1QCEA

Solution nmr structure of ectodomain of siv gp41, restrained regularized mean structure plus 29 simulated annealing structures
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
123
structure length
123
Chain Sequence
AQSRTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQTRVTAIEKYLKDQAQLNAWGAAFRQVAHTTVPWPNASLTPKWNNETWQEWERKVDFLEENITALLEEAQIQQEKNMYELQKLNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Measurement of Residual Dipolar Couplings of Macromolecules Aligned in the Nematic Phase of Acolloidal Suspension of Rod-Shaped Viruses
pubmed doi rcsb
molecule tags Viral protein
molecule keywords PROTEIN (GP41)
total genus 45
structure length 123
sequence length 123
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1999-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1qceA00
1DF5A 5HFLA 5KA6A 1MOFA 3B8NA 2M7WA 1DLBA 4E2LA 3MHHC 1Y4MA 1ENVA 1F23A 3CP1A 4G2KA 4N23A 5H9CA 4JGSA 5KA5A 2MK3A 3GWOA 3P30A 3CYOA 3H01A 2EBOA 1K34A 1QCEA 3B77A 3B8MA 1EBOA 2EZPA 4FK5C 4JF3A 1MG1A 1JQ0A 3K9AA 4N21A 3MHSC 4FJCC 3WFVA 1JPXA 1QR8A 1QBZA 5CN0A 4JPRA 2P6JA 5HFMA 1DF4A 1SZTA 2LP7A 1Y66A 2EZOA 5CMUA 1I5YA 2OT5A 3M99B 1QR9A 1K33A 1I5XA 4FIPC 2X7RB
chains in the Genus database with same CATH superfamily
1DF5A 1FXVA 3A0HZ 1EZJA 4YY3O 4FLTA 4DRXA 4E2LA 3CCVV 2HLDG 2QEXV 4PELA 4RUFA 2FYUH 4AQYB 1MABG 3SYOA 4DR5B 2X6AA 4B3RO 4K0KO 1DGSA 1PPJH 1SA0A 4TUYB 2Q6AA 3ABKB 4JYBA 5JVDB 5HFMA 4FZ1A 1Q90D 5L3DA 2A0LA 3NR7A 4FIPC 1X59A 2B9ZA 3VQVA 4MSWC 2NR5A 4P9OA 3K5NA 4JTDB 3G67A 3O65A 5FPOA 4TOIA 3UO3A 5LP6A 3ZMZA 3ZMTA 2WLIA 3AK3A 3ASNB 5IJ0B 3A8TA 2PYJA 5JJJB 4X9QA 2X6CA 2M7WA 4DK1A 5IDJA 2JGDA 3OEEG 2E3CA 2QKCA 3LUTB 5ITZB 5EBMC 5B1AC 4GUNA 1GKFA 5JQGA 1OCOC 4XBFA 1HNWB 4DRXB 1YJWV 5GW7A 1VQPV 2W6JG 2WWWA 3BRCA 4J9YB 4DR4B 4X1YA 1VF6C 4IIJB 3OD4A 3F7YC 1EN6A 3CCRV 3D8CA 3AG3C 4IYHA 1SRYA 2Q68A 1VF7A 4UXNA 4R50A 3K03A 3OMAB 1R1BA 5B1OA 4DR1B 1QHTA 4YIPA 3LSQA 5DEDA 3T1YO 2P67A 3IGAC 4LF5O 2EJ7A 3HKEA 3WB1A 3H1KH 2DYSC 3SPIA 3ZRVA 4JI2B 1MZEA 4U3JA 4CS3A 1R3JC 4J7KA 2IJIA 3JD2A 2Q8VA 4NTXA 1S3JA 3MAQA 3OE7G 1RM1C 1JMKC 2UUBB 1YI2V 1YXBA 3CB2A 2VWJA 1WA8A 3L9DA 4LC1A 2ZKOA 3SDLA 1NVPB 2E5LB 2CTRA 2Q0OC 3T4DA 1OZ0A 2EIMC 5E79Z 3P32A 2JGDB 2ATKC 1I5XA 1SQVH 3TXSA 2VQEB 3B8NA 1K3EA 4JAAA 1V54B 5LOVB 2LW7A 2BTOA 2ZQMA 3RT3C 3DTUB 4ZBMA 1XMQB 3JAWA 1Q6UA 2EIMB 1MG1A 3JALB 4PD4F 1JFFA 4O4LB 4UVAA 4JI3B 2Q4PA 1LUWA 4I4TB 1L0LH 1V54C 1I0HA 3BPZA 5KLVH 4DR3B 3F5WC 4MTFA 4MW8A 1GMGA 3K5LA 1OCZC 1ZTEA 2YEVB 1COWG 1H2GA 3STZC 2GDSA 3OR6C 1I08A 2Q67A 4B3RB 1NR1A 2Q5ZA 1NU1H 4ZI7B 2ZE6A 2EIJC 1VQ4V 4BAYA 3ZHVA 2RNBA 2ZDIC 2ZIOA 5H9CA 5EYPB 4BIZA 1RPOA 4HBNA 2UU9O 4B3TO 3RYHB 2GUZA 3B8MA 1N34B 2DN9A 4O4HA 1AVMA 1SKVA 3N2KA 4JF3A 2CAZC 1ZL8B 4JI7O 2DMXA 2JS5A 3SPJA 4JTAB 1U96A 3AK1A 1GO3F 5LL6Y 2YS8A 3K58A 3AG3B 5KMGB 4DV4O 2EIKB 1I5YA 1AR1B 1AR4A 3OM3B 1LR1A 3ZRWA 1NVPD 4MT8A 4BWAA 3K9SA 4PHZA 4LF6B 3H01A 3JASA 1R3IC 1AP5A 2EINB 1BMFG 2ADPA 2HFEC 2XNDG 3G71V 2K1EA 1XMQO 2W6IG 3K3WA 1URFA 4G27B 3SJAC 1IBLB 1LUVA 1TVKB 3JYCA 3I55V 3H1IH 3ZBHA 1L8DA 1R3LC 3PN1A 5CBGA 4DV3B 3VOUA 5CA3A 2ZE5A 1XL4A 1AP6A 5B3SB 2Y0IA 2RDCA 2WLIB 4X1KB 4F6EA 2N05A 5C93A 4H33A 4J11A 3X2QC 4XDJA 1HW7A 1AJNA 1N36B 3CMEV 4BR6A 4X62B 1Z2GA 2ZT9B 4TQFA 4JI5B 3LDEA 2ZM6B 3IFXA 1RSOB 3K9AA 4R6ZA 1BZKA 1VF6A 2UUAB 1GRJA 2LP7A 5K1XA 1B06A 3SPCA 3BAAA 4B7EA 4Q6GA 1M56C 3L74H 4I7ZB 3J80N 1VQKV 1S5JA 4DR7B 1GTOA 2IW5A 4J10A 2LQTA 1BQ0A 1FXHA 2ZNJA 2CTPA 4FK5C 1HNWO 1ROPA 1S5HC 5C8YB 1IX9A 1IXBA 3FB5C 2ZM6O 4GX2A 1Y66A 3LNMB 1AROP 1KP3A 4WFAV 3ASOC 3ZHUA 1BHAA 5IYZA 1Y4MA 3E35A 1BT8A 2UXBB 4NVPA 1QVFU 1TUEB 4LP8A 1RP3B 1XQ8A 3CRMA 3TETA 1BHBA 5CA0A 1XMOB 1I94O 5L3FA 1DLBA 2AW9A 2WLLA 3N2GB 5BY1A 4D7TA 4ZOLA 4FM1A 1W2BU 1BGYH 1R73A 3FAVA 3SYPA 1I7FA 2WLMA 1R6KA 2VS0A 4DUZO 5JQGB 4QPJA 4TV9B 1MSWD 1UFIA 1AI7A 3UKMA 5TISZ 1OCCC 4IL6Z 2HVJC 2CTWA 2A9HA 2QDOA 3SYQA 4F6RA 4OPAA 4MVSA 5C8YA 1AI6A 2JK5C 2CGNA 4JZGA 2Z0AA 5FNVB 4DV5B 1KMIZ 4DUYO 3FKSG 5LHHA 1ZL8A 2IBZH 4QE7A 4B7KA 4DO2A 1M5IA 1QVGU 2UU9B 4CBCA 1F7YA 4DV1O 1WPXA 4HAMA 4DV6O 4CH6A 4HZ3A 4YJ3A 4IT5A 4X89A 2B5UA 3JCUZ 4UCSA 3TGUH 3E8GA 1GM8A 1QR9A 3EVKA 1Z5VA 2LJ2A 4LFBB 5J2UB 2AGAA 1YZBA 2PYLA 3OEHG 2UXDO 1WNSA 2Q69A 3BA9A 3LSUA 4PA3A 4H13B 4O4HB 4JI5O 4YXWG 3F7VC 2WLNA 2P6JA 2QR4A 2CGOA 4RUEA 1HNZB 4FFKA 5KAFZ 4X1KA 4JV5B 4DR3O 3CRRA 1G1XB 2XAJA 4DV0O 4O2BB 1PNMA 3OGCC 1XREA 1UJWB 2R9IA 4LF7B 1YSCA 2V1DA 3D3IA 2JRIA 5IJ0A 1SC5B 1FS0G 2HP8A 1NH2B 1K5QA 4QNHB 4LFCO 3HKBB 4GT1A 2HHHB 1KP2A 2BOCC 1FAFA 1OCRB 2EILC 3SJCC 4UCVA 4KHPB 2BE3A 1IVSA 1VQ9V 3I56V 2A3QA 4I0XA 2E74B 3ASNC 3KZIZ 4MVMA 4J42A 4UCOA 2JIZG 4LF8O 3ABUA 4PA9A 1IXMA 2WLJA 2PTMA 3TXQA 2F4VO 4B3SO 3KG2A 1BSMA 2PGGA 4I55A 5AG2A 5KX5A 5LGUA 4GZRB 2PY5A 3AG2C 4JI8O 5KHGA 2D3OW 5IJ9B 4PDRA 3QO5A 3P30A 4RQEA 2QGNA 1K92A 1R6NA 3OUFA 4LF4B 1GM7A 4MS2A 4LF9B 3FYEB 4LCUC 1CP9A 3JSLA 5LBQA 2DJVA 1N33O 1JPXA 3GB7C 1Y74B 1W0JG 4LFBO 2IJHA 1F51A 5LP6B 1VIBA 2OCHA 3JSNA 4RO2A 4LWSB 4J9ZB 3K5OA 4R8CA 1RM1B 2MK3A 5EBLC 1N8RW 2P7TC 5LYJB 3BFRA 2CE4A 3ZJZA 5ITZA 4P30A 3JD1A 4G28B 2DYSB 2JS3A 2KQXA 4CH3A 4KL1A 1FFXA 4JI0O 3JAMN 2FMLA 5J9PC 2VQEO 4FZ0A 4YHHO 3UT5A 1B3QA 3APQA 4DV5O 4FLWA 4GX1A 3ETGA 3BA8A 2WPDG 5L3EA 1M4UA 4HNAB 3CCMV 2PF4E 4NXMB 4KP4A 4FMTA 2BSKA 2OCCC 4EFBA 2ZDIA 5GTHZ 3RYIB 5EC2C 3OR7C 4JI3O 3M99B 4DV6B 4AHCA 4AQYO 5EYPA 3EHBB 2P5OA 1M90W 1YDXA 1AJPA 1CEZA 4MTGA 3F5TA 4P2ZA 3W7WA 4UV9A 3RYIA 1QU7A 3HKCB 3OUSA 4FLVA 1Y67A 1HP8A 1WA8B 2DWEC 2EIJB 4NYKA 4NXNO 2Z5UA 3ABLC 3BHPA 5FNVA 4QE9A 2YSUB 3Q4HA 5H6QA 3IJ4A 2JJ2G 5H2FZ 4JYAB 4U3JB 1SQXH 4FM0A 5FPRA 1VQMV 4TV8A 2UUBO 2AHYA 1KQSU 3T1HB 4H0LB 1R6TA 2WLLB 3RYCA 3T1HO 2UXBO 2LO1A 3DC6A 4K3AA 3K0DA 2BTQA 3K0GA 1H8EG 5CB4A 1IBKB 1XNQB 1XI1A 4TV8B 2RQ6A 1SQBH 2OIEA 4WFHA 2UUCB 1PM9A 4TV9A 1P7BA 3AG1B 4U7NA 1P7GA 2BTQB 4LF7O 2CH7A 4CZZA 2FKXA 3DSQA 3JATA 2ZNIA 3H9VA 3VBBA 3IC7A 4X66B 2KKWA 4DV7O 5CMUA 1FYJA 3CHXA 1J5EO 2XT9A 4Q20A 3UQ8A 1SA0B 1TGOA 4RQFA 4BW5A 4MVZA 1Y76A 2ILMA 1Q6HA 3IC9A 1L0NH 5KUMA 2X6BA 4Z1MG 4WFGA 5KX5B 4WBNA 2OT5A 1H8HG 4TUYA 2F95B 3L71H 4MVQA 1OCRC 2EILB 1FJGB 4PDMA 4Z2WA 1YTFD 4X1IB 5IE9A 3J81N 1GN4A 3H1HH 1H2MA 1Q82W 2M6YA 2UUCO 3LSSA 2FTKA 2YXYA 3GWKC 3JARB 3ZEDA 3AK2A 3CC2V 1GAXA 3CS5A 1K73W 1S76D 3DC5A 4K0KB 5HFLA 3L75H 1BL8A 2OIGA 1WN7A 2WA4A 3GWOA 4ZHQA 1WAZA 1WJZA 2QM7A 4LF6O 3RVYA 1XEQA 1E1RG 1GN3A 4Z1VA 3OFNG 1VQ8V 5FL7G 3BVOA 1NR7A 1FFXB 4K35A 2WAMA 5DN6G 1KECA 2HG5C 4JYCA 3FB7C 4DW0A 1NBMG 3E8BA 5F2VO 1QNMA 1HDJA 3AEIA 5J2TB 1K9MW 5A9GA 2GBOA 4CH4A 4X65B 5IWAB 2HJDA 1XMOO 4HNAA 1PV0A 4UUJC 5DECA 4NKGB 2DOSA 1FJGO 3C3TA 3CRQA 1P49A 2KSDA 4QGPA 4WF9V 3RWRD 5LGNA 4JGSA 1V55C 2G38A 1SQFA 1TUBA 3CYOA 3CCJV 3K04A 5D5PA 1H38A 1WP7A 2IU0A 5JVDA 3RBZA 1G8MA 2XAFA 2ZR2A 1N0NA 1ZLZA 2QM4A 2B1GA 3HKCA 2RCVA 4UB6Z 2QM8A 1EN4A 1IDSA 4X1YB 4UVBA 2QA4V 2DQ3A 3HR0A 5KHIA 1NTMH 3CXHF 4PA4A 5L3CA 5LGTA 3R66A 2P90A 3ZHTA 4AILC 3CJHA 1EM1A 3H1LH 2XAHA 4F4LA 1NS1A 1M93A 2YI8A 2IU3A 3SPHA 2ZD9A 2KG7B 1ZX3A 5IYDO 4XDKA 2EINC 2BSKB 4FLYA 5LA6B 4OPHA 5JJNB 3D36C 2VQFB 1K7DA 3SJBC 4DR6B 1L1FA 3S3WA 2V7QG 2O57A 2EIKC 4FLZA 1K34A 1OCOB 2FB5A 2AXTZ 2Q7EA 2ZR3A 5LA6A 1Q3EA 4JI2O 4YJ2B 2IJKA 4B3MO 3FAVB 3CXCU 2EX3A 3RVZA 4I50B 3WB2A 3U10A 4LF5B 2DW4A 4JZ2A 1MSDA 3CE2A 1N32O 4L87A 4FVMA 3E22B 1PL0A 2DYRC 2A79B 2QTSA 1KD1W 2F4VB 1K97A 2CH7B 1EZVH 3PJSK 1FXKA 4EB6B 4DXWA 3RW0A 2JGUA 1IBMO 1E79G 5B1BB 3RGBA 3HKBA 4UCTA 1S5LZ 3M8AA 4LF8B 2HR3A 1OV9A 2JVDA 4C7UA 5CB4B 4GKJB 5JH7B 2QWQB 1SS3A 4JI4B 3FFQA 1PD3A 1GN2A 1FXKB 5H5NA 3K06A 2UXNA 1M56B 5B5EZ 4RWUA 1QLEB 3ABKC 3B40A 4JI1O 1SERA 4A5UB 1Q86W 1Z5WA 4DR6O 5IYBO 3ZN0A 4WBNB 2N74A 5L3GA 3AG4B 4NXNB 1CXZB 1GK9A 3JD3A 2VQFO 1YCIA 3W7XA 2LFSA 2XTAA 2HVKC 3JAWB 2NNUA 4KUMA 5KHKA 3MD0A 4QJFB 4JI0B 4I9QA 1SZXA 3CC4V 4JV5O 2Y4TA 1JFFB 3JD4A 1VQ5V 1JVMA 4JI6O 5BR8B 5EIBD 1I94B 5D5QA 5LXTB 3D3QA 1FXKC 1J95A 2OTLV 1OHHG 1MOFA 1FKAO 4O2AA 1F23A 4D7SA 3ZRXA 2PZSA 2QWOB 3O9OA 2W0XA 1XDCA 4O4IA 2FL4A 1VQ7V 2UUAO 3OMNB 2F1MA 2ZIMA 3WG7C 3CCSV 3ZMUA 4B08A 2YICA 2JEXA 2Q0AA 5EZYB 5CA1B 1P4RA 1XNRB 5LMUO 2OCCB 2QWRB 4WFBV 3R65A 5J2TA 2H8PC 5BR8O 2ZCEA 3W7UA 1QLNA 3ZHSA 4B3SB 4X8AA 5GONA 4ZHQB 3K57A 4XDLA 3ZMVA 3ZHRA 3APOA 4NTWA 3VQWA 4LFAB 1ZSPA 1WLEA 3MHHC 3WB0A 3L72H 2K9PA 3K59A 2QTOA 1VQNV 5BZBA 4UB8Z 1AJQA 1IBKO 4FLXA 5EC1C 1RFYA 4IYIA 3J7AU 1NTKH 2DWDC 3WU2Z 5IJ9A 1XL6A 2C2AA 3SPGA 3RFRA 3K79A 2YI9A 2HEPA 5BMVB 1M57B 2EZPA 1KKCA 3AG4C 1OJHA 2KG7A 1THZA 5K1PA 2H3OA 3THOA 2F66C 3VQXA 1HR0O 4GKKB 2P4VA 1M57C 5EBWC 3DGEA 4O4JA 1RSOA 4I4TA 3ETQA 3QO8A 2RMKB 4WFFA 5DM6V 4IHJB 3X2QB 1NQTA 3E8FA 1PL4A 1AR5A 5CBHA 1OCCB 4KFMA 1XILA 2ZE7A 5B3SC 1G4YB 3QNEA 3CRCA 2JDIG 3ETDA 3I5DA 3KCYA 3EFFK 3A0BZ 3ZCCA 4BW9A 1AI5A 1SQPH 3JATB 4EB6A 5GTIZ 2ETNA 2Y0PA 3G6BA 3CC7V 5IY5C 1KKDA 1TUBB 3LNNA 1KC8W 5IWAO 1Y74A 5J2UA 3L70H 3ML0A 1LNQA 3KKYA 3BCCH 4LNUA 3CCUV 1AB3A 2YXHA 4LR3A 4LWSA 3W7TA 1JOYA 5KA5A 1R3KC 3ETEA 2DQ0A 4TQDA 1Y76B 2YIDA 1N0JA 2E5LO 3OW2U 3CX5F 1BQZA 2GHYA 4JPRA 2JEUA 1SZTA 1FD9A 4GKKO 2QWPB 3ABMB 2F93B 3HB3B 1JJ2U 4H44B 4LF9O 3QTCA 1PP9H 5JJEB 2VWKA 1IBMB 1YEWA 4N23A 1D2DA 2LW1A 1GN6A 1T5EA 4DUZB 2E75B 1Q8IA 3TK1A 4MVOA 4DYLA 2Q7GA 2A7WA 5KAIZ 4DV1B 4DV2B 4CC5A 4ZKIA 3IAYA 2RN9A 3UCSC 2LGQA 4W4KA 1YF2A 2OWOA 4JASA 1OCZB 2X7RB 4KXRA 3G4SV 3CCLV 3FX7A 3ZIAG 5LP6C 4G2KA 4DR4O 4ICGA 1B6QA 5KHHA 4E4EA 4ZI7A 1G6UA 2V4DA 1XUQA 1YITV 1ORQC 3RYHA 3HKDB 2XAQA 4YHHB 5KA6A 1Y6XA 3SJQC 1YHQV 2ODMA 2HHHO 1N34O 2HJFC 2QKSA 1M1KW 2P22C 2Q73A 1HNXB 3WFVA 3B2EE 2ITDC 3HKDA 2GUZB 1XNRO 4YIOA 3E8HA 3C90A 2QJ1A 4DK0A 2WA3A 4EKWA 4MTOA 3ABLB 1BE3H 1TA8A 2DYRB 4TWKA 2R9AA 4OX9O 4P9PA 3ZRWB 1HNZO 2PI5A 5H6RA 3ZRSA 3CEIA 1MNGA 4HYOA 4I0XB 1N33B 1Q6IA 4X62O 2P06A 3JAKB 2YDEA 1NTZH 1US6A 2PUSA 3BABA 1XOUA 3SYCA 3AG7A 3ZS8C 4OXSA 1YJ9V 1N36O 4PJ0Z 4X66O 1SETA 1BCCH 2Y69B 4MTXA 4O2AB 5JCOC 2YXLA 3LDDA 4PI2A 2KB1A 2LFRA 4BIOA 5B1NA 3P3PA 4FJCC 1IURA 1IBLO 3C3SA 2YC0A 3ASOB 3KCXA 1A32A 1YTFB 2L35A 1S72V 4PV1B 5A2QN 1FFTB 1W59A 3RN4A 2XUMA 2XHBA 2D2CB 5E1AC 4NXMO 3FYIB 2AHZA 4FLUA 1KBHA 5KHJA 1WPBA 4LH7A 2GSMB 4J7JA 4DR1O 1V55B 1H2SB 3EXAA 5LMUB 2BCCH 2XAGA 2A06H 4IHJA 5LHIA 5IT9N 1H2KA 1U97A 3OTOB 1ZWIC 4X64B 3MDSA 5L3BA 1JCHA 1NJIW 1DK1A 4NR1A 3A2FA 1S0VA 1N32B 3JD0A 2R9RB 1MZFA 3BEHA 3AG1C 5EK0A 3CPWU 3RYFA 4UCRA 5LOVA 2H94A 2UXCB 2WSSG 4WCEV 2ITCC 4J41A 1JA8A 3T4ZA 2Y48A 2P4KA 4IGGA 4TT3G 3AG2B 4DW1A 1QCEA 4I5SA 4FFBB 1Q81W 3OAAG 3D36A 3G80A 4O4LA 3OMIB 2IH3C 4U3FH 4QIWF 2YIBD 3B09A 2RJZA 4UVCA 4L8JA 5B1BC 4AI8A 5FLXN 1SQGA 1X4TA 2JJ1G 2NN4A 3CP1A 3L73H 2B1IA 1VMGA 4QPKA 3CRAA 2NLJC 2EBOA 3ZHQA 4O4JB 1UPGA 2BOBC 4DR2O 1MMMA 3G6EV 3P3NA 4I9WA 3K08A 2CTQA 1DF4A 4WFEA 3ABMC 4FM2A 4JYYA 3B4SA 3FD9A 4FPPA 4GYCB 2Z3YA 1B04A 1EFRG 5B1AB 1J5EB 4JI4O 2QWNB 1K4DC 3B77A 2IH1C 3QG5A 2EULA 3JASB 2CK3G 4OGQB 4X64O 3CCEV 3BY6A 3CSXA 4JAVA 2N04A 1P84F 4MVRA 1K8AW 1GH6A 3GVMA 3HPLC 4JI1B 4D6TH 1K33A 2IM9A 4R7CA 4JI8B 4X20B 5JH7A 1YIJV 4DV2O 1JR9A 3M7MX 3UM7A 4RAIA 5IY5B 4NB5A 1XNQO 3E2EA 3JARA 4LFCB 1K4CC 3DXRB 3Q4HB 1WB7A 4I55B 1O9HA 4DV3O 1TVKA 4MW3A 1JJOA 1SF9A 1CPYA 1S77D 1D5AA 1MA1A 3T2MA 5IYCO 1KU9A 4EEQA 5LHGA 4PA6A 1H2LA 3NXSA 4LFAO 1F4MA 2AZ0A 1VEWA 1XBLA 4U7OA 2R70A 5EZYA 3JCZA 4KHPO 4NTYA 5BXZA 2WLKA 2ZE8A 1E1QG 1K5SA 2HKOA 4DR2B 1HNXO 1AILA 2E76B 1QLEC 1WB8A 4LH6A 4DV4B 4TSFG 4O2BA 3LDCA 4JTCB 5LYJA 4DV0B 1Q7YW 4X20A 2YIAA 5LXTA 3ZMSA 1PKXA 3CWBH 4OX9B 2ZXWC 2DE0X 1JX9A 4GX5A 3QVNA 2CUGA 1PNLA 4UFZA 2F23A 3QF7A 1GM9A 2XASA 4K8XA 3UT5B 4CS4A 4O4IB 1EBOA 4H37A 3H1JH 2Q7HA 4LF4O 4W4LA 3MHSC 1VQOV 3T1CA 1F4NA 4YY3B 1D5NA 1O9GA 2Y69C 4J80A 2Q9LA 2ADQB 5LMNB 4GKJO 4JI6B 3ABTA 2PI4A 2UXXA 5BMVA 1YVWA 2W0FC 1H2NA 1W0KG 2MW2B 1XHZA 2X0LA 2ARHA 1JQ0A 3OGIB 5CBFA 2QSAA 4IIJA 1HWYA 3CCQV 3N2GA 4GLXA 2GV9A 3WG7B 1V9PA 1Q5OA 3TJTA 4B3MB 4J7ZA 4F6RB 1IZ3A 4ABMA 1ZUQA 4FFBA 1VARA 1SESA 3E89A 4PDVA 1N4CA 2F43G 4DUYB 4UCUA 4JYAO 5KUKA 4X88A 2CDYA 2L6LA 1ZAUA 3W7SA 3E86A 4PI0A 4JI7B 3FB8C 2AZ2A 1VQ6V 5B66Z 1XHXA 1NT2B 1VF5B 3ZN1A 3U0ZA 4GCZA 4YJ3B 5LMNO 4ZOLB 3CMAV 1VQLV 2YUAA 1QQCA 5EIBC 2WLHA 4K8ZA 1KYOF 3JALA 5IYZB 2GTSA 2EJRA 1Q43A 2UXDB 3ICXA 2QE7G 4I50A 4JAUA 3HKEB 2OTJV 1HR0B 1TAEA 3TCUA 4LBEC 3CJHB 4ASUG 5CA0B 1YJNV 2LGWA 1NH2D 4LNUB 4PDLA 3RYFB 3UO2A 2QKAA 3OT7A 1FPOA 1SQQH 4CC6A 1PNKA 1KUQA 2ZINA 2IJJA 4BIUA 3FB6C 4DV7B 1VP7A 1WP8A 3S3XA 4GX0A 4EFEA 4DR7O 1KB9F 4N21A 1QR8A 1QBZA 1DTOA 1RPRA 3OTFA 4DR5O 3VQYA 1M9NA 4UV8A 4ZIBA 1NKDA 2YIBA 3CD6V 1ENVA 3A0RA 3QO7A 5JWPA 2VRZA 1NI8A 4YJ2A 3JAKA 5KMGA 1EN5A 2YEVA 3SR2C 1BS3A 5CN0A 2R72A 2UXCO 2ZXWB 3DXRA 3RYCB 3E22A 4MVUA 2Y4UA 2GTAA 3T1YB 3SYAA 4X65O 3OTOO 5GONB 2XOKG 5CA1A 3E83A 2OYQA 4PA7A 4X1IA 3STLC 3SGIA 3K5MA 3N2KB 3N27A 1NZ6A 3ZX6A 4CH5A 4CS2A 2EZOA 3U11A 5JCOA 4B3TB 1AI4A
chains in the Genus database with same CATH topology
1K7DA 1DF5A 1FXVA 1EZJA 4E2LA 3CCVV 1L1FA 2HLDG 2V7QG 4PELA 4RUFA 3OEHG 1FFTB 2QEXV 1MABG 3SYOA 2EIKC 2X6AA 2Q69A 1K34A 4PA3A 1OCOB 5E1AC 4YXWG 2ZR3A 3F7VC 2WLNA 2Q6AA 3ABKB 4JYBA 2P6JA 3FYIB 2IJKA 3CXCU 2AHZA 5HFMA 4RUEA 3RVZA 2DW4A 2GSMB 5L3DA 2A0LA 4FIPC 4L87A 2XAJA 1PL0A 1V55B 2A79B 2DYRC 1PNMA 4MSWC 3OGCC 1KD1W 4P9OA 1K97A 4JTDB 1UJWB 2XAGA 3PJSK 1FXKA 4DXWA 2R9IA 5LHIA 3RW0A 1ZWIC 1E79G 5B1BB 1YSCA 2V1DA 3D3IA 5L3BA 3ZMZA 1JCHA 1NJIW 1FS0G 1NH2B 3ZMTA 2WLIA 1S0VA 1K5QA 2HR3A 3ASNB 4QNHB 3JD0A 2R9RB 3BEHA 3AG1C 5EK0A 3CPWU 4GT1A 2X6CA 1PD3A 2H94A 2M7WA 1KP2A 2BOCC 1FXKB 5IDJA 2WSSG 4WCEV 2ITCC 1OCRB 2EILC 3OEEG 3K06A 2UXNA 3T4ZA 2Y48A 1M56B 3LUTB 4TT3G 3AG2B 1QCEA 4I5SA 1QLEB 3ABKC 5EBMC 1Q81W 1SERA 3OAAG 3D36A 1Q86W 1VQ9V 5B1AC 1GKFA 5IYBO 3OMIB 1OCOC 4XBFA 3I56V 3ZN0A 3ASNC 2IH3C 4MVMA 2JIZG 5L3GA 1YJWV 3AG4B 4QIWF 5GW7A 1VQPV 2W6JG 3JD3A 1GK9A 4UVCA 2WWWA 3W7XA 2LFSA 5B1BC 3ABUA 4PA9A 1IXMA 4J9YB 2WLJA 2HVKC 2NNUA 4KUMA 2JJ1G 3MD0A 3CP1A 2B1IA 4QPKA 3F7YC 4QJFB 3CCRV 2NLJC 2EBOA 3KG2A 3AG3C 3CC4V 1SRYA 2Q68A 4UXNA 3JD4A 4R50A 1VQ5V 2BOBC 3K03A 3OMAB 1JVMA 3G6EV 5B1OA 5LGUA 3LSQA 4I9WA 3AG2C 3K08A 2P67A 3IGAC 1DF4A 4WFEA 2D3OW 3ABMC 4PDRA 1FXKC 3QO5A 3P30A 4RQEA 1J95A 4FPPA 2Z3YA 2OTLV 1OHHG 2DYSC 1MOFA 1K92A 1R6NA 1EFRG 3SPIA 5B1AB 3ZRVA 1F23A 3OUFA 3ZRXA 1R3JC 1GM7A 4MS2A 2IJIA 3JD2A 3FYEB 4LCUC 1CP9A 1K4DC 5LBQA 1S3JA 3B77A 3OE7G 2IH1C 1RM1C 1YI2V 1VQ7V 2CK3G 3OMNB 3CCEV 3BY6A 4LC1A 1JPXA 3GB7C 4JAVA 1NVPB 1W0JG 2IJHA 4MVRA 1K8AW 3T4DA 3WG7C 1OZ0A 1F51A 3HPLC 3ZMUA 3CCSV 2EIMC 3P32A 2JEXA 1K33A 2ATKC 1I5XA 1P4RA 4RO2A 4R7CA 3B8NA 2OCCB 1K3EA 1YIJV 1V54B 4WFBV 4J9ZB 2ZQMA 3R65A 4R8CA 3UM7A 1RM1B 2MK3A 3DTUB 4RAIA 5EBLC 5IY5B 2H8PC 4ZBMA 1N8RW 3E2EA 2P7TC 3W7UA 1QLNA 2EIMB 1MG1A 3ZJZA 1K4CC 4P30A 4X8AA 3JD1A 4G28B 2DYSB 4XDLA 4UVAA 3ZMVA 5J9PC 4MW3A 1V54C 1CPYA 1S77D 1WLEA 3MHHC 3T2MA 5IYCO 2QTOA 4GX1A 1VQNV 3F5WC 5BZBA 5LHGA 3ETGA 4MTFA 4PA6A 4MW8A 1GMGA 1AJQA 3NXSA 1OCZC 2WPDG 5L3EA 1F4MA 2YEVB 1COWG 3CCMV 4U7OA 5EC1C 4KP4A 4FMTA 1H2GA 3JCZA 2OCCC 2ZDIA 3STZC 2WLKA 3OR6C 2DWDC 5EC2C 2Q67A 3OR7C 1NR1A 3M99B 1E1QG 1XL6A 1K5SA 2EIJC 2C2AA 2HKOA 3EHBB 3SPGA 1VQ4V 4BAYA 1M90W 2ZDIC 5H9CA 4BIZA 1QLEC 1RPOA 3K79A 1AJPA 1CEZA 4MTGA 1M57B 3B8MA 4P2ZA 2EZPA 3W7WA 4TSFG 3AG4C 4JF3A 4UV9A 3LDCA 3SPJA 4JTAB 1THZA 4JTCB 3OUSA 1Q7YW 1GO3F 2DWEC 2EIJB 3ZMSA 2Z5UA 3AG3B 3ABLC 1PKXA 4QE9A 2EIKB 1I5YA 2YSUB 1AR1B 5H6QA 3OM3B 2ZXWC 1JX9A 2JJ2G 4GX5A 1M57C 3ZRWA 1NVPD 1PNLA 5EBWC 3DGEA 1VQMV 1GM9A 4MT8A 2AHYA 2XASA 1KQSU 3H01A 3QO8A 1R3IC 4WFFA 2WLLB 3X2QB 2EINB 1EBOA 5DM6V 1NQTA 1BMFG 4H37A 3E8FA 3K0DA 3MHSC 5CBHA 1VQOV 3K0GA 3T1CA 1OCCB 1F4NA 2HFEC 4KFMA 1H8EG 2XNDG 5B3SC 1G4YB 3G71V 2K1EA 2Y69C 3QNEA 2W6IG 3K3WA 4G27B 2JDIG 3ABTA 2UXXA 2PI4A 3ETDA 4WFHA 3JYCA 3I55V 3EFFK 1P7BA 3ZCCA 3AG1B 2W0FC 1AI5A 1R3LC 4U7NA 1W0KG 5CBGA 4CZZA 2X0LA 3VOUA 3CC7V 5CA3A 5IY5C 1JQ0A 1XL4A 1KKDA 3VBBA 5CBFA 5B3SB 1KC8W 3IC7A 2WLIB 1HWYA 3ML0A 5CMUA 3CCQV 1LNQA 5C93A 4H33A 3X2QC 3CCUV 3WG7B 4XDJA 4Q20A 1AJNA 3W7TA 1JOYA 3CMEV 5KA5A 1R3KC 3ETEA 2DQ0A 3LDEA 4RQFA 1SESA 3E89A 4PDVA 4BW5A 2F43G 3IFXA 4MVZA 5KUKA 3K9AA 4R6ZA 4X88A 3OW2U 2GHYA 4JPRA 5KUMA 2X6BA 2JEUA 4Z1MG 4WFGA 1SZTA 2LP7A 3W7SA 3SPCA 2OT5A 1H8HG 3ABMB 1M56C 3E86A 3HB3B 1JJ2U 3FB8C 4MVQA 1OCRC 2EILB 1VQ6V 1VQKV 4PDMA 3ZN1A 1GTOA 4N23A 1YTFD 2IW5A 4GCZA 3TK1A 1FXHA 4MVOA 4FK5C 1Q82W 3CMAV 3LSSA 1ROPA 1S5HC 4ZKIA 2FTKA 1VQLV 3FB5C 4GX2A 3CC2V 1Y66A 1K73W 3LNMB 4JASA 1AROP 1KP3A 1OCZB 3ASOC 2X7RB 2WLHA 5HFLA 4WFAV 3G4SV 3CCLV 1S76D 3ZIAG 1BHAA 1Y4MA 3E35A 1BL8A 4G2KA 3GWOA 2EJRA 2QM7A 3RVYA 1B6QA 1QVFU 1TUEB 1E1RG 2QE7G 3OFNG 4LP8A 4JAUA 3TETA 1BHBA 2OTJV 1VQ8V 5FL7G 3TCUA 1YITV 1NR7A 1ORQC 2WAMA 2XAQA 4LBEC 1KECA 2HG5C 4JYCA 4ASUG 5DN6G 5KA6A 5L3FA 3SJQC 3FB7C 1YJNV 1YHQV 1NBMG 1DLBA 1NH2D 2WLLA 4PDLA 3E8BA 1W2BU 3AEIA 1PNKA 2HJFC 1R73A 2IJJA 4BIUA 2QKSA 3FB6C 1K9MW 4GX0A 1M1KW 3SYPA 2WLMA 4N21A 1R6KA 3WFVA 1QR8A 1QBZA 1DTOA 2ITDC 1RPRA 4UUJC 4QPJA 1MSWD 1M9NA 3E8HA 1AI7A 3UKMA 1OCCC 4UV8A 2HVJC 1NKDA 2A9HA 3CD6V 3SYQA 1ENVA 3A0RA 4EKWA 4MTOA 4WF9V 3QO7A 5LGNA 3ABLB 4JGSA 4MVSA 1V55C 2DYRB 4TWKA 1AI6A 3CYOA 2JK5C 3K04A 4P9PA 3CCJV 1H38A 3ZRWB 2PI5A 5H6RA 2IU0A 3ZRSA 4HYOA 3RBZA 1G8MA 2YEVA 2XAFA 3FKSG 5CN0A 5LHHA 2ZXWB 2ZR2A 2B1GA 3SYCA 4QE7A 4DO2A 2QM8A 4OXSA 1YJ9V 1QVGU 4UVBA 2QA4V 2DQ3A 4CBCA 4MVUA 4PA4A 5L3CA 5LGTA 1SETA 1WPXA 3SYAA 2P90A 4HAMA 2XOKG 4HZ3A 2Y69B 4MTXA 3E83A 4PA7A 2XAHA 4F4LA 3LDDA 2KB1A 2LFRA 3STLC 5B1NA 2IU3A 3SPHA 2ZD9A 2B5UA 4FJCC 4X89A 5IYDO 4XDKA 2EINC 3ASOB 3E8GA 2EZOA 1GM8A 1YTFB 1QR9A 1S72V 1AI4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DF5 A;  5HFL A;  5KA6 A;  1MOF A;  3B8N A;  2M7W A;  1DLB A;  4E2L A;  3MHH C;  1Y4M A;  1ENV A;  1F23 A;  3CP1 A;  4G2K A;  4N23 A;  5H9C A;  4JGS A;  5KA5 A;  2MK3 A;  3GWO A;  3P30 A;  3CYO A;  3H01 A;  2EBO A;  1K34 A;  1QCE A;  3B77 A;  3B8M A;  1EBO A;  2EZP A;  4FK5 C;  4JF3 A;  1MG1 A;  1JQ0 A;  3K9A A;  4N21 A;  3MHS C;  4FJC C;  3WFV A;  1JPX A;  1QR8 A;  1QBZ A;  5CN0 A;  4JPR A;  2P6J A;  5HFM A;  1DF4 A;  1SZT A;  2LP7 A;  1Y66 A;  2EZO A;  5CMU A;  1I5Y A;  2OT5 A;  3M99 B;  1QR9 A;  1K33 A;  1I5X A;  4FIP C;  2X7R B; 
#chains in the Genus database with same CATH topology
 1DF5 A;  1FXV A;  3A0H Z;  1EZJ A;  4YY3 O;  4FLT A;  4DRX A;  4E2L A;  3CCV V;  2HLD G;  2QEX V;  4PEL A;  4RUF A;  2FYU H;  4AQY B;  1MAB G;  3SYO A;  4DR5 B;  2X6A A;  4B3R O;  4K0K O;  1DGS A;  1PPJ H;  1SA0 A;  4TUY B;  2Q6A A;  3ABK B;  4JYB A;  5JVD B;  5HFM A;  4FZ1 A;  1Q90 D;  5L3D A;  2A0L A;  3NR7 A;  4FIP C;  1X59 A;  2B9Z A;  3VQV A;  4MSW C;  2NR5 A;  4P9O A;  3K5N A;  4JTD B;  3G67 A;  3O65 A;  5FPO A;  4TOI A;  3UO3 A;  5LP6 A;  3ZMZ A;  3ZMT A;  2WLI A;  3AK3 A;  3ASN B;  5IJ0 B;  3A8T A;  2PYJ A;  5JJJ B;  4X9Q A;  2X6C A;  2M7W A;  4DK1 A;  5IDJ A;  2JGD A;  3OEE G;  2E3C A;  2QKC A;  3LUT B;  5ITZ B;  5EBM C;  5B1A C;  4GUN A;  1GKF A;  5JQG A;  1OCO C;  4XBF A;  1HNW B;  4DRX B;  1YJW V;  5GW7 A;  1VQP V;  2W6J G;  2WWW A;  3BRC A;  4J9Y B;  4DR4 B;  4X1Y A;  1VF6 C;  4IIJ B;  3OD4 A;  3F7Y C;  1EN6 A;  3CCR V;  3D8C A;  3AG3 C;  4IYH A;  1SRY A;  2Q68 A;  1VF7 A;  4UXN A;  4R50 A;  3K03 A;  3OMA B;  1R1B A;  5B1O A;  4DR1 B;  1QHT A;  4YIP A;  3LSQ A;  5DED A;  3T1Y O;  2P67 A;  3IGA C;  4LF5 O;  2EJ7 A;  3HKE A;  3WB1 A;  3H1K H;  2DYS C;  3SPI A;  3ZRV A;  4JI2 B;  1MZE A;  4U3J A;  4CS3 A;  1R3J C;  4J7K A;  2IJI A;  3JD2 A;  2Q8V A;  4NTX A;  1S3J A;  3MAQ A;  3OE7 G;  1RM1 C;  1JMK C;  2UUB B;  1YI2 V;  1YXB A;  3CB2 A;  2VWJ A;  1WA8 A;  3L9D A;  4LC1 A;  2ZKO A;  3SDL A;  1NVP B;  2E5L B;  2CTR A;  2Q0O C;  3T4D A;  1OZ0 A;  2EIM C;  5E79 Z;  3P32 A;  2JGD B;  2ATK C;  1I5X A;  1SQV H;  3TXS A;  2VQE B;  3B8N A;  1K3E A;  4JAA A;  1V54 B;  5LOV B;  2LW7 A;  2BTO A;  2ZQM A;  3RT3 C;  3DTU B;  4ZBM A;  1XMQ B;  3JAW A;  1Q6U A;  2EIM B;  1MG1 A;  3JAL B;  4PD4 F;  1JFF A;  4O4L B;  4UVA A;  4JI3 B;  2Q4P A;  1LUW A;  4I4T B;  1L0L H;  1V54 C;  1I0H A;  3BPZ A;  5KLV H;  4DR3 B;  3F5W C;  4MTF A;  4MW8 A;  1GMG A;  3K5L A;  1OCZ C;  1ZTE A;  2YEV B;  1COW G;  1H2G A;  3STZ C;  2GDS A;  3OR6 C;  1I08 A;  2Q67 A;  4B3R B;  1NR1 A;  2Q5Z A;  1NU1 H;  4ZI7 B;  2ZE6 A;  2EIJ C;  1VQ4 V;  4BAY A;  3ZHV A;  2RNB A;  2ZDI C;  2ZIO A;  5H9C A;  5EYP B;  4BIZ A;  1RPO A;  4HBN A;  2UU9 O;  4B3T O;  3RYH B;  2GUZ A;  3B8M A;  1N34 B;  2DN9 A;  4O4H A;  1AVM A;  1SKV A;  3N2K A;  4JF3 A;  2CAZ C;  1ZL8 B;  4JI7 O;  2DMX A;  2JS5 A;  3SPJ A;  4JTA B;  1U96 A;  3AK1 A;  1GO3 F;  5LL6 Y;  2YS8 A;  3K58 A;  3AG3 B;  5KMG B;  4DV4 O;  2EIK B;  1I5Y A;  1AR1 B;  1AR4 A;  3OM3 B;  1LR1 A;  3ZRW A;  1NVP D;  4MT8 A;  4BWA A;  3K9S A;  4PHZ A;  4LF6 B;  3H01 A;  3JAS A;  1R3I C;  1AP5 A;  2EIN B;  1BMF G;  2ADP A;  2HFE C;  2XND G;  3G71 V;  2K1E A;  1XMQ O;  2W6I G;  3K3W A;  1URF A;  4G27 B;  3SJA C;  1IBL B;  1LUV A;  1TVK B;  3JYC A;  3I55 V;  3H1I H;  3ZBH A;  1L8D A;  1R3L C;  3PN1 A;  5CBG A;  4DV3 B;  3VOU A;  5CA3 A;  2ZE5 A;  1XL4 A;  1AP6 A;  5B3S B;  2Y0I A;  2RDC A;  2WLI B;  4X1K B;  4F6E A;  2N05 A;  5C93 A;  4H33 A;  4J11 A;  3X2Q C;  4XDJ A;  1HW7 A;  1AJN A;  1N36 B;  3CME V;  4BR6 A;  4X62 B;  1Z2G A;  2ZT9 B;  4TQF A;  4JI5 B;  3LDE A;  2ZM6 B;  3IFX A;  1RSO B;  3K9A A;  4R6Z A;  1BZK A;  1VF6 A;  2UUA B;  1GRJ A;  2LP7 A;  5K1X A;  1B06 A;  3SPC A;  3BAA A;  4B7E A;  4Q6G A;  1M56 C;  3L74 H;  4I7Z B;  3J80 N;  1VQK V;  1S5J A;  4DR7 B;  1GTO A;  2IW5 A;  4J10 A;  2LQT A;  1BQ0 A;  1FXH A;  2ZNJ A;  2CTP A;  4FK5 C;  1HNW O;  1ROP A;  1S5H C;  5C8Y B;  1IX9 A;  1IXB A;  3FB5 C;  2ZM6 O;  4GX2 A;  1Y66 A;  3LNM B;  1ARO P;  1KP3 A;  4WFA V;  3ASO C;  3ZHU A;  1BHA A;  5IYZ A;  1Y4M A;  3E35 A;  1BT8 A;  2UXB B;  4NVP A;  1QVF U;  1TUE B;  4LP8 A;  1RP3 B;  1XQ8 A;  3CRM A;  3TET A;  1BHB A;  5CA0 A;  1XMO B;  1I94 O;  5L3F A;  1DLB A;  2AW9 A;  2WLL A;  3N2G B;  5BY1 A;  4D7T A;  4ZOL A;  4FM1 A;  1W2B U;  1BGY H;  1R73 A;  3FAV A;  3SYP A;  1I7F A;  2WLM A;  1R6K A;  2VS0 A;  4DUZ O;  5JQG B;  4QPJ A;  4TV9 B;  1MSW D;  1UFI A;  1AI7 A;  3UKM A;  5TIS Z;  1OCC C;  4IL6 Z;  2HVJ C;  2CTW A;  2A9H A;  2QDO A;  3SYQ A;  4F6R A;  4OPA A;  4MVS A;  5C8Y A;  1AI6 A;  2JK5 C;  2CGN A;  4JZG A;  2Z0A A;  5FNV B;  4DV5 B;  1KMI Z;  4DUY O;  3FKS G;  5LHH A;  1ZL8 A;  2IBZ H;  4QE7 A;  4B7K A;  4DO2 A;  1M5I A;  1QVG U;  2UU9 B;  4CBC A;  1F7Y A;  4DV1 O;  1WPX A;  4HAM A;  4DV6 O;  4CH6 A;  4HZ3 A;  4YJ3 A;  4IT5 A;  4X89 A;  2B5U A;  3JCU Z;  4UCS A;  3TGU H;  3E8G A;  1GM8 A;  1QR9 A;  3EVK A;  1Z5V A;  2LJ2 A;  4LFB B;  5J2U B;  2AGA A;  1YZB A;  2PYL A;  3OEH G;  2UXD O;  1WNS A;  2Q69 A;  3BA9 A;  3LSU A;  4PA3 A;  4H13 B;  4O4H B;  4JI5 O;  4YXW G;  3F7V C;  2WLN A;  2P6J A;  2QR4 A;  2CGO A;  4RUE A;  1HNZ B;  4FFK A;  5KAF Z;  4X1K A;  4JV5 B;  4DR3 O;  3CRR A;  1G1X B;  2XAJ A;  4DV0 O;  4O2B B;  1PNM A;  3OGC C;  1XRE A;  1UJW B;  2R9I A;  4LF7 B;  1YSC A;  2V1D A;  3D3I A;  2JRI A;  5IJ0 A;  1SC5 B;  1FS0 G;  2HP8 A;  1NH2 B;  1K5Q A;  4QNH B;  4LFC O;  3HKB B;  4GT1 A;  2HHH B;  1KP2 A;  2BOC C;  1FAF A;  1OCR B;  2EIL C;  3SJC C;  4UCV A;  4KHP B;  2BE3 A;  1IVS A;  1VQ9 V;  3I56 V;  2A3Q A;  4I0X A;  2E74 B;  3ASN C;  3KZI Z;  4MVM A;  4J42 A;  4UCO A;  2JIZ G;  4LF8 O;  3ABU A;  4PA9 A;  1IXM A;  2WLJ A;  2PTM A;  3TXQ A;  2F4V O;  4B3S O;  3KG2 A;  1BSM A;  2PGG A;  4I55 A;  5AG2 A;  5KX5 A;  5LGU A;  4GZR B;  2PY5 A;  3AG2 C;  4JI8 O;  5KHG A;  2D3O W;  5IJ9 B;  4PDR A;  3QO5 A;  3P30 A;  4RQE A;  2QGN A;  1K92 A;  1R6N A;  3OUF A;  4LF4 B;  1GM7 A;  4MS2 A;  4LF9 B;  3FYE B;  4LCU C;  1CP9 A;  3JSL A;  5LBQ A;  2DJV A;  1N33 O;  1JPX A;  3GB7 C;  1Y74 B;  1W0J G;  4LFB O;  2IJH A;  1F51 A;  5LP6 B;  1VIB A;  2OCH A;  3JSN A;  4RO2 A;  4LWS B;  4J9Z B;  3K5O A;  4R8C A;  1RM1 B;  2MK3 A;  5EBL C;  1N8R W;  2P7T C;  5LYJ B;  3BFR A;  2CE4 A;  3ZJZ A;  5ITZ A;  4P30 A;  3JD1 A;  4G28 B;  2DYS B;  2JS3 A;  2KQX A;  4CH3 A;  4KL1 A;  1FFX A;  4JI0 O;  3JAM N;  2FML A;  5J9P C;  2VQE O;  4FZ0 A;  4YHH O;  3UT5 A;  1B3Q A;  3APQ A;  4DV5 O;  4FLW A;  4GX1 A;  3ETG A;  3BA8 A;  2WPD G;  5L3E A;  1M4U A;  4HNA B;  3CCM V;  2PF4 E;  4NXM B;  4KP4 A;  4FMT A;  2BSK A;  2OCC C;  4EFB A;  2ZDI A;  5GTH Z;  3RYI B;  5EC2 C;  3OR7 C;  4JI3 O;  3M99 B;  4DV6 B;  4AHC A;  4AQY O;  5EYP A;  3EHB B;  2P5O A;  1M90 W;  1YDX A;  1AJP A;  1CEZ A;  4MTG A;  3F5T A;  4P2Z A;  3W7W A;  4UV9 A;  3RYI A;  1QU7 A;  3HKC B;  3OUS A;  4FLV A;  1Y67 A;  1HP8 A;  1WA8 B;  2DWE C;  2EIJ B;  4NYK A;  4NXN O;  2Z5U A;  3ABL C;  3BHP A;  5FNV A;  4QE9 A;  2YSU B;  3Q4H A;  5H6Q A;  3IJ4 A;  2JJ2 G;  5H2F Z;  4JYA B;  4U3J B;  1SQX H;  4FM0 A;  5FPR A;  1VQM V;  4TV8 A;  2UUB O;  2AHY A;  1KQS U;  3T1H B;  4H0L B;  1R6T A;  2WLL B;  3RYC A;  3T1H O;  2UXB O;  2LO1 A;  3DC6 A;  4K3A A;  3K0D A;  2BTQ A;  3K0G A;  1H8E G;  5CB4 A;  1IBK B;  1XNQ B;  1XI1 A;  4TV8 B;  2RQ6 A;  1SQB H;  2OIE A;  4WFH A;  2UUC B;  1PM9 A;  4TV9 A;  1P7B A;  3AG1 B;  4U7N A;  1P7G A;  2BTQ B;  4LF7 O;  2CH7 A;  4CZZ A;  2FKX A;  3DSQ A;  3JAT A;  2ZNI A;  3H9V A;  3VBB A;  3IC7 A;  4X66 B;  2KKW A;  4DV7 O;  5CMU A;  1FYJ A;  3CHX A;  1J5E O;  2XT9 A;  4Q20 A;  3UQ8 A;  1SA0 B;  1TGO A;  4RQF A;  4BW5 A;  4MVZ A;  1Y76 A;  2ILM A;  1Q6H A;  3IC9 A;  1L0N H;  5KUM A;  2X6B A;  4Z1M G;  4WFG A;  5KX5 B;  4WBN A;  2OT5 A;  1H8H G;  4TUY A;  2F95 B;  3L71 H;  4MVQ A;  1OCR C;  2EIL B;  1FJG B;  4PDM A;  4Z2W A;  1YTF D;  4X1I B;  5IE9 A;  3J81 N;  1GN4 A;  3H1H H;  1H2M A;  1Q82 W;  2M6Y A;  2UUC O;  3LSS A;  2FTK A;  2YXY A;  3GWK C;  3JAR B;  3ZED A;  3AK2 A;  3CC2 V;  1GAX A;  3CS5 A;  1K73 W;  1S76 D;  3DC5 A;  4K0K B;  5HFL A;  3L75 H;  1BL8 A;  2OIG A;  1WN7 A;  2WA4 A;  3GWO A;  4ZHQ A;  1WAZ A;  1WJZ A;  2QM7 A;  4LF6 O;  3RVY A;  1XEQ A;  1E1R G;  1GN3 A;  4Z1V A;  3OFN G;  1VQ8 V;  5FL7 G;  3BVO A;  1NR7 A;  1FFX B;  4K35 A;  2WAM A;  5DN6 G;  1KEC A;  2HG5 C;  4JYC A;  3FB7 C;  4DW0 A;  1NBM G;  3E8B A;  5F2V O;  1QNM A;  1HDJ A;  3AEI A;  5J2T B;  1K9M W;  5A9G A;  2GBO A;  4CH4 A;  4X65 B;  5IWA B;  2HJD A;  1XMO O;  4HNA A;  1PV0 A;  4UUJ C;  5DEC A;  4NKG B;  2DOS A;  1FJG O;  3C3T A;  3CRQ A;  1P49 A;  2KSD A;  4QGP A;  4WF9 V;  3RWR D;  5LGN A;  4JGS A;  1V55 C;  2G38 A;  1SQF A;  1TUB A;  3CYO A;  3CCJ V;  3K04 A;  5D5P A;  1H38 A;  1WP7 A;  2IU0 A;  5JVD A;  3RBZ A;  1G8M A;  2XAF A;  2ZR2 A;  1N0N A;  1ZLZ A;  2QM4 A;  2B1G A;  3HKC A;  2RCV A;  4UB6 Z;  2QM8 A;  1EN4 A;  1IDS A;  4X1Y B;  4UVB A;  2QA4 V;  2DQ3 A;  3HR0 A;  5KHI A;  1NTM H;  3CXH F;  4PA4 A;  5L3C A;  5LGT A;  3R66 A;  2P90 A;  3ZHT A;  4AIL C;  3CJH A;  1EM1 A;  3H1L H;  2XAH A;  4F4L A;  1NS1 A;  1M93 A;  2YI8 A;  2IU3 A;  3SPH A;  2ZD9 A;  2KG7 B;  1ZX3 A;  5IYD O;  4XDK A;  2EIN C;  2BSK B;  4FLY A;  5LA6 B;  4OPH A;  5JJN B;  3D36 C;  2VQF B;  1K7D A;  3SJB C;  4DR6 B;  1L1F A;  3S3W A;  2V7Q G;  2O57 A;  2EIK C;  4FLZ A;  1K34 A;  1OCO B;  2FB5 A;  2AXT Z;  2Q7E A;  2ZR3 A;  5LA6 A;  1Q3E A;  4JI2 O;  4YJ2 B;  2IJK A;  4B3M O;  3FAV B;  3CXC U;  2EX3 A;  3RVZ A;  4I50 B;  3WB2 A;  3U10 A;  4LF5 B;  2DW4 A;  4JZ2 A;  1MSD A;  3CE2 A;  1N32 O;  4L87 A;  4FVM A;  3E22 B;  1PL0 A;  2DYR C;  2A79 B;  2QTS A;  1KD1 W;  2F4V B;  1K97 A;  2CH7 B;  1EZV H;  3PJS K;  1FXK A;  4EB6 B;  4DXW A;  3RW0 A;  2JGU A;  1IBM O;  1E79 G;  5B1B B;  3RGB A;  3HKB A;  4UCT A;  1S5L Z;  3M8A A;  4LF8 B;  2HR3 A;  1OV9 A;  2JVD A;  4C7U A;  5CB4 B;  4GKJ B;  5JH7 B;  2QWQ B;  1SS3 A;  4JI4 B;  3FFQ A;  1PD3 A;  1GN2 A;  1FXK B;  5H5N A;  3K06 A;  2UXN A;  1M56 B;  5B5E Z;  4RWU A;  1QLE B;  3ABK C;  3B40 A;  4JI1 O;  1SER A;  4A5U B;  1Q86 W;  1Z5W A;  4DR6 O;  5IYB O;  3ZN0 A;  4WBN B;  2N74 A;  5L3G A;  3AG4 B;  4NXN B;  1CXZ B;  1GK9 A;  3JD3 A;  2VQF O;  1YCI A;  3W7X A;  2LFS A;  2XTA A;  2HVK C;  3JAW B;  2NNU A;  4KUM A;  5KHK A;  3MD0 A;  4QJF B;  4JI0 B;  4I9Q A;  1SZX A;  3CC4 V;  4JV5 O;  2Y4T A;  1JFF B;  3JD4 A;  1VQ5 V;  1JVM A;  4JI6 O;  5BR8 B;  5EIB D;  1I94 B;  5D5Q A;  5LXT B;  3D3Q A;  1FXK C;  1J95 A;  2OTL V;  1OHH G;  1MOF A;  1FKA O;  4O2A A;  1F23 A;  4D7S A;  3ZRX A;  2PZS A;  2QWO B;  3O9O A;  2W0X A;  1XDC A;  4O4I A;  2FL4 A;  1VQ7 V;  2UUA O;  3OMN B;  2F1M A;  2ZIM A;  3WG7 C;  3CCS V;  3ZMU A;  4B08 A;  2YIC A;  2JEX A;  2Q0A A;  5EZY B;  5CA1 B;  1P4R A;  1XNR B;  5LMU O;  2OCC B;  2QWR B;  4WFB V;  3R65 A;  5J2T A;  2H8P C;  5BR8 O;  2ZCE A;  3W7U A;  1QLN A;  3ZHS A;  4B3S B;  4X8A A;  5GON A;  4ZHQ B;  3K57 A;  4XDL A;  3ZMV A;  3ZHR A;  3APO A;  4NTW A;  3VQW A;  4LFA B;  1ZSP A;  1WLE A;  3MHH C;  3WB0 A;  3L72 H;  2K9P A;  3K59 A;  2QTO A;  1VQN V;  5BZB A;  4UB8 Z;  1AJQ A;  1IBK O;  4FLX A;  5EC1 C;  1RFY A;  4IYI A;  3J7A U;  1NTK H;  2DWD C;  3WU2 Z;  5IJ9 A;  1XL6 A;  2C2A A;  3SPG A;  3RFR A;  3K79 A;  2YI9 A;  2HEP A;  5BMV B;  1M57 B;  2EZP A;  1KKC A;  3AG4 C;  1OJH A;  2KG7 A;  1THZ A;  5K1P A;  2H3O A;  3THO A;  2F66 C;  3VQX A;  1HR0 O;  4GKK B;  2P4V A;  1M57 C;  5EBW C;  3DGE A;  4O4J A;  1RSO A;  4I4T A;  3ETQ A;  3QO8 A;  2RMK B;  4WFF A;  5DM6 V;  4IHJ B;  3X2Q B;  1NQT A;  3E8F A;  1PL4 A;  1AR5 A;  5CBH A;  1OCC B;  4KFM A;  1XIL A;  2ZE7 A;  5B3S C;  1G4Y B;  3QNE A;  3CRC A;  2JDI G;  3ETD A;  3I5D A;  3KCY A;  3EFF K;  3A0B Z;  3ZCC A;  4BW9 A;  1AI5 A;  1SQP H;  3JAT B;  4EB6 A;  5GTI Z;  2ETN A;  2Y0P A;  3G6B A;  3CC7 V;  5IY5 C;  1KKD A;  1TUB B;  3LNN A;  1KC8 W;  5IWA O;  1Y74 A;  5J2U A;  3L70 H;  3ML0 A;  1LNQ A;  3KKY A;  3BCC H;  4LNU A;  3CCU V;  1AB3 A;  2YXH A;  4LR3 A;  4LWS A;  3W7T A;  1JOY A;  5KA5 A;  1R3K C;  3ETE A;  2DQ0 A;  4TQD A;  1Y76 B;  2YID A;  1N0J A;  2E5L O;  3OW2 U;  3CX5 F;  1BQZ A;  2GHY A;  4JPR A;  2JEU A;  1SZT A;  1FD9 A;  4GKK O;  2QWP B;  3ABM B;  2F93 B;  3HB3 B;  1JJ2 U;  4H44 B;  4LF9 O;  3QTC A;  1PP9 H;  5JJE B;  2VWK A;  1IBM B;  1YEW A;  4N23 A;  1D2D A;  2LW1 A;  1GN6 A;  1T5E A;  4DUZ B;  2E75 B;  1Q8I A;  3TK1 A;  4MVO A;  4DYL A;  2Q7G A;  2A7W A;  5KAI Z;  4DV1 B;  4DV2 B;  4CC5 A;  4ZKI A;  3IAY A;  2RN9 A;  3UCS C;  2LGQ A;  4W4K A;  1YF2 A;  2OWO A;  4JAS A;  1OCZ B;  2X7R B;  4KXR A;  3G4S V;  3CCL V;  3FX7 A;  3ZIA G;  5LP6 C;  4G2K A;  4DR4 O;  4ICG A;  1B6Q A;  5KHH A;  4E4E A;  4ZI7 A;  1G6U A;  2V4D A;  1XUQ A;  1YIT V;  1ORQ C;  3RYH A;  3HKD B;  2XAQ A;  4YHH B;  5KA6 A;  1Y6X A;  3SJQ C;  1YHQ V;  2ODM A;  2HHH O;  1N34 O;  2HJF C;  2QKS A;  1M1K W;  2P22 C;  2Q73 A;  1HNX B;  3WFV A;  3B2E E;  2ITD C;  3HKD A;  2GUZ B;  1XNR O;  4YIO A;  3E8H A;  3C90 A;  2QJ1 A;  4DK0 A;  2WA3 A;  4EKW A;  4MTO A;  3ABL B;  1BE3 H;  1TA8 A;  2DYR B;  4TWK A;  2R9A A;  4OX9 O;  4P9P A;  3ZRW B;  1HNZ O;  2PI5 A;  5H6R A;  3ZRS A;  3CEI A;  1MNG A;  4HYO A;  4I0X B;  1N33 B;  1Q6I A;  4X62 O;  2P06 A;  3JAK B;  2YDE A;  1NTZ H;  1US6 A;  2PUS A;  3BAB A;  1XOU A;  3SYC A;  3AG7 A;  3ZS8 C;  4OXS A;  1YJ9 V;  1N36 O;  4PJ0 Z;  4X66 O;  1SET A;  1BCC H;  2Y69 B;  4MTX A;  4O2A B;  5JCO C;  2YXL A;  3LDD A;  4PI2 A;  2KB1 A;  2LFR A;  4BIO A;  5B1N A;  3P3P A;  4FJC C;  1IUR A;  1IBL O;  3C3S A;  2YC0 A;  3ASO B;  3KCX A;  1A32 A;  1YTF B;  2L35 A;  1S72 V;  4PV1 B;  5A2Q N;  1FFT B;  1W59 A;  3RN4 A;  2XUM A;  2XHB A;  2D2C B;  5E1A C;  4NXM O;  3FYI B;  2AHZ A;  4FLU A;  1KBH A;  5KHJ A;  1WPB A;  4LH7 A;  2GSM B;  4J7J A;  4DR1 O;  1V55 B;  1H2S B;  3EXA A;  5LMU B;  2BCC H;  2XAG A;  2A06 H;  4IHJ A;  5LHI A;  5IT9 N;  1H2K A;  1U97 A;  3OTO B;  1ZWI C;  4X64 B;  3MDS A;  5L3B A;  1JCH A;  1NJI W;  1DK1 A;  4NR1 A;  3A2F A;  1S0V A;  1N32 B;  3JD0 A;  2R9R B;  1MZF A;  3BEH A;  3AG1 C;  5EK0 A;  3CPW U;  3RYF A;  4UCR A;  5LOV A;  2H94 A;  2UXC B;  2WSS G;  4WCE V;  2ITC C;  4J41 A;  1JA8 A;  3T4Z A;  2Y48 A;  2P4K A;  4IGG A;  4TT3 G;  3AG2 B;  4DW1 A;  1QCE A;  4I5S A;  4FFB B;  1Q81 W;  3OAA G;  3D36 A;  3G80 A;  4O4L A;  3OMI B;  2IH3 C;  4U3F H;  4QIW F;  2YIB D;  3B09 A;  2RJZ A;  4UVC A;  4L8J A;  5B1B C;  4AI8 A;  5FLX N;  1SQG A;  1X4T A;  2JJ1 G;  2NN4 A;  3CP1 A;  3L73 H;  2B1I A;  1VMG A;  4QPK A;  3CRA A;  2NLJ C;  2EBO A;  3ZHQ A;  4O4J B;  1UPG A;  2BOB C;  4DR2 O;  1MMM A;  3G6E V;  3P3N A;  4I9W A;  3K08 A;  2CTQ A;  1DF4 A;  4WFE A;  3ABM C;  4FM2 A;  4JYY A;  3B4S A;  3FD9 A;  4FPP A;  4GYC B;  2Z3Y A;  1B04 A;  1EFR G;  5B1A B;  1J5E B;  4JI4 O;  2QWN B;  1K4D C;  3B77 A;  2IH1 C;  3QG5 A;  2EUL A;  3JAS B;  2CK3 G;  4OGQ B;  4X64 O;  3CCE V;  3BY6 A;  3CSX A;  4JAV A;  2N04 A;  1P84 F;  4MVR A;  1K8A W;  1GH6 A;  3GVM A;  3HPL C;  4JI1 B;  4D6T H;  1K33 A;  2IM9 A;  4R7C A;  4JI8 B;  4X20 B;  5JH7 A;  1YIJ V;  4DV2 O;  1JR9 A;  3M7M X;  3UM7 A;  4RAI A;  5IY5 B;  4NB5 A;  1XNQ O;  3E2E A;  3JAR A;  4LFC B;  1K4C C;  3DXR B;  3Q4H B;  1WB7 A;  4I55 B;  1O9H A;  4DV3 O;  1TVK A;  4MW3 A;  1JJO A;  1SF9 A;  1CPY A;  1S77 D;  1D5A A;  1MA1 A;  3T2M A;  5IYC O;  1KU9 A;  4EEQ A;  5LHG A;  4PA6 A;  1H2L A;  3NXS A;  4LFA O;  1F4M A;  2AZ0 A;  1VEW A;  1XBL A;  4U7O A;  2R70 A;  5EZY A;  3JCZ A;  4KHP O;  4NTY A;  5BXZ A;  2WLK A;  2ZE8 A;  1E1Q G;  1K5S A;  2HKO A;  4DR2 B;  1HNX O;  1AIL A;  2E76 B;  1QLE C;  1WB8 A;  4LH6 A;  4DV4 B;  4TSF G;  4O2B A;  3LDC A;  4JTC B;  5LYJ A;  4DV0 B;  1Q7Y W;  4X20 A;  2YIA A;  5LXT A;  3ZMS A;  1PKX A;  3CWB H;  4OX9 B;  2ZXW C;  2DE0 X;  1JX9 A;  4GX5 A;  3QVN A;  2CUG A;  1PNL A;  4UFZ A;  2F23 A;  3QF7 A;  1GM9 A;  2XAS A;  4K8X A;  3UT5 B;  4CS4 A;  4O4I B;  1EBO A;  4H37 A;  3H1J H;  2Q7H A;  4LF4 O;  4W4L A;  3MHS C;  1VQO V;  3T1C A;  1F4N A;  4YY3 B;  1D5N A;  1O9G A;  2Y69 C;  4J80 A;  2Q9L A;  2ADQ B;  5LMN B;  4GKJ O;  4JI6 B;  3ABT A;  2PI4 A;  2UXX A;  5BMV A;  1YVW A;  2W0F C;  1H2N A;  1W0K G;  2MW2 B;  1XHZ A;  2X0L A;  2ARH A;  1JQ0 A;  3OGI B;  5CBF A;  2QSA A;  4IIJ A;  1HWY A;  3CCQ V;  3N2G A;  4GLX A;  2GV9 A;  3WG7 B;  1V9P A;  1Q5O A;  3TJT A;  4B3M B;  4J7Z A;  4F6R B;  1IZ3 A;  4ABM A;  1ZUQ A;  4FFB A;  1VAR A;  1SES A;  3E89 A;  4PDV A;  1N4C A;  2F43 G;  4DUY B;  4UCU A;  4JYA O;  5KUK A;  4X88 A;  2CDY A;  2L6L A;  1ZAU A;  3W7S A;  3E86 A;  4PI0 A;  4JI7 B;  3FB8 C;  2AZ2 A;  1VQ6 V;  5B66 Z;  1XHX A;  1NT2 B;  1VF5 B;  3ZN1 A;  3U0Z A;  4GCZ A;  4YJ3 B;  5LMN O;  4ZOL B;  3CMA V;  1VQL V;  2YUA A;  1QQC A;  5EIB C;  2WLH A;  4K8Z A;  1KYO F;  3JAL A;  5IYZ B;  2GTS A;  2EJR A;  1Q43 A;  2UXD B;  3ICX A;  2QE7 G;  4I50 A;  4JAU A;  3HKE B;  2OTJ V;  1HR0 B;  1TAE A;  3TCU A;  4LBE C;  3CJH B;  4ASU G;  5CA0 B;  1YJN V;  2LGW A;  1NH2 D;  4LNU B;  4PDL A;  3RYF B;  3UO2 A;  2QKA A;  3OT7 A;  1FPO A;  1SQQ H;  4CC6 A;  1PNK A;  1KUQ A;  2ZIN A;  2IJJ A;  4BIU A;  3FB6 C;  4DV7 B;  1VP7 A;  1WP8 A;  3S3X A;  4GX0 A;  4EFE A;  4DR7 O;  1KB9 F;  4N21 A;  1QR8 A;  1QBZ A;  1DTO A;  1RPR A;  3OTF A;  4DR5 O;  3VQY A;  1M9N A;  4UV8 A;  4ZIB A;  1NKD A;  2YIB A;  3CD6 V;  1ENV A;  3A0R A;  3QO7 A;  5JWP A;  2VRZ A;  1NI8 A;  4YJ2 A;  3JAK A;  5KMG A;  1EN5 A;  2YEV A;  3SR2 C;  1BS3 A;  5CN0 A;  2R72 A;  2UXC O;  2ZXW B;  3DXR A;  3RYC B;  3E22 A;  4MVU A;  2Y4U A;  2GTA A;  3T1Y B;  3SYA A;  4X65 O;  3OTO O;  5GON B;  2XOK G;  5CA1 A;  3E83 A;  2OYQ A;  4PA7 A;  4X1I A;  3STL C;  3SGI A;  3K5M A;  3N2K B;  3N27 A;  1NZ6 A;  3ZX6 A;  4CH5 A;  4CS2 A;  2EZO A;  3U11 A;  5JCO A;  4B3T B;  1AI4 A; 
#chains in the Genus database with same CATH homology
 1K7D A;  1DF5 A;  1FXV A;  1EZJ A;  4E2L A;  3CCV V;  1L1F A;  2HLD G;  2V7Q G;  4PEL A;  4RUF A;  3OEH G;  1FFT B;  2QEX V;  1MAB G;  3SYO A;  2EIK C;  2X6A A;  2Q69 A;  1K34 A;  4PA3 A;  1OCO B;  5E1A C;  4YXW G;  2ZR3 A;  3F7V C;  2WLN A;  2Q6A A;  3ABK B;  4JYB A;  2P6J A;  3FYI B;  2IJK A;  3CXC U;  2AHZ A;  5HFM A;  4RUE A;  3RVZ A;  2DW4 A;  2GSM B;  5L3D A;  2A0L A;  4FIP C;  4L87 A;  2XAJ A;  1PL0 A;  1V55 B;  2A79 B;  2DYR C;  1PNM A;  4MSW C;  3OGC C;  1KD1 W;  4P9O A;  1K97 A;  4JTD B;  1UJW B;  2XAG A;  3PJS K;  1FXK A;  4DXW A;  2R9I A;  5LHI A;  3RW0 A;  1ZWI C;  1E79 G;  5B1B B;  1YSC A;  2V1D A;  3D3I A;  5L3B A;  3ZMZ A;  1JCH A;  1NJI W;  1FS0 G;  1NH2 B;  3ZMT A;  2WLI A;  1S0V A;  1K5Q A;  2HR3 A;  3ASN B;  4QNH B;  3JD0 A;  2R9R B;  3BEH A;  3AG1 C;  5EK0 A;  3CPW U;  4GT1 A;  2X6C A;  1PD3 A;  2H94 A;  2M7W A;  1KP2 A;  2BOC C;  1FXK B;  5IDJ A;  2WSS G;  4WCE V;  2ITC C;  1OCR B;  2EIL C;  3OEE G;  3K06 A;  2UXN A;  3T4Z A;  2Y48 A;  1M56 B;  3LUT B;  4TT3 G;  3AG2 B;  1QCE A;  4I5S A;  1QLE B;  3ABK C;  5EBM C;  1Q81 W;  1SER A;  3OAA G;  3D36 A;  1Q86 W;  1VQ9 V;  5B1A C;  1GKF A;  5IYB O;  3OMI B;  1OCO C;  4XBF A;  3I56 V;  3ZN0 A;  3ASN C;  2IH3 C;  4MVM A;  2JIZ G;  5L3G A;  1YJW V;  3AG4 B;  4QIW F;  5GW7 A;  1VQP V;  2W6J G;  3JD3 A;  1GK9 A;  4UVC A;  2WWW A;  3W7X A;  2LFS A;  5B1B C;  3ABU A;  4PA9 A;  1IXM A;  4J9Y B;  2WLJ A;  2HVK C;  2NNU A;  4KUM A;  2JJ1 G;  3MD0 A;  3CP1 A;  2B1I A;  4QPK A;  3F7Y C;  4QJF B;  3CCR V;  2NLJ C;  2EBO A;  3KG2 A;  3AG3 C;  3CC4 V;  1SRY A;  2Q68 A;  4UXN A;  3JD4 A;  4R50 A;  1VQ5 V;  2BOB C;  3K03 A;  3OMA B;  1JVM A;  3G6E V;  5B1O A;  5LGU A;  3LSQ A;  4I9W A;  3AG2 C;  3K08 A;  2P67 A;  3IGA C;  1DF4 A;  4WFE A;  2D3O W;  3ABM C;  4PDR A;  1FXK C;  3QO5 A;  3P30 A;  4RQE A;  1J95 A;  4FPP A;  2Z3Y A;  2OTL V;  1OHH G;  2DYS C;  1MOF A;  1K92 A;  1R6N A;  1EFR G;  3SPI A;  5B1A B;  3ZRV A;  1F23 A;  3OUF A;  3ZRX A;  1R3J C;  1GM7 A;  4MS2 A;  2IJI A;  3JD2 A;  3FYE B;  4LCU C;  1CP9 A;  1K4D C;  5LBQ A;  1S3J A;  3B77 A;  3OE7 G;  2IH1 C;  1RM1 C;  1YI2 V;  1VQ7 V;  2CK3 G;  3OMN B;  3CCE V;  3BY6 A;  4LC1 A;  1JPX A;  3GB7 C;  4JAV A;  1NVP B;  1W0J G;  2IJH A;  4MVR A;  1K8A W;  3T4D A;  3WG7 C;  1OZ0 A;  1F51 A;  3HPL C;  3ZMU A;  3CCS V;  2EIM C;  3P32 A;  2JEX A;  1K33 A;  2ATK C;  1I5X A;  1P4R A;  4RO2 A;  4R7C A;  3B8N A;  2OCC B;  1K3E A;  1YIJ V;  1V54 B;  4WFB V;  4J9Z B;  2ZQM A;  3R65 A;  4R8C A;  3UM7 A;  1RM1 B;  2MK3 A;  3DTU B;  4RAI A;  5EBL C;  5IY5 B;  2H8P C;  4ZBM A;  1N8R W;  3E2E A;  2P7T C;  3W7U A;  1QLN A;  2EIM B;  1MG1 A;  3ZJZ A;  1K4C C;  4P30 A;  4X8A A;  3JD1 A;  4G28 B;  2DYS B;  4XDL A;  4UVA A;  3ZMV A;  5J9P C;  4MW3 A;  1V54 C;  1CPY A;  1S77 D;  1WLE A;  3MHH C;  3T2M A;  5IYC O;  2QTO A;  4GX1 A;  1VQN V;  3F5W C;  5BZB A;  5LHG A;  3ETG A;  4MTF A;  4PA6 A;  4MW8 A;  1GMG A;  1AJQ A;  3NXS A;  1OCZ C;  2WPD G;  5L3E A;  1F4M A;  2YEV B;  1COW G;  3CCM V;  4U7O A;  5EC1 C;  4KP4 A;  4FMT A;  1H2G A;  3JCZ A;  2OCC C;  2ZDI A;  3STZ C;  2WLK A;  3OR6 C;  2DWD C;  5EC2 C;  2Q67 A;  3OR7 C;  1NR1 A;  3M99 B;  1E1Q G;  1XL6 A;  1K5S A;  2EIJ C;  2C2A A;  2HKO A;  3EHB B;  3SPG A;  1VQ4 V;  4BAY A;  1M90 W;  2ZDI C;  5H9C A;  4BIZ A;  1QLE C;  1RPO A;  3K79 A;  1AJP A;  1CEZ A;  4MTG A;  1M57 B;  3B8M A;  4P2Z A;  2EZP A;  3W7W A;  4TSF G;  3AG4 C;  4JF3 A;  4UV9 A;  3LDC A;  3SPJ A;  4JTA B;  1THZ A;  4JTC B;  3OUS A;  1Q7Y W;  1GO3 F;  2DWE C;  2EIJ B;  3ZMS A;  2Z5U A;  3AG3 B;  3ABL C;  1PKX A;  4QE9 A;  2EIK B;  1I5Y A;  2YSU B;  1AR1 B;  5H6Q A;  3OM3 B;  2ZXW C;  1JX9 A;  2JJ2 G;  4GX5 A;  1M57 C;  3ZRW A;  1NVP D;  1PNL A;  5EBW C;  3DGE A;  1VQM V;  1GM9 A;  4MT8 A;  2AHY A;  2XAS A;  1KQS U;  3H01 A;  3QO8 A;  1R3I C;  4WFF A;  2WLL B;  3X2Q B;  2EIN B;  1EBO A;  5DM6 V;  1NQT A;  1BMF G;  4H37 A;  3E8F A;  3K0D A;  3MHS C;  5CBH A;  1VQO V;  3K0G A;  3T1C A;  1OCC B;  1F4N A;  2HFE C;  4KFM A;  1H8E G;  2XND G;  5B3S C;  1G4Y B;  3G71 V;  2K1E A;  2Y69 C;  3QNE A;  2W6I G;  3K3W A;  4G27 B;  2JDI G;  3ABT A;  2UXX A;  2PI4 A;  3ETD A;  4WFH A;  3JYC A;  3I55 V;  3EFF K;  1P7B A;  3ZCC A;  3AG1 B;  2W0F C;  1AI5 A;  1R3L C;  4U7N A;  1W0K G;  5CBG A;  4CZZ A;  2X0L A;  3VOU A;  3CC7 V;  5CA3 A;  5IY5 C;  1JQ0 A;  1XL4 A;  1KKD A;  3VBB A;  5CBF A;  5B3S B;  1KC8 W;  3IC7 A;  2WLI B;  1HWY A;  3ML0 A;  5CMU A;  3CCQ V;  1LNQ A;  5C93 A;  4H33 A;  3X2Q C;  3CCU V;  3WG7 B;  4XDJ A;  4Q20 A;  1AJN A;  3W7T A;  1JOY A;  3CME V;  5KA5 A;  1R3K C;  3ETE A;  2DQ0 A;  3LDE A;  4RQF A;  1SES A;  3E89 A;  4PDV A;  4BW5 A;  2F43 G;  3IFX A;  4MVZ A;  5KUK A;  3K9A A;  4R6Z A;  4X88 A;  3OW2 U;  2GHY A;  4JPR A;  5KUM A;  2X6B A;  2JEU A;  4Z1M G;  4WFG A;  1SZT A;  2LP7 A;  3W7S A;  3SPC A;  2OT5 A;  1H8H G;  3ABM B;  1M56 C;  3E86 A;  3HB3 B;  1JJ2 U;  3FB8 C;  4MVQ A;  1OCR C;  2EIL B;  1VQ6 V;  1VQK V;  4PDM A;  3ZN1 A;  1GTO A;  4N23 A;  1YTF D;  2IW5 A;  4GCZ A;  3TK1 A;  1FXH A;  4MVO A;  4FK5 C;  1Q82 W;  3CMA V;  3LSS A;  1ROP A;  1S5H C;  4ZKI A;  2FTK A;  1VQL V;  3FB5 C;  4GX2 A;  3CC2 V;  1Y66 A;  1K73 W;  3LNM B;  4JAS A;  1ARO P;  1KP3 A;  1OCZ B;  3ASO C;  2X7R B;  2WLH A;  5HFL A;  4WFA V;  3G4S V;  3CCL V;  1S76 D;  3ZIA G;  1BHA A;  1Y4M A;  3E35 A;  1BL8 A;  4G2K A;  3GWO A;  2EJR A;  2QM7 A;  3RVY A;  1B6Q A;  1QVF U;  1TUE B;  1E1R G;  2QE7 G;  3OFN G;  4LP8 A;  4JAU A;  3TET A;  1BHB A;  2OTJ V;  1VQ8 V;  5FL7 G;  3TCU A;  1YIT V;  1NR7 A;  1ORQ C;  2WAM A;  2XAQ A;  4LBE C;  1KEC A;  2HG5 C;  4JYC A;  4ASU G;  5DN6 G;  5KA6 A;  5L3F A;  3SJQ C;  3FB7 C;  1YJN V;  1YHQ V;  1NBM G;  1DLB A;  1NH2 D;  2WLL A;  4PDL A;  3E8B A;  1W2B U;  3AEI A;  1PNK A;  2HJF C;  1R73 A;  2IJJ A;  4BIU A;  2QKS A;  3FB6 C;  1K9M W;  4GX0 A;  1M1K W;  3SYP A;  2WLM A;  4N21 A;  1R6K A;  3WFV A;  1QR8 A;  1QBZ A;  1DTO A;  2ITD C;  1RPR A;  4UUJ C;  4QPJ A;  1MSW D;  1M9N A;  3E8H A;  1AI7 A;  3UKM A;  1OCC C;  4UV8 A;  2HVJ C;  1NKD A;  2A9H A;  3CD6 V;  3SYQ A;  1ENV A;  3A0R A;  4EKW A;  4MTO A;  4WF9 V;  3QO7 A;  5LGN A;  3ABL B;  4JGS A;  4MVS A;  1V55 C;  2DYR B;  4TWK A;  1AI6 A;  3CYO A;  2JK5 C;  3K04 A;  4P9P A;  3CCJ V;  1H38 A;  3ZRW B;  2PI5 A;  5H6R A;  2IU0 A;  3ZRS A;  4HYO A;  3RBZ A;  1G8M A;  2YEV A;  2XAF A;  3FKS G;  5CN0 A;  5LHH A;  2ZXW B;  2ZR2 A;  2B1G A;  3SYC A;  4QE7 A;  4DO2 A;  2QM8 A;  4OXS A;  1YJ9 V;  1QVG U;  4UVB A;  2QA4 V;  2DQ3 A;  4CBC A;  4MVU A;  4PA4 A;  5L3C A;  5LGT A;  1SET A;  1WPX A;  3SYA A;  2P90 A;  4HAM A;  2XOK G;  4HZ3 A;  2Y69 B;  4MTX A;  3E83 A;  4PA7 A;  2XAH A;  4F4L A;  3LDD A;  2KB1 A;  2LFR A;  3STL C;  5B1N A;  2IU3 A;  3SPH A;  2ZD9 A;  2B5U A;  4FJC C;  4X89 A;  5IYD O;  4XDK A;  2EIN C;  3ASO B;  3E8G A;  2EZO A;  1GM8 A;  1YTF B;  1QR9 A;  1S72 V;  1AI4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...