1QCEA

Solution nmr structure of ectodomain of siv gp41, restrained regularized mean structure plus 29 simulated annealing structures
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
123
structure length
123
Chain Sequence
AQSRTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQTRVTAIEKYLKDQAQLNAWGAAFRQVAHTTVPWPNASLTPKWNNETWQEWERKVDFLEENITALLEEAQIQQEKNMYELQKLNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (GP41)
publication title Measurement of Residual Dipolar Couplings of Macromolecules Aligned in the Nematic Phase of Acolloidal Suspension of Rod-Shaped Viruses
pubmed doi rcsb
molecule tags Viral protein
total genus 45
structure length 123
sequence length 123
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1999-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1qceA00
3B8MA 3M99B 4FIPC 2EZOA 1JPXA 5CMUA 4FJCC 2M7WA 4N23A 3P30A 4G2KA 1DF5A 2EBOA 3WFVA 2OT5A 1Y66A 3MHHC 1K34A 3K9AA 1DF4A 1QCEA 1DLBA 3MHSC 3GWOA 5KA5A 3B77A 2LP7A 3B8NA 1JQ0A 4JF3A 2P6JA 2EZPA 5KA6A 1MOFA 1Y4MA 2X7RB 1QR9A 1MG1A 5HFLA 3H01A 4JGSA 5CN0A 1I5XA 5H9CA 3CYOA 1ENVA 3CP1A 1EBOA 4FK5C 1I5YA 1QR8A 4E2LA 5HFMA 4JPRA 1F23A 1K33A 2MK3A 1QBZA 1SZTA 4N21A
chains in the Genus database with same CATH superfamily
3ZMVA 2ZD9A 4X66O 4JTCB 3JCUZ 1NI8A 4FFKA 2QKSA 3EVKA 2ZR3A 1VQ8V 1HNXB 4LF8O 3SJBC 4JPRA 2WLIB 3AG3B 3D8CA 2Y0PA 1H2NA 1QLEB 1YTFD 4OXSA 5CMUA 1L8DA 3QVNA 1XDCA 3FAVB 3QO7A 3ABKB 1KC8W 5LXTB 3T4ZA 3JYCA 2E75B 3SJAC 4UCVA 4FFBB 5JVDB 4JI8B 3A2FA 5BY1A 3UQ8A 3EHBB 4IL6Z 1WPXA 3E86A 4K0KO 3LSQA 5DEDA 3OUFA 3SDLA 1QU7A 4WFAV 4BWAA 1MZEA 4O4JB 5LHHA 1H8HG 3FYIB 3AG1B 1BL8A 1GM8A 1ENVA 4WBNB 3DSQA 4RUEA 4JV5O 3UT5B 4G27B 4UV9A 2B9ZA 1G1XB 3BEHA 1SKVA 3AG3C 4W4LA 4X64O 5EIBD 3JD2A 4I7ZB 3T2MA 4HNAA 2RMKB 2DQ3A 2YXYA 1AP5A 2FB5A 3JAKB 5B1BB 1GN3A 4ASUG 1QVGU 3CCEV 3K59A 2AHZA 2CH7A 2HG5C 3RYFB 2R72A 3IC7A 1N0JA 3AG7A 1AI5A 5K1XA 1OCCB 2Q7GA 2YXHA 2KG7A 3E8FA 2F4VB 1A32A 1GTOA 1H2KA 2UXBO 4JZ2A 3AG1C 3OGCC 3DXRB 4IHJB 1KMIZ 3HKBB 2IH1C 4NTWA 1XBLA 1IBKO 3H1HH 2O57A 4CS2A 3LDEA 1PD3A 3B2EE 3OW2U 2YEVB 3UO3A 4DV3O 4MVOA 5B66Z 3L73H 3S3XA 3SPGA 3BAAA 2YDEA 2Q7HA 1UFIA 1R73A 1S77D 1SQPH 1IURA 2JJ1G 3TXQA 2V4DA 2JRIA 5J2TA 1NBMG 4JV5B 2P4VA 4J41A 2ARHA 1AVMA 1OCCC 2ZE7A 1Y4MA 3Q4HB 2LW1A 4DV1O 3P32A 4NTXA 3A0HZ 1FXKB 1K33A 3VQVA 2PYLA 2DOSA 5B3SB 4IHJA 2LO1A 1YCIA 1XUQA 4WFGA 4DV4O 5CA3A 3G4SV 2YIBA 1J5EO 4PDRA 2K1EA 1VARA 3ZCCA 2IU3A 4PDVA 1EZVH 4DV5O 2F23A 4X1YB 5GTHZ 3UKMA 1Q6UA 1X59A 2OTJV 4WFFA 1AROP 1P84F 3OTOO 5FLXN 1Q8IA 2EZOA 1THZA 3VQWA 1VQ9V 1XNRO 1WLEA 4GX1A 3VBBA 3SR2C 5KMGB 1NR1A 2CTQA 4IT5A 3N2GB 3NR7A 4GKJO 1WNSA 5TISZ 4MS2A 3BA9A 3JAWA 5JCOA 2Z5UA 1IBKB 1W0KG 1RPRA 4PHZA 2ITDC 3KCYA 5J9PC 4DV3B 2R9AA 2JJ2G 2WLMA 2YIDA 2A06H 3OM3B 4TSFG 3J81N 2QR4A 1GMGA 5IJ0A 3BABA 5B3SC 1KBHA 4JYAO 1WA8A 2DE0X 3J7AU 2N74A 2XAJA 4UCOA 4I4TA 1N34O 3ZX6A 2A7WA 1GKFA 1U97A 3I56V 2B1IA 2WLNA 5LA6B 1TAEA 4N21A 2P67A 4X1IB 2GHYA 2P22C 1JA8A 1B3QA 2PTMA 4LNUB 1M1KW 1MSWD 4DV1B 3MHHC 5IYCO 1AILA 3WG7B 1E1RG 1MA1A 1HNZB 4X20A 5CB4B 3A0BZ 1N36B 1L1FA 4GT1A 4DR2O 2LFSA 4B3TO 4PJ0Z 2WA3A 2BTQA 5B5EZ 4DV4B 5DN6G 2Y48A 2UXDO 1KECA 4MT8A 4LFCO 4CH4A 1ZUQA 1DF5A 4DV5B 1HNWO 2PZSA 1Y74A 1JOYA 1VEWA 3OEHG 3OTOB 3ML0A 1TUEB 3ETQA 2GV9A 4B7KA 4X65B 4JI1B 1XNRB 5JJNB 2DQ0A 2LGWA 5L3DA 5HFMA 4EB6B 4MTFA 1MSDA 2Y69B 4GKJB 3CRCA 4JYYA 5LA6A 4R7CA 4BIZA 2UUCO 4JAAA 2N05A 3ZHQA 5DM6V 1K8AW 1M57B 3BA8A 4CBCA 5CA0B 3WG7C 3ZMSA 2HVJC 3R66A 5C8YB 4JYAB 3OAAG 4F6RA 5KHIA 1BS3A 2F43G 3HB3B 3CSXA 1RP3B 1SZXA 1N34B 3CCQV 3C3SA 1SC5B 1S5LZ 4TWKA 1SA0B 4L87A 4A5UB 1Z5VA 2Y4UA 4HAMA 3L71H 2ZKOA 1JCHA 2ILMA 1IXMA 3OMAB 4LBEC 4U3JA 4YIPA 1RSOA 4QNHB 4QPKA 2UXXA 4DR5O 4J7JA 3CHXA 1KKCA 2EINC 1FJGO 4B3MB 4G2KA 4DR2B 3CCLV 3T1CA 3K5NA 2WWWA 3OT7A 3B8NA 3IGAC 5IYDO 3RN4A 1H2MA 1NVPB 4P2ZA 1M57C 4JAVA 5E79Z 4JI3O 1IXBA 4J80A 3JSNA 2GTSA 1SRYA 3ZRWB 1SQFA 2P4KA 3T1HB 1SQQH 2XAFA 4MVSA 3LDDA 3ZRVA 3OEEG 1H2LA 1TVKB 2B5UA 2UUCB 5KHGA 4DR6B 4OPAA 2Q67A 1N32O 1JVMA 4DV0B 2F66C 3L9DA 4YY3O 3K0DA 2W6IG 3SJCC 3ZMTA 5JJJB 4DR7O 4ZOLA 2ATKC 3ABUA 4I9WA 3AEIA 4O4HA 4DR1O 4LF5O 2X7RB 4KUMA 3CEIA 2ZR2A 4NR1A 3SYQA 1HR0O 4Q6GA 4BR6A 1FD9A 2CE4A 1K9MW 2VQEO 2ADPA 4GKKO 1AJPA 3ZHTA 2A0LA 4X62O 5JWPA 3ZHRA 5BR8B 5KHKA 3GWOA 2Q8VA 2JEUA 3ZRWA 1AI7A 3KG2A 1YEWA 3TXSA 1FJGB 1IX9A 1NTKH 2HEPA 5LL6Y 2XOKG 4GYCB 1SQGA 1DLBA 3JARB 1S5HC 1S0VA 2RNBA 3CRQA 2OTLV 3NXSA 1V54B 5H9CA 2GDSA 2DMXA 4LFAB 4JI6B 1HWYA 4FLYA 1F7YA 4JI5O 1FFTB 2IU0A 4RO2A 5B1AC 3HKDA 5KX5A 3N27A 4LF4O 1YIJV 2WLHA 3CRAA 3CC7V 1EFRG 1QVFU 1N32B 1RFYA 1CPYA 2EIKB 1VQ5V 1US6A 1XHZA 2NN4A 1NS1A 2K9PA 2DN9A 4LF5B 3JARA 1KP2A 1G8MA 2HR3A 4UVBA 2BE3A 3CRMA 4MVRA 3IFXA 4K3AA 3G71V 1NR7A 3K0GA 5D5PA 5CBGA 5IY5B 5E1AC 4X62B 2ZQMA 3G6EV 5BMVA 3OR6C 5L3CA 1VF5B 4KHPO 1SESA 1DF4A 4TV9A 1N33O 4LP8A 3BVOA 1D5AA 1AP6A 4GLXA 4YJ2A 2PY5A 1N0NA 2F93B 3ZRSA 1V55B 1P49A 2X6CA 1QR8A 3K03A 4DV2O 3RBZA 2EIKC 3W7XA 5B1NA 4DV7O 1XMOO 2X6AA 4C7UA 4HNAB 3CB2A 2Q6AA 4WFEA 1GM9A 1O9HA 5LYJB 3MAQA 1LNQA 2JIZG 1MNGA 4NKGB 2CH7B 3ZN0A 4I9QA 5CA1A 1SQBH 3RFRA 5IY5C 4J9ZB 2PUSA 1SERA 2KG7B 2OT5A 5KLVH 1L0NH 1VF6A 3P3PA 3W7SA 2BOCC 2E5LO 2GSMB 4JI4O 1R6KA 4LF6O 5IT9N 4HYOA 2ZIOA 2Q0OC 1G6UA 2QKCA 2OIGA 5H5NA 1RM1B 1AB3A 1V55C 3FB6C 4PI2A 1M93A 5IYZA 3WB1A 4H13B 2QA4V 5C93A 1NTMH 1KYOF 4UUJC 1VMGA 4YIOA 4MTXA 1FKAO 2PI4A 1XMQO 5LYJA 2AXTZ 2DYSC 2FMLA 3CYOA 2ZCEA 1TGOA 2AW9A 4LF9O 1W59A 1QNMA 1PL4A 4H44B 2CDYA 4X66B 4KHPB 1E1QG 3LNNA 3M99B 1Q82W 1N33B 1CEZA 4X88A 3CXCU 3OD4A 2XAQA 5J2TB 5JH7A 3T4DA 3ETGA 2NLJC 1GAXA 1K34A 1EZJA 2EULA 4LF8B 2RQ6A 4I0XA 1YJNV 4X1KA 3CCUV 3G6BA 1ROPA 2L35A 4IGGA 1NQTA 4DV7B 1XMOB 3H1KH 5DECA 4XDLA 3APOA 2HLDG 1WAZA 3FYEB 3RVYA 5FNVA 4IIJB 1RM1C 3IAYA 2BCCH 3E2EA 4PV1B 2P06A 4DV6O 1I0HA 2Q5ZA 3E8HA 1GRJA 1R3KC 2HVKC 4P9OA 4X89A 5IWAO 4Z2WA 1R1BA 4K0KB 4J9YB 3VQYA 1YVWA 5LHGA 4IYIA 2AZ0A 3D36A 3D36C 4UFZA 3UM7A 1GN6A 1BMFG 1KP3A 2V1DA 5KUKA 2E5LB 1V9PA 4JI4B 3JATA 4JI0O 3TJTA 1ORQC 3JAWB 5KA6A 3ABTA 4JYBA 3CS5A 2P90A 3DC6A 2JK5C 3TCUA 3K5MA 2QSAA 4UVAA 4NXMO 4WF9V 4X64B 1EN4A 3CRRA 3FB7C 5IJ0B 1GM7A 4P9PA 1U96A 4FLTA 5LP6A 5LP6C 3E35A 3CMAV 3P3NA 2IJHA 1WA8B 4IIJA 1Y66A 4I4TB 5KHHA 5KAFZ 2QEXV 5FPOA 1FFXA 2NNUA 3A8TA 1XREA 3RWRD 5BXZA 4EFBA 4LC1A 2JDIG 4K8XA 4B7EA 3OTFA 4R6ZA 1YDXA 1Z5WA 2IM9A 3H9VA 5LBQA 4X20B 3F7YC 1I94O 2Y0IA 3JALA 2UXBB 3GWKC 2WAMA 3X2QB 1I08A 2BTQB 5JCOC 4ICGA 2PGGA 5EIBC 3OGIB 4LH6A 3ASOC 4DV6B 3E22A 3LUTB 2QJ1A 3CPWU 2CAZC 1S72V 2BOBC 3LDCA 5JQGA 1COWG 1Y74B 3CMEV 3F7VC 2ZE8A 4YXWG 3SPJA 3RYHB 1JJOA 5J2UA 4TQFA 4FLZA 1XL6A 3QO8A 2Y4TA 3K04A 1PL0A 3QG5A 4F6EA 4DW0A 4JI0B 4RWUA 4CC6A 2GUZA 1YI2V 4Z1MG 2UUAO 1JPXA 4DRXB 4FLXA 5A2QN 1Y76A 3EXAA 4KFMA 5LGUA 2D3OW 1MMMA 4NXMB 3E83A 4CH3A 4U7NA 2XAHA 5BZBA 4NXNO 1TUBA 3CJHA 1HW7A 3X2QC 4JI2O 4F6RB 4E2LA 3THOA 4JI7O 3L75H 3IC9A 2LQTA 2E74B 1J5EB 3ZIAG 2ZNIA 1Q7YW 1PNKA 1P4RA 2R70A 3RT3C 2P6JA 2IBZH 3RYHA 1LUVA 2R9RB 2CTWA 1W2BU 1ZWIC 4DUYO 4U3JB 1RSOB 3O65A 2EINB 4PELA 1YJ9V 1H8EG 4ZHQA 4DRXA 2G38A 2EJ7A 2W6JG 4JTAB 1ZLZA 3STZC 1KU9A 2W0XA 1MZFA 1M90W 5GTIZ 1R3IC 3OR7C 1G4YB 1NH2D 1VQKV 1IBLO 3JD1A 4UB6Z 2DJVA 1VQ4V 2OWOA 4DXWA 4PD4F 1BQ0A 3RYIA 3ABLB 3KKYA 4AQYO 3ZS8C 3MHSC 1QCEA 2VS0A 3G80A 1NTZH 5L3BA 3K58A 1H38A 4IYHA 3ETDA 3MDSA 1SETA 2QTSA 2ZINA 3QTCA 1EBOA 1R3JC 3SYCA 4MW8A 3U10A 1BZKA 1QHTA 4ZOLB 4FIPC 5CBFA 2XHBA 2OCHA 3OMIB 4J42A 2FL4A 4NXNB 4B3TB 4JI2B 4RQEA 4O4HB 2AGAA 1H2SB 4BIOA 2WA4A 2UXDB 2E3CA 4PA7A 4LR3A 1AJNA 1K4DC 4GUNA 4LFCB 2WSSG 4FMTA 1HNWB 3U0ZA 5LHIA 3T1YO 1H2GA 4Z1VA 3P30A 1WB8A 2YC0A 3CC2V 3WFVA 3QF7A 4MVZA 2WLJA 4CH5A 4DO2A 1HDJA 3M7MX 2QM4A 3ABLC 1IDSA 4I50A 2UXCO 2Q7EA 3K08A 1UJWB 1BE3H 3K06A 3U11A 3F5TA 3C90A 2VQFO 1YF2A 1SS3A 1ZL8A 2MW2B 5LOVA 1AR1B 2A9HA 1OCRB 2IJJA 5EC1C 4O2AA 2LJ2A 1XNQO 2IW5A 3FX7A 4QE9A 5B1AB 3HKDB 2E76B 2XASA 4MSWC 5KX5B 4RQFA 3K3WA 2W0FC 1JFFA 3JD3A 1Z2GA 2D2CB 2ITCC 3ZN1A 2ZM6O 2KKWA 3CD6V 1R3LC 1N8RW 1IBMO 3LSSA 2Q69A 4DR5B 1W0JG 4JZGA 5GW7A 2RCVA 4L8JA 3ZHUA 4PDMA 1CXZB 3AK1A 3GVMA 1K4CC 1PP9H 5FL7G 4NTYA 2UU9O 4TV8A 3ASNC 2HJDA 1OCRC 4JI3B 1JQ0A 2ZE6A 2QWQB 2CTRA 2YS8A 2GBOA 1R6NA 5BMVB 4FZ1A 1BGYH 4LF7O 1WP8A 4BIUA 2M7WA 2UXCB 4TV9B 4H37A 1J95A 1ZX3A 4XBFA 5IJ9A 4I55A 4YJ2B 3UO2A 4YY3B 3JASA 3CWBH 3ZRXA 4DR7B 4O4LB 3VQXA 3AK2A 2P5OA 3BCCH 4JI8O 4DK1A 3JSLA 4DR1B 1GO3F 3LSUA 1S3JA 4D7TA 4FM1A 2OCCC 1PNLA 2IJIA 1SF9A 1HR0B 4ZI7A 2UUBO 2VQEB 4KP4A 2QWPB 4GKKB 5CA1B 4AI8A 3SYAA 3HKEA 4TQDA 1VQMV 3FD9A 3K9SA 3E8GA 4RAIA 1GH6A 1FYJA 3SPIA 2CUGA 1K5SA 4DW1A 4O2BA 3RVZA 4HBNA 1P7BA 1Y67A 1VQOV 5EYPB 1FPOA 5HFLA 2H94A 4DR4O 2H3OA 3KCXA 1XHXA 4JTDB 1LUWA 5AG2A 4UCUA 5IYZB 4O4LA 2QDOA 3CCRV 5EBWC 2HJFC 4K35A 5LGNA 4PA3A 4W4KA 4TUYA 2EBOA 1NT2B 4ABMA 3UCSC 2B1GA 1RPOA 4LF7B 2QWRB 2XT9A 3W7WA 1YITV 2DYSB 4JI5B 5EZYB 4OGQB 3CP1A 1YXBA 5GONA 4LF4B 1VQNV 2F4VO 4R50A 3VOUA 4O4IA 1MABG 3AG4B 5JH7B 1K73W 1M9NA 1VQPV 4FVMA 3QNEA 4K8ZA 5EC2C 1KQSU 3BPZA 3WB2A 3HR0A 2ZNJA 3D3QA 4BAYA 2QKAA 4QE7A 2LW7A 2DYRB 1IZ3A 4I0XB 3K57A 2VWJA 2RDCA 4WFBV 4X1KB 2JS5A 1VF6C 1MOFA 1F4NA 1WN7A 1AR4A 4YJ3B 5EYPA 4AILC 3JCZA 1M4UA 2YIBD 5FNVB 1CP9A 3G67A 3BHPA 1Y6XA 4J11A 4R8CA 3BY6A 2UUBB 3K9AA 2WLKA 5H6QA 4X9QA 2QGNA 1JJ2U 1S5JA 4OPHA 1DTOA 2Q0AA 4LWSB 1WP7A 5EZYA 1HP8A 5KHJA 5B1OA 2WLIA 3JAMN 3JATB 1QLEC 3AG4C 3FAVA 4DR4B 3ABKC 1YTFB 5LXTA 3RYCB 1Q81W 3JD4A 4FM2A 4JF3A 4GZRB 2OIEA 2L6LA 1Q5OA 4DV2B 2DYRC 1YZBA 3E8BA 2KSDA 4RUFA 4FFBA 5JVDA 4HZ3A 2V7QG 3OE7G 3CCMV 4YJ3A 5LP6B 2H8PC 1I7FA 3CCJV 4LCUC 4DUZO 4FJCC 4GX5A 1NU1H 1EN6A 4MVMA 3C3TA 1FFXB 5IE9A 1WJZA 1X4TA 4O4JA 3I55V 4AHCA 2AHYA 1ZTEA 2CTPA 2C2AA 4WBNA 2ZT9B 4LWSA 1F23A 1PV0A 3UT5A 3DGEA 4YHHO 1OCOB 3FFQA 1VP7A 3HKCB 1F51A 5L3FA 2LGQA 4X8AA 3JALB 4LF6B 4EEQA 3A0RA 1OCZB 1QLNA 3RYCA 3ASOB 3E22B 3JAKA 4UV8A 5B1BC 2FKXA 1K92A 3HPLC 4MTGA 2P7TC 5JQGB 1ZAUA 3H1JH 4UCSA 3RYFA 3TGUH 2ODMA 1JX9A 3F5WC 1XMQB 3ZEDA 1E79G 2PI5A 5J2UB 4E4EA 4LF9B 1BHBA 4JYCA 5H2FZ 2F95B 4PA4A 3FB5C 4JGSA 3SJQC 1TA8A 1XL4A 1HNZO 1IVSA 2ETNA 2GUZB 1AR5A 2VRZA 2Q4PA 1N36O 1K97A 3E89A 4TT3G 3K5LA 2YICA 3DXRA 3HKBA 3RW0A 1Y76B 3TETA 2QWOB 1JMKC 4B3RO 3QO5A 1NZ6A 1OCOC 1XOUA 1VQ6V 3HKCA 2X6BA 2YEVA 1PKXA 1FXHA 2DWDC 2LP7A 3B77A 3SYOA 4PDLA 4XDKA 1TUBB 3APQA 3CJHB 2Z3YA 4DUZB 1KD1W 1OCZC 1WPBA 5F2VO 3R65A 2GTAA 4BW9A 4X65O 1P7GA 3L72H 4JI1O 1Q86W 1Q90D 3SGIA 2FYUH 4N23A 1XQ8A 3MD0A 3OFNG 2EJRA 5IWAB 4GX2A 3D3IA 1URFA 2F1MA 2QTOA 4CH6A 3BFRA 4YHHB 1B06A 3M8AA 3Q4HA 2ZXWB 3OMNB 1FXKA 1FXKC 3L70H 4OX9O 5LMUO 2XAGA 2Q73A 4ZHQB 1Q6IA 1K3EA 4I5SA 1OV9A 2LFRA 2Q9LA 4CC5A 5A9GA 1KB9F 3OUSA 4X1YA 2EILB 3ABMB 2RJZA 2ZE5A 1XILA 3RYIB 5KMGA 4UB8Z 5L3EA 2QE7G 1UPGA 1OHHG 4PA9A 1GN2A 4PI0A 3N2GA 3ZMZA 4B3MO 1B04A 1MG1A 1PM9A 4QPJA 1I5XA 4G28B 3CX5F 1Q3EA 3GB7C 4Q20A 4B3RB 2PYJA 4GCZA 3RGBA 4UXNA 1QBZA 1JR9A 2ZXWC 1I94B 4ZKIA 4J7KA 4XDJA 2QM7A 4NYKA 4DR3O 1NVPD 5KA5A 1GN4A 2A3QA 2BSKB 5KAIZ 1QR9A 1YJWV 3PN1A 2UXNA 3T1HO 4J7ZA 4J10A 3J80N 3H1LH 1KKDA 4QIWF 2EIMB 3ZMUA 5EK0A 3SYPA 1M56B 1YSCA 2EILC 2XUMA 4DR6O 3ABMC 1VQLV 4X1IA 4MW3A 4DV0O 2YI9A 4LNUA 2M6YA 4CS3A 4F4LA 4I50B 1T5EA 5KUMA 2YSUB 3O9OA 5CB4A 4OX9B 5LMUB 1BHAA 2UUAB 2YUAA 1FXVA 4MVQA 4LFBO 1ZL8B 1SZTA 1BSMA 5LOVB 1VIBA 4B3SO 2KB1A 5K1PA 4O2AB 1S76D 3ICXA 2XTAA 1XEQA 2JVDA 2HFEC 1L0LH 4ZIBA 3DTUB 3B09A 1BQZA 4UCRA 5IDJA 1FS0G 4JI7B 4KXRA 5BR8O 3CC4V 2BSKA 1I5YA 3CCSV 1JFFB 1D5NA 4EB6A 4DYLA 2R9IA 2Y69C 4KL1A 2EIMC 1WB7A 1M56C 4DUYB 2HHHO 2IH3C 2CGNA 4LH7A 3B4SA 4NVPA 3WB0A 5CBHA 4FZ0A 5CA0A 2WPDG 4FLWA 2QWNB 1Q43A 4DR3B 5C8YA 2HP8A 4TV8B 1NH2B 1N4CA 1OZ0A 4FLVA 3ASNB 4U3FH 4P30A 3DC5A 5EBLC 4LFAO 4JI6O 3BRCA 2JGDB 2X0LA 1NKDA 2NR5A 5ITZB 4D7SA 1SA0A 4NB5A 2JS3A 2EZPA 5D5QA 1IBLB 1FAFA 4H0LB 3CCVV 5LMNO 3JD0A 2EIJB 4FK5C 4MTOA 1BCCH 2JEXA 1BT8A 4AQYB 1F4MA 1B6QA 4EKWA 1DGSA 4BW5A 4D6TH 3ZHVA 5IJ9B 4GX0A 3EFFK 1AJQA 1M5IA 4I55B 3ZHSA 1R6TA 2XNDG 5IYBO 4WCEV 4LFBB 4FLUA 4TOIA 3JASB 4B3SB 3KZIZ 4FPPA 2ZIMA 1Q6HA 3S3WA 2MK3A 5H6RA 4PA6A 5FPRA 2OCCB 2WLLB 4U7OA 4ZBMA 3AG2B 1KUQA 2CK3G 2JGDA 4ZI7B 2ZDIA 2ZDIC 5ITZA 1TVKA 1VF7A 3T1YB 4UVCA 1K7DA 3HKEB 1AI4A 2PF4E 2EIJC 2FTKA 1GK9A 4H33A 1HNXO 2BTOA 5LGTA 2HHHB 1OJHA 1ZSPA 2N04A 4O2BB 3I5DA 3ETEA 3PJSK 4QGPA 3K5OA 1PPJH 5JJEB 2VQFB 3H01A 4MVUA 3N2KB 2YXLA 3ZBHA 1D2DA 1SQVH 2IJKA 1XNQB 2HKOA 1O9GA 2VWKA 3B8MA 3W7TA 1EM1A 2CGOA 4TUYB 3SPCA 2QM8A 3CE2A 4UCTA 2RN9A 4WFHA 3AK3A 3WU2Z 1K5QA 2AZ2A 3FKSG 3K79A 5LMNB 3ZJZA 2OYQA 4B08A 1LR1A 2YI8A 4JAUA 2WLLA 2EX3A 3SPHA 3AG2C 1SQXH 4CZZA 3FB8C 1DK1A 5EBMC 5GONB 5CN0A 3LNMB 4FM0A 4O4IB 1NJIW 4QJFB 3CXHF 2YIAA 3H1IH 1YHQV 2JGUA 1EN5A 2ZM6B 3IJ4A 2DW4A 2ADQB 3STLC 5L3GA 3L74H 1QQCA 1IBMB 3TK1A 4EFEA 2KQXA 1PNMA 3B40A 1VQ7V 3W7UA 1V54C 4DK0A 4CS4A 2A79B 1XI1A 2UU9B 2Z0AA 3N2KA 4JASA 2DWEC 2Q68A 1AI6A
chains in the Genus database with same CATH topology
3K0DA 1OCOB 2W6IG 3ZMTA 3ZIAG 3ZMVA 2ZD9A 1Q7YW 1F51A 1PNKA 5L3FA 2ATKC 3ABUA 1P4RA 4X8AA 4JTCB 4I9WA 3A0RA 1OCZB 2P6JA 1QLNA 3AEIA 2QKSA 2X7RB 4KUMA 2R9RB 2ZR3A 1VQ8V 3ASOB 4UV8A 1W2BU 1ZWIC 5B1BC 2ZR2A 3SYQA 1K92A 4JPRA 3HPLC 2WLIB 3AG3B 4MTGA 2P7TC 2EINB 1K9MW 1QLEB 1YTFD 4OXSA 5CMUA 1AJPA 3QO7A 4PELA 3ABKB 1YJ9V 2A0LA 1H8EG 1KC8W 1JX9A 3F5WC 2W6JG 4JTAB 1E79G 3T4ZA 3JYCA 2PI5A 3GWOA 2JEUA 3ZRWA 1AI7A 3STZC 1BHBA 4JYCA 3KG2A 1M90W 4PA4A 1R3IC 3FB5C 4JGSA 3SJQC 3OR7C 1G4YB 1NH2D 1XL4A 2XOKG 1VQKV 3JD1A 3EHBB 1WPXA 1K97A 3E86A 3E89A 1DLBA 4TT3G 3LSQA 1S5HC 3OUFA 3RW0A 1S0VA 3TETA 1VQ4V 3QO5A 4WFAV 1OCOC 4DXWA 3ABLB 1VQ6V 3MHSC 1QCEA 2X6BA 2YEVA 1PKXA 1FXHA 2DWDC 2LP7A 3B77A 3NXSA 3SYOA 5L3BA 5LHHA 1H38A 1V54B 4PDLA 4XDKA 1H8HG 3ETDA 3FYIB 3AG1B 1SETA 1BL8A 1GM8A 2Z3YA 1KD1W 5H9CA 1OCZC 1ENVA 1EBOA 1R3JC 4RUEA 3R65A 1HWYA 4G27B 3SYCA 4UV9A 4MW8A 1FFTB 2IU0A 4RO2A 5B1AC 3BEHA 1Q86W 4FIPC 5CBFA 3AG3C 4N23A 3OMIB 3MD0A 1YIJV 2WLHA 3OFNG 2EJRA 3JD2A 3CC7V 4GX2A 1EFRG 3D3IA 1QVFU 4RQEA 3T2MA 2QTOA 2DQ3A 1CPYA 5B1BB 4ASUG 4PA7A 1QVGU 1AJNA 2ZXWB 3CCEV 1K4DC 2AHZA 2WSSG 4FMTA 2EIKB 1VQ5V 2HG5C 3OMNB 1FXKA 1FXKC 3IC7A 2XAGA 5LHIA 1AI5A 1H2GA 3P30A 1KP2A 3CC2V 1G8MA 2HR3A 4UVBA 3WFVA 1OCCB 4MVZA 2WLJA 1K3EA 4I5SA 4DO2A 3E8FA 4MVRA 3IFXA 3G71V 3ABLC 2OTLV 1NR7A 2LFRA 3K08A 1UJWB 1GTOA 3K0GA 5CBGA 3OUSA 5IY5B 5E1AC 3K06A 3AG1C 3OGCC 2EILB 2IH1C 2ZQMA 3ABMB 3G6EV 3OR6C 3LDEA 5L3CA 1PD3A 1AR1B 2A9HA 1OCRB 2IJJA 5EC1C 3OW2U 2YEVB 1SESA 1DF4A 2IW5A 4MVOA 5L3EA 2QE7G 1OHHG 4LP8A 4PA9A 3ZMZA 3SPGA 4QE9A 1MG1A 4QPJA 1I5XA 4G28B 3ZRSA 1V55B 3GB7C 4Q20A 2X6CA 5B1AB 1QR8A 4GCZA 3K03A 4UXNA 1QBZA 2XASA 3RBZA 1R73A 4MSWC 4RQFA 1S77D 2ZXWC 3K3WA 2W0FC 3JD3A 4ZKIA 2EIKC 2JJ1G 4XDJA 3W7XA 5B1NA 2QM7A 2X6AA 2ITCC 1NBMG 3ZN1A 2Q6AA 5KA5A 1NVPD 4WFEA 3CD6V 1R3LC 1GM9A 1OCCC 1N8RW 1Y4MA 1QR9A 1LNQA 2JIZG 1YJWV 3LSSA 2Q69A 2UXNA 3P32A 1W0JG 5GW7A 3ZN0A 1FXKB 1KKDA 1K33A 4PDMA 4QIWF 2EIMB 3ZMUA 5IY5C 5B3SB 4J9ZB 5EK0A 1K4CC 1M56B 1YSCA 2EILC 5FL7G 3SYPA 3ABMC 1VQLV 1SERA 4WFGA 3ASNC 4MW3A 5CA3A 2OT5A 3G4SV 4F4LA 1OCRC 1JQ0A 5KUMA 2YSUB 4PDRA 2K1EA 3W7SA 3ZCCA 2BOCC 2IU3A 2GSMB 4PDVA 1BHAA 1R6KA 4HYOA 3UKMA 1R6NA 1FXVA 2OTJV 4MVQA 4WFFA 1AROP 1RM1B 1V55C 1SZTA 4BIUA 3FB6C 2EZOA 1THZA 1VQ9V 2KB1A 2QA4V 1WLEA 2M7WA 4GX1A 3VBBA 5C93A 1S76D 1NR1A 4H37A 1J95A 2HFEC 4UUJC 4XBFA 3DTUB 5IDJA 4MTXA 4MS2A 1FS0G 2PI4A 2Z5UA 1W0KG 3CC4V 1RPRA 3CYOA 2DYSC 3ZRXA 2ITDC 1I5YA 3CCSV 5J9PC 1E1QG 2JJ2G 2WLMA 3OM3B 3M99B 1Q82W 1CEZA 4X88A 3CXCU 4TSFG 2R9IA 2XAQA 1GMGA 2Y69C 2EIMC 5B3SC 3T4DA 1GO3F 3ETGA 1M56C 2NLJC 1K34A 1S3JA 2OCCC 1PNLA 1EZJA 2XAJA 2IJIA 2IH3C 1YJNV 3CCUV 5CBHA 1ROPA 1GKFA 4KP4A 2WPDG 3I56V 1NQTA 2B1IA 2WLNA 3SYAA 4XDLA 4N21A 2HLDG 1NH2B 1VQMV 1OZ0A 3FYEB 2P67A 3ASNB 3RVYA 2GHYA 4P30A 1RM1C 3E2EA 5EBLC 3E8GA 4RAIA 1M1KW 1MSWD 2X0LA 1NKDA 3MHHC 3SPIA 5IYCO 3WG7B 1K5SA 1E1RG 3E8HA 1R3KC 3RVZA 2EZPA 1P7BA 1VQOV 2HVKC 4P9OA 1L1FA 4X89A 4GT1A 5HFLA 2LFSA 2H94A 3CCVV 4J9YB 3JD0A 2EIJB 4FK5C 4MTOA 4JTDB 5DN6G 2JEXA 5LHGA 2Y48A 3D36A 1F4MA 3UM7A 1KECA 1B6QA 1BMFG 1KP3A 3CCRV 5EBWC 4MT8A 2HJFC 4EKWA 2V1DA 4BW5A 5KUKA 4PA3A 5LGNA 1DF5A 2EBOA 4GX0A 3EFFK 1AJQA 1JOYA 2B1GA 1RPOA 1ORQC 2XNDG 3OEHG 5IYBO 4WCEV 3ML0A 1TUEB 5KA6A 3W7WA 1YITV 2DYSB 3ABTA 4JYBA 2P90A 2JK5C 3TCUA 2DQ0A 3CP1A 4UVAA 1VQNV 4FPPA 4WF9V 5L3DA 4R50A 3VOUA 2MK3A 4MTFA 5HFMA 3FB7C 5H6RA 1MABG 2Y69B 3AG4B 4PA6A 1GM7A 4P9PA 1K73W 1M9NA 4R7CA 4BIZA 1VQPV 3QNEA 3E35A 3CMAV 5EC2C 2IJHA 1KQSU 2OCCB 2WLLB 4U7OA 5DM6V 1Y66A 4ZBMA 3AG2B 4BAYA 4QE7A 2CK3G 1K8AW 2DYRB 4WFBV 1M57B 2QEXV 1MOFA 4CBCA 2ZDIA 3WG7C 2ZDIC 2NNUA 3ZMSA 1F4NA 2HVJC 4UVCA 1K7DA 3JCZA 1AI4A 4LC1A 2JDIG 3OAAG 1CP9A 2EIJC 2FTKA 1GK9A 4H33A 2F43G 3HB3B 4R6ZA 5LGTA 4R8CA 3BY6A 3CCQV 5LBQA 4TWKA 4L87A 3K9AA 2WLKA 3F7YC 5H6QA 3ETEA 3PJSK 2WAMA 1JJ2U 3X2QB 4HAMA 1DTOA 3H01A 1JCHA 4MVUA 1IXMA 3OMAB 4LBEC 3ASOC 3LUTB 3CPWU 4QNHB 2IJKA 2HKOA 3B8MA 5B1OA 3W7TA 2WLIA 2UXXA 4QPKA 1S72V 3SPCA 2BOBC 2EINC 3LDCA 2QM8A 1COWG 1QLEC 3AG4C 3CMEV 4G2KA 3F7VC 4WFHA 3T1CA 3CCLV 4YXWG 1K5QA 3FKSG 3SPJA 2WWWA 3K79A 3ABKC 1YTFB 3ZJZA 1Q81W 3B8NA 3JD4A 4JAUA 2WLLA 3IGAC 4JF3A 5IYDO 3SPHA 1XL6A 3AG2C 4CZZA 3FB8C 3QO8A 2DYRC 5EBMC 1NVPB 4P2ZA 3LNMB 5CN0A 3E8BA 1M57C 3K04A 1PL0A 4JAVA 4RUFA 1NJIW 4QJFB 4HZ3A 2V7QG 1YHQV 3OE7G 3CCMV 1YI2V 4Z1MG 2H8PC 3CCJV 4LCUC 1JPXA 2DW4A 4FJCC 4GX5A 3STLC 4MVMA 5L3GA 4KFMA 1SRYA 3ZRWB 5LGUA 2D3OW 3TK1A 2XAFA 4MVSA 1PNMA 3LDDA 3ZRVA 3OEEG 3E83A 1VQ7V 3W7UA 4U7NA 2XAHA 2B5UA 3I55V 5BZBA 1V54C 2A79B 2AHYA 3X2QC 2Q67A 1JVMA 2C2AA 4E2LA 1F23A 4JASA 3DGEA 2DWEC 2Q68A 1AI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B8M A;  3M99 B;  4FIP C;  2EZO A;  1JPX A;  5CMU A;  4FJC C;  2M7W A;  4N23 A;  3P30 A;  4G2K A;  1DF5 A;  2EBO A;  3WFV A;  2OT5 A;  1Y66 A;  3MHH C;  1K34 A;  3K9A A;  1DF4 A;  1QCE A;  1DLB A;  3MHS C;  3GWO A;  5KA5 A;  3B77 A;  2LP7 A;  3B8N A;  1JQ0 A;  4JF3 A;  2P6J A;  2EZP A;  5KA6 A;  1MOF A;  1Y4M A;  2X7R B;  1QR9 A;  1MG1 A;  5HFL A;  3H01 A;  4JGS A;  5CN0 A;  1I5X A;  5H9C A;  3CYO A;  1ENV A;  3CP1 A;  1EBO A;  4FK5 C;  1I5Y A;  1QR8 A;  4E2L A;  5HFM A;  4JPR A;  1F23 A;  1K33 A;  2MK3 A;  1QBZ A;  1SZT A;  4N21 A; 
#chains in the Genus database with same CATH topology
 3ZMV A;  2ZD9 A;  4X66 O;  4JTC B;  3JCU Z;  1NI8 A;  4FFK A;  2QKS A;  3EVK A;  2ZR3 A;  1VQ8 V;  1HNX B;  4LF8 O;  3SJB C;  4JPR A;  2WLI B;  3AG3 B;  3D8C A;  2Y0P A;  1H2N A;  1QLE B;  1YTF D;  4OXS A;  5CMU A;  1L8D A;  3QVN A;  1XDC A;  3FAV B;  3QO7 A;  3ABK B;  1KC8 W;  5LXT B;  3T4Z A;  3JYC A;  2E75 B;  3SJA C;  4UCV A;  4FFB B;  5JVD B;  4JI8 B;  3A2F A;  5BY1 A;  3UQ8 A;  3EHB B;  4IL6 Z;  1WPX A;  3E86 A;  4K0K O;  3LSQ A;  5DED A;  3OUF A;  3SDL A;  1QU7 A;  4WFA V;  4BWA A;  1MZE A;  4O4J B;  5LHH A;  1H8H G;  3FYI B;  3AG1 B;  1BL8 A;  1GM8 A;  1ENV A;  4WBN B;  3DSQ A;  4RUE A;  4JV5 O;  3UT5 B;  4G27 B;  4UV9 A;  2B9Z A;  1G1X B;  3BEH A;  1SKV A;  3AG3 C;  4W4L A;  4X64 O;  5EIB D;  3JD2 A;  4I7Z B;  3T2M A;  4HNA A;  2RMK B;  2DQ3 A;  2YXY A;  1AP5 A;  2FB5 A;  3JAK B;  5B1B B;  1GN3 A;  4ASU G;  1QVG U;  3CCE V;  3K59 A;  2AHZ A;  2CH7 A;  2HG5 C;  3RYF B;  2R72 A;  3IC7 A;  1N0J A;  3AG7 A;  1AI5 A;  5K1X A;  1OCC B;  2Q7G A;  2YXH A;  2KG7 A;  3E8F A;  2F4V B;  1A32 A;  1GTO A;  1H2K A;  2UXB O;  4JZ2 A;  3AG1 C;  3OGC C;  3DXR B;  4IHJ B;  1KMI Z;  3HKB B;  2IH1 C;  4NTW A;  1XBL A;  1IBK O;  3H1H H;  2O57 A;  4CS2 A;  3LDE A;  1PD3 A;  3B2E E;  3OW2 U;  2YEV B;  3UO3 A;  4DV3 O;  4MVO A;  5B66 Z;  3L73 H;  3S3X A;  3SPG A;  3BAA A;  2YDE A;  2Q7H A;  1UFI A;  1R73 A;  1S77 D;  1SQP H;  1IUR A;  2JJ1 G;  3TXQ A;  2V4D A;  2JRI A;  5J2T A;  1NBM G;  4JV5 B;  2P4V A;  4J41 A;  2ARH A;  1AVM A;  1OCC C;  2ZE7 A;  1Y4M A;  3Q4H B;  2LW1 A;  4DV1 O;  3P32 A;  4NTX A;  3A0H Z;  1FXK B;  1K33 A;  3VQV A;  2PYL A;  2DOS A;  5B3S B;  4IHJ A;  2LO1 A;  1YCI A;  1XUQ A;  4WFG A;  4DV4 O;  5CA3 A;  3G4S V;  2YIB A;  1J5E O;  4PDR A;  2K1E A;  1VAR A;  3ZCC A;  2IU3 A;  4PDV A;  1EZV H;  4DV5 O;  2F23 A;  4X1Y B;  5GTH Z;  3UKM A;  1Q6U A;  1X59 A;  2OTJ V;  4WFF A;  1ARO P;  1P84 F;  3OTO O;  5FLX N;  1Q8I A;  2EZO A;  1THZ A;  3VQW A;  1VQ9 V;  1XNR O;  1WLE A;  4GX1 A;  3VBB A;  3SR2 C;  5KMG B;  1NR1 A;  2CTQ A;  4IT5 A;  3N2G B;  3NR7 A;  4GKJ O;  1WNS A;  5TIS Z;  4MS2 A;  3BA9 A;  3JAW A;  5JCO A;  2Z5U A;  1IBK B;  1W0K G;  1RPR A;  4PHZ A;  2ITD C;  3KCY A;  5J9P C;  4DV3 B;  2R9A A;  2JJ2 G;  2WLM A;  2YID A;  2A06 H;  3OM3 B;  4TSF G;  3J81 N;  2QR4 A;  1GMG A;  5IJ0 A;  3BAB A;  5B3S C;  1KBH A;  4JYA O;  1WA8 A;  2DE0 X;  3J7A U;  2N74 A;  2XAJ A;  4UCO A;  4I4T A;  1N34 O;  3ZX6 A;  2A7W A;  1GKF A;  1U97 A;  3I56 V;  2B1I A;  2WLN A;  5LA6 B;  1TAE A;  4N21 A;  2P67 A;  4X1I B;  2GHY A;  2P22 C;  1JA8 A;  1B3Q A;  2PTM A;  4LNU B;  1M1K W;  1MSW D;  4DV1 B;  3MHH C;  5IYC O;  1AIL A;  3WG7 B;  1E1R G;  1MA1 A;  1HNZ B;  4X20 A;  5CB4 B;  3A0B Z;  1N36 B;  1L1F A;  4GT1 A;  4DR2 O;  2LFS A;  4B3T O;  4PJ0 Z;  2WA3 A;  2BTQ A;  5B5E Z;  4DV4 B;  5DN6 G;  2Y48 A;  2UXD O;  1KEC A;  4MT8 A;  4LFC O;  4CH4 A;  1ZUQ A;  1DF5 A;  4DV5 B;  1HNW O;  2PZS A;  1Y74 A;  1JOY A;  1VEW A;  3OEH G;  3OTO B;  3ML0 A;  1TUE B;  3ETQ A;  2GV9 A;  4B7K A;  4X65 B;  4JI1 B;  1XNR B;  5JJN B;  2DQ0 A;  2LGW A;  5L3D A;  5HFM A;  4EB6 B;  4MTF A;  1MSD A;  2Y69 B;  4GKJ B;  3CRC A;  4JYY A;  5LA6 A;  4R7C A;  4BIZ A;  2UUC O;  4JAA A;  2N05 A;  3ZHQ A;  5DM6 V;  1K8A W;  1M57 B;  3BA8 A;  4CBC A;  5CA0 B;  3WG7 C;  3ZMS A;  2HVJ C;  3R66 A;  5C8Y B;  4JYA B;  3OAA G;  4F6R A;  5KHI A;  1BS3 A;  2F43 G;  3HB3 B;  3CSX A;  1RP3 B;  1SZX A;  1N34 B;  3CCQ V;  3C3S A;  1SC5 B;  1S5L Z;  4TWK A;  1SA0 B;  4L87 A;  4A5U B;  1Z5V A;  2Y4U A;  4HAM A;  3L71 H;  2ZKO A;  1JCH A;  2ILM A;  1IXM A;  3OMA B;  4LBE C;  4U3J A;  4YIP A;  1RSO A;  4QNH B;  4QPK A;  2UXX A;  4DR5 O;  4J7J A;  3CHX A;  1KKC A;  2EIN C;  1FJG O;  4B3M B;  4G2K A;  4DR2 B;  3CCL V;  3T1C A;  3K5N A;  2WWW A;  3OT7 A;  3B8N A;  3IGA C;  5IYD O;  3RN4 A;  1H2M A;  1NVP B;  4P2Z A;  1M57 C;  4JAV A;  5E79 Z;  4JI3 O;  1IXB A;  4J80 A;  3JSN A;  2GTS A;  1SRY A;  3ZRW B;  1SQF A;  2P4K A;  3T1H B;  1SQQ H;  2XAF A;  4MVS A;  3LDD A;  3ZRV A;  3OEE G;  1H2L A;  1TVK B;  2B5U A;  2UUC B;  5KHG A;  4DR6 B;  4OPA A;  2Q67 A;  1N32 O;  1JVM A;  4DV0 B;  2F66 C;  3L9D A;  4YY3 O;  3K0D A;  2W6I G;  3SJC C;  3ZMT A;  5JJJ B;  4DR7 O;  4ZOL A;  2ATK C;  3ABU A;  4I9W A;  3AEI A;  4O4H A;  4DR1 O;  4LF5 O;  2X7R B;  4KUM A;  3CEI A;  2ZR2 A;  4NR1 A;  3SYQ A;  1HR0 O;  4Q6G A;  4BR6 A;  1FD9 A;  2CE4 A;  1K9M W;  2VQE O;  2ADP A;  4GKK O;  1AJP A;  3ZHT A;  2A0L A;  4X62 O;  5JWP A;  3ZHR A;  5BR8 B;  5KHK A;  3GWO A;  2Q8V A;  2JEU A;  3ZRW A;  1AI7 A;  3KG2 A;  1YEW A;  3TXS A;  1FJG B;  1IX9 A;  1NTK H;  2HEP A;  5LL6 Y;  2XOK G;  4GYC B;  1SQG A;  1DLB A;  3JAR B;  1S5H C;  1S0V A;  2RNB A;  3CRQ A;  2OTL V;  3NXS A;  1V54 B;  5H9C A;  2GDS A;  2DMX A;  4LFA B;  4JI6 B;  1HWY A;  4FLY A;  1F7Y A;  4JI5 O;  1FFT B;  2IU0 A;  4RO2 A;  5B1A C;  3HKD A;  5KX5 A;  3N27 A;  4LF4 O;  1YIJ V;  2WLH A;  3CRA A;  3CC7 V;  1EFR G;  1QVF U;  1N32 B;  1RFY A;  1CPY A;  2EIK B;  1VQ5 V;  1US6 A;  1XHZ A;  2NN4 A;  1NS1 A;  2K9P A;  2DN9 A;  4LF5 B;  3JAR A;  1KP2 A;  1G8M A;  2HR3 A;  4UVB A;  2BE3 A;  3CRM A;  4MVR A;  3IFX A;  4K3A A;  3G71 V;  1NR7 A;  3K0G A;  5D5P A;  5CBG A;  5IY5 B;  5E1A C;  4X62 B;  2ZQM A;  3G6E V;  5BMV A;  3OR6 C;  5L3C A;  1VF5 B;  4KHP O;  1SES A;  1DF4 A;  4TV9 A;  1N33 O;  4LP8 A;  3BVO A;  1D5A A;  1AP6 A;  4GLX A;  4YJ2 A;  2PY5 A;  1N0N A;  2F93 B;  3ZRS A;  1V55 B;  1P49 A;  2X6C A;  1QR8 A;  3K03 A;  4DV2 O;  3RBZ A;  2EIK C;  3W7X A;  5B1N A;  4DV7 O;  1XMO O;  2X6A A;  4C7U A;  4HNA B;  3CB2 A;  2Q6A A;  4WFE A;  1GM9 A;  1O9H A;  5LYJ B;  3MAQ A;  1LNQ A;  2JIZ G;  1MNG A;  4NKG B;  2CH7 B;  3ZN0 A;  4I9Q A;  5CA1 A;  1SQB H;  3RFR A;  5IY5 C;  4J9Z B;  2PUS A;  1SER A;  2KG7 B;  2OT5 A;  5KLV H;  1L0N H;  1VF6 A;  3P3P A;  3W7S A;  2BOC C;  2E5L O;  2GSM B;  4JI4 O;  1R6K A;  4LF6 O;  5IT9 N;  4HYO A;  2ZIO A;  2Q0O C;  1G6U A;  2QKC A;  2OIG A;  5H5N A;  1RM1 B;  1AB3 A;  1V55 C;  3FB6 C;  4PI2 A;  1M93 A;  5IYZ A;  3WB1 A;  4H13 B;  2QA4 V;  5C93 A;  1NTM H;  1KYO F;  4UUJ C;  1VMG A;  4YIO A;  4MTX A;  1FKA O;  2PI4 A;  1XMQ O;  5LYJ A;  2AXT Z;  2DYS C;  2FML A;  3CYO A;  2ZCE A;  1TGO A;  2AW9 A;  4LF9 O;  1W59 A;  1QNM A;  1PL4 A;  4H44 B;  2CDY A;  4X66 B;  4KHP B;  1E1Q G;  3LNN A;  3M99 B;  1Q82 W;  1N33 B;  1CEZ A;  4X88 A;  3CXC U;  3OD4 A;  2XAQ A;  5J2T B;  5JH7 A;  3T4D A;  3ETG A;  2NLJ C;  1GAX A;  1K34 A;  1EZJ A;  2EUL A;  4LF8 B;  2RQ6 A;  4I0X A;  1YJN V;  4X1K A;  3CCU V;  3G6B A;  1ROP A;  2L35 A;  4IGG A;  1NQT A;  4DV7 B;  1XMO B;  3H1K H;  5DEC A;  4XDL A;  3APO A;  2HLD G;  1WAZ A;  3FYE B;  3RVY A;  5FNV A;  4IIJ B;  1RM1 C;  3IAY A;  2BCC H;  3E2E A;  4PV1 B;  2P06 A;  4DV6 O;  1I0H A;  2Q5Z A;  3E8H A;  1GRJ A;  1R3K C;  2HVK C;  4P9O A;  4X89 A;  5IWA O;  4Z2W A;  1R1B A;  4K0K B;  4J9Y B;  3VQY A;  1YVW A;  5LHG A;  4IYI A;  2AZ0 A;  3D36 A;  3D36 C;  4UFZ A;  3UM7 A;  1GN6 A;  1BMF G;  1KP3 A;  2V1D A;  5KUK A;  2E5L B;  1V9P A;  4JI4 B;  3JAT A;  4JI0 O;  3TJT A;  1ORQ C;  3JAW B;  5KA6 A;  3ABT A;  4JYB A;  3CS5 A;  2P90 A;  3DC6 A;  2JK5 C;  3TCU A;  3K5M A;  2QSA A;  4UVA A;  4NXM O;  4WF9 V;  4X64 B;  1EN4 A;  3CRR A;  3FB7 C;  5IJ0 B;  1GM7 A;  4P9P A;  1U96 A;  4FLT A;  5LP6 A;  5LP6 C;  3E35 A;  3CMA V;  3P3N A;  2IJH A;  1WA8 B;  4IIJ A;  1Y66 A;  4I4T B;  5KHH A;  5KAF Z;  2QEX V;  5FPO A;  1FFX A;  2NNU A;  3A8T A;  1XRE A;  3RWR D;  5BXZ A;  4EFB A;  4LC1 A;  2JDI G;  4K8X A;  4B7E A;  3OTF A;  4R6Z A;  1YDX A;  1Z5W A;  2IM9 A;  3H9V A;  5LBQ A;  4X20 B;  3F7Y C;  1I94 O;  2Y0I A;  3JAL A;  2UXB B;  3GWK C;  2WAM A;  3X2Q B;  1I08 A;  2BTQ B;  5JCO C;  4ICG A;  2PGG A;  5EIB C;  3OGI B;  4LH6 A;  3ASO C;  4DV6 B;  3E22 A;  3LUT B;  2QJ1 A;  3CPW U;  2CAZ C;  1S72 V;  2BOB C;  3LDC A;  5JQG A;  1COW G;  1Y74 B;  3CME V;  3F7V C;  2ZE8 A;  4YXW G;  3SPJ A;  3RYH B;  1JJO A;  5J2U A;  4TQF A;  4FLZ A;  1XL6 A;  3QO8 A;  2Y4T A;  3K04 A;  1PL0 A;  3QG5 A;  4F6E A;  4DW0 A;  4JI0 B;  4RWU A;  4CC6 A;  2GUZ A;  1YI2 V;  4Z1M G;  2UUA O;  1JPX A;  4DRX B;  4FLX A;  5A2Q N;  1Y76 A;  3EXA A;  4KFM A;  5LGU A;  2D3O W;  1MMM A;  4NXM B;  3E83 A;  4CH3 A;  4U7N A;  2XAH A;  5BZB A;  4NXN O;  1TUB A;  3CJH A;  1HW7 A;  3X2Q C;  4JI2 O;  4F6R B;  4E2L A;  3THO A;  4JI7 O;  3L75 H;  3IC9 A;  2LQT A;  2E74 B;  1J5E B;  3ZIA G;  2ZNI A;  1Q7Y W;  1PNK A;  1P4R A;  2R70 A;  3RT3 C;  2P6J A;  2IBZ H;  3RYH A;  1LUV A;  2R9R B;  2CTW A;  1W2B U;  1ZWI C;  4DUY O;  4U3J B;  1RSO B;  3O65 A;  2EIN B;  4PEL A;  1YJ9 V;  1H8E G;  4ZHQ A;  4DRX A;  2G38 A;  2EJ7 A;  2W6J G;  4JTA B;  1ZLZ A;  3STZ C;  1KU9 A;  2W0X A;  1MZF A;  1M90 W;  5GTI Z;  1R3I C;  3OR7 C;  1G4Y B;  1NH2 D;  1VQK V;  1IBL O;  3JD1 A;  4UB6 Z;  2DJV A;  1VQ4 V;  2OWO A;  4DXW A;  4PD4 F;  1BQ0 A;  3RYI A;  3ABL B;  3KKY A;  4AQY O;  3ZS8 C;  3MHS C;  1QCE A;  2VS0 A;  3G80 A;  1NTZ H;  5L3B A;  3K58 A;  1H38 A;  4IYH A;  3ETD A;  3MDS A;  1SET A;  2QTS A;  2ZIN A;  3QTC A;  1EBO A;  1R3J C;  3SYC A;  4MW8 A;  3U10 A;  1BZK A;  1QHT A;  4ZOL B;  4FIP C;  5CBF A;  2XHB A;  2OCH A;  3OMI B;  4J42 A;  2FL4 A;  4NXN B;  4B3T B;  4JI2 B;  4RQE A;  4O4H B;  2AGA A;  1H2S B;  4BIO A;  2WA4 A;  2UXD B;  2E3C A;  4PA7 A;  4LR3 A;  1AJN A;  1K4D C;  4GUN A;  4LFC B;  2WSS G;  4FMT A;  1HNW B;  3U0Z A;  5LHI A;  3T1Y O;  1H2G A;  4Z1V A;  3P30 A;  1WB8 A;  2YC0 A;  3CC2 V;  3WFV A;  3QF7 A;  4MVZ A;  2WLJ A;  4CH5 A;  4DO2 A;  1HDJ A;  3M7M X;  2QM4 A;  3ABL C;  1IDS A;  4I50 A;  2UXC O;  2Q7E A;  3K08 A;  1UJW B;  1BE3 H;  3K06 A;  3U11 A;  3F5T A;  3C90 A;  2VQF O;  1YF2 A;  1SS3 A;  1ZL8 A;  2MW2 B;  5LOV A;  1AR1 B;  2A9H A;  1OCR B;  2IJJ A;  5EC1 C;  4O2A A;  2LJ2 A;  1XNQ O;  2IW5 A;  3FX7 A;  4QE9 A;  5B1A B;  3HKD B;  2E76 B;  2XAS A;  4MSW C;  5KX5 B;  4RQF A;  3K3W A;  2W0F C;  1JFF A;  3JD3 A;  1Z2G A;  2D2C B;  2ITC C;  3ZN1 A;  2ZM6 O;  2KKW A;  3CD6 V;  1R3L C;  1N8R W;  1IBM O;  3LSS A;  2Q69 A;  4DR5 B;  1W0J G;  4JZG A;  5GW7 A;  2RCV A;  4L8J A;  3ZHU A;  4PDM A;  1CXZ B;  3AK1 A;  3GVM A;  1K4C C;  1PP9 H;  5FL7 G;  4NTY A;  2UU9 O;  4TV8 A;  3ASN C;  2HJD A;  1OCR C;  4JI3 B;  1JQ0 A;  2ZE6 A;  2QWQ B;  2CTR A;  2YS8 A;  2GBO A;  1R6N A;  5BMV B;  4FZ1 A;  1BGY H;  4LF7 O;  1WP8 A;  4BIU A;  2M7W A;  2UXC B;  4TV9 B;  4H37 A;  1J95 A;  1ZX3 A;  4XBF A;  5IJ9 A;  4I55 A;  4YJ2 B;  3UO2 A;  4YY3 B;  3JAS A;  3CWB H;  3ZRX A;  4DR7 B;  4O4L B;  3VQX A;  3AK2 A;  2P5O A;  3BCC H;  4JI8 O;  4DK1 A;  3JSL A;  4DR1 B;  1GO3 F;  3LSU A;  1S3J A;  4D7T A;  4FM1 A;  2OCC C;  1PNL A;  2IJI A;  1SF9 A;  1HR0 B;  4ZI7 A;  2UUB O;  2VQE B;  4KP4 A;  2QWP B;  4GKK B;  5CA1 B;  4AI8 A;  3SYA A;  3HKE A;  4TQD A;  1VQM V;  3FD9 A;  3K9S A;  3E8G A;  4RAI A;  1GH6 A;  1FYJ A;  3SPI A;  2CUG A;  1K5S A;  4DW1 A;  4O2B A;  3RVZ A;  4HBN A;  1P7B A;  1Y67 A;  1VQO V;  5EYP B;  1FPO A;  5HFL A;  2H94 A;  4DR4 O;  2H3O A;  3KCX A;  1XHX A;  4JTD B;  1LUW A;  5AG2 A;  4UCU A;  5IYZ B;  4O4L A;  2QDO A;  3CCR V;  5EBW C;  2HJF C;  4K35 A;  5LGN A;  4PA3 A;  4W4K A;  4TUY A;  2EBO A;  1NT2 B;  4ABM A;  3UCS C;  2B1G A;  1RPO A;  4LF7 B;  2QWR B;  2XT9 A;  3W7W A;  1YIT V;  2DYS B;  4JI5 B;  5EZY B;  4OGQ B;  3CP1 A;  1YXB A;  5GON A;  4LF4 B;  1VQN V;  2F4V O;  4R50 A;  3VOU A;  4O4I A;  1MAB G;  3AG4 B;  5JH7 B;  1K73 W;  1M9N A;  1VQP V;  4FVM A;  3QNE A;  4K8Z A;  5EC2 C;  1KQS U;  3BPZ A;  3WB2 A;  3HR0 A;  2ZNJ A;  3D3Q A;  4BAY A;  2QKA A;  4QE7 A;  2LW7 A;  2DYR B;  1IZ3 A;  4I0X B;  3K57 A;  2VWJ A;  2RDC A;  4WFB V;  4X1K B;  2JS5 A;  1VF6 C;  1MOF A;  1F4N A;  1WN7 A;  1AR4 A;  4YJ3 B;  5EYP A;  4AIL C;  3JCZ A;  1M4U A;  2YIB D;  5FNV B;  1CP9 A;  3G67 A;  3BHP A;  1Y6X A;  4J11 A;  4R8C A;  3BY6 A;  2UUB B;  3K9A A;  2WLK A;  5H6Q A;  4X9Q A;  2QGN A;  1JJ2 U;  1S5J A;  4OPH A;  1DTO A;  2Q0A A;  4LWS B;  1WP7 A;  5EZY A;  1HP8 A;  5KHJ A;  5B1O A;  2WLI A;  3JAM N;  3JAT B;  1QLE C;  3AG4 C;  3FAV A;  4DR4 B;  3ABK C;  1YTF B;  5LXT A;  3RYC B;  1Q81 W;  3JD4 A;  4FM2 A;  4JF3 A;  4GZR B;  2OIE A;  2L6L A;  1Q5O A;  4DV2 B;  2DYR C;  1YZB A;  3E8B A;  2KSD A;  4RUF A;  4FFB A;  5JVD A;  4HZ3 A;  2V7Q G;  3OE7 G;  3CCM V;  4YJ3 A;  5LP6 B;  2H8P C;  1I7F A;  3CCJ V;  4LCU C;  4DUZ O;  4FJC C;  4GX5 A;  1NU1 H;  1EN6 A;  4MVM A;  3C3T A;  1FFX B;  5IE9 A;  1WJZ A;  1X4T A;  4O4J A;  3I55 V;  4AHC A;  2AHY A;  1ZTE A;  2CTP A;  2C2A A;  4WBN A;  2ZT9 B;  4LWS A;  1F23 A;  1PV0 A;  3UT5 A;  3DGE A;  4YHH O;  1OCO B;  3FFQ A;  1VP7 A;  3HKC B;  1F51 A;  5L3F A;  2LGQ A;  4X8A A;  3JAL B;  4LF6 B;  4EEQ A;  3A0R A;  1OCZ B;  1QLN A;  3RYC A;  3ASO B;  3E22 B;  3JAK A;  4UV8 A;  5B1B C;  2FKX A;  1K92 A;  3HPL C;  4MTG A;  2P7T C;  5JQG B;  1ZAU A;  3H1J H;  4UCS A;  3RYF A;  3TGU H;  2ODM A;  1JX9 A;  3F5W C;  1XMQ B;  3ZED A;  1E79 G;  2PI5 A;  5J2U B;  4E4E A;  4LF9 B;  1BHB A;  4JYC A;  5H2F Z;  2F95 B;  4PA4 A;  3FB5 C;  4JGS A;  3SJQ C;  1TA8 A;  1XL4 A;  1HNZ O;  1IVS A;  2ETN A;  2GUZ B;  1AR5 A;  2VRZ A;  2Q4P A;  1N36 O;  1K97 A;  3E89 A;  4TT3 G;  3K5L A;  2YIC A;  3DXR A;  3HKB A;  3RW0 A;  1Y76 B;  3TET A;  2QWO B;  1JMK C;  4B3R O;  3QO5 A;  1NZ6 A;  1OCO C;  1XOU A;  1VQ6 V;  3HKC A;  2X6B A;  2YEV A;  1PKX A;  1FXH A;  2DWD C;  2LP7 A;  3B77 A;  3SYO A;  4PDL A;  4XDK A;  1TUB B;  3APQ A;  3CJH B;  2Z3Y A;  4DUZ B;  1KD1 W;  1OCZ C;  1WPB A;  5F2V O;  3R65 A;  2GTA A;  4BW9 A;  4X65 O;  1P7G A;  3L72 H;  4JI1 O;  1Q86 W;  1Q90 D;  3SGI A;  2FYU H;  4N23 A;  1XQ8 A;  3MD0 A;  3OFN G;  2EJR A;  5IWA B;  4GX2 A;  3D3I A;  1URF A;  2F1M A;  2QTO A;  4CH6 A;  3BFR A;  4YHH B;  1B06 A;  3M8A A;  3Q4H A;  2ZXW B;  3OMN B;  1FXK A;  1FXK C;  3L70 H;  4OX9 O;  5LMU O;  2XAG A;  2Q73 A;  4ZHQ B;  1Q6I A;  1K3E A;  4I5S A;  1OV9 A;  2LFR A;  2Q9L A;  4CC5 A;  5A9G A;  1KB9 F;  3OUS A;  4X1Y A;  2EIL B;  3ABM B;  2RJZ A;  2ZE5 A;  1XIL A;  3RYI B;  5KMG A;  4UB8 Z;  5L3E A;  2QE7 G;  1UPG A;  1OHH G;  4PA9 A;  1GN2 A;  4PI0 A;  3N2G A;  3ZMZ A;  4B3M O;  1B04 A;  1MG1 A;  1PM9 A;  4QPJ A;  1I5X A;  4G28 B;  3CX5 F;  1Q3E A;  3GB7 C;  4Q20 A;  4B3R B;  2PYJ A;  4GCZ A;  3RGB A;  4UXN A;  1QBZ A;  1JR9 A;  2ZXW C;  1I94 B;  4ZKI A;  4J7K A;  4XDJ A;  2QM7 A;  4NYK A;  4DR3 O;  1NVP D;  5KA5 A;  1GN4 A;  2A3Q A;  2BSK B;  5KAI Z;  1QR9 A;  1YJW V;  3PN1 A;  2UXN A;  3T1H O;  4J7Z A;  4J10 A;  3J80 N;  3H1L H;  1KKD A;  4QIW F;  2EIM B;  3ZMU A;  5EK0 A;  3SYP A;  1M56 B;  1YSC A;  2EIL C;  2XUM A;  4DR6 O;  3ABM C;  1VQL V;  4X1I A;  4MW3 A;  4DV0 O;  2YI9 A;  4LNU A;  2M6Y A;  4CS3 A;  4F4L A;  4I50 B;  1T5E A;  5KUM A;  2YSU B;  3O9O A;  5CB4 A;  4OX9 B;  5LMU B;  1BHA A;  2UUA B;  2YUA A;  1FXV A;  4MVQ A;  4LFB O;  1ZL8 B;  1SZT A;  1BSM A;  5LOV B;  1VIB A;  4B3S O;  2KB1 A;  5K1P A;  4O2A B;  1S76 D;  3ICX A;  2XTA A;  1XEQ A;  2JVD A;  2HFE C;  1L0L H;  4ZIB A;  3DTU B;  3B09 A;  1BQZ A;  4UCR A;  5IDJ A;  1FS0 G;  4JI7 B;  4KXR A;  5BR8 O;  3CC4 V;  2BSK A;  1I5Y A;  3CCS V;  1JFF B;  1D5N A;  4EB6 A;  4DYL A;  2R9I A;  2Y69 C;  4KL1 A;  2EIM C;  1WB7 A;  1M56 C;  4DUY B;  2HHH O;  2IH3 C;  2CGN A;  4LH7 A;  3B4S A;  4NVP A;  3WB0 A;  5CBH A;  4FZ0 A;  5CA0 A;  2WPD G;  4FLW A;  2QWN B;  1Q43 A;  4DR3 B;  5C8Y A;  2HP8 A;  4TV8 B;  1NH2 B;  1N4C A;  1OZ0 A;  4FLV A;  3ASN B;  4U3F H;  4P30 A;  3DC5 A;  5EBL C;  4LFA O;  4JI6 O;  3BRC A;  2JGD B;  2X0L A;  1NKD A;  2NR5 A;  5ITZ B;  4D7S A;  1SA0 A;  4NB5 A;  2JS3 A;  2EZP A;  5D5Q A;  1IBL B;  1FAF A;  4H0L B;  3CCV V;  5LMN O;  3JD0 A;  2EIJ B;  4FK5 C;  4MTO A;  1BCC H;  2JEX A;  1BT8 A;  4AQY B;  1F4M A;  1B6Q A;  4EKW A;  1DGS A;  4BW5 A;  4D6T H;  3ZHV A;  5IJ9 B;  4GX0 A;  3EFF K;  1AJQ A;  1M5I A;  4I55 B;  3ZHS A;  1R6T A;  2XND G;  5IYB O;  4WCE V;  4LFB B;  4FLU A;  4TOI A;  3JAS B;  4B3S B;  3KZI Z;  4FPP A;  2ZIM A;  1Q6H A;  3S3W A;  2MK3 A;  5H6R A;  4PA6 A;  5FPR A;  2OCC B;  2WLL B;  4U7O A;  4ZBM A;  3AG2 B;  1KUQ A;  2CK3 G;  2JGD A;  4ZI7 B;  2ZDI A;  2ZDI C;  5ITZ A;  1TVK A;  1VF7 A;  3T1Y B;  4UVC A;  1K7D A;  3HKE B;  1AI4 A;  2PF4 E;  2EIJ C;  2FTK A;  1GK9 A;  4H33 A;  1HNX O;  2BTO A;  5LGT A;  2HHH B;  1OJH A;  1ZSP A;  2N04 A;  4O2B B;  3I5D A;  3ETE A;  3PJS K;  4QGP A;  3K5O A;  1PPJ H;  5JJE B;  2VQF B;  3H01 A;  4MVU A;  3N2K B;  2YXL A;  3ZBH A;  1D2D A;  1SQV H;  2IJK A;  1XNQ B;  2HKO A;  1O9G A;  2VWK A;  3B8M A;  3W7T A;  1EM1 A;  2CGO A;  4TUY B;  3SPC A;  2QM8 A;  3CE2 A;  4UCT A;  2RN9 A;  4WFH A;  3AK3 A;  3WU2 Z;  1K5Q A;  2AZ2 A;  3FKS G;  3K79 A;  5LMN B;  3ZJZ A;  2OYQ A;  4B08 A;  1LR1 A;  2YI8 A;  4JAU A;  2WLL A;  2EX3 A;  3SPH A;  3AG2 C;  1SQX H;  4CZZ A;  3FB8 C;  1DK1 A;  5EBM C;  5GON B;  5CN0 A;  3LNM B;  4FM0 A;  4O4I B;  1NJI W;  4QJF B;  3CXH F;  2YIA A;  3H1I H;  1YHQ V;  2JGU A;  1EN5 A;  2ZM6 B;  3IJ4 A;  2DW4 A;  2ADQ B;  3STL C;  5L3G A;  3L74 H;  1QQC A;  1IBM B;  3TK1 A;  4EFE A;  2KQX A;  1PNM A;  3B40 A;  1VQ7 V;  3W7U A;  1V54 C;  4DK0 A;  4CS4 A;  2A79 B;  1XI1 A;  2UU9 B;  2Z0A A;  3N2K A;  4JAS A;  2DWE C;  2Q68 A;  1AI6 A; 
#chains in the Genus database with same CATH homology
 3K0D A;  1OCO B;  2W6I G;  3ZMT A;  3ZIA G;  3ZMV A;  2ZD9 A;  1Q7Y W;  1F51 A;  1PNK A;  5L3F A;  2ATK C;  3ABU A;  1P4R A;  4X8A A;  4JTC B;  4I9W A;  3A0R A;  1OCZ B;  2P6J A;  1QLN A;  3AEI A;  2QKS A;  2X7R B;  4KUM A;  2R9R B;  2ZR3 A;  1VQ8 V;  3ASO B;  4UV8 A;  1W2B U;  1ZWI C;  5B1B C;  2ZR2 A;  3SYQ A;  1K92 A;  4JPR A;  3HPL C;  2WLI B;  3AG3 B;  4MTG A;  2P7T C;  2EIN B;  1K9M W;  1QLE B;  1YTF D;  4OXS A;  5CMU A;  1AJP A;  3QO7 A;  4PEL A;  3ABK B;  1YJ9 V;  2A0L A;  1H8E G;  1KC8 W;  1JX9 A;  3F5W C;  2W6J G;  4JTA B;  1E79 G;  3T4Z A;  3JYC A;  2PI5 A;  3GWO A;  2JEU A;  3ZRW A;  1AI7 A;  3STZ C;  1BHB A;  4JYC A;  3KG2 A;  1M90 W;  4PA4 A;  1R3I C;  3FB5 C;  4JGS A;  3SJQ C;  3OR7 C;  1G4Y B;  1NH2 D;  1XL4 A;  2XOK G;  1VQK V;  3JD1 A;  3EHB B;  1WPX A;  1K97 A;  3E86 A;  3E89 A;  1DLB A;  4TT3 G;  3LSQ A;  1S5H C;  3OUF A;  3RW0 A;  1S0V A;  3TET A;  1VQ4 V;  3QO5 A;  4WFA V;  1OCO C;  4DXW A;  3ABL B;  1VQ6 V;  3MHS C;  1QCE A;  2X6B A;  2YEV A;  1PKX A;  1FXH A;  2DWD C;  2LP7 A;  3B77 A;  3NXS A;  3SYO A;  5L3B A;  5LHH A;  1H38 A;  1V54 B;  4PDL A;  4XDK A;  1H8H G;  3ETD A;  3FYI B;  3AG1 B;  1SET A;  1BL8 A;  1GM8 A;  2Z3Y A;  1KD1 W;  5H9C A;  1OCZ C;  1ENV A;  1EBO A;  1R3J C;  4RUE A;  3R65 A;  1HWY A;  4G27 B;  3SYC A;  4UV9 A;  4MW8 A;  1FFT B;  2IU0 A;  4RO2 A;  5B1A C;  3BEH A;  1Q86 W;  4FIP C;  5CBF A;  3AG3 C;  4N23 A;  3OMI B;  3MD0 A;  1YIJ V;  2WLH A;  3OFN G;  2EJR A;  3JD2 A;  3CC7 V;  4GX2 A;  1EFR G;  3D3I A;  1QVF U;  4RQE A;  3T2M A;  2QTO A;  2DQ3 A;  1CPY A;  5B1B B;  4ASU G;  4PA7 A;  1QVG U;  1AJN A;  2ZXW B;  3CCE V;  1K4D C;  2AHZ A;  2WSS G;  4FMT A;  2EIK B;  1VQ5 V;  2HG5 C;  3OMN B;  1FXK A;  1FXK C;  3IC7 A;  2XAG A;  5LHI A;  1AI5 A;  1H2G A;  3P30 A;  1KP2 A;  3CC2 V;  1G8M A;  2HR3 A;  4UVB A;  3WFV A;  1OCC B;  4MVZ A;  2WLJ A;  1K3E A;  4I5S A;  4DO2 A;  3E8F A;  4MVR A;  3IFX A;  3G71 V;  3ABL C;  2OTL V;  1NR7 A;  2LFR A;  3K08 A;  1UJW B;  1GTO A;  3K0G A;  5CBG A;  3OUS A;  5IY5 B;  5E1A C;  3K06 A;  3AG1 C;  3OGC C;  2EIL B;  2IH1 C;  2ZQM A;  3ABM B;  3G6E V;  3OR6 C;  3LDE A;  5L3C A;  1PD3 A;  1AR1 B;  2A9H A;  1OCR B;  2IJJ A;  5EC1 C;  3OW2 U;  2YEV B;  1SES A;  1DF4 A;  2IW5 A;  4MVO A;  5L3E A;  2QE7 G;  1OHH G;  4LP8 A;  4PA9 A;  3ZMZ A;  3SPG A;  4QE9 A;  1MG1 A;  4QPJ A;  1I5X A;  4G28 B;  3ZRS A;  1V55 B;  3GB7 C;  4Q20 A;  2X6C A;  5B1A B;  1QR8 A;  4GCZ A;  3K03 A;  4UXN A;  1QBZ A;  2XAS A;  3RBZ A;  1R73 A;  4MSW C;  4RQF A;  1S77 D;  2ZXW C;  3K3W A;  2W0F C;  3JD3 A;  4ZKI A;  2EIK C;  2JJ1 G;  4XDJ A;  3W7X A;  5B1N A;  2QM7 A;  2X6A A;  2ITC C;  1NBM G;  3ZN1 A;  2Q6A A;  5KA5 A;  1NVP D;  4WFE A;  3CD6 V;  1R3L C;  1GM9 A;  1OCC C;  1N8R W;  1Y4M A;  1QR9 A;  1LNQ A;  2JIZ G;  1YJW V;  3LSS A;  2Q69 A;  2UXN A;  3P32 A;  1W0J G;  5GW7 A;  3ZN0 A;  1FXK B;  1KKD A;  1K33 A;  4PDM A;  4QIW F;  2EIM B;  3ZMU A;  5IY5 C;  5B3S B;  4J9Z B;  5EK0 A;  1K4C C;  1M56 B;  1YSC A;  2EIL C;  5FL7 G;  3SYP A;  3ABM C;  1VQL V;  1SER A;  4WFG A;  3ASN C;  4MW3 A;  5CA3 A;  2OT5 A;  3G4S V;  4F4L A;  1OCR C;  1JQ0 A;  5KUM A;  2YSU B;  4PDR A;  2K1E A;  3W7S A;  3ZCC A;  2BOC C;  2IU3 A;  2GSM B;  4PDV A;  1BHA A;  1R6K A;  4HYO A;  3UKM A;  1R6N A;  1FXV A;  2OTJ V;  4MVQ A;  4WFF A;  1ARO P;  1RM1 B;  1V55 C;  1SZT A;  4BIU A;  3FB6 C;  2EZO A;  1THZ A;  1VQ9 V;  2KB1 A;  2QA4 V;  1WLE A;  2M7W A;  4GX1 A;  3VBB A;  5C93 A;  1S76 D;  1NR1 A;  4H37 A;  1J95 A;  2HFE C;  4UUJ C;  4XBF A;  3DTU B;  5IDJ A;  4MTX A;  4MS2 A;  1FS0 G;  2PI4 A;  2Z5U A;  1W0K G;  3CC4 V;  1RPR A;  3CYO A;  2DYS C;  3ZRX A;  2ITD C;  1I5Y A;  3CCS V;  5J9P C;  1E1Q G;  2JJ2 G;  2WLM A;  3OM3 B;  3M99 B;  1Q82 W;  1CEZ A;  4X88 A;  3CXC U;  4TSF G;  2R9I A;  2XAQ A;  1GMG A;  2Y69 C;  2EIM C;  5B3S C;  3T4D A;  1GO3 F;  3ETG A;  1M56 C;  2NLJ C;  1K34 A;  1S3J A;  2OCC C;  1PNL A;  1EZJ A;  2XAJ A;  2IJI A;  2IH3 C;  1YJN V;  3CCU V;  5CBH A;  1ROP A;  1GKF A;  4KP4 A;  2WPD G;  3I56 V;  1NQT A;  2B1I A;  2WLN A;  3SYA A;  4XDL A;  4N21 A;  2HLD G;  1NH2 B;  1VQM V;  1OZ0 A;  3FYE B;  2P67 A;  3ASN B;  3RVY A;  2GHY A;  4P30 A;  1RM1 C;  3E2E A;  5EBL C;  3E8G A;  4RAI A;  1M1K W;  1MSW D;  2X0L A;  1NKD A;  3MHH C;  3SPI A;  5IYC O;  3WG7 B;  1K5S A;  1E1R G;  3E8H A;  1R3K C;  3RVZ A;  2EZP A;  1P7B A;  1VQO V;  2HVK C;  4P9O A;  1L1F A;  4X89 A;  4GT1 A;  5HFL A;  2LFS A;  2H94 A;  3CCV V;  4J9Y B;  3JD0 A;  2EIJ B;  4FK5 C;  4MTO A;  4JTD B;  5DN6 G;  2JEX A;  5LHG A;  2Y48 A;  3D36 A;  1F4M A;  3UM7 A;  1KEC A;  1B6Q A;  1BMF G;  1KP3 A;  3CCR V;  5EBW C;  4MT8 A;  2HJF C;  4EKW A;  2V1D A;  4BW5 A;  5KUK A;  4PA3 A;  5LGN A;  1DF5 A;  2EBO A;  4GX0 A;  3EFF K;  1AJQ A;  1JOY A;  2B1G A;  1RPO A;  1ORQ C;  2XND G;  3OEH G;  5IYB O;  4WCE V;  3ML0 A;  1TUE B;  5KA6 A;  3W7W A;  1YIT V;  2DYS B;  3ABT A;  4JYB A;  2P90 A;  2JK5 C;  3TCU A;  2DQ0 A;  3CP1 A;  4UVA A;  1VQN V;  4FPP A;  4WF9 V;  5L3D A;  4R50 A;  3VOU A;  2MK3 A;  4MTF A;  5HFM A;  3FB7 C;  5H6R A;  1MAB G;  2Y69 B;  3AG4 B;  4PA6 A;  1GM7 A;  4P9P A;  1K73 W;  1M9N A;  4R7C A;  4BIZ A;  1VQP V;  3QNE A;  3E35 A;  3CMA V;  5EC2 C;  2IJH A;  1KQS U;  2OCC B;  2WLL B;  4U7O A;  5DM6 V;  1Y66 A;  4ZBM A;  3AG2 B;  4BAY A;  4QE7 A;  2CK3 G;  1K8A W;  2DYR B;  4WFB V;  1M57 B;  2QEX V;  1MOF A;  4CBC A;  2ZDI A;  3WG7 C;  2ZDI C;  2NNU A;  3ZMS A;  1F4N A;  2HVJ C;  4UVC A;  1K7D A;  3JCZ A;  1AI4 A;  4LC1 A;  2JDI G;  3OAA G;  1CP9 A;  2EIJ C;  2FTK A;  1GK9 A;  4H33 A;  2F43 G;  3HB3 B;  4R6Z A;  5LGT A;  4R8C A;  3BY6 A;  3CCQ V;  5LBQ A;  4TWK A;  4L87 A;  3K9A A;  2WLK A;  3F7Y C;  5H6Q A;  3ETE A;  3PJS K;  2WAM A;  1JJ2 U;  3X2Q B;  4HAM A;  1DTO A;  3H01 A;  1JCH A;  4MVU A;  1IXM A;  3OMA B;  4LBE C;  3ASO C;  3LUT B;  3CPW U;  4QNH B;  2IJK A;  2HKO A;  3B8M A;  5B1O A;  3W7T A;  2WLI A;  2UXX A;  4QPK A;  1S72 V;  3SPC A;  2BOB C;  2EIN C;  3LDC A;  2QM8 A;  1COW G;  1QLE C;  3AG4 C;  3CME V;  4G2K A;  3F7V C;  4WFH A;  3T1C A;  3CCL V;  4YXW G;  1K5Q A;  3FKS G;  3SPJ A;  2WWW A;  3K79 A;  3ABK C;  1YTF B;  3ZJZ A;  1Q81 W;  3B8N A;  3JD4 A;  4JAU A;  2WLL A;  3IGA C;  4JF3 A;  5IYD O;  3SPH A;  1XL6 A;  3AG2 C;  4CZZ A;  3FB8 C;  3QO8 A;  2DYR C;  5EBM C;  1NVP B;  4P2Z A;  3LNM B;  5CN0 A;  3E8B A;  1M57 C;  3K04 A;  1PL0 A;  4JAV A;  4RUF A;  1NJI W;  4QJF B;  4HZ3 A;  2V7Q G;  1YHQ V;  3OE7 G;  3CCM V;  1YI2 V;  4Z1M G;  2H8P C;  3CCJ V;  4LCU C;  1JPX A;  2DW4 A;  4FJC C;  4GX5 A;  3STL C;  4MVM A;  5L3G A;  4KFM A;  1SRY A;  3ZRW B;  5LGU A;  2D3O W;  3TK1 A;  2XAF A;  4MVS A;  1PNM A;  3LDD A;  3ZRV A;  3OEE G;  3E83 A;  1VQ7 V;  3W7U A;  4U7N A;  2XAH A;  2B5U A;  3I55 V;  5BZB A;  1V54 C;  2A79 B;  2AHY A;  3X2Q C;  2Q67 A;  1JVM A;  2C2A A;  4E2L A;  1F23 A;  4JAS A;  3DGE A;  2DWE C;  2Q68 A;  1AI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...