1QC6A

Evh1 domain from ena/vasp-like protein in complex with acta peptide
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
113
structure length
108
Chain Sequence
MSEQSICQARASVMVYDDTSKKWVPIKFSRINIYHNTASSTFRVVGVKLQDQQVVINYSIVKGLKYNQATPTFHQWRDARQVYGLNFASKEEATTFSNAMLFALNIMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of EVH1, a novel proline-rich ligand-binding module involved in cytoskeletal dynamics and neural function
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein
molecule keywords EVH1 DOMAIN FROM ENA/VASP-LIKE PROTEIN
total genus 20
structure length 108
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1qc6A00
3GYPA 4K2PA 3ODWA 1B55A 1MIXA 5LOPB 3ZVRA 3SYXA 5C79A 4PNKA 2DA0A 3P6AA 4K17A 5JP4A 1Q67A 1Y5OA 2E2XA 2V76A 5D3XA 4HHVA 2DFKA 5DIFB 3SNHA 1UEFA 2YT0A 4ZRIA 1Z87A 1WGUA 4Y94A 2P0DA 3DXEA 1BAKA 1X11A 4GMVA 2Y8GA 4PQ0A 2COCA 4XWXA 1H10A 2D11A 4IFSA 2X18A 1KZ7A 3TFMA 1EF1A 1GC6A 2DYQA 4K81A 3ULBA 1DYNA 3TW1A 4GMXB 2LG1A 2DX1A 2EC1A 2GCJA 2FJLA 2H7DA 3OANA 2GS0A 1GG3A 1K5DB 1WJ1A 1AQCA 5C5BA 4CHMA 1E5WA 4ZRJA 1MKEA 2DHIA 2RSGA 2R09A 2DYNA 3TCAA 4DX8A 2QKMA 2LKOA 4WVFB 2NZ8B 1DDVA 5KQ1A 2ELAA 3WYFB 1UPQA 1U5EA 4HDQA 2DTCA 1MK7B 1W1HA 3O96A 3PSCA 2PZ1A 1LW3A 5DHAB 2M14A 2Y8FA 1QC6A 5C5BB 1H4RA 5HE2A 3M1IB 4HB0B 4KHAA 3NSUA 4KVGB 2MFQA 4NSWA 2COFA 4DXAB 1BWNA 1V5PA 2JP2A 2IYBA 1FB8A 3KZ1A 1DDWA 4F7UP 4Z2NA 2YRYA 5HE3A 1ZSQA 2YS1A 2COAA 3KRWA 4D0NB 5JHGA 4IOYX 1V5UA 2IFSA 2G35A 1V89A 2Q13A 2DHKA 2J0JA 5LONB 2D9WA 2UZRA 2KUPA 1FHWA 4H8SA 2P0FA 3AU5A 5J3TA 1WJMA 3F5RA 3PG7A 2J0KA 1W1GA 2VKIA 2HE7A 2L1CA 3CXBB 2EJ8A 3F0WA 1MAIA 1U5GA 3U8ZA 2K00A 4GPTB 1SGHA 2KCJA 1XX0A 5CLLB 3TO1A 5FI0A 1X05A 5EFXA 3HQCA 1RRPB 4GZUA 1PLSA 5D3YA 2DKPA 2MDXA 4F7HA 5CLQB 2CODA 4HATB 1NTYA 1X1GA 3KY9A 1ZC3B 3BINA 1EVHA 5KQ4A 2DX5A 1MPHA 1ZVRA 4WSFA 1P5TA 2GCLA 4K2OA 1DROA 4F7GA 2ADZA 1EAZA 2EMTA 4A6KA 3D8FA 3RCPA 4KHBB 4ZRKA 1NI2A 1XODA 3AJ4A 2LULA 5HE0A 2I1JA 3ML4A 4HDOA 4MY6A 5JHHA 1XCGA 2H7EA 2Y7BA 2R0DA 3QWMA 1DDMA 3HW2B 2GJYA 2HTHB 5DI9B 2P0HA 2N23A 1WI1A 1GC7A 4IAPA 3N7CA 1X1FA 1MK9B 2Z0PA 3A98B 2RVBB 2RLOA 4EMOA 4KHOA 4TYZA 2D9XA 4BBKA 1V61A 3PVLA 2EMSA 3SUZA 1WG7A 2I5CA 3PP2A 1MIZB 3BJIA 1FOEA 2I1KA 1UPRA 1ZC4B 1I7AA 3PEGA 5J3YA 2ROZB 2D9YA 1Y19B 2AL6A 1J0WA 1N3HA 1LB1A 5J3QA 1OQNA 2VSZA 4HAVB 2OTXA 3PVWA 2W2XD 2N0YA 2DLWA 3D8DA 2QKLA 1BTNA 1XD4A 2UVMA 1UNPA 2D9ZA 3IVFA 3P7ZA 3TVVA 1QQGA 3PZDA 5DH9B 1W1DA 2Z0OA 1PMSA 1PFJA 1TXDA 2RNRB 5D3VA 1XR0B 2DHJA 1UNRA 2LOXA 2MKRA 4YONA 1AWEA 1WGQA 3LJUX 1X86A 1M7EA 5D27A 1KZGA 4HB3B 4DBBA 2MWNB 1J19A 3MPXA 4HAXB 2YF0A 1TJ6A 4P7IA 3PVUA 4YL8A 4MK0A 3QIJA 1EGXA 2M38A 2D10A 4B6HA 1RJ2A 2YS5A 5D3WA 2W2WA 3SV1A 4CYEA 2XQNM 3DXDA 5C6RA 1OY2A 4A5KA 2CY4A 2J0MA 3FEHA 3UZTA 2LOZA 1FAOA 3AU4A 2OQBA 4TKNA 3QBVB 4WJ7A 1UNQA 3T06A 3GYOA 4A6HA 1IRSA 4NY0A 4GXBA 3VOQA 4KAXB 1ZM0A 4HAUB 2CY5A 1DBHA 2AEHA 2RUKB 3A8QA 5DHFB 2YS3A 1OMWA 2DN6A 2CAYA 2YSZA 5GOWB 4L6EA 4HAYB 1V5MA 3V5WA 3MDBC 1NTVA 1M7RA 2I5FA 5C16A 1P6SA 1P3RA 3X23A 4EJNA 1U2BA 1V88A 3FM8C 2L2IA 2BCJA 3G9WA 2VRWB 4HB4B 2UZSA 2RGNB 3KRXA 1I2HA 1FGYA 1TQZA 2D4QA 2W2XC 4HB2B 2ZPYA 2J59M 1XKEA 4HAWB 3CIKA 3ULCA 1FGZA 2DKQA 2Z0QA 1K5GB 2LYDA 4CHJA 2KGXB 3SO6A 3DXCA 4HAZB 4DX90 2YT1A 1SHCA 1U5FA 1WVHA 1FHOA 1NU2A 2D9VA 1U27A 3ODOA 1U29A 2P8VA 4GN1A 3D8EA 1KI1B 2D2QA 3FSSA 2K2UA 2YVCA 4Z2MB 5KCVA 2K2JA 5HE1A 2ROVA 2CRFA 1FHXA 2ELBA 3ODXA 3ZDTA 3U7DA 2NMBA 5JLJB 4C0AA 5L81A 3VIAA 4EKUA 1ISNA 4A6FA 1U5DA 1BTKA 5FI1A 3WA0A 3A8PA 4MT7A 4A6FB 3HK0A 3KSYA
chains in the Genus database with same CATH superfamily
3GYPA 4K2PA 3ODWA 1B55A 1MIXA 5LOPB 3NWAA 3ZVRA 3SYXA 5C79A 4PNKA 2DA0A 3P6AA 4K17A 5JP4A 1Q67A 1Y5OA 2E2XA 2V76A 5D3XA 4HHVA 2DFKA 5DIFB 3SNHA 4GNKB 1UEFA 2YT0A 4ZRIA 4CSQA 5I2SA 1Z87A 1WGUA 4Y94A 2P0DA 3DXEA 1BAKA 1X11A 4GMVA 4D6WA 2Y8GA 4PQ0A 2COCA 4XWXA 1H10A 2D11A 4IFSA 2X18A 1KZ7A 3TFMA 1EF1A 1GC6A 2DYQA 4K81A 3ULBA 1T77A 1DYNA 3TW1A 4GMXB 2LG1A 2DX1A 2EC1A 2GCJA 2FJLA 2H7DA 3OANA 2GS0A 4DIXA 1GG3A 1K5DB 1WJ1A 1AQCA 5C5BA 4CHMA 1E5WA 4ZRJA 1MKEA 2DHIA 2RSGA 2R09A 2DYNA 3TCAA 4DX8A 2QKMA 2LKOA 4WVFB 2NBVA 2NZ8B 1DDVA 5KQ1A 2ELAA 3WYFB 2ZKMX 1UPQA 1U5EA 4HDQA 2DTCA 1MK7B 2RRFA 1W1HA 3O96A 3PSCA 2PZ1A 1LW3A 3NWDA 5DHAB 4QXAB 5LG4B 2M14A 2Y8FA 1ZYIA 2KIGA 1QC6A 4OT1A 5C5BB 1H4RA 5HE2A 3M1IB 4HB0B 4KHAA 3NSUA 4KVGB 2MFQA 4NSWA 2COFA 4DXAB 1BWNA 1V5PA 2JP2A 2IYBA 1FB8A 3KZ1A 1DDWA 4F7UP 4Z2NA 2YRYA 5HE3A 1ZSQA 2YS1A 2COAA 3KRWA 4D0NB 5JHGA 4IOYX 1V5UA 2IFSA 2G35A 1V89A 2Q13A 2DHKA 2J0JA 5LONB 2D9WA 2UZRA 2KIEA 2KUPA 1FHWA 4H8SA 2P0FA 3AU5A 5J3TA 1WJMA 3F5RA 3PG7A 2J0KA 1W1GA 3FVCA 2VKIA 2HE7A 2L1CA 3CXBB 3A58A 2EJ8A 3F0WA 1MAIA 1U5GA 2GUMA 3U8ZA 2K00A 4GPTB 1SGHA 2KCJA 1XX0A 5CLLB 3TO1A 5FI0A 1X05A 5EFXA 3HQCA 1RRPB 4GZUA 1PLSA 5D3YA 2DKPA 2MDXA 4F7HA 5CLQB 2CODA 4HATB 1NTYA 1X1GA 3KY9A 1ZC3B 4QJ5B 3BINA 4QJ3B 1EVHA 5KQ4A 2DX5A 1MPHA 1ZVRA 4WSFA 1P5TA 2GCLA 4K2OA 5M4YB 2R2YA 1DROA 4F7GA 2ADZA 1EAZA 2EMTA 4A6KA 3D8FA 3RCPA 4KHBB 4ZRKA 1NI2A 1XODA 3AJ4A 2LULA 5HE0A 2I1JA 3ML4A 4GOUA 4HDOA 4MY6A 5JHHA 1XCGA 2H7EA 2Y7BA 2R0DA 3QWMA 1DDMA 3HW2B 2GJYA 2HTHB 5DI9B 2P0HA 2N23A 1WI1A 3DCXA 1GC7A 4IAPA 3N7CA 1X1FA 1MK9B 2Z0PA 3A98B 2RVBB 2RLOA 4EMOA 4KHOA 4TYZA 3HSAA 2D9XA 4BBKA 1V61A 3PVLA 2EMSA 3SUZA 1WG7A 2I5CA 3PP2A 1MIZB 3BJIA 1FOEA 2I1KA 1UPRA 3PEGA 1I7AA 1ZC4B 5J3YA 2ROZB 2D9YA 1Y19B 2AL6A 1J0WA 1N3HA 1LB1A 5J3QA 1OQNA 2VSZA 4HAVB 3HIEA 2OTXA 3PVWA 2W2XD 2N0YA 2DLWA 1MI1A 2Z59A 3D8DA 2QKLA 1BTNA 1XD4A 2UVMA 1UNPA 2D9ZA 3IVFA 3P7ZA 3TVVA 1QQGA 3PZDA 5DH9B 1W1DA 2Z0OA 3U12A 1PMSA 1PFJA 1TXDA 2RNRB 5D3VA 1XR0B 2DHJA 4QJ4B 1UNRA 2LOXA 2MKRA 4YONA 1AWEA 1WGQA 3LJUX 1X86A 1M7EA 5D27A 1KZGA 4HB3B 4DBBA 2MWNB 1J19A 4KHBA 3MPXA 2KR0A 4HAXB 2FJUB 2YF0A 1TJ6A 4P7IA 3PVUA 4YL8A 2Z13A 4MK0A 3QIJA 1EGXA 2M38A 2D10A 4B6HA 1RJ2A 3NW8A 2YS5A 5D3WA 2W2WA 3SV1A 4CYEA 2XQNM 3DXDA 5C6RA 1OY2A 4A5KA 2CY4A 2J0MA 3FEHA 3UZTA 2LOZA 1FAOA 3AU4A 2OQBA 4TKNA 3QBVB 4WJ7A 5IRSA 1UNQA 3T06A 3GYOA 4A6HA 1IRSA 4NY0A 4GXBA 3VOQA 4KAXB 1ZM0A 4HAUB 2CY5A 1DBHA 2AEHA 2RUKB 3A8QA 5DHFB 2YS3A 1OMWA 2DN6A 2CAYA 2YSZA 5GOWB 4L6EA 4HAYB 1V5MA 3V5WA 3MDBC 1NTVA 1M7RA 2I5FA 5C16A 1P6SA 1P3RA 3X23A 4EJNA 1U2BA 1V88A 3FM8C 2L2IA 2BCJA 3G9WA 2VRWB 4HB4B 2UZSA 2RGNB 4L1RA 3KRXA 2YT2A 1I2HA 1FGYA 1TQZA 2D4QA 2Z14A 2W2XC 4HB2B 2ZPYA 2J59M 1XKEA 4HAWB 3CIKA 3ULCA 3B77A 1FGZA 2DKQA 2Z0QA 2Z4DA 1K5GB 2LYDA 4CHJA 2KGXB 3SO6A 2K49A 3DXCA 4HAZB 4DX90 2YT1A 1SHCA 1U5FA 4OSNA 1WVHA 1FHOA 2K8EA 1NU2A 2D9VA 1U27A 3ODOA 1U29A 2P8VA 4GN1A 3D8EA 1KI1B 2D2QA 3FSSA 2K2UA 2YVCA 4Z2MB 5KCVA 2K2JA 5HE1A 5I2MA 4HSIA 2ROVA 2CRFA 1FHXA 2ELBA 3ODXA 3ZDTA 3U7DA 2NMBA 5JLJB 4C0AA 5L81A 3VIAA 2KUQA 4EKUA 1ISNA 4A6FA 3NWFA 1U5DA 1BTKA 5FI1A 3WA0A 3OHMB 3A8PA 4MT7A 4A6FB 3HK0A 3KSYA
chains in the Genus database with same CATH topology
3GYPA 4K2PA 3ODWA 1B55A 1MIXA 5LOPB 3ZVRA 3SYXA 5C79A 4PNKA 2DA0A 3P6AA 4K17A 5JP4A 1Q67A 1Y5OA 2E2XA 2V76A 5D3XA 4HHVA 2DFKA 5DIFB 3SNHA 1UEFA 2YT0A 4ZRIA 1Z87A 1WGUA 4Y94A 2P0DA 3DXEA 1BAKA 1X11A 4GMVA 2Y8GA 4PQ0A 2COCA 4XWXA 1H10A 2D11A 4IFSA 2X18A 1KZ7A 3TFMA 1EF1A 1GC6A 2DYQA 4K81A 3ULBA 1DYNA 3TW1A 4GMXB 2LG1A 2DX1A 2EC1A 2GCJA 2FJLA 2H7DA 3OANA 2GS0A 1GG3A 1K5DB 1WJ1A 1AQCA 5C5BA 4CHMA 1E5WA 4ZRJA 1MKEA 2DHIA 2RSGA 2R09A 2DYNA 3TCAA 4DX8A 2QKMA 2LKOA 4WVFB 2NZ8B 1DDVA 5KQ1A 2ELAA 3WYFB 1UPQA 1U5EA 4HDQA 2DTCA 1MK7B 1W1HA 3O96A 3PSCA 2PZ1A 1LW3A 5DHAB 2M14A 2Y8FA 1QC6A 5C5BB 1H4RA 5HE2A 3M1IB 4HB0B 4KHAA 3NSUA 4KVGB 2MFQA 4NSWA 2COFA 4DXAB 1BWNA 1V5PA 2JP2A 2IYBA 1FB8A 3KZ1A 1DDWA 4F7UP 4Z2NA 2YRYA 5HE3A 1ZSQA 2YS1A 2COAA 3KRWA 4D0NB 5JHGA 4IOYX 1V5UA 2IFSA 2G35A 1V89A 2Q13A 2DHKA 2J0JA 5LONB 2D9WA 2UZRA 2KUPA 1FHWA 4H8SA 2P0FA 3AU5A 5J3TA 1WJMA 3F5RA 3PG7A 2J0KA 1W1GA 2VKIA 2HE7A 2L1CA 3CXBB 2EJ8A 3F0WA 1MAIA 1U5GA 3U8ZA 2K00A 4GPTB 1SGHA 2KCJA 1XX0A 5CLLB 3TO1A 5FI0A 1X05A 5EFXA 3HQCA 1RRPB 4GZUA 1PLSA 5D3YA 2DKPA 2MDXA 4F7HA 5CLQB 2CODA 4HATB 1NTYA 1X1GA 3KY9A 1ZC3B 3BINA 1EVHA 5KQ4A 2DX5A 1MPHA 1ZVRA 4WSFA 1P5TA 2GCLA 4K2OA 1DROA 4F7GA 2ADZA 1EAZA 2EMTA 4A6KA 3D8FA 3RCPA 4KHBB 4ZRKA 1NI2A 1XODA 3AJ4A 2LULA 5HE0A 2I1JA 3ML4A 4HDOA 4MY6A 5JHHA 1XCGA 2H7EA 2Y7BA 2R0DA 3QWMA 1DDMA 3HW2B 2GJYA 2HTHB 5DI9B 2P0HA 2N23A 1WI1A 1GC7A 4IAPA 3N7CA 1X1FA 1MK9B 2Z0PA 3A98B 2RVBB 2RLOA 4EMOA 4KHOA 4TYZA 2D9XA 4BBKA 1V61A 3PVLA 2EMSA 3SUZA 1WG7A 2I5CA 3PP2A 1MIZB 3BJIA 1FOEA 2I1KA 1UPRA 1ZC4B 1I7AA 3PEGA 5J3YA 2ROZB 2D9YA 1Y19B 2AL6A 1J0WA 1N3HA 1LB1A 5J3QA 1OQNA 2VSZA 4HAVB 2OTXA 3PVWA 2W2XD 2N0YA 2DLWA 3D8DA 2QKLA 1BTNA 1XD4A 2UVMA 1UNPA 2D9ZA 3IVFA 3P7ZA 3TVVA 1QQGA 3PZDA 5DH9B 1W1DA 2Z0OA 1PMSA 1PFJA 1TXDA 2RNRB 5D3VA 1XR0B 2DHJA 1UNRA 2LOXA 2MKRA 4YONA 1AWEA 1WGQA 3LJUX 1X86A 1M7EA 5D27A 1KZGA 4HB3B 4DBBA 2MWNB 1J19A 3MPXA 4HAXB 2YF0A 1TJ6A 4P7IA 3PVUA 4YL8A 4MK0A 3QIJA 1EGXA 2M38A 2D10A 4B6HA 1RJ2A 2YS5A 5D3WA 2W2WA 3SV1A 4CYEA 2XQNM 3DXDA 5C6RA 1OY2A 4A5KA 2CY4A 2J0MA 3FEHA 3UZTA 2LOZA 1FAOA 3AU4A 2OQBA 4TKNA 3QBVB 4WJ7A 1UNQA 3T06A 3GYOA 4A6HA 1IRSA 4NY0A 4GXBA 3VOQA 4KAXB 1ZM0A 4HAUB 2CY5A 1DBHA 2AEHA 2RUKB 3A8QA 5DHFB 2YS3A 1OMWA 2DN6A 2CAYA 2YSZA 5GOWB 4L6EA 4HAYB 1V5MA 3V5WA 3MDBC 1NTVA 1M7RA 2I5FA 5C16A 1P6SA 1P3RA 3X23A 4EJNA 1U2BA 1V88A 3FM8C 2L2IA 2BCJA 3G9WA 2VRWB 4HB4B 2UZSA 2RGNB 3KRXA 1I2HA 1FGYA 1TQZA 2D4QA 2W2XC 4HB2B 2ZPYA 2J59M 1XKEA 4HAWB 3CIKA 3ULCA 1FGZA 2DKQA 2Z0QA 1K5GB 2LYDA 4CHJA 2KGXB 3SO6A 3DXCA 4HAZB 4DX90 2YT1A 1SHCA 1U5FA 1WVHA 1FHOA 1NU2A 2D9VA 1U27A 3ODOA 1U29A 2P8VA 4GN1A 3D8EA 1KI1B 2D2QA 3FSSA 2K2UA 2YVCA 4Z2MB 5KCVA 2K2JA 5HE1A 2ROVA 2CRFA 1FHXA 2ELBA 3ODXA 3ZDTA 3U7DA 2NMBA 5JLJB 4C0AA 5L81A 3VIAA 4EKUA 1ISNA 4A6FA 1U5DA 1BTKA 5FI1A 3WA0A 3A8PA 4MT7A 4A6FB 3HK0A 3KSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GYP A;  4K2P A;  3ODW A;  1B55 A;  1MIX A;  5LOP B;  3ZVR A;  3SYX A;  5C79 A;  4PNK A;  2DA0 A;  3P6A A;  4K17 A;  5JP4 A;  1Q67 A;  1Y5O A;  2E2X A;  2V76 A;  5D3X A;  4HHV A;  2DFK A;  5DIF B;  3SNH A;  1UEF A;  2YT0 A;  4ZRI A;  1Z87 A;  1WGU A;  4Y94 A;  2P0D A;  3DXE A;  1BAK A;  1X11 A;  4GMV A;  2Y8G A;  4PQ0 A;  2COC A;  4XWX A;  1H10 A;  2D11 A;  4IFS A;  2X18 A;  1KZ7 A;  3TFM A;  1EF1 A;  1GC6 A;  2DYQ A;  4K81 A;  3ULB A;  1DYN A;  3TW1 A;  4GMX B;  2LG1 A;  2DX1 A;  2EC1 A;  2GCJ A;  2FJL A;  2H7D A;  3OAN A;  2GS0 A;  1GG3 A;  1K5D B;  1WJ1 A;  1AQC A;  5C5B A;  4CHM A;  1E5W A;  4ZRJ A;  1MKE A;  2DHI A;  2RSG A;  2R09 A;  2DYN A;  3TCA A;  4DX8 A;  2QKM A;  2LKO A;  4WVF B;  2NZ8 B;  1DDV A;  5KQ1 A;  2ELA A;  3WYF B;  1UPQ A;  1U5E A;  4HDQ A;  2DTC A;  1MK7 B;  1W1H A;  3O96 A;  3PSC A;  2PZ1 A;  1LW3 A;  5DHA B;  2M14 A;  2Y8F A;  1QC6 A;  5C5B B;  1H4R A;  5HE2 A;  3M1I B;  4HB0 B;  4KHA A;  3NSU A;  4KVG B;  2MFQ A;  4NSW A;  2COF A;  4DXA B;  1BWN A;  1V5P A;  2JP2 A;  2IYB A;  1FB8 A;  3KZ1 A;  1DDW A;  4F7U P;  4Z2N A;  2YRY A;  5HE3 A;  1ZSQ A;  2YS1 A;  2COA A;  3KRW A;  4D0N B;  5JHG A;  4IOY X;  1V5U A;  2IFS A;  2G35 A;  1V89 A;  2Q13 A;  2DHK A;  2J0J A;  5LON B;  2D9W A;  2UZR A;  2KUP A;  1FHW A;  4H8S A;  2P0F A;  3AU5 A;  5J3T A;  1WJM A;  3F5R A;  3PG7 A;  2J0K A;  1W1G A;  2VKI A;  2HE7 A;  2L1C A;  3CXB B;  2EJ8 A;  3F0W A;  1MAI A;  1U5G A;  3U8Z A;  2K00 A;  4GPT B;  1SGH A;  2KCJ A;  1XX0 A;  5CLL B;  3TO1 A;  5FI0 A;  1X05 A;  5EFX A;  3HQC A;  1RRP B;  4GZU A;  1PLS A;  5D3Y A;  2DKP A;  2MDX A;  4F7H A;  5CLQ B;  2COD A;  4HAT B;  1NTY A;  1X1G A;  3KY9 A;  1ZC3 B;  3BIN A;  1EVH A;  5KQ4 A;  2DX5 A;  1MPH A;  1ZVR A;  4WSF A;  1P5T A;  2GCL A;  4K2O A;  1DRO A;  4F7G A;  2ADZ A;  1EAZ A;  2EMT A;  4A6K A;  3D8F A;  3RCP A;  4KHB B;  4ZRK A;  1NI2 A;  1XOD A;  3AJ4 A;  2LUL A;  5HE0 A;  2I1J A;  3ML4 A;  4HDO A;  4MY6 A;  5JHH A;  1XCG A;  2H7E A;  2Y7B A;  2R0D A;  3QWM A;  1DDM A;  3HW2 B;  2GJY A;  2HTH B;  5DI9 B;  2P0H A;  2N23 A;  1WI1 A;  1GC7 A;  4IAP A;  3N7C A;  1X1F A;  1MK9 B;  2Z0P A;  3A98 B;  2RVB B;  2RLO A;  4EMO A;  4KHO A;  4TYZ A;  2D9X A;  4BBK A;  1V61 A;  3PVL A;  2EMS A;  3SUZ A;  1WG7 A;  2I5C A;  3PP2 A;  1MIZ B;  3BJI A;  1FOE A;  2I1K A;  1UPR A;  1ZC4 B;  1I7A A;  3PEG A;  5J3Y A;  2ROZ B;  2D9Y A;  1Y19 B;  2AL6 A;  1J0W A;  1N3H A;  1LB1 A;  5J3Q A;  1OQN A;  2VSZ A;  4HAV B;  2OTX A;  3PVW A;  2W2X D;  2N0Y A;  2DLW A;  3D8D A;  2QKL A;  1BTN A;  1XD4 A;  2UVM A;  1UNP A;  2D9Z A;  3IVF A;  3P7Z A;  3TVV A;  1QQG A;  3PZD A;  5DH9 B;  1W1D A;  2Z0O A;  1PMS A;  1PFJ A;  1TXD A;  2RNR B;  5D3V A;  1XR0 B;  2DHJ A;  1UNR A;  2LOX A;  2MKR A;  4YON A;  1AWE A;  1WGQ A;  3LJU X;  1X86 A;  1M7E A;  5D27 A;  1KZG A;  4HB3 B;  4DBB A;  2MWN B;  1J19 A;  3MPX A;  4HAX B;  2YF0 A;  1TJ6 A;  4P7I A;  3PVU A;  4YL8 A;  4MK0 A;  3QIJ A;  1EGX A;  2M38 A;  2D10 A;  4B6H A;  1RJ2 A;  2YS5 A;  5D3W A;  2W2W A;  3SV1 A;  4CYE A;  2XQN M;  3DXD A;  5C6R A;  1OY2 A;  4A5K A;  2CY4 A;  2J0M A;  3FEH A;  3UZT A;  2LOZ A;  1FAO A;  3AU4 A;  2OQB A;  4TKN A;  3QBV B;  4WJ7 A;  1UNQ A;  3T06 A;  3GYO A;  4A6H A;  1IRS A;  4NY0 A;  4GXB A;  3VOQ A;  4KAX B;  1ZM0 A;  4HAU B;  2CY5 A;  1DBH A;  2AEH A;  2RUK B;  3A8Q A;  5DHF B;  2YS3 A;  1OMW A;  2DN6 A;  2CAY A;  2YSZ A;  5GOW B;  4L6E A;  4HAY B;  1V5M A;  3V5W A;  3MDB C;  1NTV A;  1M7R A;  2I5F A;  5C16 A;  1P6S A;  1P3R A;  3X23 A;  4EJN A;  1U2B A;  1V88 A;  3FM8 C;  2L2I A;  2BCJ A;  3G9W A;  2VRW B;  4HB4 B;  2UZS A;  2RGN B;  3KRX A;  1I2H A;  1FGY A;  1TQZ A;  2D4Q A;  2W2X C;  4HB2 B;  2ZPY A;  2J59 M;  1XKE A;  4HAW B;  3CIK A;  3ULC A;  1FGZ A;  2DKQ A;  2Z0Q A;  1K5G B;  2LYD A;  4CHJ A;  2KGX B;  3SO6 A;  3DXC A;  4HAZ B;  4DX9 0;  2YT1 A;  1SHC A;  1U5F A;  1WVH A;  1FHO A;  1NU2 A;  2D9V A;  1U27 A;  3ODO A;  1U29 A;  2P8V A;  4GN1 A;  3D8E A;  1KI1 B;  2D2Q A;  3FSS A;  2K2U A;  2YVC A;  4Z2M B;  5KCV A;  2K2J A;  5HE1 A;  2ROV A;  2CRF A;  1FHX A;  2ELB A;  3ODX A;  3ZDT A;  3U7D A;  2NMB A;  5JLJ B;  4C0A A;  5L81 A;  3VIA A;  4EKU A;  1ISN A;  4A6F A;  1U5D A;  1BTK A;  5FI1 A;  3WA0 A;  3A8P A;  4MT7 A;  4A6F B;  3HK0 A;  3KSY A; 
#chains in the Genus database with same CATH topology
 3GYP A;  4K2P A;  3ODW A;  1B55 A;  1MIX A;  5LOP B;  3NWA A;  3ZVR A;  3SYX A;  5C79 A;  4PNK A;  2DA0 A;  3P6A A;  4K17 A;  5JP4 A;  1Q67 A;  1Y5O A;  2E2X A;  2V76 A;  5D3X A;  4HHV A;  2DFK A;  5DIF B;  3SNH A;  4GNK B;  1UEF A;  2YT0 A;  4ZRI A;  4CSQ A;  5I2S A;  1Z87 A;  1WGU A;  4Y94 A;  2P0D A;  3DXE A;  1BAK A;  1X11 A;  4GMV A;  4D6W A;  2Y8G A;  4PQ0 A;  2COC A;  4XWX A;  1H10 A;  2D11 A;  4IFS A;  2X18 A;  1KZ7 A;  3TFM A;  1EF1 A;  1GC6 A;  2DYQ A;  4K81 A;  3ULB A;  1T77 A;  1DYN A;  3TW1 A;  4GMX B;  2LG1 A;  2DX1 A;  2EC1 A;  2GCJ A;  2FJL A;  2H7D A;  3OAN A;  2GS0 A;  4DIX A;  1GG3 A;  1K5D B;  1WJ1 A;  1AQC A;  5C5B A;  4CHM A;  1E5W A;  4ZRJ A;  1MKE A;  2DHI A;  2RSG A;  2R09 A;  2DYN A;  3TCA A;  4DX8 A;  2QKM A;  2LKO A;  4WVF B;  2NBV A;  2NZ8 B;  1DDV A;  5KQ1 A;  2ELA A;  3WYF B;  2ZKM X;  1UPQ A;  1U5E A;  4HDQ A;  2DTC A;  1MK7 B;  2RRF A;  1W1H A;  3O96 A;  3PSC A;  2PZ1 A;  1LW3 A;  3NWD A;  5DHA B;  4QXA B;  5LG4 B;  2M14 A;  2Y8F A;  1ZYI A;  2KIG A;  1QC6 A;  4OT1 A;  5C5B B;  1H4R A;  5HE2 A;  3M1I B;  4HB0 B;  4KHA A;  3NSU A;  4KVG B;  2MFQ A;  4NSW A;  2COF A;  4DXA B;  1BWN A;  1V5P A;  2JP2 A;  2IYB A;  1FB8 A;  3KZ1 A;  1DDW A;  4F7U P;  4Z2N A;  2YRY A;  5HE3 A;  1ZSQ A;  2YS1 A;  2COA A;  3KRW A;  4D0N B;  5JHG A;  4IOY X;  1V5U A;  2IFS A;  2G35 A;  1V89 A;  2Q13 A;  2DHK A;  2J0J A;  5LON B;  2D9W A;  2UZR A;  2KIE A;  2KUP A;  1FHW A;  4H8S A;  2P0F A;  3AU5 A;  5J3T A;  1WJM A;  3F5R A;  3PG7 A;  2J0K A;  1W1G A;  3FVC A;  2VKI A;  2HE7 A;  2L1C A;  3CXB B;  3A58 A;  2EJ8 A;  3F0W A;  1MAI A;  1U5G A;  2GUM A;  3U8Z A;  2K00 A;  4GPT B;  1SGH A;  2KCJ A;  1XX0 A;  5CLL B;  3TO1 A;  5FI0 A;  1X05 A;  5EFX A;  3HQC A;  1RRP B;  4GZU A;  1PLS A;  5D3Y A;  2DKP A;  2MDX A;  4F7H A;  5CLQ B;  2COD A;  4HAT B;  1NTY A;  1X1G A;  3KY9 A;  1ZC3 B;  4QJ5 B;  3BIN A;  4QJ3 B;  1EVH A;  5KQ4 A;  2DX5 A;  1MPH A;  1ZVR A;  4WSF A;  1P5T A;  2GCL A;  4K2O A;  5M4Y B;  2R2Y A;  1DRO A;  4F7G A;  2ADZ A;  1EAZ A;  2EMT A;  4A6K A;  3D8F A;  3RCP A;  4KHB B;  4ZRK A;  1NI2 A;  1XOD A;  3AJ4 A;  2LUL A;  5HE0 A;  2I1J A;  3ML4 A;  4GOU A;  4HDO A;  4MY6 A;  5JHH A;  1XCG A;  2H7E A;  2Y7B A;  2R0D A;  3QWM A;  1DDM A;  3HW2 B;  2GJY A;  2HTH B;  5DI9 B;  2P0H A;  2N23 A;  1WI1 A;  3DCX A;  1GC7 A;  4IAP A;  3N7C A;  1X1F A;  1MK9 B;  2Z0P A;  3A98 B;  2RVB B;  2RLO A;  4EMO A;  4KHO A;  4TYZ A;  3HSA A;  2D9X A;  4BBK A;  1V61 A;  3PVL A;  2EMS A;  3SUZ A;  1WG7 A;  2I5C A;  3PP2 A;  1MIZ B;  3BJI A;  1FOE A;  2I1K A;  1UPR A;  3PEG A;  1I7A A;  1ZC4 B;  5J3Y A;  2ROZ B;  2D9Y A;  1Y19 B;  2AL6 A;  1J0W A;  1N3H A;  1LB1 A;  5J3Q A;  1OQN A;  2VSZ A;  4HAV B;  3HIE A;  2OTX A;  3PVW A;  2W2X D;  2N0Y A;  2DLW A;  1MI1 A;  2Z59 A;  3D8D A;  2QKL A;  1BTN A;  1XD4 A;  2UVM A;  1UNP A;  2D9Z A;  3IVF A;  3P7Z A;  3TVV A;  1QQG A;  3PZD A;  5DH9 B;  1W1D A;  2Z0O A;  3U12 A;  1PMS A;  1PFJ A;  1TXD A;  2RNR B;  5D3V A;  1XR0 B;  2DHJ A;  4QJ4 B;  1UNR A;  2LOX A;  2MKR A;  4YON A;  1AWE A;  1WGQ A;  3LJU X;  1X86 A;  1M7E A;  5D27 A;  1KZG A;  4HB3 B;  4DBB A;  2MWN B;  1J19 A;  4KHB A;  3MPX A;  2KR0 A;  4HAX B;  2FJU B;  2YF0 A;  1TJ6 A;  4P7I A;  3PVU A;  4YL8 A;  2Z13 A;  4MK0 A;  3QIJ A;  1EGX A;  2M38 A;  2D10 A;  4B6H A;  1RJ2 A;  3NW8 A;  2YS5 A;  5D3W A;  2W2W A;  3SV1 A;  4CYE A;  2XQN M;  3DXD A;  5C6R A;  1OY2 A;  4A5K A;  2CY4 A;  2J0M A;  3FEH A;  3UZT A;  2LOZ A;  1FAO A;  3AU4 A;  2OQB A;  4TKN A;  3QBV B;  4WJ7 A;  5IRS A;  1UNQ A;  3T06 A;  3GYO A;  4A6H A;  1IRS A;  4NY0 A;  4GXB A;  3VOQ A;  4KAX B;  1ZM0 A;  4HAU B;  2CY5 A;  1DBH A;  2AEH A;  2RUK B;  3A8Q A;  5DHF B;  2YS3 A;  1OMW A;  2DN6 A;  2CAY A;  2YSZ A;  5GOW B;  4L6E A;  4HAY B;  1V5M A;  3V5W A;  3MDB C;  1NTV A;  1M7R A;  2I5F A;  5C16 A;  1P6S A;  1P3R A;  3X23 A;  4EJN A;  1U2B A;  1V88 A;  3FM8 C;  2L2I A;  2BCJ A;  3G9W A;  2VRW B;  4HB4 B;  2UZS A;  2RGN B;  4L1R A;  3KRX A;  2YT2 A;  1I2H A;  1FGY A;  1TQZ A;  2D4Q A;  2Z14 A;  2W2X C;  4HB2 B;  2ZPY A;  2J59 M;  1XKE A;  4HAW B;  3CIK A;  3ULC A;  3B77 A;  1FGZ A;  2DKQ A;  2Z0Q A;  2Z4D A;  1K5G B;  2LYD A;  4CHJ A;  2KGX B;  3SO6 A;  2K49 A;  3DXC A;  4HAZ B;  4DX9 0;  2YT1 A;  1SHC A;  1U5F A;  4OSN A;  1WVH A;  1FHO A;  2K8E A;  1NU2 A;  2D9V A;  1U27 A;  3ODO A;  1U29 A;  2P8V A;  4GN1 A;  3D8E A;  1KI1 B;  2D2Q A;  3FSS A;  2K2U A;  2YVC A;  4Z2M B;  5KCV A;  2K2J A;  5HE1 A;  5I2M A;  4HSI A;  2ROV A;  2CRF A;  1FHX A;  2ELB A;  3ODX A;  3ZDT A;  3U7D A;  2NMB A;  5JLJ B;  4C0A A;  5L81 A;  3VIA A;  2KUQ A;  4EKU A;  1ISN A;  4A6F A;  3NWF A;  1U5D A;  1BTK A;  5FI1 A;  3WA0 A;  3OHM B;  3A8P A;  4MT7 A;  4A6F B;  3HK0 A;  3KSY A; 
#chains in the Genus database with same CATH homology
 3GYP A;  4K2P A;  3ODW A;  1B55 A;  1MIX A;  5LOP B;  3ZVR A;  3SYX A;  5C79 A;  4PNK A;  2DA0 A;  3P6A A;  4K17 A;  5JP4 A;  1Q67 A;  1Y5O A;  2E2X A;  2V76 A;  5D3X A;  4HHV A;  2DFK A;  5DIF B;  3SNH A;  1UEF A;  2YT0 A;  4ZRI A;  1Z87 A;  1WGU A;  4Y94 A;  2P0D A;  3DXE A;  1BAK A;  1X11 A;  4GMV A;  2Y8G A;  4PQ0 A;  2COC A;  4XWX A;  1H10 A;  2D11 A;  4IFS A;  2X18 A;  1KZ7 A;  3TFM A;  1EF1 A;  1GC6 A;  2DYQ A;  4K81 A;  3ULB A;  1DYN A;  3TW1 A;  4GMX B;  2LG1 A;  2DX1 A;  2EC1 A;  2GCJ A;  2FJL A;  2H7D A;  3OAN A;  2GS0 A;  1GG3 A;  1K5D B;  1WJ1 A;  1AQC A;  5C5B A;  4CHM A;  1E5W A;  4ZRJ A;  1MKE A;  2DHI A;  2RSG A;  2R09 A;  2DYN A;  3TCA A;  4DX8 A;  2QKM A;  2LKO A;  4WVF B;  2NZ8 B;  1DDV A;  5KQ1 A;  2ELA A;  3WYF B;  1UPQ A;  1U5E A;  4HDQ A;  2DTC A;  1MK7 B;  1W1H A;  3O96 A;  3PSC A;  2PZ1 A;  1LW3 A;  5DHA B;  2M14 A;  2Y8F A;  1QC6 A;  5C5B B;  1H4R A;  5HE2 A;  3M1I B;  4HB0 B;  4KHA A;  3NSU A;  4KVG B;  2MFQ A;  4NSW A;  2COF A;  4DXA B;  1BWN A;  1V5P A;  2JP2 A;  2IYB A;  1FB8 A;  3KZ1 A;  1DDW A;  4F7U P;  4Z2N A;  2YRY A;  5HE3 A;  1ZSQ A;  2YS1 A;  2COA A;  3KRW A;  4D0N B;  5JHG A;  4IOY X;  1V5U A;  2IFS A;  2G35 A;  1V89 A;  2Q13 A;  2DHK A;  2J0J A;  5LON B;  2D9W A;  2UZR A;  2KUP A;  1FHW A;  4H8S A;  2P0F A;  3AU5 A;  5J3T A;  1WJM A;  3F5R A;  3PG7 A;  2J0K A;  1W1G A;  2VKI A;  2HE7 A;  2L1C A;  3CXB B;  2EJ8 A;  3F0W A;  1MAI A;  1U5G A;  3U8Z A;  2K00 A;  4GPT B;  1SGH A;  2KCJ A;  1XX0 A;  5CLL B;  3TO1 A;  5FI0 A;  1X05 A;  5EFX A;  3HQC A;  1RRP B;  4GZU A;  1PLS A;  5D3Y A;  2DKP A;  2MDX A;  4F7H A;  5CLQ B;  2COD A;  4HAT B;  1NTY A;  1X1G A;  3KY9 A;  1ZC3 B;  3BIN A;  1EVH A;  5KQ4 A;  2DX5 A;  1MPH A;  1ZVR A;  4WSF A;  1P5T A;  2GCL A;  4K2O A;  1DRO A;  4F7G A;  2ADZ A;  1EAZ A;  2EMT A;  4A6K A;  3D8F A;  3RCP A;  4KHB B;  4ZRK A;  1NI2 A;  1XOD A;  3AJ4 A;  2LUL A;  5HE0 A;  2I1J A;  3ML4 A;  4HDO A;  4MY6 A;  5JHH A;  1XCG A;  2H7E A;  2Y7B A;  2R0D A;  3QWM A;  1DDM A;  3HW2 B;  2GJY A;  2HTH B;  5DI9 B;  2P0H A;  2N23 A;  1WI1 A;  1GC7 A;  4IAP A;  3N7C A;  1X1F A;  1MK9 B;  2Z0P A;  3A98 B;  2RVB B;  2RLO A;  4EMO A;  4KHO A;  4TYZ A;  2D9X A;  4BBK A;  1V61 A;  3PVL A;  2EMS A;  3SUZ A;  1WG7 A;  2I5C A;  3PP2 A;  1MIZ B;  3BJI A;  1FOE A;  2I1K A;  1UPR A;  1ZC4 B;  1I7A A;  3PEG A;  5J3Y A;  2ROZ B;  2D9Y A;  1Y19 B;  2AL6 A;  1J0W A;  1N3H A;  1LB1 A;  5J3Q A;  1OQN A;  2VSZ A;  4HAV B;  2OTX A;  3PVW A;  2W2X D;  2N0Y A;  2DLW A;  3D8D A;  2QKL A;  1BTN A;  1XD4 A;  2UVM A;  1UNP A;  2D9Z A;  3IVF A;  3P7Z A;  3TVV A;  1QQG A;  3PZD A;  5DH9 B;  1W1D A;  2Z0O A;  1PMS A;  1PFJ A;  1TXD A;  2RNR B;  5D3V A;  1XR0 B;  2DHJ A;  1UNR A;  2LOX A;  2MKR A;  4YON A;  1AWE A;  1WGQ A;  3LJU X;  1X86 A;  1M7E A;  5D27 A;  1KZG A;  4HB3 B;  4DBB A;  2MWN B;  1J19 A;  3MPX A;  4HAX B;  2YF0 A;  1TJ6 A;  4P7I A;  3PVU A;  4YL8 A;  4MK0 A;  3QIJ A;  1EGX A;  2M38 A;  2D10 A;  4B6H A;  1RJ2 A;  2YS5 A;  5D3W A;  2W2W A;  3SV1 A;  4CYE A;  2XQN M;  3DXD A;  5C6R A;  1OY2 A;  4A5K A;  2CY4 A;  2J0M A;  3FEH A;  3UZT A;  2LOZ A;  1FAO A;  3AU4 A;  2OQB A;  4TKN A;  3QBV B;  4WJ7 A;  1UNQ A;  3T06 A;  3GYO A;  4A6H A;  1IRS A;  4NY0 A;  4GXB A;  3VOQ A;  4KAX B;  1ZM0 A;  4HAU B;  2CY5 A;  1DBH A;  2AEH A;  2RUK B;  3A8Q A;  5DHF B;  2YS3 A;  1OMW A;  2DN6 A;  2CAY A;  2YSZ A;  5GOW B;  4L6E A;  4HAY B;  1V5M A;  3V5W A;  3MDB C;  1NTV A;  1M7R A;  2I5F A;  5C16 A;  1P6S A;  1P3R A;  3X23 A;  4EJN A;  1U2B A;  1V88 A;  3FM8 C;  2L2I A;  2BCJ A;  3G9W A;  2VRW B;  4HB4 B;  2UZS A;  2RGN B;  3KRX A;  1I2H A;  1FGY A;  1TQZ A;  2D4Q A;  2W2X C;  4HB2 B;  2ZPY A;  2J59 M;  1XKE A;  4HAW B;  3CIK A;  3ULC A;  1FGZ A;  2DKQ A;  2Z0Q A;  1K5G B;  2LYD A;  4CHJ A;  2KGX B;  3SO6 A;  3DXC A;  4HAZ B;  4DX9 0;  2YT1 A;  1SHC A;  1U5F A;  1WVH A;  1FHO A;  1NU2 A;  2D9V A;  1U27 A;  3ODO A;  1U29 A;  2P8V A;  4GN1 A;  3D8E A;  1KI1 B;  2D2Q A;  3FSS A;  2K2U A;  2YVC A;  4Z2M B;  5KCV A;  2K2J A;  5HE1 A;  2ROV A;  2CRF A;  1FHX A;  2ELB A;  3ODX A;  3ZDT A;  3U7D A;  2NMB A;  5JLJ B;  4C0A A;  5L81 A;  3VIA A;  4EKU A;  1ISN A;  4A6F A;  1U5D A;  1BTK A;  5FI1 A;  3WA0 A;  3A8P A;  4MT7 A;  4A6F B;  3HK0 A;  3KSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...