  2W2X D;  3TFM A;  1NU2 A;  1U2B A;  1UPQ A;  3QWM A;  1UPR A;  2M38 A;  4YL8 A;  2N23 A;  1X11 A;  1NTV A;  3HW2 B;  2MFQ A;  2DN6 A;  3GYP A;  5CLL B;  2N0Y A;  4GXB A;  2R0D A;  1XOD A;  2XQN M;  2H7E A;  2GJY A;  5DHF B;  2G35 A;  4P7I A;  2MWN B;  2IFS A;  3IVF A;  5CLQ B;  2LOX A;  3SV1 A;  2EMT A;  1WJ1 A;  2ROZ B;  2YF0 A;  5LON B;  4HAV B;  4C0A A;  1SGH A;  2KGX B;  1P6S A;  2DTC A;  2D2Q A;  2RGN B;  2QKM A;  3A8Q A;  4Z2N A;  4HAT B;  4IOY X;  2VSZ A;  1RRP B;  1WVH A;  1DDM A;  2NMB A;  4ZRI A;  3WA0 A;  3RCP A;  2EMS A;  1BAK A;  2EJ8 A;  2UZS A;  3X23 A;  2DHK A;  2NZ8 B;  1FGZ A;  4B6H A;  2ADZ A;  1UNQ A;  4HB0 B;  4DX8 A;  1TXD A;  3PSC A;  2ZPY A;  4EMO A;  1NI2 A;  1GC6 A;  1FHX A;  3SUZ A;  2DX5 A;  2R09 A;  2Z0O A;  3O96 A;  4K2P A;  5D3X A;  4K81 A;  3DXD A;  2LG1 A;  4A6F B;  2DLW A;  4DXA B;  2D9W A;  2YSZ A;  4F7U P;  1U5F A;  2V76 A;  3ML4 A;  4PQ0 A;  3VIA A;  5DI9 B;  4TYZ A;  5JLJ B;  3UZT A;  4GMX B;  2AEH A;  1W1D A;  2HE7 A;  4Z2M B;  2H7D A;  2MKR A;  2CRF A;  3PEG A;  1FGY A;  1DYN A;  1EAZ A;  4HAU B;  4IFS A;  3TW1 A;  3T06 A;  1OY2 A;  5D3V A;  5DIF B;  1ZC4 B;  5L81 A;  1UEF A;  2M14 A;  3PVL A;  5HE2 A;  1U5G A;  5D27 A;  1ZSQ A;  2YVC A;  4HHV A;  3D8E A;  3KY9 A;  3LJU X;  4HB2 B;  4WSF A;  2GCJ A;  2IYB A;  2MDX A;  2AL6 A;  2COA A;  1WJM A;  3ODW A;  1EGX A;  2D10 A;  1OQN A;  2DYN A;  3KZ1 A;  1W1G A;  3D8D A;  4ZRK A;  3VOQ A;  4GPT B;  2K00 A;  2COC A;  3ULC A;  5JP4 A;  3PVU A;  4NY0 A;  4F7H A;  2LUL A;  1P5T A;  1MIZ B;  1X05 A;  4WVF B;  1U27 A;  1Y19 B;  1B55 A;  2LYD A;  2Z0P A;  1I2H A;  3AU5 A;  3KRW A;  1J19 A;  5HE3 A;  1K5G B;  4EJN A;  4D0N B;  1V61 A;  2W2W A;  3PP2 A;  4K2O A;  4HB4 B;  2JP2 A;  1QQG A;  2KCJ A;  1DBH A;  1Q67 A;  1E5W A;  1MK7 B;  5C5B A;  1FAO A;  2D11 A;  2RSG A;  4GMV A;  4A5K A;  1FOE A;  2DYQ A;  2YS1 A;  4K17 A;  2L1C A;  2Y8G A;  4A6H A;  2P0D A;  1MAI A;  4GN1 A;  4DX9 0;  3TO1 A;  1UNP A;  1XX0 A;  1U5E A;  4KVG B;  3A98 B;  1DDW A;  2DX1 A;  5J3T A;  2LOZ A;  1P3R A;  2VRW B;  1X1G A;  5D3Y A;  4KHO A;  1N3H A;  5KQ4 A;  2ELB A;  2Q13 A;  2Y7B A;  2KUP A;  3WYF B;  1XCG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...