1QCCA

Crystal structures of adenine phosphoribosyltransferase from leishmania donovani
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
236
structure length
236
Chain Sequence
PFKEVSPNSFLLDDSHALSQLLKKSYRWYSPVFSPRNVPRFADVSSITESPETLKAIRDFLVQRYRAMSPAPTHILGFDARGFLFGPMIAVELEIPFVLMRKADKNAGLLIRSEPYEKEYKEAAPEVMTIRYGSIGKGSRVVLIDDVLATGGTALSGLQLVEASDAVVVEMVSILSIPFLKAAEKIHSTANSRYKDIKFISLLSDDALTEENCGDSKNYTGPRVLSCGDVLAEHPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADENINE PHOSPHORIBOSYLTRANSFERASE
publication title Crystal structures of adenine phosphoribosyltransferase from Leishmania donovani.
pubmed doi rcsb
source organism Leishmania donovani
molecule tags Transferase
total genus 68
structure length 236
sequence length 236
ec nomenclature
pdb deposition date 1999-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qccA00
1ECGA 1A4XA 1JLRA 2H07A 1BD4A 1DQNA 1QK5A 1ECFA 2C4KA 1DBRA 1OROA 1O57A 1G9TA 1QB7A 1XTTA 2HCRA 5JV5A 1OPRA 4P86A 1I14A 1XZNA 1YFZA 1D6NA 1U9YA 1W30A 2PRZA 1ECJA 1A95A 5BSKA 4OHCA 4KN6A 4RADA 1CJBA 1UPFA 1A3CA 1P17A 1TC1A 3M3HA 4RANA 4LYGA 1STOA 2PS1A 1BZYA 3GEPA 1QCDA 1ECCA 2JKZA 4M0KA 4LZAA 5ESXA 4QRIA 5IAOA 4QYIA 1I13A 1XTVA 1U9ZA 1R3UA 3KB8A 3DMPA 1I0LA 1QCCA 3NAGA 4WN3A 1G9SA 5ESWA 5EUCA 1NONA 4X44A 4M0PA 4S2UA 1XTUA 4M0UA 3ACCA 1VSTA 1G2QA 1FSGA 2JI4A 4RACA 4Z1OA 2JBHA 1J7JA 1PZMA 4RQBA 5BQOA 1DKUA 1VCHA 3N2LA 4P83A 4IJQA 1DQPA 1IBSA 4RHXA 1AO0A 1ZN9A 2VFAA 3MBIA 3H83A 1OREA 1QK4A 1XZ8A 2YZKA 3LPNA 4MB6A 4RHTA 5KAPA 1HMPA 5K51A 3S5JA 1ZN7A 4JLSA 4WMLA 4X45A 5HIAA 3ACDA 1UPUA 3OHPA 1P18A 1P4AA 1A96A 4RHUA 3GGJA 4P80A 4PAWA 2IGBA 1I0IA 1A98A 2GEBA 3EFHA 5BRNA 1LH0A 2EHJA 2H08A 3HVUA 1Y0BA 4RAOA 1DKRA 4RAQA 2WNSA 3DEZA 1BD3A 2P1ZA 1VDMA 2XBUA 3O7MA 4ZFNA 1GRVA 3ACBA 1MZVA 1QB8A 1TC2A 4P81A 1GPH1 4JITA 5IPFA 5BQPA 4P84A 1UFRA 2H06A 4RABA 4RV4A 1ECBA 5HKLA 2E55A 3GGCA 1WD5A 2JKYA 1V9SA 4LYYA 4RQAA 1HGXA 1QK3A 4P3KA 2AEEA 5KAMA 1Z7GA 5JSQA 4FYMA 4TWBA 4QYIB 1JLSA 3OZFA 1NULA 5E38A 1L1RA 1L1QA 1G2PA 4F8EA 1A97A 4LZNA 2FXVA 1P19A 4LZOA 3DAHA 1O5OA 4RHYA 3LRTA 3MJDA 4PFQA 1I5EA 4P82A 3OZGA 2PRYA 2DY0A 3G6WA 1ZN8A 3QW4B
chains in the Genus database with same CATH superfamily
5K0LA 4D9CA 3DZKA 2J8ZA 3QA3E 2OV4A 4EDHA 5IABA 3ISVA 1KMNA 1Y34E 4UCXA 3M34A 4LRWA 5IARA 3GVHA 4LF8B 2QVZX 3GAFA 2AC7A 4A0QA 4JLOA 4LX8A 1BDIA 4BAZA 1EINA 1Y9DA 2B9EA 3NZEA 4AKTA 3DNFA 4EY4A 3D4BA 1AMOA 1E4YA 4DLSA 2HF9A 1SVOA 2YXEA 4HRAA 2ZAGA 5J1SB 1WUHS 1FXSA 3ILHA 4QM6A 1GXSA 4LQCA 3FVWA 4E21A 1NVTA 2VNSA 4DDKA 2ZQYA 4ZVQA 5CG1A 4PQRA 3U7IA 1A5TA 1L7BA 4H18A 3DE1X 1P4SA 3TLGA 1HNWB 1BROA 1ZU5A 1YK1A 2QUIA 3TSZA 4C01A 2D00A 3PNVA 3NWBA 3FHJA 4QYIA 2XDQA 1QONA 2YFQA 1SY7A 4MDYA 4M60A 4WINA 5E2IA 2WG2A 3ZV3A 1ZJWA 1E69A 1K2VN 1OX4A 1ORRA 2VRWA 3S2YA 2ZJZA 1M34E 2NUAA 4XXHA 1UFKA 5I8PA 1HC7A 2XMDA 1F8XA 3GRVA 4BBZA 4JROA 3DLBA 2ZE5A 3WYNA 1NRWA 4ZQFA 2ZJ4A 3CRW1 3ZIDA 1ONSA 1R1DA 3F1LA 4P7KA 1HE8B 4GP6A 1A9RA 4D25A 5E7QA 1KH2A 1UH5A 3GRZA 4GBJA 1QNFA 4PLHA 4E94A 5CFMA 4XOIA 1K0FA 3INTA 3KR0A 3SR3A 5C5CA 3ZYZA 1IEQA 4YT2A 4UHDA 4EECA 3RRMA 4LXYA 2XCOA 1ORTA 3L1UA 3R0VA 3FPJA 1FYXA 4C22A 4X45A 4YUVA 2N9UA 2PXXA 3QBTA 5TS3A 1U8YA 3DZDA 2L42A 1JPVA 1GU7A 3PRYA 1VPEA 3HBMA 4IQGA 4KG7A 3SJCA 4CLXA 4JVLA 4LNUA 4RZUA 3KQOA 2ZWOA 4OA8A 1C0PA 2HFJA 2OAGA 3CUEF 3KL2A 3L0IB 5CTJA 1JMVA 3QV2A 4G1FA 1Z5NA 4NJMB 3R74A 3UT6A 1VE5A 1KQGA 2DF8A 2O06A 2A6PA 3HM2A 1QRSA 3JQ9A 4DYVA 4LJ6A 1UBNA 4JUCA 3I9LA 3GV0A 2AWOA 3R3HA 1PYOA 2C5HA 4TSKA 5IKOA 1XMIA 1LZLA 5CXXA 4DEXA 1FK8A 3O82A 1QIFA 1XMPA 4MMZB 4BQNA 4DLVA 3C5CA 2IEDA 1Z5PA 2V6FA 3NX4A 4MI3A 3B52X 2J33A 4D41A 1XWFA 4QPPA 1NZDA 5CBPB 2ZCUA 4G09A 3QXCA 3KWMA 4Q3CA 2DMRA 5IW8A 2PDAA 5AT1A 3TBHA 1JBQA 5LM3A 3QMVA 4FFPA 4LE2A 2AE2A 4QUEA 1P7VA 1CIPA 1ZGGA 3CTMA 1C9MA 4QGFA 2ORWA 1E3JA 2P4HX 2VH5R 2Z04A 5F5LA 3RK0A 3ZHRA 4K6MA 1ORDA 1CP3A 2FDCA 1FNDA 1DEAA 3E5HA 3N5CA 4M0LA 3FMGA 4K03A 3MJRA 4FCWA 2DUNA 4FYXA 3I61A 4B6RA 3F49S 1AUVA 2PUWA 2I4TA 5LYYA 3ANSA 4UEKA 1E7QA 2EERA 3N3BC 4GF5A 3HA2A 4WCVA 1E66A 1T1SA 2PRYA 3G59A 4JEMA 4Z4QA 4Q37A 3M6VA 3QW4B 4E5VA 2ZVPX 4DCSA 1Y4ZA 4MA4A 2G7ZA 3G2QA 4KIWA 1X13A 4KRFA 3TVDA 2ZSUA 4UATA 2ZANA 1W52X 1ZCFA 5I7WA 1L6IA 1XD2A 2WF7A 3AHFA 3OZDA 4PG8A 3VU0A 1DU4A 5G1PA 3FVQA 3WMGA 1XYVA 2XITA 1DBVO 2UZ3A 3GPBA 1MB0A 3QE4A 2B1RA 3ADPA 2VZ8A 4QXRA 4B84A 1SIUA 1TIKA 1WHSA 5C1PA 4EGQA 2F43A 3GAZA 4FX5A 4RIEA 4LGCA 4HQFA 3E27A 4D0GA 1G6OA 1VQ1A 4FHFA 1WABA 1QTIA 1BGVA 1U94A 2J59A 2ZOSA 2ZBFA 2OXTA 1L9KA 5CDFA 2JZNA 2CMFA 1K6EA 1DKNA 2FPXA 1CY2A 1KA9H 1VI2A 3GO4A 4OMDA 4EW6A 1KO8A 2WK1A 1G17A 3DC2A 1E1RA 3I2YX 4E5KA 4LZAA 5JQGF 4QOJA 1KMMA 4UXHA 2WABA 4EG3A 1EFTA 5KQLA 1E2LA 3WGIA 3RFUA 1DCFA 3U0VA 3CB4A 1JLLA 4TL9A 4BNWA 4E7OA 2WILA 5M29A 5CLIA 5IM4F 1K2WA 3ONVA 5B37A 1IMOA 1R18A 1VHWA 2NWQA 3OC0A 5F4ZA 2HNAA 2FAXA 4TKZA 5EWLA 4TVBA 4N5LA 5EUBA 2H2HA 2HPHA 2I8LA 1VB5A 3FKJA 3H5WA 4GLLA 3HC7A 3ZD8A 5EE0A 3PRHA 2XIQA 5C1BA 3GWGA 1U3VA 4RL4A 5FLEX 3U3JA 4EM6A 4F4JA 1TYEB 4J91A 3A4NA 4EEKA 1N7HA 3DG9A 2HHLA 2WBLC 1KERA 4LHWA 1BWPA 1XDSA 4N47A 1G64A 3W6NA 1NG1A 1NVEA 1L5YA 5EXSA 5HZHA 2OFXA 2OO3A 1PNQA 2HK9A 4IHJB 1ZUHA 3FDFA 4DYDA 3BXPA 3TX2A 4FQ7A 4N18A 3GLIE 3LWNA 2WFLA 3K2IA 5IDYA 3LIIA 3CWZA 2MIIA 2QHXA 1MNQA 1I4EB 3FSEA 4PSCA 2RAVA 3UJ9A 3U4MA 3RS3A 5I3ZA 1TA4A 1ZH0A 2FSUA 2ZJFA 5LQSA 2GERA 1GL6A 2VPPA 3EXIA 4YV7A 4TLCA 3TUIC 1U0LA 4F5EA 7AT1A 2QTGA 2AKEA 2CB0A 1KI6A 1LNZA 1ZH6A 3PHJA 4Z4EA 1NBME 3JARB 4XPIB 4Y2RA 2C4HA 5IUKC 3ZE8A 5LD2B 3QH4A 1QDLB 3QVSA 1IN8A 3MCZA 2RJNA 3AR7A 4NZPA 3AJDA 4LV6A 3B6IA 4TTAA 1GG8A 2JLAA 3JR7A 4Y2GA 3ENKA 4KR7A 2Q8QA 3GGOA 1JVSA 1YVEI 3DHYA 2AK3A 3IDSA 1W5SA 1N1MA 3OIWA 4MQFB 4RMGA 2X6QA 1QX4A 3ZWDA 3ANYB 3KHTA 3OZFA 1E3LA 5TJ9A 4HDQB 3I2JA 4IQ8A 4EG4A 4RQUA 5ITZA 1QH8B 2JLUA 4RXMA 2PUFA 2NUPA 3P0RA 1P74A 1K6MA 1SKYE 2WQZA 2AOTA 1D2CA 1HOXA 4G8BA 3WK6A 3C3CA 2H3HA 1IONA 4B17A 2P40A 1W36B 3CUKA 1G8SA 4HFMA 3BKWA 2ZJAA 5CX4A 3UWSA 3OEED 4DPMA 4H1VA 2AFIA 3S8YA 3T7DA 2HWKA 1JJIA 1XEXB 1JWAB 2PMKA 3MRSA 4QDTA 4RVNA 1FW6A 2GD1O 1Z35A 3WWYA 2WIGA 3IP9A 2YJ5A 3DW1X 5DMHA 3MF4A 1OTXA 3NWEA 4UHJA 2YIJA 3UHOA 5LP1A 2XUGA 5IZCA 4NRDA 3R75A 3SYLA 3JSAA 1DQSA 3CRQA 3URKA 1E3QA 2H5LA 1Z9BA 3GGSA 4OB8A 1W4AA 4QYSA 1N4AA 4B8WA 5EQDA 2H4YA 1R37A 3F73A 3H11B 2JHGA 1NG9A 1TZJA 2NVBA 3L5OA 3EGVA 3ZHZA 2D8AA 3KXIA 4MWZA 3RAEC 1BX1A 2J6BA 1P0QA 2RAUA 1I0ZA 3ML1A 5FRDA 2PQ6A 2FN4A 3DD1A 2SBTA 3JWIA 4CV0A 3VBCA 2Q1XA 1Z38A 3QHPA 2Y4OA 5DT2A 5B3AA 3UW3A 3C45A 3CWCA 4I5GA 1DI0A 1EX1A 3EFOA 1JX6A 4BCDA 1GITA 1KMIY 5KVCA 4JI3B 1KI4A 4M0PA 1B0PA 3AVOA 4IUBS 1YOBA 2KI5A 4IX9A 3HB4X 3FD8A 2KX7A 2VAPA 4OKNA 2PAFA 4QZVA 5B55A 3BD8A 4DABA 2XZPA 4FSHA 2IDJA 5HKKA 5F3RA 1XQVA 1IRIA 1WSDA 1KEUA 1X8LA 2QU7A 3KAKA 4GOJA 4KLAA 3SC2A 4ZCIA 4M6WA 1FF9A 3Q6IA 2Q9BA 4BO6A 3ET4A 3PS9A 3M1AA 4IR7A 4OCZA 3VZDA 3VX4A 4F9EA 1AUOA 5EI5A 1ZUNB 4LXQA 2AH5A 4PZYA 1J0BA 4AJ4A 3N59A 1WNFA 3BS4A 3OU2A 1ISFA 4OQFA 4AJNA 3I8SA 4A5SA 6REQA 8OHMA 5K0FA 3E2PA 4BJ1A 5FUMA 3QYJA 2D0DA 2XHEA 3M4JA 6PFKA 4GKAA 5ICCA 4X62B 1EFLA 4PPYA 1CZHA 4LW8A 2P4EA 3AEQA 3OFVA 4HDMA 4G9BA 3M2PA 3MWYW 1XAHA 4W5OA 3T5MA 1GGHA 2P1ZA 3II6X 1W4CA 2QZZA 3ME5A 4EG1A 1V5GA 2RC6A 4HX2A 3EEBA 1AB6A 4MIYA 4TL7A 3ZY2A 4FGSA 4BLQA 4BVFA 5CB0A 2EGUA 5TQ0B 3RU3A 4BFVA 1HL7A 5BVGB 4D9KA 5AM5A 2FCRA 2XD4A 3KJIA 1SOAA 1Y9AA 1ZP6A 2XD9A 5CK5A 1ZO8A 5MGNA 4CW7A 1D9ZA 1TUBB 1LCIA 2W4QA 2QTHA 4IEIA 4IJUA 2V55B 4LYYA 5B3JC 1YQTA 2A3NA 2P65A 4XRGA 2Z98A 3KOMA 1NURA 3MILA 3AM1A 2C77A 4W6ZA 1AS3A 3SM9A 2BGUA 3BSFA 2ZB8A 1URPA 2X5KO 5L40A 4YALA 1U0OC 1P33A 3KQVA 3B3GA 5F77A 1XDUA 2H4HA 2A14A 4JB3A 5BN4B 5GINE 3NXSA 1PEYA 2GK4A 3NM6B 4BVGA 1XZJA 4MIOA 1UBLS 3QTTA 1MPTA 3B89A 5E9AA 4BAUA 5C8ZA 4EUKA 3JATA 1N0UA 1GXSB 1Z29A 3GA7A 1F60A 4RVHA 1Z2DA 1MC4A 2JAPA 2Q3JA 4MKGA 2Z2YA 2B8TA 3LYLA 3F5SA 2IZ0A 3SJ7A 2G9RA 3FYUB 4AQYB 1WIWA 4HH1A 3BHJA 1HK7A 1QF6A 4HS9A 1NF2A 1ONOA 2CFSA 4XUGB 4OP2A 8ATCA 4EVIA 2BM0A 1X1QA 2R8RA 4DDTA 1FB5A 2YWXA 1XRSB 1ENZA 2RHWA 5DI3A 5L3VA 2K2QB 1T5TA 1O4WA 1TJNA 2HIGA 1OX4B 1NU6A 2MTBA 3CF2A 1D2HA 3O92A 5D3MB 3DEFA 2O1XA 4F2HA 2QN6A 1FP4A 4LISA 1A8UA 3SFTA 5AIBA 1U90A 4YMGA 2J09A 1Y6ZA 4D42A 1JIQA 4JS0A 1RXWA 4HP8A 1A69A 3I83A 4MWSA 2GBCA 2WUEA 4JK3A 1MR3F 3T7KA 2C58A 4OMFG 3WJAA 3NJ4A 2UUOA 3EXEB 3OUUA 4J43A 1FX0A 2W9XA 4WGGA 1CYDA 2C9YA 4ZRDA 2I3BA 2O8FA 1PUXA 3KR2A 4CKEB 2J07A 2WIKA 4LMBA 4NBKA 4KHPB 2W2NA 5I4KA 2QMZA 4QJ4A 5K3OA 4X97A 1II0A 4M7PA 1ZLXA 4WFQA 4MVJG 4G1EB 1EDEA 4BFXA 2V98A 3LQ4A 2RIRA 3FPBA 5CXQA 3T3PB 2W98A 1X1AA 1W0CA 2XB2A 3PNKA 3KSRA 2F9MA 1IBLB 3EXHA 4AZSA 3EGXA 5D7BA 2OV8A 1RJWA 2F17A 2G25A 3CONA 5E9JA 1VMDA 1JR3D 2J6HA 4B3BA 5LQRA 1VGRA 4H31A 4TUYF 3WLEA 4MUXA 1UAGA 4CBVA 1V9CA 2J3JA 2EJVA 4UM7A 2ZB7A 4BS9A 4DDWA 2Q5JA 2O7SA 1LX7A 4NQZA 4POAA 1TLLA 3NT5A 1ESZA 4TPKA 3BFJA 3V3KA 1I4TD 3FWKA 3PDHA 4MNTA 2ODPA 4HWOA 4K86A 4V3CA 3JQAB 4KR9A 2X8JA 4P93A 3WSTA 5JTUA 1XTPA 4Q34A 1Z5ZA 3KJFA 1VOTA 2ZJ6A 1WU7A 3CVWA 3NHMA 1JIXA 2CD9A 3GFFA 2MMCA 2Y77A 3U6KA 1O1YA 2QN2A 3EUWA 4W5WA 4S1WA 3RBXA 5CVEA 4C2BA 1JJBA 2P6MA 3H0KA 1GPYA 1GCOA 1SEVA 4RS3A 1NXTA 5KOJA 3W3AH 2G06A 2V3VA 3SP1A 1LU9A 4QC2A 2NV2B 1B16A 2Q28A 3Q9LA 4B9EA 4OQ4A 2IXTA 4RA9A 1XA0A 4MS1A 3OX4A 4FI3F 3Q12A 2OVFA 3DCJA 3QOFA 1JDBC 3WDMA 3Q10A 4K1XA 2FPLA 1LSUA 4G25A 4JXXA 2XYGA 1OV6A 2ZLBA 2ZYSA 3ASZA 4XQGA 1AUPA 3G49A 4HQ0A 3EWAA 3GVCA 1SUCA 2BUBA 4YP7A 2AXEA 2IYZA 5IAAA 5K8LA 2DR0A 1Z75A 2IHVA 4LQ4A 1HLDA 1WXFA 1OV4A 2SKEA 1OC4A 2WYHA 2ZRDA 4FIDA 4D3FA 2RHDA 1E1DA 1QHHB 3ORYA 1G8MA 5AI9A 2QGZA 3EBLA 1XZBA 3PUIA 5ALKA 3ERCA 2QMHA 3A9RA 4WBNA 4C7OA 5IJ9A 4PRLA 3SIXA 2HLDD 1KDVA 4LVOA 2BJVA 4PG5A 2PUEA 3L0PA 1E9RA 1PNTA 1VE1A 2F3RA 3A14A 3I6ZA 2RGGA 3KXKA 3P20A 3EPLA 2PIAA 3LBFA 5YASA 4AY4A 1KYXA 1DBRA 2Q9AA 1QIKA 2QI9C 2JAUA 4KQXA 5GADl 2C31A 1LJ8A 1B8NA 2I4MA 4CIXA 1EGAA 4PX5A 1JG2A 2ILTA 3DTYA 4YO8A 5JZBA 1AHHA 3W2EA 3GFRA 3UTCA 1EEHA 2X4IA 1VL5A 3IMKA 4N12A 3OZCA 3AUUA 1R8XA 4X8LA 2QSYA 5HIIA 3VDRA 5LMCA 4MUYA 3A58B 4FYHA 3PITA 3PFFA 2C4VA 2QRZA 4DZTA 2BP7B 1GAEO 1RQPA 2GLUA 3HKBA 1IUNA 4QDKA 4CRWB 2PCJA 1NC3A 1VCIA 2CLCX 3Q87B 3AF6A 4ZHQA 2GBIA 2UUPA 2HN9A 3RANA 3OCYA 2Y6UA 3LDFA 1IY9A 3ETLA 3GDWA 4PRZA 5SYMA 5KZMB 2FV8A 2JHFA 5L9AA 1X7YA 4LSMA 3KUUA 5FAXA 5IT9A 1PI3A 3D4NA 1F2VA 2ZYTX 3BBLA 2Z4TA 3CNHA 1G5IA 3A2KA 3A2MA 3LKZA 2SCUB 3PEUA 3LCUA 5FKJA 3PYLA 1Z5VA 2B8JA 2OV1A 4MYDA 3OZUA 3E9MA 2D74A 2J7PA 1Q1ZA 3HCRA 3IIMA 3O4HA 1MG0A 5D1NA 5SY4A 3KYCA 4IOJA 4YASA 4L8FA 4LHZA 4R8KA 2D0OB 2CJFA 2EKDA 5AJZA 3H7IA 3TLYA 4GDFA 4R1OA 4A73A 4TLEA 2J9FA 5KTNA 2IEYA 1T2NA 1ZESA 4O0MA 3S5JA 1NX9A 4M55A 3D3WA 3W7BA 4HS4A 3S0JA 2QLNA 3L3BA 5CA1B 4ACAA 1WVMA 4NATA 3ESRA 1TZ2A 4OQMA 2WUGA 4GI3A 3T0IA 1Z16A 2JJQA 1IIBA 3HCCA 2IUEA 5CB8A 1Q5PA 1VJ5A 4LJSA 4O1IA 4ZEOA 3MSXA 6ADHA 1VG9B 3RYCA 2E49A 1F0PA 3PGMA 3UICA 1IVNA 5BURA 1MB4A 3WP1B 1NW8A 2CBXA 1ACMA 4G5HA 3ZJVA 3VDNB 4WCDA 4Y2TA 4G0NA 1MPXA 4B81A 4DC0A 2BR3A 3UA3A 1LF5A 2WT8A 1PT5A 1NBMD 2Y1XA 4PNHA 5E6UB 1OAOC 4DR7B 5FL7D 1SVIA 1XL0A 2WD7B 2B35A 4PC3A 3U3ZA 2NZJA 4F5WA 2R8OA 3SVLA 1I2AA 3L0OA 6Q21A 2OD2A 2FZEA 5AW8A 1C81A 3MWKA 4UKDA 5KJ6A 4JIMA 3ZQKA 3GPCA 2OCXA 4Q1AA 3TB4A 5M04A 3I76A 4BOYA 3ESQA 3E9YA 3TSCA 3FTCA 1EJ6A 2O4UX 1CUIA 2IP1A 2FUG6 2ATXA 2VYND 3HMKA 1R4MB 4Q4JA 3TLCA 3U13A 4D4JA 2EJTA 5C7YA 2J3DA 4RHFA 1PWYE 2UZAA 1AQUA 1C50A 3B9RA 1P0CA 3JPYA 4HFNA 1UEIA 2BPOA 4LZPA 3AXSA 3NG1A 4OATA 3UFXB 2AGVA 4ETWA 1IXRC 1FDRA 1K7CA 2I6FA 3UKOA 3NAQA 5JCJD 4ZVOA 3KVVA 2NUTA 1G19A 3TQQA 4YDQA 4J4TA 4BKUA 5HRUA 1THTA 5A5GA 1DADA 3QKUA 4O4IA 3PHLA 2NZYA 5BN3B 4ARBA 1C1HA 2OBBA 2XEDA 3NRCA 5BSTA 3BJMA 4KW7A 1R16A 1SXGA 1K1EA 2C4KA 2EC5A 4BP9A 3GUZA 4HVLA 4RJKA 4U0KA 3QEAZ 1HZZC 4TRRA 1YZHA 2HCRA 2P9FA 3L4BC 3P26A 4YT8A 3OD5A 1G20B 1PTJA 1QKKA 1YDGA 1ZZGA 3GMDA 3H1TA 3BERA 3O1IC 3E7DA 3IOEA 3R9KA 3HWX1 3R0IA 3U1BA 4FZRA 1SZJG 3IAHA 1A95A 3BIFA 3S2ZA 1OBOA 1DPFA 2HK6A 1CJBA 2Z09A 3H5VA 1YS6A 4BVHA 5ARCA 1YE8A 3TOZA 4HAYA 2FP4B 2V7QA 4F96A 4BMSA 1FZQA 2WM8A 3VBEA 1JIKA 2WM9B 3Q15C 1XXHB 3H1AA 2CV1A 4LUCA 3WYEA 1PR2A 3BXHA 3GJ8A 2R47A 1QP7A 2YDXA 3AESB 4OBWA 4I55A 1G8PA 1E6MA 4DQLA 5BRJA 1QQTA 4E30A 1FBNA 2X76A 1PL7A 4K9LA 3LQ1A 3WNZA 5KX5F 1C1DA 3AYZB 2DBZA 4ESOA 1D3AA 4R8LA 3B70A 5IHPA 2Q4OA 2Y1DA 2VDOB 5D86A 3HJCA 1KSGA 5LNK6 1ODIA 4M0UA 4UEWA 1J56A 3EX7C 2OHJA 2E48A 3PX2A 3KG2A 4II7A 3TL6A 4R2KA 1KNQA 2MINB 5UKDA 4BO9A 3OCXA 5HNKA 1QKIA 1WP4A 4KYIB 2H1LA 2XUHA 3AEZA 5KAPA 621PA 5JXHA 2WU1A 3VZQA 3KQMA 3K0EA 5CMLA 3JVUA 1TUEA 1ZM9A 2HFKA 3BL8A 4X8OA 5FEUA 3O26A 3RI3A 1U7PA 1JQ5A 2IS4A 2Q9CA 4JOCA 3DCNA 3A9UA 3KLOA 5K99A 3I2KA 4Z3OA 5L7WA 3K09C 2QUBA 1WS6A 3DVAA 1W47A 3L5KA 4D9FA 3AQIA 4M9XA 2JK0A 3FTNA 5HRCA 3LI2A 4WECA 3WNQA 3DMDA 2WHPB 2GDZA 3S2IA 3LQRA 2ZEJA 4H1WA 3UWKA 4RYDA 1D1QA 1UFVA 4F6CA 2GEDA 3W1WA 3FLAA 1XTZA 1S5PA 3OCJA 1Z63A 5JAUA 3I52A 4V38A 2M9MA 4E33A 2W2KA 3I12A 3IEIA 3ZPXA 4KJZA 2CC2A 4J0QA 4V0LA 4KYUA 4RQTA 1TECE 5E2AA 5C5IA 5JADA 3B36A 2CVZA 1EEXB 1E2UA 4YCBA 2YH2A 4NFHA 3UO8B 2APJA 5PGMA 2H8KA 4D6XA 5EHNA 4AZ3A 2ZIXA 1TEXA 2O2EA 3UUGA 3RG2A 1KYIA 4S12A 1NSFA 3KR1A 4ND2A 2HMAA 3NS7A 2QTVB 4LC1A 1YJCA 1Y3FE 1P6UA 2OO7A 4EF5A 3GFSA 4S1NA 4B4OA 2PFGA 1LBSA 1A97A 5CB4F 4B80A 4QPNA 4MGYR 3I5MA 4E7PA 1YZFA 2JGRA 2H1RA 4HWSA 1TCBA 2AUNA 4I5DA 4BMZA 4RCYA 2JDIA 1B6RA 2Q7OE 2H17A 4Q1BA 3NGMA 3NGXA 1RHRA 2D5CA 4YJFA 3W0LB 4RY9A 5C8YA 3OKCA 8ABPA 2QLLA 3H7AA 4G84A 1R0XA 2XTJA 4G0ZA 4HLNA 1RBMA 3V1MA 3ADCA 2BAGA 5DGIA 1KARA 4KO3S 2X0FA 4OG2A 1KK1A 4PXSA 5EMHA 2X0DA 4HAIA 4EW1A 1LDEA 4Y1EA 1VJ1A 4FZJA 5AUOB 4YAEA 5L3QA 1XLVA 2IKSA 4I4NA 1K8ZB 1DAHA 1FX0B 4UZSA 2ZYVX 2UUCB 4OHBA 3E22A 2I8AA 4GZMA 1S2GA 1R9JA 2LCIA 5ALEA 4CLOB 1Q7BA 1RAGA 5LKAA 5LP6C 1EWQA 2JARA 1XJ0A 3Q7RA 5DB4A 3U4GA 3JYHA 4EX6A 3ZDDA 3HY6A 1IHPA 3LO8A 4U63A 3WZMA 4ZI5A 2HUPA 5T8KA 7MDHA 3T9BA 3NVKI 2BRUC 4HTFA 1IQ0A 3PQ7A 3DE6X 3NTQA 1T8YA 4OXKA 2BFFA 4C9BA 3ZI0A 2RIPA 3AL3A 3D31A 3LUBA 1JKXA 1Q77A 1RQGA 2F8LA 5DSXA 4DTCA 2V8OA 5HQ3A 1XRJA 1A7JA 2WUVA 1NSTA 2V5AA 4LZWA 1WF6A 2BW0A 2ORYA 3C3WA 1YQDA 3MWDA 3ZR4B 4EQ6A 1YHNA 4LOHA 2IPMA 2J3MA 4EBBA 1GT91 1CIJA 2ZUSA 5JC1A 2VTBB 3K5HA 3D6TB 1QV7A 2VPXA 2QRQA 3GJXC 3H9CA 4RY2A 3AUJB 3BMQB 1QIDA 4KQ2A 1I7PA 4BQPA 3CG4A 1G2OA 1SEPA 2VXYA 3W5IA 4N7JA 1GGNA 4GZ6A 2EFHB 4TTPA 1LV8A 3QI7A 3V9AA 1E6KA 3E1KA 5K8IA 4MRNA 1ZVMA 5AW5A 1GPKA 1P4AA 1T5BA 4Y2UA 5IKMA 3P2MA 2C3OA 2DY1A 1NQVA 4RA9B 2OZVA 3KVRA 3IT2A 3MB8A 4RSHA 1GZ7A 1YBFA 2IGBA 3P2OA 3O03A 1UPCA 3T99A 5KNDH 2PKEA 3JD4A 4CQLA 3IR7A 1LRKA 1OWLA 1Q12A 1RABA 2ODBA 2WP8J 4ZPXA 4AG3A 5LDDC 2GZAA 2IYTA 5C3MA 3R7WA 2IEBA 1AXGA 2WJAA 4MEJA 3IERA 4HY3A 4INZA 4YMSA 3Q8MA 2PX3A 3GFGA 4ZT6A 3FFBA 4A27A 1XDBA 1DTSA 2VJYA 2QSJA 1KO5A 5COQA 1XCJA 3A6GA 3DDZX 3N8DA 4BN5A 4N49A 4O1HA 4YGYA 2TECE 5L7YA 1SUBA 2CJXA 5AK0A 3UMFA 1PWEA 1UJ5A 3N9IA 1ODLA 2C7PA 2VC2B 1CP2A 1T4GA 3QHAA 4AUKA 1T34A 1EA5A 5DM60 4UNRA 3B5IA 3WKAA 4YCAA 2YYYA 5CIWA 1ZD2P 3ZWYA 5FQNA 1AF7A 4B35A 1U4OA 3KQPA 1U9IA 1JYFA 1Z5OA 3SQLA 2RHTA 4XCVA 3V7YA 4PLYA 4J0DA 2R00C 3EIOA 3KSUA 4UXIA 5C8XA 1M74A 3IOMA 2HU5A 3P1JA 2XKKA 4P34A 2CHEA 3F6PA 1JQ3A 2CLLB 1I2CA 4OLJA 5A0TA 5F4BA 4UZFA 3D6NB 4N0DA 1CNMA 3K1ZA 3ZE6A 1U11A 4L85A 5KSZA 4IIJB 3F97A 2H1OA 4N8SA 4K3VA 2BDUA 2PR2A 3JWJA 3PCXA 3PNLA 4OK6A 4BNTA 4C0LA 2FWMX 5J63A 2GN4A 3BGIA 3S1LA 1UBFA 2DFKB 2OILA 1K75A 4URYR 1H23A 2B5WA 3QWFA 3N2IA 1S6YA 1PDVA 2AW5A 1FMJA 1R64A 4EUSA 2Q5FA 2JCSA 3WLTA 1FDTA 3AI1A 3F7NA 3A11A 4QREA 2GN2A 2YFKA 1SOUA 3ZHXA 1I14A 2FWJA 3T1VA 2A8YA 4EGFA 2WB4A 1U9YA 4YRBA 1U7XA 1XZGA 3KDPA 3AU9A 5DYYA 1NUUA 1LDYA 4GOMD 2O23A 4PLVA 3T3DA 1ILWA 2XBMA 1H5NA 1I32A 2VCEA 1I4OA 1Z82A 2CVFA 5ALPA 4KSBA 1FDIA 1TC1A 3L92A 5FHRA 3SLGA 4B40A 1ZAYA 3BRSA 1PGNA 1VLMA 3PA8A 5DV9A 3OLQA 1HT0A 3IMEA 3AHCA 3IKVA 1H9AA 3O5AA 2RKWA 3DYIA 2BKUA 2B20A 2QMOA 3PQ6A 4YCDA 5IT5A 3MEQA 3KYCB 3NDRA 2VUIB 1XROA 4XARA 1EG2A 1G41A 3PPVA 1RI1A 1BS1A 2ZSFA 3L0DA 3B1ZA 3I5AA 5T67A 2X0JA 3NWPA 2OOSA 5J4LA 4IIYA 4QWMA 2P9QA 5H5JA 3BM5A 3GFTA 4ZVLA 4F84A 4YAOA 1DAMA 4TMWA 4YFYA 1HYHA 2D4HA 4TKVA 3G89A 4DILA 2YZGA 3WBJA 2AJLI 1CQPA 1ZJJA 2GESA 1D7OA 2NO9A 4U4AA 3IBFA 4UUNA 3SSAA 4A0HA 3K0CC 5K05A 1P7WA 3THXA 3B7WA 1LVHA 4MUAA 1JXMA 1NVUQ 4DNQA 2GD2A 1NXOA 4WW0A 3TGWA 2YWHA 7REQA 1NR5A 2BDEA 1QLHA 1UC4B 2AHOA 3VC7A 3LBIA 3F2IA 4U2DA 1C7JA 3BMXA 3IAXA 5K3CA 3UFBA 2AN1A 1WUKS 1OFUA 2CZCA 3LVQE 1KTVA 4U8GA 3T9EA 2ZIUB 5JBQA 1OXUA 1F6DA 2FEOA 1FXUA 3LY7A 1ISJA 3H2SA 3B1WA 3UUEA 2HU7A 4OQYA 4FFVA 1LS1A 1NT2A 2EWWA 1JIJA 2BM8A 3H97A 4M49A 1ETHA 1RQXA 2GFQA 2ZTHA 3G13A 3ZGVA 4BVBA 2EG9A 4FJ1A 5KYYA 3AUTA 3Q88A 4BKRA 3K0FA 5D5HA 1ADJA 4ZZ2A 3DZBA 2OCDA 4M76B 5C7OO 4AICA 4EMSA 4GO1A 1QUEA 3FWYA 1KZHA 3O91A 1CEQA 1H1LA 4J0JA 4DUGA 3P96A 3ULKA 2OC9A 2XLBA 3DEAA 1XZIA 1KOLA 1CR0A 2FETA 5LQMA 4WA8A 4LYDA 4DRYA 2JAWA 3NYIA 1R6VA 1WTAA 2FR8A 5AQEA 1DWPA 3IHTA 1N2JA 5KAMA 4MX8A 1TK3A 3ECAA 3R0ZA 4MWTA 4RLQA 3N87A 3W5BA 1A1VA 1E1NA 5ALUA 4B73A 1CUSA 3IJRA 1KPHA 1JKIA 3HWSA 3ND5A 1P4HA 5TX7A 2IXFA 1NQWA 1R0YA 1N6KA 4EELA 3SQXA 1EFPA 1KJQA 4N4AA 5C53B 1RNLA 4HNAB 5HF9A 1E7SA 5IC4A 1YRAA 4O4LA 3KV3O 2I8CA 2RI6A 3AR3A 5A2QA 4WI1A 1JAYA 1S3SA 2GAAA 3AK4A 3IVCA 1RQ2A 4LWPA 5D3ZA 1D4ZA 5FLXA 3L0SA 2ZI4A 3R5XA 2V65A 4JP2A 2BMFA 2VJNA 3BRWA 3RROA 2JD2A 2O19A 2LUOA 1ZD8A 1A4XA 4N7BA 4WNCA 4F71A 2Z5LA 5JCXA 3LUPA 3HZZA 4RD1A 4LOKA 5DW0A 2IV3A 5F9MA 1NUPA 1DIOB 2P2NA 4DDHA 1ZWKA 4PYOA 2NNWB 2I6TA 2EX0A 4JT4A 3EPKA 4D8VA 1UKYA 2A67A 1XTTA 3D4LA 2QUZA 3BGOS 3IQGX 3OECA 4R51A 1HH4A 2JVIA 1XFDA 4TTJA 5AWFC 3IXQA 3VKWA 4F9FA 1BMFA 4BO5A 4BO8A 1UODA 1YGYA 1OR8A 3MOGA 2I1WA 5J5CA 1CVRA 1A2OA 2FG5A 2XWSA 3E3MA 3QPWA 3U3MA 2WUFA 3IBGA 2Q7XA 4REOA 3A26A 3ORSA 3HRIA 2JRCA 2JLYA 3R76A 1K9VF 4ZJZA 5KDOA 2WVGA 4CEIA 2GFIA 1VLQA 5ESXA 1DUIA 4PY2A 3COZA 4EPVA 4TYQA 4QXAA 4M7OA 1W6UA 5IAOA 4P4TA 1IBCA 5CLFA 1EQAA 3KM0A 1TJ5A 4GBGA 4TN1A 4WCFC 5ALIA 2YWRA 4AL4A 4B79A 3UWOA 3CLRD 5JSZA 2O8NA 2OK7A 2PL5A 5AO9A 3LC1O 3IVAA 3AIOA 4WADA 4DVJA 2Q5CA 3ENQA 4FFDA 3GEGA 1O87A 1V4VA 2DECA 2O7NA 1S8NA 4Q48A 3CX7A 3CVOA 1S2DA 1ZM4A 4IDOA 5ALOA 2JJ1D 1CUVA 2VDQB 4LBZA 1QGOA 3U2QA 4MQBA 4ZTUB 3RVQA 1A8IA 1AKMA 2UYGA 3IC5A 3P45A 5CM8B 5FBKA 5BSRA 4L2IB 4B1FA 3BCHA 2I76A 5JOQA 4L6IA 4ND6A 1JSXA 4AS1A 1Q17A 1MXHA 1G5HA 1QS0A 1V6AA 2XUKA 3BMNA 5E6RB 1DQYA 2BHLA 3D8BA 4LJ9A 4X6UA 1ML4A 5LBUA 4E14A 4Q4CA 4EKEA 3CLUD 3H84A 2C83A 2CVPA 2P2CA 1L5OA 1M6VB 2PTGA 1EVJA 1HY3A 2HLNA 3GFQA 3GXBA 1CK4A 2ZJYA 1C3OB 1JJFA 1MW9X 2AN5A 3MC1A 4QJ5A 3AONB 3UAWA 1K92A 4ZRNA 2M6LA 1SQ0A 4NZNA 1L7PA 1U2SA 2FG7C 2GKSA 4KTVE 2LKCA 5JEEA 2X6RA 2GCIA 2ZRPA 5C35A 2RK3A 2PMBA 3NAMA 1FYDA 2CHVA 3AERB 3L9WA 3VVLA 1PQ4A 4XEUA 4TT3D 1GAQA 1KEPA 3P9CA 3GCGA 3JQFA 3K5WA 4KOEC 2Q62A 4HF7A 4RV4A 3SHWA 4EA9A 4X20B 3DDOA 3MLBA 3TPFA 2DP4E 1LQ2A 1GQ2A 4HGNA 5BSVA 4ZGWA 1WUTA 4WDQA 4AK9A 1JHMA 2VNKA 3C6XA 2ZK7A 5F3DA 4CTOA 1I1OA 3W5UA 1M73E 2O6HA 3E1GA 2ID4A 3GRKA 4MI9A 3RH0A 2DPGA 2JIZD 3GHYA 4UBMA 1Z0SA 1D6SA 5HOQA 1DGQA 2CNBA 4IOMA 5CNKA 1VKOA 1G3RA 2WI8A 3FOAA 3L2OB 4CF3A 1LWOA 1JYSA 4X7BA 4NG4A 2J7KA 3BZBA 5DXAA 4IJ5A 1V41E 1PZHA 4UBKA 3ZIUA 5DNYB 1FVFA 2KWIA 3IBTA 3Q8LA 2OORA 4UBNA 3LE8A 3MWFA 1VFNA 4W5QA 1UKVY 3SAJA 1POXA 4GIBA 4HADA 3LDAA 4JJZA 1XDZA 4GWKA 4LV8B 4G5QA 1ECGA 2HWWA 3RUAA 1WULS 3VNAA 4AC9A 1C41A 1CRQA 4KO2S 4RK7A 2NQ2C 4LCJA 3U7GA 1FZTA 3WXMA 3MFQA 1D5CA 1FUKA 1UT8A 4KE6A 3VR1A 4AP5A 1HDYA 1Z83A 3JAWB 1W96A 2EFDB 3DMGA 1GUDA 5CT4A 3VZCA 2PMFA 3KTFA 2UYOA 3BK2A 3C41J 3B12A 5BV8A 1H42A 2PRZA 1YZNA 2QW1A 3K30A 5JXJA 5K9ZA 5IYZA 4NECA 3TBKA 1MUUA 4GZLA 3M3HA 1C1XA 1ZSNA 2I2AA 2Y66A 4OI2A 4WESB 3BL5A 2LIPA 4E4RA 4HDSA 3MWDB 1EVYA 2AUTA 4XB6B 4Y1RA 3LCCA 4QAJA 5FOVA 3SM3A 3UK0A 1PJLA 4A10A 4YAKA 9ABPA 3DZFA 2ZTMA 3IP6A 4B2LA 3QOXA 3J7AC 4B3SB 2JCXA 1JDPA 1BU5A 4BNNA 3FGZA 4DVGA 5KWVA 3LCVB 4Q6WA 2O07A 5GZ6A 3JZMA 4X84A 2WP0A 1G9SA 1T5IA 5JAMA 2XPCA 3H17A 4ZQGA 1UK6A 4CMIB 5BT9A 2Q0XA 1WXXA 2OAP1 1AG9A 2PU7A 4GX2A 4ZEVA 1WB5A 3EPRA 3FUVA 4HDRA 2RH8A 4ME6A 4Q7EA 3R5FA 1AQIA 1M1YE 4RE5A 1X15A 3FH0A 2QAGA 1Q11A 1Q0ZA 1SVUA 1WKCA 2PRSA 3H2IA 4QUBA 3V00A 1D2RA 2YWEA 2PSHA 3YASA 4WKCA 2Q4DA 3LK7A 3B20A 5SV2A 4O5AA 5B3KA 3UC9A 3CY6A 4KSCA 1J23A 5K3FA 5HF5A 1ZZEA 3DE7X 3JASB 4FTWA 2HYDA 1XPRA 1E6CA 2FSFA 4HAWA 4A23A 1KR2A 4LX0A 3UZUA 5IN5A 4B7XA 4ZZ3A 5LMNB 1N25A 4FT2A 1P9RA 1Q92A 2A4MA 2FUNB 1PGOA 3NCTA 4JWKA 1JWLA 2V4MA 3FBTA 4G65A 4GYYA 1ZOIA 3ONWA 2OG1A 3O7MA 4OHRA 1RBYA 2VRNA 4NCJA 1OE0A 4UM8B 5J23A 3KJHA 4ZCPA 1C7QA 1DAOA 4NR0A 3C6YA 3RW9A 2Z43A 3ADBA 2JH9A 3LSTA 5KTOA 3N39C 4HFRA 1NV9A 3E8SA 3IP1A 3TLZA 4B71A 4D9JA 5I51A 1PLJA 4A36A 2A0KA 2PH3A 1EI9A 2BFCA 2IXEA 4EI2A 4ABTA 2EYQA 1Y1PA 4U2FA 3WDLA 2WVAA 1O5IA 5E2BA 3UV6A 5KREA 3SKYA 4CN9A 1V1RB 1JRLA 2QD4A 1NQXA 2GN1A 1T6BY 4L28A 4MKHA 1LW6E 4RMJA 4TWBA 4DMCA 4X91A 4ZI7B 3GLSA 1ODCA 1ZMBA 3GELA 2H51A 1VZ3A 3ZE9A 3UPDA 5LVAA 2IS6A 4BE9A 1EM6A 2GF2A 2VSXA 4BQFA 4Q05A 2ZITA 2EGGA 1QRRA 3R44A 2NX2A 3HP7A 1M6WA 1C9EA 1RJEA 2PUVA 3LRTA 5JH7F 3THWB 4BV9A 2DETA 4WZBA 5TVGA 4K46A 1Z6TA 2G1KA 3BFXA 3M3PA 1SA0A 3PFIA 1YCDA 4GEGA 3FX2A 1W34A 2C9OA 4R1UA 4QLOA 13PKA 2EX4A 4RHEA 4YH1A 5ELLA 2GPTA 2C1ZA 3AFOA 1G66A 1OLSB 1NBIA 2WSLA 4M9ZA 4P92A 4WTOA 1FJHA 3T6KA 4DLUA 2VF7A 3H8WA 1NI4B 3SBOA 1SHLA 2HSZA 4BNIA 4JUFA 1J33A 1T5LA 1XKXA 2IQ5A 4NYIQ 1FP7A 3I09A 3T7SA 1L5HA 1O9GA 2AI1A 1X7WA 2Q8NA 1HE3A 1WHTA 2X19A 1I3NA 2OO5A 4AJ2A 3GRCA 2PZLA 4NV0A 1KY3A 3CUVA 1GGVA 2WJYA 3DUWA 3MCUA 5K4AA 5I9NA 3R7DA 1V39A 5I7HA 5LXTF 3SZGA 4A2PA 4XIGS 2PSFA 5AI0A 4Z8YA 4RANA 5EGSA 4CG2A 2O0MA 3KZCA 4ZQCB 2VDMB 3AWIA 4IDGA 4TKVB 5CR9A 3VGJA 4A91A 1QCDA 3VFDA 3OZAA 4AVYA 2DLDA 3NTRA 3G0CA 1YR8A 4XB1A 4EO4A 3V7UA 3ZY3A 1Y8RA 4ZGBA 5KOHB 5DRYA 1P5RA 2QTTA 1NOIA 1TVMA 5AKJA 3NKFA 1TM2A 4Q9NA 2R97A 2UZ0A 1YL6A 3SFZA 4DCCA 2IY9A 1RCFA 1WXGA 1Z2NX 2ZBPA 4FDUA 3NYRA 1DBPA 1ID1A 2WFAA 3WGQA 4INJA 4ZJPA 3LUKA 2AG6A 1G1AA 3LLVA 1HM5A 1DKLA 3E1SA 3HYTA 5DJ5A 4DJEC 3GOQA 1G3QA 1NAIA 2P75A 2A35A 4OB6A 4PGHA 3MELA 4DSNA 4Q6BA 1I4DD 1ZCAA 3PHCA 2HX1A 1J22A 1J8FA 1RAFA 3A4TA 4KU4A 4U7HA 3C85A 3L49A 3TL2A 1DT3A 4O1MA 1OH6A 2XOEA 1ZGBA 4A2WA 4ALIA 3KB1A 1COWA 3GJ0A 4WJKB 2DCMA 4CI9A 1WMEA 3N8HA 4DIKA 2Q5QA 1USKA 3PFHA 5B5SA 4H7HA 3P9KA 3AFHA 1KU6A 4PAWA 3L7LA 4D46A 3FIUA 2KLBA 5J3JA 1ZD1A 2Z8YM 4CEHB 4QASA 4D8TA 4HR7A 3S1SA 3BIOA 3L40A 5EIAA 3RTEA 2NXCA 1EX7A 2XQVA 5GONA 2G6BA 3DFIA 3OKPA 4AO7A 3IAM6 4N5IX 5B4TA 3IEVA 3ZNPA 1Q84A 4N41A 3VZSA 4J1NA 2RD2A 3IV9A 2HA6A 4PRKA 5KNBD 1GP2A 4GPD1 5EIOA 5KQPA 2C5BA 3OM0A 3J7TA 3P4UA 1AZSC 1N2ZA 1RMTA 1BX0A 3JAKA 2OAQ1 2IYSA 5DF1A 3R5HA 2OHHA 5CDGA 4UJ3A 4AB1A 3MNFA 4ILEA 2VJDA 3GN1A 4LSWA 4LXXA 1P62B 3CKMA 1Y7HA 2FW6A 3FXAA 3PNMA 1B8OA 4CMKA 3EG9A 5ABPA 5FO0A 1C0LA 1M10A 1DTWB 1PG2A 3G5LA 2AI3A 2BM9A 2HADA 4LSGA 4ZVVA 2XDAA 1E9AA 4TRJA 5ENZA 2RBEA 3L7JA 5JZ9A 4C4YA 5FJIA 1QTNA 3V7FA 4LI0A 1JZSA 4TXNA 4HV4A 1KYTA 1GGMA 5E4YA 1IVYA 1TVKB 2IOQA 4HNUA 3T15A 2B8EA 5D01A 2YUIA 1HX7A 2QBYA 3VYSB 3Q7QA 1TM5E 4KFRA 5EYPB 3OQIB 4U39A 1T3ZA 1RWQA 2AI2A 5IEBA 4OGLA 3ZGXA 2NTVA 1P60A 4E1AA 2YIMA 2O50A 1THZA 4EMBA 1BWSA 3VNQA 4TQ9A 3JVVA 1OZ0A 4D4MA 3TLAA 4K6HA 2V7TA 1EUQA 1K89A 3CJTA 3M6UA 4IEFB 4QUGA 4Z9FA 5H4GA 1M6HA 2BJWA 5FTNA 2Z5VA 3FCSB 3ZIAD 1H0SA 3IAS6 1ZGAA 3FE2A 3FSGA 3OWOA 4DXHA 4YCLA 1YI1A 2TMGA 3OTHA 4B87A 1VIYA 5MFZA 4LQLA 4NCAA 3RSGA 2GA9A 3ETEA 4J3NA 4X7PA 4ZO9A 3VKUA 3WWOA 1GIAA 1FL9A 1T26A 2WAXA 3UY4A 3QE3A 3VR5D 3CNLA 3TGPA 2H5JA 4NDZA 4X90A 3WGVA 4YQFA 2JFBA 3I5UA 4MAFA 2R85A 3A9VA 2O0KA 2VWGA 3LGSA 5EIXA 4V0KA 3LYAA 4S04A 1XCGB 3ZDCA 4NE7A 4IJMA 5IBRA 3GEMA 1YB4A 3VTKA 4X44A 1NA5A 1YU9A 3RK4A 2XVAA 5LKRA 1XCOA 2C5SA 3V2HA 3AG6A 1C9KA 4FKBA 1E20A 4EF6A 4IY1A 2CHQA 5CHYA 4GOLD 2X58A 4IJQA 1LJLA 1P8AA 2YN0A 4CM4A 1JPJA 3VHXB 1HOTA 1AO0A 3WLMA 3WC4A 3P9IA 3S4YA 2GUWA 2HDOA 1B76A 2HOQA 3AY0A 2A4KA 1JQKA 2AEJA 1C29B 1AZLA 3ECCA 3LHIA 3OIUA 3KFXA 4EG5A 3KQQA 1UKAA 1ISHA 4IFBA 2A58A 2OZLA 3TG2A 1QMGA 3ON5A 4ITRC 4EZIA 3RK1A 2AT1A 3AB8A 1Q91A 1M1NA 2GJ4A 4CKXA 3PCTA 3SK0A 1KHHA 4E0BA 2AFHA 1U28A 5ES4B 4L4XA 1AK1A 5IJZA 1DKRA 3N7AA 2DERA 1GL9B 1I1HA 1OI7A 2EWMA 4YJGA 3LJKA 4ZAXA 2ZWMA 3KVOA 3B5EA 3DONA 4QQRA 3EH2A 1WQ1R 2BEWB 2J67A 3HN7A 1XAJA 4KDEA 3BMOB 7GPBA 4G01B 4FCVA 1OOEA 4LRTB 2QIPA 2XSZD 1WBDA 4KX5A 2I6XA 2IYOA 4MYSA 2R86A 4WOCA 3EQ2A 3HI6A 5TMBA 1S02A 2H4FA 3PD0A 4R3WA 4OKIA 5LWQA 1X7GA 3COVA 4L5JA 2YYSA 3U4IA 3VR2A 5FORA 4MGEA 4DNFA 1M8FA 4N82A 4NWIA 2ODAA 2P68A 4PYRA 3U31A 5G4KA 3BRQA 3OSUA 1MIHA 3CGWA 3VPFA 4ZARA 2QUHA 3K0KA 4K0RA 4QPCA 2DPLA 1EHIA 1FE8A 1JE1A 4CF5A 2FVYA 4FFBA 2BTQA 1FMLA 4EGAA 1W5FA 2I5PO 2BH9A 2JCGA 3PIIA 2O8DA 5T64A 4YECA 5SY6A 3HZHA 3OICA 3IMFA 3I9KA 4DIOA 3PC8A 3U4DA 3FKSA 4EY3A 1COZA 4U2CA 3OZGA 3G0GA 1MA3A 1K4MA 3PC6A 2V7EA 3P4XA 3RFCA 4OM8A 1AQ6A 5IEJA 4ZP1A 3HDHA 4Y6SA 3KS9A 1P8JA 4N3AA 1DJNA 1NJFA 1BH6A 1QQ5A 3G0BA 3P0IA 4GQAA 5DHTA 4CM5A 4KITB 3IPLA 3UC5A 2EGHA 2C42A 4R0MA 1TJ4A 2QVBA 3EUEA 1YACA 5K3EA 1Y7LA 5AKLA 3K2EA 1DIHA 2XY4A 2OBNA 3QUCA 2VPQA 5F3WB 2XJ4A 1XZNA 2F8SA 4NJOA 3ANXA 4HLQB 3OCWA 4RFVA 3UEOA 3AJEA 4RIFA 5HK9A 4ZOQI 1YL7A 2V6IA 4KFTA 3UGJA 2PT6A 4F85A 1UWLA 1SC9A 4JBWA 4CIYA 4Y6GB 3W3AA 4H3SA 5EVJA 1ZMOA 1RWVA 2ZGVA 3HQ4O 4F8YA 2YASA 4JOSA 5JDCC 4G6ZA 2GCNA 4TX1A 3DWGA 1T8PA 4FOSA 1Y9JA 1W85A 4PC6A 3IAFA 4HX9A 5DOVA 4ZC8A 3HGMA 2K5UA 1VRVA 4ZZ1A 1ZGZA 2HJ9A 3OM1A 2X7XA 3OO1A 1TCCA 4MPDA 3C98A 1YNSA 2HRBA 3NVAA 4XUDA 1A9XA 2ANCA 2WWHA 3L1JA 4P4GA 1FPQA 3RUPA 3RS4A 1B8PA 3CSDA 3TDNA 5HDQA 1KWKA 1ZOLA 4MYHA 1P0MA 1Z8FA 4DYHA 4F3CA 5A6SA 1MENA 2X2EA 3KOUA 1O6BA 1Q0QA 4CQNA 3PT5A 5CP8A 3IQXA 4JSYA 4QXMA 5ANRB 4D56A 3U44B 1XCPA 1IOVA 2PKYX 1VHQA 3PHBE 1SCAA 1USGA 4IHJF 3MINA 3CR8A 3NBYC 1SU8A 3AW8A 5TQ2B 2EKZA 3AKCA 3R0JA 1I33A 3RD5A 2QV0A 3TPZA 4WLEA 5TGZA 3AVXA 1HDXA 2Y05A 3FUUA 3WRWA 4UQOA 1W9HA 3NO4A 3QEOA 1M0WA 3Q9SA 2F2TA 4O2AA 2QMEA 3VPBA 2IYUA 1PG5A 1R6BX 5CD1A 3C2QA 1JQLB 4M9QA 3W7AA 3OLVA 1I9GA 2BF4A 4MDHA 4Z1MA 2XA9A 1B14A 4BPBA 4PIVA 4NCXA 3TRDA 4V0OA 4BLTA 2R7LA 3AEXA 2F7SA 1UIRA 1V6CA 3KUXA 1SVMA 1J9ZA 4HVAA 2O1EA 3T7EA 1JDSA 3ILVA 4LMPA 2MHCA 4WY2A 5B1IA 1WUJS 1K7YA 4TTIA 1KEWA 4CMEC 2EP7A 2OV2A 2LPMA 4IQ0A 3D4IA 4A2QA 5ICEA 4GEKA 2PXCA 4RJ2A 3I5YA 5H8WA 3AWDA 4Z5XA 4JMLA 3PEVA 2XYPA 4LY6A 4Q4AB 2BEUB 2PXAA 2YQ5A 3EC2A 2FN3A 4YP9A 1KJZA 4AMGA 4BVJA 1I6MA 4Q19A 1P2BA 1Y4DE 1P1HA 4RQAA 3VXKA 3KTDA 3IDZA 4WZZA 4BQRA 1P9NA 5TPZA 1YMQA 1GSHA 3EA5A 3FNQA 3QYAA 5I4CA 5KJCA 1VKJA 2FPUA 2AD5A 4JGIA 1L9XA 3WAJA 1UMDA 1VM6A 1FFCA 4QVGA 1SXJA 5ICGA 1RLJA 2PGXA 2E4AA 3BX1A 3G79A 3GLIB 4U5XA 4CLRB 4YQEA 1E1CA 3F0TA 3R7NA 1VMKA 1JG6A 4JMPA 5C81A 1YB1A 4XYEA 4D9HA 1X7WB 4WEOA 1JEQA 5B2ZA 1C2YA 1FUYB 4LDJA 4O8CA 3T5TA 1QYCA 4A0GA 3W2HA 5AKZA 2GQ0A 2C5LA 1PKEA 2AOUA 3H0CA 3L8GA 1ESDA 4ZQEA 1JQBA 2EKPA 4MR9A 4IRXA 3ZWQA 4FNGA 1YKFA 1RRPA 4DLLA 2UXDB 3BZWA 3ROFA 1GVHA 1GGJA 1W25A 1YF3A 2YOHA 4LIPD 1N9KA 1EZ4A 4BFWA 1H3FA 1FU7A 2EFCB 1KZYC 1NQ5A 1MO4A 2HBRA 4UE3S 3SEAA 2YBDA 4P0TA 4QXQA 5I5GA 1UK7A 1QR6A 2OEPA 1JTVA 5AFSA 1JAHA 1ESEA 4JQOA 3TOSA 3OQMA 2GBFA 4JL5A 2JGDA 3V4SA 3U5ZB 4IJKA 3NUZA 3TNLA 3J81k 1OFVA 4ETMA 4N5MA 1G18A 4TYWA 4AN4A 2CLSA 1QJCA 3WL4A 3WWCA 2DFNA 2WG0A 1KJIA 1SBTA 1DC7A 1JIIA 1XZAA 1H8ED 2PT9A 3ND8A 2VSFA 3DH0A 3U17A 1G21E 3UHFA 3ZWNA 1LWNA 3IP8A 3P9QA 4A7PA 1JHXA 1SD1A 4YXWA 3VGPA 1XB2A 4B4UA 5E9WA 1OYOA 2AJTA 4YUXA 3G0DA 3HCOA 3OAAD 2ET6A 1IE3A 2XMGA 4LC0A 5DLDA 3HNPA 3CR7A 2OFPA 4NH0A 4C7KA 3MD0A 1IMJA 2IY8A 3CEHA 4GOND 1U8TA 4RD6A 1E9SA 4F4IA 1EB8A 1NMYA 1FMFA 4OKSA 3TLMA 2REQA 4S1TA 4ZVMA 3M3DA 3DZIA 3RU7A 4QRDA 5AVYA 5FBWB 2BF7A 4V02A 3R5KA 4B4WA 2HMVA 3ZE2B 4MV4A 3WLOA 3B7PA 2OCGA 4PX2A 1NFFA 4KWEA 3MFYA 2ETXA 3ZXSA 4O4JA 3ELYA 1YR9A 2CF5A 1OTHA 3T38A 3CU5A 4RA6A 2J87A 1CPYA 2AOVA 3EVBA 4KZKA 4OQZA 1LLUA 3SC6A 4FYYA 1C7EA 2FZ5A 3GOHA 3S2FA 2DG2A 3IOYA 4CLDA 1YB2A 2OCYC 4LDQA 4LDAA 1N33B 4FE4A 5G3YA 3G8AA 2Z2ZA 1ZUIA 2B4YA 3HXTA 1WEKA 3JQDA 2NU9A 4ESHA 3BFVA 4C0QC 5KC9A 2IYQA 5IASA 3JTMA 2Y1KA 2XF2A 1GRRA 1T3SA 1ZRNA 2DHRA 3LBYA 3Q9UA 3A4IA 3RIYA 3EJWA 3O1HB 4P0PB 1AZTA 4HGRA 4A26A 1OH7A 4JX9A 2OC4A 2QW8A 2NSJA 4NU0A 3RUEA 4EMTA 1XN4A 4EVRA 4LE1A 1Q7EA 2VPTA 4TRNA 3DKIA 3QHQA 4H77A 3QXSA 2WAMA 1PT9A 1KJ8A 2VT2A 3A1VA 4FI3C 3ASYA 4QEZA 4WY5A 4BYGA 4K2AA 1TJ3A 2B6HA 4M8IA 521PA 1HTWA 5TB5A 1M72A 3U4HA 5IN4A 4TM7A 6LDHA 2DRIA 4JU9A 3HVJA 1ZJ6A 2ZSIA 1JI0A 5EZ5A 2HA3A 4PGGA 1PQYA 1C0IA 1OA1A 221PA 3DP7A 1LNQA 2LIVA 3Q8XB 2J5BA 2D62A 1BA2A 2YQZA 3R2JA 4FILA 3DW3X 4NV3A 5E0KB 2FXVA 4UHBA 3SHFA 3WLSA 1XHLA 4DGSA 2QR3A 1CR2A 2XUQA 4PFQA 3DE2X 4LK2A 3V55A 5HUQA 1YR1A 2G0NA 1YS7A 1N92A 1OB5A 5KQMA 2WJWA 3R6DA 4BGEA 4TV9B 1DAFA 4A8TA 4X71A 4G4GA 4ES6A 3FMIA 3I5XA 3A7EA 1IEVA 1L2TA 5HFJA 1EM8A 2ZW9A 4BUCA 4OXNA 2H9AA 2IW1A 4YREA 5F7OA 3H2ZA 5FPKA 3U16A 1L5ZA 1CNFA 4JHLA 3ZLJA 3EJ6A 2BSAA 5G2OA 2OG2A 1T10A 3IALA 2ZYDA 2QNBA 4ZTBA 2F1IA 4G41A 1J5XA 3Q5EA 3EDQA 2K87A 4B43A 2SKDA 3CN7A 1YBMA 4YPOA 4PV7A 3CZ5A 4EFNA 4RADA 1NF8A 2RGBA 1X0XA 5LQAA 1Y81A 4TLAA 2G28A 1F3LA 3V3TA 3HHPA 4O25A 4XIYA 2NU6B 2IU0A 3M7IA 1G8YA 5BPHA 5FOQA 1E1QD 3EEYA 3V42A 5I7FA 5GMOA 4PGFA 2H4JA 1FJGB 4YAJA 2CXNA 2EZUA 2JFVA 3LQFA 3R0QA 4MKFA 1J06A 2FFJA 4DQXA 1HTBA 1PP4A 2FPPB 3B1XA 3IJPA 4I9GA 4J3JA 2W2MA 1BKSB 2YJZA 4L1KA 3RCBA 1XPOA 2JGEA 1ZIDA 2E4YA 2WYIA 3FNIA 3EZ2A 3RF6A 3N0VA 3A4VA 1GARA 4JP1A 4GICA 1Z2AA 821PA 1EUCA 3L43A 4F6RA 4DDVA 4DR5B 4I1UA 5BV0A 1MD9A 3BOSA 5ERXA 1T9DA 1X6VA 1JHDA 3U4QB 4FQ5A 3S2UA 1CQIA 1O6GA 2D2IA 2R8XA 1GV1A 4P1ZA 4W8GA 3FR7A 3STWA 4F4CA 1C4KA 3JD0A 3NU1A 4XCXA 5AM2A 4YRDA 4JLSA 2RAPA 4UDOA 3T3NA 3ACDA 2ZREA 3L9XA 3RUCA 3DFUA 3OHPA 1SZDA 4KPUB 4TOIA 4N65A 5JISA 3CLKA 1E9EA 1IG0A 2IIPA 2B7BA 3B3AA 3BDIA 4U7DA 1GFSA 2WJGA 1N36B 4JIGA 4BRZA 5AW6A 3FVVA 1V16A 4I2VA 5KTPA 4Y9RA 4JFRA 1LA2A 2JBAA 5CLJA 1LEHA 2Y0BA 2C7BA 5IAEA 1R9MA 3TB6A 2H1WA 1VLJA 3QLTA 1WPRA 3TW4A 4ZKDA 1SRQA 1MV5A 4L3VA 2XAUA 3O8OA 4JBGA 2P3LA 4IDAA 5GY7A 2C59A 2B30A 3KIPA 1N0WA 3AM3A 4L4RA 2FMTA 1U3UA 2OBLA 2OXRA 5C8DA 1IHXA 1MEJA 2FP3A 2GI4A 2H2DA 2Q1YA 4OGKA 4R7ZA 5EJMA 3GUVA 2OYSA 4NE2A 2C84A 3EDMA 2I87A 1EP2B 5AW9A 1OXVA 1VHTA 2DE0X 4RY8A 2IDKA 2QS9A 5TPWA 4QRHA 3FW1A 5E6SA 2B1JA 3HFRA 2PVSA 2WU0A 1NNLA 3QW2A 4CMCA 1J99A 4HAVA 1HLGA 1XRMA 1WMDA 5FNZA 3DOHA 3NWJA 1R0LA 4MQEA 1U1EA 5DX0A 1H0KA 3O4IA 4DQ0A 4F2GA 2BFBA 4RLSA 5DX8A 5E95A 1F06A 1ZKDA 2A5LA 3FGNA 1RC1A 3NOXA 5DNDA 1IQUA 1P4JA 3TD6A 5HQTA 1MW8X 3K73O 1HT1E 4UW9A 4DJJA 4D81A 1D2NA 1ZK3A 2XYQA 3COPA 4HSEA 1HA3A 1DQNA 3PJDA 1QK5A 4HX5A 3R9XA 4QYXA 4YV0A 4YRFA 3SMQA 1P7CA 3D2AA 3F7OA 3PC2A 2V7WA 4E3ZA 2AX4A 5L51A 3ETNA 4MJXA 3WYBA 3WQHA 2QTWB 2JFOA 4WXYB 2NO0A 3WB1A 3Q72A 5DBGA 5CDUA 3EIXA 2HF8A 3HNOA 2YWDA 4CGZA 5K4HA 4PS0A 1PR0A 1QR2A 4UMDA 3K20A 2FGKA 3E3LA 5DM0A 3I92A 4KFCA 1BH2A 4D02A 2PX5A 2C04A 3EHDA 3VO9A 1SUFA 2FN7A 3AI7A 3IQHX 5J58A 5DNAA 1ULTA 1VSUA 2H59A 1HQKA 2ISSD 5LIRA 2GR9A 5DNUA 1F6WA 3CJQA 4NS1A 4D4KA 5IKXA 3ZD6A 4RF2A 3AVVA 1E2BA 2PCLA 4JT2A 3NRJA 1DRUA 3UB4A 1MMFB 2VHYA 3F6CA 3PUKA 2M98A 4H7EA 3RAFC 3M33A 2GJKA 2WOOA 4KWHA 1NPDA 1SD5A 4D57A 4ZIRB 1KPIA 3PGVA 1E3MA 2FZGA 3OCCA 3TK1A 1U3FA 3OF5A 2XTAA 4MQ6A 4Q3NA 5CA1F 1P1IA 3BWDD 4X1OA 2W8BB 2OY0A 1GILA 1H85A 1IYZA 2X4GA 2G08A 2XDYA 3AV3A 3OFND 3KLPX 3ORHA 3U3XA 3DLCA 4NL4H 3EZNA 2ALJA 3BHNA 2P3OA 2QUAA 2ZB2A 3LXUX 4YQZA 1TA0A 5F21A 2QPAA 4W1SA 1ZI8A 2ZRKA 1P5FA 5CLHA 1TU4A 3M4XA 3OI7A 2AZTA 2AC2A 2XEXA 3STTA 3W9UA 4GVLA 5JJKA 2Z3VA 4XGRA 3F5FA 1ABEA 1M7BA 2BYTA 3TW8A 1UZNA 5CYFA 3LZ6A 1K3TA 3HO6A 3TM5A 1NP7A 1PD1A 5DYNA 4QBHA 4GM4A 4P98A 5IWAB 1WZEA 1YQXA 5U9CA 1E2HA 4Y30A 2IK8A 3ZWMA 1YASA 2KM1A 4R69A 3S55A 2J9YB 5H1YA 3V8RA 2CWDA 3GVPA 4HOYA 3M83A 1SQ6A 1SVKA 3LW8A 3OM8A 3PNBA 1CV2A 1DX6A 2ZT8A 2B4RO 5D5PA 1QF7A 1GPH1 3PGJA 4MQ5A 4O2AF 4JL8A 1I3CA 4AIIA 2JJ2D 3G02A 1MO2A 2C0QA 3PG5A 5HCNA 2XMPA 1WD5A 3LLSA 3OZSA 2YFYA 1XZDA 4J0GA 4C0HA 1KDRA 4JLKA 4IIVA 3B9BA 1Q6ZA 5BSUA 4U8HA 3O74A 1Y80A 4I1PA 4ZCTA 1I30A 3AT1A 2N1MA 3IVRA 3D8RA 3FTPA 2E89A 4UD6A 2REXB 3NKVA 3SYMA 4R83A 2GYUA 1S1CA 2OBYA 1NRXA 3W5VA 4BFTA 4EHIA 3LQQA 10MHA 5GOTA 1L4FA 2I6GA 3H5NA 1VLHA 2ZCVA 4QLAA 3S6JA 4CIDA 3TL3A 4DAOA 2F1KA 1R6UA 1CRWG 2Q1TA 5FV7A 1RLTA 3ZS8A 1TRHA 1YUBA 4OA5A 5EWJA 3LF1A 3WTCA 4R2LA 1OH5A 2I91A 1P2UA 4QSMA 4PC2A 1Y6FA 2DT8A 2CL0X 1EXNA 5CDSA 1H2ZA 1MEEA 3RSCA 4KQ6A 2IUTA 5B7GA 2BUCA 2AQHA 2VOEA 3ICWA 5E0OA 4O4HB 5IAGA 4PQGA 2VQ6A 2X7HA 3AHDA 5FUVA 4B2PA 2HU8A 5JV5A 1PT7A 1QE5A 3HXKA 4IILA 2CNDA 1A1SA 2ZR7A 3CX8A 3E9CA 1N6RA 4OI4A 3IBSA 5AXCA 2MSLA 2ZR9A 1M9NA 3INGA 5JYBA 2WFMA 3BWVA 4Y7DA 5BYKA 5LQKA 2EW2A 4HWKA 4JBYA 3QELB 1KZ4A 4ZGGA 1XPUA 3B13B 1YRQA 1YO6A 3FB4A 2BCJQ 3B6ZA 3MCTA 3K70B 3HVIA 2H1IA 3MD9A 3GP8A 4X61A 2H4WA 2Z4RA 3O38A 4TSFD 1X80B 4UMFA 3HKDB 4J1TC 4EYOA 5LOVA 2PKRA 2PRJA 3MWEA 5JAOA 5B3JA 1BWRA 2I29A 4MV9A 2X8AA 2VDPB 4O4JB 1VA4A 2IP4A 3CE9A 1BE0A 1QU3A 1XTUA 5H3HA 4X7MA 1IXKA 1XCBA 2WG1A 4ZAGA 3T7IA 1U1CA 4L8LA 1W4ZA 3KZKA 4PPNA 4Z1OA 4JI0B 2PX0A 1PYGA 2YL2A 3ZE7A 4ND8B 1YH3A 3B8HA 3BDVA 4NDAA 3WWPA 4CG1A 4F4UA 3DMTC 3OZBA 3LLMA 1HPLA 3ZCRA 1FS4A 3NATA 1O6CA 2PZJA 4YRTA 2CVOA 3ZJYA 3IA7A 5IC5A 2BFDB 3WQBA 5BWNA 1JSLA 4HLCA 1X87A 2AMYA 4OL9A 3B51X 4XGNA 4GI7A 3WZ2A 3WZLA 1NBWB 1ZW1A 3AF5A 4JY7A 3TZKA 4Q3AA 3TZEA 2PJDA 3D8NA 3I0MA 5JO0A 2COKA 5IAJA 1JEYA 3S7TA 4KR0A 3MOSA 3TW0A 5C9ZA 4YP5A 3OE7A 1MOSA 3A1DA 4DEVA 3KBOA 2GM3A 3DAPA 3I6QA 3ZU2A 5BP7A 4JLNA 4HNSA 4IHKA 1RKUA 3ETCA 3LH5A 2CCKA 2AG1A 5EMLA 4Y2JA 3MUNA 1D2GA 1OGYA 4FR0A 1ZIPA 5IC6A 4ZFNA 5AVRA 3K6SB 1U0RA 3MK31 4B6EA 4HH0A 4YHHB 5KSYA 3T5AA 1G2IA 3N8NA 1PJQA 2CLEB 1XVVA 2MJLA 1VYTA 1VRWA 4DR2B 2P9JA 5F7JA 3AQ4A 3RRJA 3PD1A 1NNSA 2QRJA 1EZ1A 3D6UA 3HXLA 3MQ2A 4QVKA 2D06A 4URUR 2F6RA 4NBTA 3TQCA 2JIDA 3HS3A 3OHSX 1DOAA 1KFCB 3JD2A 1G4UR 5JD5A 3PWTA 4XD2A 4BFSA 4L9WA 2GBLC 4DFDA 3TQOA 5K0TA 3GFBA 3VOAA 4URHA 3VR4D 5A5EA 5K20A 1MABB 2XXAB 1JJVA 1JXQA 1Z25A 2PQ0A 4JBNA 3A6LA 4UPVA 3ZNNA 1UMCA 2F4VB 1V1MA 4JOQA 5K5EA 1Y89A 1BYUA 5JATA 4XYLA 3RRBA 2IYXA 5G53C 1P19A 2PJUA 3NIGB 2OGUA 2FMKA 2PD3A 3PJGA 2BKAA 3MLEA 3QGMA 4RHYA 2ZAOA 3WI7A 3JQ6A 4V0MA 3UV3A 3ONNA 4BGVA 5IXSA 4POOA 1QSGA 3WLLA 1M2OA 4C0SA 1M7HA 5K8JB 4PTYA 1PFKA 1B93A 1FYVA 1Q44A 3KXPA 3R7AA 3EBPA 5KTRA 3PPXA 4LTDA 3UWMA 4YJ2A 4MA0A 4C5AA 4TLBA 4XSHA 1WE2A 3QKWA 3L79A 5LJLA 3KSBC 1NOKA 4LHYA 4Q7JB 5KJEA 4J1QA 2O7QA 1FA9A 3SX2A 5I7RA 2FFBA 2WPDD 3GT7A 2PUJA 2Q3FA 2A5JA 3N6XA 4K9NA 3LKDA 3OT1A 1SC3A 2JFPA 3H4VA 3ZW9A 4X1YB 4ZYXA 4KVGA 2Q41A 4UDYX 1G42A 3ZD9A 1DJPA 2QXUA 2ZJ5A 3N70A 4E5MA 4C6HA 4CKWB 3ZCSA 4B6OA 3QTBA 4ZHSA 1J1IA 1QFSA 1ZLYA 1ZIYA 1DINA 1O6ZA 2NU8B 3A2LA 2PSEA 3EZLA 3OQHA 1HKUA 2RMKA 2Y2UA 3LGAA 2MSWA 1RQNA 3OTWA 4RH0A 4PYMA 4K3UA 4OU5A 3Q40A 4YJ3A 4KNVA 3R8CA 1D8TA 1NUAA 1V3TA 2CGEA 4JQZA 4MINA 4MVJD 4AN0A 4CJXA 4NE9A 3D8SA 5HCUA 4LVCA 4EUNA 1Q20A 4GMDA 1H5QA 2F3UA 1XIVA 2VF4X 3HCPA 5HGJA 1EE9A 2XBLA 3ISTA 3A25A 3LMKA 4G24A 3ZQ4A 1V5WA 4QJIA 3CM0A 5EQJB 3QXGA 1EFCA 4ZDWA 5HF8A 3SVTA 2WVJA 4DEYA 2G1JA 1UANA 1VSTA 1KOGA 1V3QE 2V9CA 1GD1O 3AEKA 2I7DA 3UIEA 4W82A 3N2LA 3NRBA 5HA5A 4UNPA 2ACKA 2K2WA 2YJ6A 2D6FA 4X3OA 4OXYA 3MBIA 5TQJA 5DSZA 3JQ7B 3EPHA 3L1KA 4AT1A 5JSYA 4R81A 1I7SB 1GA1A 4K8OA 2X86A 4DM4A 3LT4A 1IBRA 3IIIA 3P7MA 4FCCA 1DDGA 4LXUA 4ANFA 4U3JB 5DHAA 2H92A 5IAKA 4HB0A 5A3JA 3K9BA 3OO0A 2GDJA 2OOKA 1MG5A 3DJFA 3GGJA 1VL6A 2HXYA 2OWEA 4TQGA 1JDZA 4AY3A 3F5MA 1T6ZA 1AKUA 1HSOA 1JXAA 3D2CA 1PW7A 5J9FA 3OPVA 2VT6A 3UOWA 2HHJA 3PENA 1QFYA 4Y3UA 4L0CA 1ULZA 2OFWA 4JAVC 1JBEA 2ONZA 2WJIA 3QVOA 4K2HA 1O95D 3I45A 3OIGA 4M21A 2ZM6B 3FPGA 5JXWA 2JEZA 4MULA 4PAQA 3UMCA 4GAEA 2AR7A 2QYSA 2HB6A 3MBKA 3TEMA 4DCGA 4RTNA 1KO4A 2QIOA 1KK3A 4HDKA 3R7SA 3RB8A 4D26A 2EDAA 5K45A 3A32A 2R6AA 3QWIA 5FWYB 3ZBQA 1II8A 4JCOA 3K8OE 4GHWA 4JV5B 1HWYA 1YC5A 1C80A 3N2GA 3WJ1A 3K9QO 1JHPA 3BXGA 4P4LA 1T8TA 3WL6A 2BEVB 2ZWVA 2IELA 2Y1FA 2HF7A 1T15A 4BGUA 3F74A 1A50B 1JDTA 1QIJA 4G8JA 4NEHB 1H2RS 2X1HA 3K0SA 4EABA 1JR2A 1K97A 1L8LA 5B58T 2W6IA 1GYQA 3ROPA 3WGGA 3L4KA 2H1CA 3UMBA 2JK1A 3EQ7A 4Y7CA 4C2AA 3QOWA 4YAGA 2EJBA 1LLDA 2JRLA 3A1UA 2CHUA 3CR3C 4XDGA 1GPAA 4UTXA 3KT8A 3Q7EA 1LQTA 4ZOLA 3C15C 5BQ5A 2EATA 2Q3LA 1FRVA 1P1BA 1PHRA 1ULHA 4XM0A 2FDXA 4HGQA 5GOZA 5J2UA 2ZRFA 4AN1A 2PN1A 3EBOA 4JP5A 2ETVA 4HDNA 5A2GA 4P4NA 3V1LA 5EP3A 5HUHA 3ITDA 2I4RA 1G63A 1UDWA 5AOBA 3LHFA 4H7IA 3IIEA 4UBOA 5KNBH 5KO2A 3E6AA 4TVKA 2VATA 2KB0A 4JJ8A 2IHNA 1V11B 2JHCA 2X0NA 2YIDA 3D2LA 4JJGA 1OAOA 2WHRA 3BMCA 4A8PA 2EFGA 2FGJA 3LM8A 4NH4A 2MR6A 1I0LA 3NAGA 4INOA 3CJRA 4D0LB 1ANKA 2JFWA 3U5TA 1QCYA 1JP7A 1XJCA 2OGWA 5FA5A 4EX7A 3OBBA 2FPIB 5AI4A 4NARA 4P5PA 4CCWA 4LGVA 4WXHA 2AV6A 4FYJA 3W5SA 4C3VA 3IRUA 1LZKA 2WU4A 3TD9A 1EP9A 1BAPA 2J46A 2Z2IA 2ZE7A 3DZJA 3K35A 3KT3A 4R4JA 5CPBA 1AD2A 3I58A 5JZMA 2C95A 4AJJA 1T36B 4RHXA 4BVKA 3CRZA 1YOVA 3TN7A 4RVFA 1AVTA 1WAMA 1EB9A 2UZ1A 4RTRA 4A6EA 3M4YA 5L4NA 5B6IA 3ELWA 1HDGO 4C2UA 5CYPA 5BYBA 5E7IA 3OOWA 4HZUA 3ASVA 2XTMA 4K9KA 3E5NA 1QFXA 3HPRA 1L4EA 4H59A 4OSOA 4R16A 3UMGA 1VGQA 5F98A 1ZD3A 2QAIA 5KWJA 3E7XA 3AVYA 3EODA 2C2XA 1V8DA 2P62A 2QG4A 3OLYA 4CR7A 3PUVA 4Q7KA 3IEXA 3LRPA 1LTHR 4KRXA 3UMMA 3AZPA 1HZZA 2L19A 4NYIR 2EDCA 4OM7A 4R05A 1TE2A 3LX6A 3AETA 3MW8A 1W1WA 3N5KA 2R68A 3PNSA 5ENDA 1G7RA 2ZRJA 4ZOCA 2K7ZA 1KVQA 5IFKA 1CQJB 4XQ0A 1T2AA 4AKSA 3HKEA 2C8VA 5LA6B 1JVBA 1R0ZA 3VR6D 4BNXA 3W2GA 3NTUA 4F4HA 5KYVA 5T6BA 3HTXA 1BC5A 4GECA 2XMCA 1I1NA 1U4NA 3QA9A 4I3GA 3VR5H 3Q98A 3MM4A 3VRHA 4H4DA 4BX8A 1A8QA 3BT7A 4Q93A 8ADHA 1DDOA 5EJ8A 1IG3A 1MHTA 1B8VA 1CRLA 4PX9A 4TWIA 5C1OA 5LDHA 1C8KA 3CLTC 3RVLA 3I9V6 1I4LD 4NBUA 3S2GA 3IAEA 3FUWA 3ICPA 5CJJA 4W5NA 5L3ZA 4CCYA 1SGWA 3BGDA 2P6UA 3ZWXA 1ZI6A 1WDTA 4TROA 1QOQB 2JS7A 4QUAA 1PDOA 1QIIA 1FNMA 2YR0A 3MT7A 4RY0A 2J3KA 3ZZTA 4DLNA 2R4UA 1UIMA 1NJ5A 1YAJA 1RM3A 4AP9A 2HMSA 4RUKA 3RWBA 4DA0A 4G3XA 2WHQA 4K6FA 2NP7A 1P3DA 1T2VA 4NJEA 2NVUA 2WFZA 4YLEA 2Q50A 5AVVA 2IPLA 4R54A 5DRTA 4EMUA 2PUCA 1I6LA 2POCA 3DAFA 1IEWA 5BMVB 5JLJA 3ROEA 1PIWA 3K09A 1PKXA 2EQ5A 3DL4A 4GT1A 4XSGA 4CKBA 5AW4A 3AVQA 4I7EA 2BZGA 1E0KA 3GZNB 3F6RA 4KXVA 2QPOA 3OX2A 3UJ3X 4ZCQA 1FXWA 4EJFA 1AIPA 1EBFA 2QXTA 3QVGA 5T4BA 3UB2A 4CM9A 1G6HA 4EG8A 3URMA 5IBCA 3FBWA 3CUSA 2QYHA 3WP0A 4EHKA 1FIUA 4G56A 1CUGA 5EE9A 2IKQA 4O59O 1NMXA 1Z2EA 4NCNA 1BQ4A 3COJA 4QNNA 3AM4A 3ADKA 3KJXA 4ODIA 4PBTA 3WIDA 4CU2A 1YRWA 4Q9AA 1M34A 2W43A 1KHTA 2H7XA 2JGMA 2R5FA 1RHKA 2VXCA 4MV3A 4ZAFA 2DOKA 3DFFA 1J0CA 3AVWA 3ZOZA 4X1IA 4ED9A 1B4DA 1KIAA 1Z7WA 4G0YA 3UK7A 4CM8A 2G83A 2PZAA 1D7AA 3OQNA 1O08A 3GD5A 1UOQA 4DQUA 2B2XA 1YB7A 3GJSA 1AKEA 1CUYA 4JSTA 2RI0A 3SZOA 4DB4A 2PY6A 1V8ZA 4QQNA 1CUUA 3GCWA 4P3YA 4P4SB 4BFYA 3C7TA 3GPIA 1RYYA 3VVCA 1GCIA 1EG7A 3CBQA 5DOZA 4EVSA 5TV2A 2DR2A 3BWEA 2BGJA 2FQYA 3BORA 5KS2A 4N6NA 2J31A 4RESA 2PGIA 3L8ZA 4LTNA 4BP8A 2DPXA 2CLOB 2FW8A 2VF2A 2FE4A 4GRAA 4JELA 1EXDA 1R0WA 5IVPA 3S70A 1DWUA 1GRQA 1VSVA 2O2XA 2B2CA 4YGXB 4B32A 5K09A 3IKMB 3LFHA 2WSIA 3JYQA 3O8CA 1XHFA 2G88A 3QKRA 5FQOA 3I6BA 1O94D 1U0SY 1VPLA 1EESA 4ARZB 4C0AC 3QFTA 4A9AA 2HCJB 4OXIA 2FEMA 4XDYA 1Q0PA 1GUBA 3HB7A 1XEFA 3D6FA 4Y9TA 4C6SA 5KSWB 3GRPA 3QM1A 3T5DA 4P81A 3HMQA 5AVJA 1XMSA 1K0UA 2PZMA 3R3XA 5FPTA 3K0AB 4N8DA 1SIBE 4RGBA 3MGKA 2GEKA 4MRRA 3PC4A 1TIBA 1XJWA 1IH8A 1NN0A 1OU0A 3FOCA 3MCAA 5DYTA 1B8UA 2TYSB 4IV8A 4AW9A 1TD1A 1NQOA 2ZUBA 2FQQA 3C8ZA 5BR1A 4AZWA 5AJVB 2BRUA 2UZIR 4D3SA 4KTTE 3SF8A 3AY7A 4FJ0A 1TKAA 1OW3B 1SUIA 4LQDA 2WTEA 2I3GA 1HG0A 3COYA 2JGLA 3MSCA 4MPTA 5FWXB 5GJWC 2CXQA 2VWHA 3RC3A 2D5IA 1P7ZA 3PUHA 3SJBA 2ZDHA 3NEYA 2VDWB 4W8OA 3OT1B 4EY5A 3L0ZA 2CDBA 1J07A 2ZU0C 2WTXA 3DBLA 5I9BA 2VRCD 4IUDS 4AIRA 1C4OA 2I22A 5C3UA 3VPAA 3OZXA 5CT6A 1SBNE 1PVDA 2EU8A 1FTWA 3BSWA 5BRAA 1EQ2A 3TWOA 4BO2A 4PPGA 1IRXA 3VPXA 1PU2A 1IJEA 1EK5A 4EWLA 4FHCA 1A8SA 2DQYA 2HA4A 1C30B 2X5OA 4KAXA 1WB9A 2FPGB 4DUYB 3HDQA 3AM5A 3BGSA 4CEJA 4OX9Y 4F2WA 2QUJA 3AUKA 2O3RA 5F52A 2QRVB 3UH0A 1DT5A 1WU8A 3H2JA 3H6GA 1L1FA 3MCWA 3THYA 4B3TB 2WPNA 4PLWA 2OA0A 3STYA 3B2EA 2QM7A 5HF6A 4E09A 1QQBA 1P3JA 5EJ6A 5EY5B 3O8RA 4OEHA 1DMSA 4HB3A 3WHLA 3D6AA 4QJ3A 1MA0A 4KR6A 2CE2X 1H2EA 1RHMA 5KCMA 3EIHA 2WU8A 4M54A 5K0JA 3Q9NA 4EA6A 4GLFA 3B1JA 4JXJA 2AFIE 3L4EA 2Y71A 4M88A 2JLZA 4B3CA 4MHSA 4RVCA 5KYNA 3AZOA 3AVPA 3FF1A 4DC9A 4DCNA 2B0JA 5CFOA 4C4PA 3GT0A 4UTPA 2CYBA 1XZMA 3FZGA 1HORA 1IULA 1YAHA 3IT1A 1TAUA 2BMWA 2IFTA 4NBLA 1NONA 4C89A 1K7XB 3ZWOA 4QJBA 4S2UA 4UNSA 2XGGA 4BCBA 3DTTA 1WLYA 8AT1A 4YJ3F 1CBUA 2QL9A 1J90A 3GCZA 3Q41A 1Y5MA 2OECA 2YHSA 3GQBA 1WCYA 2QSUA 4Q9DA 4KBFA 4Z7OB 4K0KB 1BXRB 2VFAA 5FPQA 2WWGA 3LUDA 2DTXA 2ODNA 4C4AA 3HL0A 3RABA 5HKOA 3GT3A 2BFEA 1OLXB 4RTMA 2ATIA 1FX1A 5CAEB 2PUGA 4OHKA 1SBYA 5DWVA 5AHOA 1G20E 1IDOA 5DSTA 4BNDA 2G72A 4EYGA 1UQUA 3S2EA 3K7EA 4M7WA 3T9FA 4HMQA 4PN3A 2OBMA 1NM5C