1QCEA

Solution nmr structure of ectodomain of siv gp41, restrained regularized mean structure plus 29 simulated annealing structures
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
123
structure length
123
Chain Sequence
b'AQSRTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQTRVTAIEKYLKDQAQLNAWGAAFRQVAHTTVPWPNASLTPKWNNETWQEWERKVDFLEENITALLEEAQIQQEKNMYELQKLNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (GP41)
publication title Measurement of Residual Dipolar Couplings of Macromolecules Aligned in the Nematic Phase of Acolloidal Suspension of Rod-Shaped Viruses
pubmed doi rcsb
molecule tags Viral protein
total genus 45
structure length 123
sequence length 123
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1999-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1qceA00
5HFMA 5KA5A 3B77A 1QR8A 5H9CA 3H01A 3P30A 1QCEA 4FJCC 1ENVA 2MK3A 4FK5C 4JPRA 4E2LA 1DLBA 1I5YA 5KA6A 4G2KA 3WFVA 2P6JA 3B8NA 3CYOA 2EZOA 3MHHC 2M7WA 1Y66A 1JPXA 4JGSA 1QBZA 1JQ0A 1MG1A 2OT5A 1EBOA 4N23A 5HFLA 1DF5A 1DF4A 1I5XA 1K34A 4N21A 2EZPA 1SZTA 1K33A 3GWOA 3CP1A 3K9AA 3B8MA 1Y4MA 5CMUA 1MOFA 2LP7A 1F23A 4FIPC 4JF3A 2EBOA 5CN0A 3M99B 2X7RB 1QR9A 3MHSC
chains in the Genus database with same CATH superfamily
3P3PA 4MTOA 1PV0A 2OTJV 1H2NA 1JJ2U 1Q86W 3FB6C 1WB7A 1KECA 4LF4O 4WFFA 1EN6A 3J81N 4UXNA 1CXZB 4J7ZA 3JALB 4DR7B 1HDJA 3TJTA 3TCUA 1FFXB 2ZXWC 4JI7O 4UVCA 5LP6A 4FFBB 3A2FA 1SZXA 3FD9A 4DV4B 3CEIA 1GK9A 4LFCO 1S5HC 1LNQA 1Q7YW 1K3EA 3K79A 1YITV 4PDVA 4TWKA 3CC2V 2PI4A 1WN7A 1M57B 4NKGB 1ZLZA 1NTKH 2JEUA 5B1BB 4J9YB 5IYBO 2CTPA 2EIMC 2GDSA 5CN0A 1G1XB 1KD1W 1PNLA 2P4VA 5EYPA 3OMAB 2AZ2A 5F2VO 3ZRXA 1SESA 2YEVB 2QKCA 4BW5A 4MVQA 3JATB 4QPJA 3SPCA 1S0VA 2DQ3A 1VQ4V 4AI8A 4CH5A 4L87A 1SQGA 1X59A 1CPYA 4J11A 5KHJA 2ATKC 4PA7A 1AR5A 3RYHB 1VP7A 4DR5B 3HKDA 3QNEA 5FPRA 4DR1B 3ZEDA 4GLXA 3JD1A 1IBKB 3RT3C 3OGCC 1FYJA 4ZI7B 2E74B 2GV9A 3G67A 5GTIZ 1Q81W 1V54B 1O9GA 5KUKA 2EIJB 1W0KG 4UCVA 1R3LC 4U3JA 2X6CA 2OTLV 3STZC 4DV2B 2JGDA 2ZM6O 2ZNJA 5KMGA 2EJ7A 3RGBA 3CCQV 3CRRA 1MMMA 1KKCA 4ZHQB 4R8CA 2V7QG 2UUAB 3CE2A 2YXHA 1SRYA 2QTSA 5LYJB 1M57C 3CHXA 4BIZA 4WF9V 1WNSA 4JI2O 1GAXA 1OCRB 1EZJA 4PDRA 3DXRA 4H0LB 3RYCA 2YIBA 2JVDA 4UVAA 2BTQA 2RNBA 2ZDIC 3K3WA 2BOBC 4DR6O 4J7JA 4X20A 3UT5B 1XHXA 2RDCA 3TGUH 4JI5B 4Z1MG 5ITZA 1XDCA 2AHYA 4K0KB 1AI6A 2HHHB 5FLXN 1TAEA 1U97A 3ZRSA 2Q7HA 1B04A 5KHGA 3CSXA 4LF4B 1RFYA 4YY3B 4RWUA 1K7DA 2GTSA 2IJHA 2H94A 1M1KW 4LF5O 4JI7B 4MVZA 4LF7B 4O2BA 4EB6B 4O4HB 1Z5VA 2QM8A 1WLEA 1MSWD 2EIJC 4LFCB 1BE3H 4UV8A 3G80A 5LMUB 3CCVV 3LNNA 1U96A 1YCIA 2CE4A 3N27A 4B08A 4PDMA 1MZEA 1TVKB 3CCJV 3K9AA 4R6ZA 1Y4MA 1P49A 4JF3A 5LXTA 1AI7A 3KCXA 3ZJZA 2B5UA 1KKDA 2CAZC 2IBZH 3RW0A 1YJWV 2FMLA 2L6LA 1V55B 3CMEV 2BSKB 5EIBD 3ZRVA 5K1XA 4OGQB 2VQEB 4ZKIA 2ZE8A 4I5SA 1SQBH 1VQ5V 4HYOA 1NJIW 2DW4A 4IT5A 5L3FA 5AG2A 4JASA 5E79Z 5LGNA 3B8NA 4J42A 2A3QA 4KXRA 4CH4A 2W0XA 5CA1B 3A8TA 3J7AU 2XOKG 4X9QA 1B06A 4OXSA 4UFZA 2X7RB 3F7YC 4EEQA 5B66Z 1Q6UA 1RSOB 2EIKC 2XHBA 3CCUV 5TISZ 3OEHG 2ZM6B 3SYCA 3RBZA 4YJ3B 1GM9A 5J9PC 4HNAA 4I4TA 3ZBHA 4LWSB 5B1AC 1S77D 3ABMB 4P9OA 3EXAA 3JAMN 4DK1A 1NU1H 5D5QA 1AR4A 2P67A 1Z5WA 1JFFA 1Y74A 1OCCB 1WAZA 4XDKA 2LQTA 1VQ6V 1I94O 1BS3A 4X64O 3OGIB 3ETEA 1RPOA 2ZD9A 2Z3YA 1XQ8A 4N23A 3WU2Z 2IU0A 2NN4A 1IXMA 1PD3A 3M99B 1SQXH 2F4VO 1KBHA 4JTDB 4X1YA 2FL4A 5L3EA 4WFEA 1GKFA 1Q3EA 4X88A 1VMGA 2WLLA 3CRQA 2Y69B 4YHHB 4FM1A 1BGYH 2JGUA 2R9RB 3JARA 3SYOA 2ZDIA 4LF5B 4WFAV 4ZBMA 1SZTA 2F43G 3KKYA 3QVNA 2E3CA 4UUJC 3AK3A 3K0GA 4MTGA 4FIPC 2JS3A 4MW8A 3JYCA 2DQ0A 5KHHA 3A0HZ 2UXNA 4FZ1A 5EYPB 2HEPA 1EFRG 1L0LH 2M7WA 1KYOF 2KG7B 3ETQA 3BEHA 1B6QA 3P3NA 4TV9B 5EBMC 4IIJA 1UPGA 3BRCA 3JD0A 1K92A 3ASNC 1R3KC 3L70H 1KC8W 4QE7A 1IURA 4CH6A 4AQYB 3CCSV 4RO2A 3BVOA 4GKKO 4JYAB 4DO2A 2VWKA 4B3TO 1SQFA 2GHYA 2CTQA 3H1IH 5LGUA 1IXBA 3AG3B 4X66O 2Y0IA 3B4SA 1AJQA 2V4DA 2FKXA 1M56C 4PHZA 3JAWA 4CBCA 2QJ1A 4JGSA 3QF7A 2JGDB 2K9PA 4NTXA 4TUYA 5B1NA 4CZZA 2YIDA 5EK0A 1PKXA 5LHHA 4DR7O 2ZQMA 1GMGA 3ETDA 4FM0A 5EZYB 4FLUA 3ZMUA 4X1IB 2Q69A 4U7OA 3ZMVA 1HNWB 5J2TA 3E2EA 4LCUC 3WB1A 3APOA 3D3QA 1R73A 5C8YB 3L75H 5IJ9A 1JCHA 3OUSA 3H1JH 4UCTA 3FB7C 4KP4A 2XTAA 3DC6A 2P06A 3X2QB 2W6JG 4LF8O 1I94B 4X64B 1M90W 4GZRB 1YIJV 3CRMA 4H37A 1ZSPA 4TT3G 4UVBA 2KQXA 4JI1B 3E8BA 3CD6V 3OW2U 5KHKA 4I55A 5DECA 4DR5O 3P30A 2E5LO 2ZNIA 1ENVA 2WLKA 3BPZA 2UXCB 2M6YA 3MHHC 1IBKO 3N2GA 3ZMZA 1MG1A 2PGGA 1GM8A 3RN4A 5A2QN 2QTOA 4CS2A 3B09A 1XI1A 4GCZA 2LP7A 1PM9A 1FKAO 4TSFG 1Y6XA 4IGGA 1I08A 2PTMA 4DV6O 1KUQA 2DJVA 2ZIOA 3JD3A 1G8MA 2QR4A 1DK1A 2R9AA 1R6NA 2O57A 3RVYA 5L3DA 1JR9A 3CMAV 4JV5O 1HP8A 3UM7A 5FL7G 2E75B 1YJNV 2UUAO 4LF9O 1BHAA 3CXHF 1F23A 3K9SA 4DV1B 3AG4B 3KCYA 4JAAA 5CA0A 4IL6Z 4MVUA 2W0FC 4RUFA 3JAKB 1YTFD 3K0DA 2DYRB 3UO2A 3WG7C 2IH3C 1JQ0A 4UV9A 4B3TB 3F7VC 1QLEC 2B1GA 3K08A 4KL1A 2HVKC 3OM3B 2EULA 2JEXA 1IZ3A 3R66A 4JI5O 4K0KO 1YHQV 5B3SB 1RP3B 1GM7A 1Q6HA 4X8AA 3ZCCA 3H01A 4EFBA 1SETA 2Q9LA 3ABLC 5FNVA 5J2UB 4NR1A 1BSMA 4YY3O 4IHJA 3CRCA 1L0NH 2QM4A 1RM1B 4F6RA 2P7TC 5CBGA 3SJAC 4HNAB 4I4TB 4MTFA 1DTOA 5IJ0B 4LF6O 4LF7O 4CS3A 4JAVA 4CH3A 5JJEB 4MT8A 3ABKB 1Q90D 3MDSA 2GUZA 3MAQA 1BL8A 2PUSA 4DUYO 5LMUO 2JRIA 5BMVB 5IY5C 3K59A 2EZPA 3FAVB 4BIUA 2ARHA 2F66C 5EC1C 4KUMA 3VBBA 1QVFU 1Q82W 4I50A 4ICGA 4LF8B 3BAAA 3ETGA 3OR7C 4LNUA 3J80N 1B3QA 1SS3A 1FFTB 2UXXA 2HLDG 3LSSA 1LUVA 3CC7V 2WAMA 3E22A 1HR0O 2JJ1G 3AG1C 4O4IA 1IX9A 4DRXA 2Q68A 1AR1B 1P84F 2VQEO 1IBMO 4CS4A 2P5OA 1XL4A 5KUMA 5EC2C 4I0XB 4QE9A 2JJ2G 4U7NA 2LW1A 1AILA 5H6RA 2E5LB 1QU7A 2QEXV 4FLXA 2K1EA 4IYHA 2Q8VA 2Q67A 4ASUG 2DYSB 2BE3A 1SA0A 5JJJB 2ODMA 1PP9H 1OZ0A 5KAFZ 3L72H 5L3CA 4IIJB 1JVMA 3B77A 3FB8C 3BCCH 4DV6B 1XMOO 1W59A 2FTKA 2EJRA 1XNQO 3OEEG 4JV5B 4I7ZB 2RJZA 3F5TA 2RN9A 2BCCH 4XDJA 4GX1A 1K33A 3CCEV 4LF9B 1Y76B 2OCHA 1TUBB 4DYLA 1E79G 3RFRA 4O4JA 2AGAA 1N36O 2W6IG 4FLYA 3A0RA 5B1BC 1VQNV 4E4EA 2MK3A 3ABTA 2RMKB 3ZMSA 3SGIA 2VWJA 1Y66A 1JPXA 4K35A 2E76B 4HZ3A 3ZRWA 3C3TA 4Z1VA 1SQVH 4RQFA 5LA6B 1JOYA 1SQQH 4MVRA 3S3XA 3ASOB 3SDLA 1FXKA 2Q0OC 1KQSU 2WLIA 1Q5OA 1DLBA 4I9QA 4TV8A 5BZBA 5IYZA 1AI4A 1AVMA 5DN6G 1K97A 4YHHO 3HKCA 3UO3A 5LOVA 3CJHB 4LR3A 4HAMA 3DGEA 1WA8A 1UJWB 2IJIA 4LF6B 2OIGA 1N33O 1K9MW 3ZHQA 4J80A 4BAYA 4JZGA 3ZX6A 3GVMA 1V54C 2HFEC 3ZS8C 4O2AA 4YJ2A 3JCZA 3K5OA 4DUYB 1BHBA 2UXBO 4K8ZA 5L3GA 2BOCC 1I0HA 5JQGA 1L1FA 4I9WA 4DR2B 4PA4A 2P22C 3LUTB 4QIWF 1P7BA 3LNMB 3DTUB 5IE9A 5LMNB 1OCRC 3SJCC 3CC4V 3FFQA 4NXMB 4AQYO 2WA3A 4B7KA 4YXWG 3AG7A 1HR0B 4GUNA 3LSQA 4JYAO 1H2MA 5HFLA 3RYIB 3OTOO 5KX5B 5JJNB 5EBLC 1IBMB 1AP5A 4RUEA 4JAUA 1EM1A 1NKDA 1QR8A 2CGOA 4DV0O 4GX5A 1VF6C 2UU9O 1KMIZ 2Q73A 1GN4A 3SPIA 1DF4A 2LGQA 3ZHRA 3N2KA 3AK2A 2DWDC 5CB4A 4C7UA 4JI3O 1A32A 4QJFB 1XMOB 4NXNB 4JI8O 3HKEA 1ORQC 1COWG 1J95A 1TUEB 1XNQB 5JVDB 3OD4A 4DV5O 2P6JA 1SC5B 4B3SO 1ZL8A 1HNWO 5CA0B 2CK3G 1VEWA 3MD0A 3LDDA 1EBOA 4ZOLB 1KU9A 1MA1A 4OPAA 4O4LB 1N36B 2WWWA 1VQ8V 4FLZA 4PI0A 3C3SA 3S3WA 3U10A 2DMXA 3JALA 1FFXA 4MTXA 3BA8A 4FFBA 2OT5A 5FNVB 4PA3A 4LH6A 2EINB 1V55C 1H2LA 3JSNA 1ZX3A 2P90A 1Q8IA 5DEDA 4JI1O 5EIBC 2QSAA 2XNDG 4P2ZA 4FK5C 1FPOA 5D5PA 1GN3A 2Q5ZA 4BIOA 5LP6B 1SKVA 3G6EV 2UXCO 4N21A 5BY1A 4X65B 1N33B 2YEVA 3W7WA 3JATA 1FD9A 4UCOA 1OCOB 2IH1C 1W0JG 4RAIA 4J7KA 4FJCC 1KP2A 5LHGA 2WLMA 2F95B 2AHZA 2UXBB 4I50B 1NH2B 1VF7A 2ZR2A 4DW0A 3I56V 4U3FH 2LFSA 3RYHA 3ZIAG 3AG2B 1L8DA 2N04A 4Z2WA 4RQEA 3T1HB 1GN2A 3ABMC 2XUMA 2YSUB 4DV1O 4PDLA 4ZIBA 1E1QG 3QO7A 2LGWA 4ZI7A 3FX7A 4MSWC 2CUGA 4JYCA 3HKDB 3OTOB 2QWOB 1OCCC 2CH7A 2R9IA 3D36C 4WFBV 1XUQA 4R7CA 2DWEC 3CB2A 3M7MX 1ROPA 5IYCO 1QNMA 5IT9N 3OR6C 3STLC 4DV0B 4ZHQA 2OCCB 4UB6Z 3E35A 5LL6Y 1YVWA 4L8JA 1M9NA 2UU9B 4U3JB 1JA8A 2VS0A 1VIBA 3E8HA 3LDEA 3TXSA 3D3IA 4NTWA 3WB2A 2Z0AA 2X0LA 3TXQA 1BT8A 2QWPB 4ABMA 2QE7G 5KMGB 2X6AA 2Y69C 3Q4HA 3K5NA 1NVPB 5IDJA 2L35A 2UXDO 4JI3B 4JI8B 1ZAUA 3LDCA 4DV5B 1F4MA 4B3SB 3E89A 4UB8Z 3IAYA 1K5QA 3DXRB 1N32B 3ZHUA 3RYCB 1XREA 2ZIMA 2BTQB 4UCRA 1EN5A 3JD4A 2OWOA 4GX0A 4X20B 1S72V 1HWYA 5ITZB 2PYJA 4PI2A 4H13B 3T2MA 4XDLA 1JX9A 1YZBA 1WPBA 4MVSA 4W4KA 3NXSA 3CCMV 1FXKB 4EB6A 2EILB 4O4HA 4H33A 4FZ0A 2ZINA 4GX2A 3QTCA 2HR3A 2Q0AA 2QWQB 1IBLO 3IFXA 1XMQB 5IYZB 3T1CA 1OJHA 2Q7GA 3DC5A 1IVSA 4WFGA 1AJPA 1HNXO 3HKCB 3VQWA 3AG3C 1XHZA 4PELA 1V9PA 1TVKA 1M93A 4O2BB 2P4KA 3QO5A 1VQLV 1X4TA 3SYQA 1QHTA 4LBEC 2NR5A 1QQCA 3RYFA 1Q6IA 3W7TA 2BSKA 1S76D 3JD2A 2HG5C 1JJOA 3BHPA 3K04A 4G27B 1F51A 4BR6A 5LXTB 4PJ0Z 4AHCA 1NBMG 1H2KA 2WSSG 2ZXWB 3BA9A 3IGAC 1BCCH 4R50A 1PL0A 3U0ZA 4CC5A 3VQVA 3K5LA 2Y0PA 3CPWU 2QWRB 2WLNA 1NR7A 1M5IA 5CA1A 3EHBB 4LFAO 3G4SV 4TQDA 1THZA 3X2QC 5L3BA 3U11A 2WA4A 1MZFA 2EIMB 2XT9A 1JMKC 4P30A 3JCUZ 1YEWA 4J10A 2ITDC 1NTZH 1E1RG 2QWNB 4FPPA 1R3IC 2BTOA 4PV1B 3HPLC 4LWSA 4LFBB 5KLVH 4EKWA 3K57A 1NS1A 3SR2C 1YI2V 3APQA 1I5YA 4FM2A 1R1BA 1R3JC 4F6EA 4X1KA 4D7SA 1WJZA 1DF5A 2ZT9B 1NT2B 3KZIZ 3W7UA 2YDEA 5CMUA 1US6A 2YUAA 2UXDB 3CS5A 2B9ZA 2YXYA 2HP8A 4X62O 4JI6B 4OX9O 3B2EE 2D2CB 2KKWA 1NZ6A 2PYLA 4JZ2A 4DV7O 3UQ8A 1JFFB 1Y74B 4EFEA 3JSLA 1FXHA 3L73H 1H8HG 2Y48A 2X6BA 4D7TA 4DR2O 1S5JA 4BWAA 3OE7G 4A5UB 3UKMA 2Y4UA 2C2AA 3T4DA 1ZWIC 1D5NA 3AG4C 5LGTA 2AZ0A 5LMNO 4Q20A 4YIOA 3JASA 4NXMO 4X1YB 1UFIA 1IBLB 2DYRC 4NTYA 3RWRD 2WLLB 3P32A 4X89A 5B1OA 1HNXB 4B7EA 3QG5A 4QNHB 4DV3O 3JARB 2IJJA 3NR7A 4G28B 3CWBH 2KG7A 1H38A 1Q43A 4TV9A 2N74A 3HB3B 2XAQA 3GB7C 5B3SC 4JTAB 1YDXA 5A9GA 1WB8A 2MW2B 4LC1A 3RVZA 5GTHZ 2DOSA 1I7FA 1D5AA 1YJ9V 3ZMTA 2IM9A 4NVPA 1VF5B 1RM1C 2ZR3A 4TQFA 4B3MO 2R72A 1BZKA 1P4RA 2XAHA 4NXNO 5LBQA 1K5SA 3ZHSA 3ABKC 4D6TH 1CP9A 2YI8A 3IJ4A 1MNGA 3AEIA 2VQFB 2LFRA 2D3OW 2RCVA 3OMIB 5IYDO 1NQTA 3B8MA 1NI8A 3G71V 2FYUH 2QKSA 3FYEB 1AJNA 2CH7B 1FAFA 5CBHA 3OFNG 1WP8A 2GSMB 4LFAB 2Z5UA 1LR1A 4OPHA 4QGPA 3I55V 4MVMA 5LHIA 4GT1A 1MSDA 2V1DA 5EZYA 4X1IA 1O9HA 2JS5A 3E8FA 3JAWB 3H1KH 1KB9F 1YF2A 1VQMV 3T1YB 2A0LA 5C8YA 4TUYB 4PA9A 3Q4HB 5E1AC 5GONA 3TETA 1SERA 4MW3A 4DR4B 5KA6A 2WLJA 4WBNA 4AILC 4NB5A 1M4UA 5J2TB 2JIZG 1S3JA 4X65O 1YSCA 4X62B 3EFFK 2ADPA 5JH7A 1LUWA 1VQOV 5IJ9B 4OX9B 2DYSC 1S5LZ 1URFA 1N0JA 1QCEA 1D2DA 4YIPA 1AP6A 4DV7B 4H44B 3SJBC 1QBZA 2QA4V 2NLJC 2FB5A 2LO1A 2Q4PA 2EIKB 3ZHVA 4FVMA 3B40A 1VQKV 1MABG 3T1HO 5KAIZ 3OMNB 2A06H 2GTAA 5B1AB 2A9HA 3HKBA 3EVKA 2RQ6A 3CYOA 4I55B 2R70A 3IC7A 1HNZO 1BQ0A 3FKSG 3CP1A 2ITCC 3G6BA 1FJGO 3SPHA 4DV3B 3SPGA 3N2GB 2QKAA 3BFRA 2DN9A 2OYQA 1GTOA 1K4CC 2YIAA 2ZE7A 3VQYA 4JPRA 1K73W 3ASOC 3RYFB 4Q6GA 4G2KA 1K4DC 3WFVA 2HJDA 1XILA 3E83A 3H1HH 2UUBO 3O65A 1I5XA 3W7SA 3GWOA 1R6KA 2Q7EA 2G38A 3JAKA 1K8AW 1VARA 4B3MB 4GKJO 3THOA 1ZTEA 1N8RW 4JI4O 3PN1A 2AXTZ 3SPJA 1R6TA 1CEZA 4FLTA 3BABA 3WB0A 2KB1A 3W7XA 1N32O 3TK1A 5J2UA 4LP8A 4NYKA 1QR9A 4MVOA 3ML0A 2PI5A 2ILMA 5CBFA 2F1MA 2IU3A 2CTWA 2JDIG 3K5MA 4E2LA 4J9ZB 1NTMH 2ADQB 5JCOC 5IJ0A 5C93A 5GW7A 2ZKOA 3ASNB 1H2SB 1F7YA 2HKOA 4PD4F 4JI2B 4JYBA 2CDYA 5FPOA 4X1KB 1XMQO 1Z2GA 4B3RO 3MHSC 4IHJB 5BMVA 5H9CA 4F6RB 3E8GA 3FAVA 4DR6B 5JWPA 1XOUA 4PA6A 1N0NA 1VQPV 3GWKC 5CA3A 4DUZO 2WLHA 2Y4TA 1K34A 4KFMA 2GUZB 1EZVH 1M56B 4GYCB 1FXVA 3F5WC 4DW1A 5B5EZ 1KP3A 3L9DA 1NH2D 2KSDA 2A7WA 4TOIA 3O9OA 1G6UA 1BQZA 4DR3O 1AROP 4I0XA 3OAAG 4DK0A 4LNUB 3ZN1A 5IWAO 1SF9A 2XAGA 1QVGU 1VQ7V 3JASB 3E22B 2PY5A 2H3OA 4O4IB 1ZUQA 4DRXB 2VRZA 2YICA 1J5EO 1XNRO 3DSQA 2N05A 2CTRA 3K03A 2A79B 5BR8O 4FFKA 2YC0A 4FLVA 3D8CA 2F23A 3K58A 1PPJH 1HNZB 5EBWC 3ICXA 3A0BZ 2LW7A 1Y67A 4LH7A 4F4LA 1NR1A 3UCSC 1FJGB 1FS0G 1WPXA 3R65A 2EBOA 4JTCB 4UCSA 3SJQC 2EINC 1N34O 4JI0O 2EX3A 4LFBO 3H1LH 1SA0B 1Y76A 3T4ZA 1TUBA 5LYJA 2UUBB 2UUCO 2YS8A 1NVPD 2IW5A 1H2GA 5LP6C 2AW9A 2GBOA 2WPDG 4GKJB 3LSUA 3HR0A 2CGNA 4KHPO 5H6QA 1WP7A 1TA8A 4HBNA 3H9VA 3UT5A 4JI4B 3OTFA 3C90A 4JI6O 3M8AA 4O4JB 1TGOA 1OCOC 1SQPH 2YIBD 3SYPA 5LA6A 2HJFC 4K3AA 4K8XA 3VOUA 2B1IA 1VF6A 3K06A 3CCLV 2OIEA 2XAJA 3FB5C 3CCRV 1MOFA 3I5DA 5H2FZ 1H8EG 2H8PC 3ZRWB 3CX5F 3AG2C 3ZN0A 3CJHA 4XBFA 1AI5A 4DV4O 1T5EA 4JYYA 5BXZA 1OHHG 2YXLA 1PNMA 5GONB 4MS2A 2WLIB 2PZSA 4TV8B 2JK5C 4B3RB 4WBNB 4IYIA 4WCEV 1DGSA 4FMTA 1W2BU 5LOVB 3WG7B 1WA8B 1YXBA 1XBLA 1QLEB 4QPKA 3QO8A 2Q6AA 2EZOA 5JH7B 4DUZB 3AK1A 1PL4A 2OCCC 3L71H 1XL6A 2ZCEA 2XASA 4O2AB 1OCZB 4YJ2B 5JCOA 1BMFG 1QLNA 3L74H 2NNUA 1AB3A 2IJKA 3VQXA 2F4VB 3ABLB 5JQGB 2HVJC 1EN4A 3OT7A 1PNKA 3RYIA 4DR1O 5KX5A 3OUFA 1GRJA 4DR3B 4WFHA 1XEQA 1HW7A 4UCUA 5IWAB 1OV9A 2YI9A 3HKBB 3SYAA 2VQFO 2ZE6A 2QDOA 1J5EB 4W4LA 4DXWA 5HFMA 4P9PA 3IC9A 5KA5A 5KHIA 1G4YB 1VQ9V 1XNRB 3E86A 5BR8B 1N4CA 5IY5B 5H5NA 2LJ2A 2F93B 1GN6A 4DV2O 3BY6A 3CRAA 2PF4E 1RSOA 3KG2A 1FXKC 2EILC 1P7GA 5JVDA 2QGNA 4YJ3A 2ZE5A 1N34B 2QM7A 4JI0B 4ZOLA 3PJSK 3T1YO 4GKKB 3AG1B 4O4LA 3N2KB 4BW9A 2UUCB 1F4NA 5CB4B 5K1PA 4DR4O 1IDSA 1GH6A 1RPRA 4CC6A 1YTFB 3HKEB 2DE0X 2ETNA 3ABUA 1GO3F 3FYIB 4X66B 4J41A 1ZL8B 2XAFA 4KHPB 3CXCU 3D36A 1OCZC 3ZHTA 4FLWA 2HHHO 5DM6V
chains in the Genus database with same CATH topology
4MTOA 2OTJV 2A0LA 3ZMUA 1JJ2U 4PA9A 5E1AC 2Q69A 3TETA 1Q86W 4U7OA 3ZMVA 3FB6C 1SERA 4MW3A 5KA6A 3E2EA 4LCUC 4MTXA 2WLJA 1KECA 4WFFA 1R73A 2OT5A 4UXNA 4PA3A 1JCHA 2EINB 1V55C 3TCUA 3OUSA 2ZXWC 2JIZG 1S3JA 1YSCA 3FB7C 4KP4A 4UVCA 2P90A 3EFFK 1VQOV 2DYSC 3X2QB 2W6JG 2XNDG 4P2ZA 1QCEA 4FK5C 1GK9A 1S5HC 1LNQA 1Q7YW 1K3EA 3K79A 3G6EV 1YITV 1M90W 4PDVA 4TWKA 3CC2V 2PI4A 1YIJV 1QBZA 2QA4V 1M57B 2NLJC 4N21A 4H37A 4TT3G 2EIKB 2JEUA 5B1BB 4J9YB 5IYBO 4UVBA 2YEVA 2EIMC 5CN0A 3W7WA 1KD1W 1PNLA 1VQKV 3OMAB 1MABG 3E8BA 3CD6V 1OCOB 3OW2U 2IH1C 1W0JG 3OMNB 4RAIA 5B1AB 3ZRXA 3P30A 2A9HA 1SESA 4FJCC 1ENVA 2YEVB 1KP2A 4BW5A 5LHGA 2WLKA 2WLMA 4MVQA 2AHZA 3CYOA 4QPJA 3SPCA 1NH2B 1S0VA 3MHHC 2ZR2A 2DQ3A 1VQ4V 3IC7A 3ZMZA 3I56V 2LFSA 1MG1A 1GM8A 2QTOA 3FKSG 4L87A 3ZIAG 3CP1A 1CPYA 2ITCC 3AG2B 4GCZA 4RQEA 2LP7A 3SPHA 3ABMC 2ATKC 3SPGA 2YSUB 4PA7A 4TSFG 4PDLA 3QNEA 1E1QG 3QO7A 1GTOA 1K4CC 4JPRA 1K73W 3JD3A 3ASOC 3JD1A 1G8MA 4MSWC 4G2KA 1K4DC 3WFVA 4JYCA 1R6NA 3E83A 3OGCC 3RVYA 5L3DA 1OCCC 3CMAV 2R9IA 3UM7A 1I5XA 4WFBV 4R7CA 5FL7G 3W7SA 2DWEC 3GWOA 1R6KA 1YJNV 1Q81W 1BHAA 1ROPA 1V54B 5KUKA 1F23A 5IYCO 2EIJB 1W0KG 1R3LC 3AG4B 1K8AW 3OR6C 3STLC 2X6CA 2OTLV 3STZC 4MVUA 2OCCB 2W0FC 3E35A 4RUFA 1N8RW 1M9NA 3SPJA 1YTFD 3K0DA 3CCQV 2DYRB 1CEZA 3WG7C 2IH3C 3E8HA 3LDEA 1JQ0A 2KB1A 4R8CA 2V7QG 3D3IA 3F7VC 4UV9A 1QLEC 2B1GA 2X0LA 3K08A 3W7XA 2HVKC 2QE7G 1SRYA 3OM3B 2X6AA 2Y69C 1NVPB 2JEXA 3TK1A 1M57C 5IDJA 4LP8A 4BIZA 4WF9V 1QR9A 4MVOA 1YHQV 5B3SB 1GM7A 1OCRB 3ML0A 2PI5A 1EZJA 4PDRA 5CBFA 2IU3A 2JDIG 4X8AA 3ZCCA 3H01A 3LDCA 1SETA 3ABLC 4J9ZB 4UVAA 4E2LA 1F4MA 3E89A 2ZDIC 3K3WA 1K5QA 2BOBC 5C93A 5GW7A 3ASNB 4Z1MG 1RM1B 2P7TC 2HKOA 5CBGA 2AHYA 1AI6A 3JD4A 4MTFA 4JYBA 1DTOA 4GX0A 3MHSC 1S72V 4JAVA 1HWYA 3ZRSA 5H9CA 4MT8A 3ABKB 3T2MA 4XDLA 1JX9A 3E8GA 4MVSA 1BL8A 4PA6A 3NXSA 1VQPV 3CCMV 1FXKB 2EILB 5CA3A 1K7DA 5IY5C 4H33A 2WLHA 4GX2A 1K34A 2IJHA 2EZPA 2HR3A 2H94A 1M1KW 4KFMA 3IFXA 4BIUA 4MVZA 3T1CA 5EC1C 1M56B 4KUMA 3VBBA 1FXVA 1QVFU 4WFGA 1Q82W 1AJPA 3F5WC 3AG3C 2QM8A 1KP3A 1WLEA 3ETGA 4PELA 3OR7C 2EIJC 1NH2D 1MSWD 1FFTB 4UV8A 2UXXA 2HLDG 3CCVV 3LSSA 3QO5A 3CC7V 1VQLV 2WAMA 1AROP 4PDMA 2JJ1G 3AG1C 3OAAG 3SYQA 3ZN1A 3CCJV 2Q68A 4LBEC 2XAGA 3K9AA 1AR1B 4R6ZA 1Y4MA 1QVGU 1VQ7V 4JF3A 1XL4A 1AI7A 5KUMA 5EC2C 3ZJZA 3W7TA 4QE9A 2B5UA 1KKDA 2JJ2G 4U7NA 1S76D 3JD2A 5H6RA 2HG5C 3K04A 3K03A 4G27B 1F51A 3RW0A 2A79B 2QEXV 1NBMG 1YJWV 1V55B 3CMEV 5EBWC 2K1EA 2WSSG 2ZXWB 3ZRVA 3IGAC 4F4LA 1NR1A 4ZKIA 2Q67A 4I5SA 4ASUG 1FS0G 2DYSB 1PL0A 4R50A 1VQ5V 1WPXA 3R65A 4HYOA 2EBOA 2DW4A 4JTCB 1NJIW 1OZ0A 5L3CA 3SJQC 3CPWU 2EINC 1JVMA 2WLNA 3B77A 3FB8C 5L3FA 1NR7A 3EHBB 4JASA 2FTKA 2EJRA 3T4ZA 3G4SV 5LGNA 3B8NA 1THZA 3X2QC 3OEEG 5L3BA 2EIMB 1NVPD 2IW5A 1H2GA 4XDJA 4GX1A 1K33A 3CCEV 4P30A 1E79G 2XOKG 2ITDC 2WPDG 2W6IG 4OXSA 1E1RG 2X7RB 3F7YC 4FPPA 1R3IC 3A0RA 5H6QA 3HPLC 2EIKC 5B1BC 3CCUV 4EKWA 1VQNV 3OEHG 2MK3A 1YI2V 3ABTA 3SYCA 3RBZA 1I5YA 3ZMSA 1OCOC 1GM9A 5J9PC 1R3JC 3SYPA 1Y66A 1JPXA 2HJFC 5B1AC 1S77D 3ABMB 4HZ3A 4P9OA 3ZRWA 3VOUA 1DF5A 2B1IA 3K06A 3CCLV 3W7UA 2XAJA 3FB5C 3CCRV 5CMUA 1MOFA 4RQFA 1H8EG 1JOYA 4MVRA 2H8PC 3ASOB 3ZRWB 2P67A 1FXKA 3AG2C 1KQSU 2WLIA 1OCCB 3ZN0A 4XDKA 4XBFA 1VQ6V 1AI5A 1DLBA 5BZBA 1OHHG 3ETEA 1AI4A 1RPOA 1PNMA 2ZD9A 5DN6G 1K97A 2Z3YA 4N23A 4MS2A 2WLIB 1FXHA 4HAMA 1H8HG 2Y48A 2X6BA 2IU0A 3DGEA 1UJWB 2JK5C 1IXMA 1PD3A 2IJIA 3M99B 4WCEV 3OE7G 1K9MW 4FMTA 1W2BU 4BAYA 4JTDB 3UKMA 3WG7B 2C2AA 1V54C 2HFEC 5L3EA 4WFEA 1GKFA 1ZWIC 3T4DA 3JCZA 3AG4C 1QLEB 4QPKA 4X88A 1BHBA 3QO8A 5LGTA 2Q6AA 2WLLA 4Q20A 2EZOA 2Y69B 2OCCC 5L3GA 2R9RB 3SYOA 1XL6A 2BOCC 2ZDIA 4WFAV 1L1FA 2XASA 1OCZB 4I9WA 1SZTA 2DYRC 4ZBMA 2F43G 1BMFG 3K0GA 4MTGA 4PA4A 4UUJC 3LUTB 1QLNA 2NNUA 2WLLB 1P7BA 3P32A 2IJKA 4QIWF 4FIPC 4X89A 5B1OA 3ABLB 4MW8A 3JYCA 4QNHB 2IJJA 3LNMB 2DQ0A 4G28B 2HVJC 1H38A 1PNKA 3DTUB 3HB3B 2XAQA 3OUFA 2UXNA 3GB7C 5B3SC 1OCRC 3CC4V 4JTAB 4WFHA 1EFRG 2M7WA 4YXWG 3BEHA 3LSQA 1B6QA 5HFLA 3SYAA 5EBMC 4LC1A 3RVZA 5EBLC 3JD0A 1YJ9V 3ZMTA 1K92A 3ASNC 1R3KC 4RUEA 4JAUA 1KC8W 1NKDA 1RM1C 4DXWA 2ZR3A 4P9PA 5HFMA 5KA5A 4QE7A 1G4YB 1VQ9V 1QR8A 1P4RA 3E86A 2XAHA 5IY5B 3CCSV 4GX5A 4RO2A 5LBQA 3BY6A 1K5SA 4DO2A 3ABKC 1CP9A 3SPIA 3AEIA 1DF4A 2LFRA 2D3OW 3OMIB 2GHYA 3KG2A 5LGUA 5IYDO 3AG3B 1FXKC 1NQTA 3B8MA 2EILC 3G71V 1AJQA 2QKSA 3FYEB 1AJNA 5CBHA 2DWDC 2QM7A 3OFNG 4QJFB 3PJSK 1ORQC 1COWG 1J95A 1M56C 2GSMB 2Z5UA 1TUEB 3AG1B 4CBCA 3I55V 4MVMA 2P6JA 5LHIA 4GT1A 1F4NA 4JGSA 2V1DA 2CK3G 1RPRA 3MD0A 3LDDA 1EBOA 1YTFB 3ABUA 1GO3F 3FYIB 3E8FA 5B1NA 4CZZA 5EK0A 1PKXA 2WWWA 5LHHA 2XAFA 2ZQMA 1GMGA 3CXCU 3D36A 1VQ8V 1OCZC 1VQMV 3ETDA 5DM6V
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HFM A;  5KA5 A;  3B77 A;  1QR8 A;  5H9C A;  3H01 A;  3P30 A;  1QCE A;  4FJC C;  1ENV A;  2MK3 A;  4FK5 C;  4JPR A;  4E2L A;  1DLB A;  1I5Y A;  5KA6 A;  4G2K A;  3WFV A;  2P6J A;  3B8N A;  3CYO A;  2EZO A;  3MHH C;  2M7W A;  1Y66 A;  1JPX A;  4JGS A;  1QBZ A;  1JQ0 A;  1MG1 A;  2OT5 A;  1EBO A;  4N23 A;  5HFL A;  1DF5 A;  1DF4 A;  1I5X A;  1K34 A;  4N21 A;  2EZP A;  1SZT A;  1K33 A;  3GWO A;  3CP1 A;  3K9A A;  3B8M A;  1Y4M A;  5CMU A;  1MOF A;  2LP7 A;  1F23 A;  4FIP C;  4JF3 A;  2EBO A;  5CN0 A;  3M99 B;  2X7R B;  1QR9 A;  3MHS C; 
#chains in the Genus database with same CATH topology
 3P3P A;  4MTO A;  1PV0 A;  2OTJ V;  1H2N A;  1JJ2 U;  1Q86 W;  3FB6 C;  1WB7 A;  1KEC A;  4LF4 O;  4WFF A;  1EN6 A;  3J81 N;  4UXN A;  1CXZ B;  4J7Z A;  3JAL B;  4DR7 B;  1HDJ A;  3TJT A;  3TCU A;  1FFX B;  2ZXW C;  4JI7 O;  4UVC A;  5LP6 A;  4FFB B;  3A2F A;  1SZX A;  3FD9 A;  4DV4 B;  3CEI A;  1GK9 A;  4LFC O;  1S5H C;  1LNQ A;  1Q7Y W;  1K3E A;  3K79 A;  1YIT V;  4PDV A;  4TWK A;  3CC2 V;  2PI4 A;  1WN7 A;  1M57 B;  4NKG B;  1ZLZ A;  1NTK H;  2JEU A;  5B1B B;  4J9Y B;  5IYB O;  2CTP A;  2EIM C;  2GDS A;  5CN0 A;  1G1X B;  1KD1 W;  1PNL A;  2P4V A;  5EYP A;  3OMA B;  2AZ2 A;  5F2V O;  3ZRX A;  1SES A;  2YEV B;  2QKC A;  4BW5 A;  4MVQ A;  3JAT B;  4QPJ A;  3SPC A;  1S0V A;  2DQ3 A;  1VQ4 V;  4AI8 A;  4CH5 A;  4L87 A;  1SQG A;  1X59 A;  1CPY A;  4J11 A;  5KHJ A;  2ATK C;  4PA7 A;  1AR5 A;  3RYH B;  1VP7 A;  4DR5 B;  3HKD A;  3QNE A;  5FPR A;  4DR1 B;  3ZED A;  4GLX A;  3JD1 A;  1IBK B;  3RT3 C;  3OGC C;  1FYJ A;  4ZI7 B;  2E74 B;  2GV9 A;  3G67 A;  5GTI Z;  1Q81 W;  1V54 B;  1O9G A;  5KUK A;  2EIJ B;  1W0K G;  4UCV A;  1R3L C;  4U3J A;  2X6C A;  2OTL V;  3STZ C;  4DV2 B;  2JGD A;  2ZM6 O;  2ZNJ A;  5KMG A;  2EJ7 A;  3RGB A;  3CCQ V;  3CRR A;  1MMM A;  1KKC A;  4ZHQ B;  4R8C A;  2V7Q G;  2UUA B;  3CE2 A;  2YXH A;  1SRY A;  2QTS A;  5LYJ B;  1M57 C;  3CHX A;  4BIZ A;  4WF9 V;  1WNS A;  4JI2 O;  1GAX A;  1OCR B;  1EZJ A;  4PDR A;  3DXR A;  4H0L B;  3RYC A;  2YIB A;  2JVD A;  4UVA A;  2BTQ A;  2RNB A;  2ZDI C;  3K3W A;  2BOB C;  4DR6 O;  4J7J A;  4X20 A;  3UT5 B;  1XHX A;  2RDC A;  3TGU H;  4JI5 B;  4Z1M G;  5ITZ A;  1XDC A;  2AHY A;  4K0K B;  1AI6 A;  2HHH B;  5FLX N;  1TAE A;  1U97 A;  3ZRS A;  2Q7H A;  1B04 A;  5KHG A;  3CSX A;  4LF4 B;  1RFY A;  4YY3 B;  4RWU A;  1K7D A;  2GTS A;  2IJH A;  2H94 A;  1M1K W;  4LF5 O;  4JI7 B;  4MVZ A;  4LF7 B;  4O2B A;  4EB6 B;  4O4H B;  1Z5V A;  2QM8 A;  1WLE A;  1MSW D;  2EIJ C;  4LFC B;  1BE3 H;  4UV8 A;  3G80 A;  5LMU B;  3CCV V;  3LNN A;  1U96 A;  1YCI A;  2CE4 A;  3N27 A;  4B08 A;  4PDM A;  1MZE A;  1TVK B;  3CCJ V;  3K9A A;  4R6Z A;  1Y4M A;  1P49 A;  4JF3 A;  5LXT A;  1AI7 A;  3KCX A;  3ZJZ A;  2B5U A;  1KKD A;  2CAZ C;  2IBZ H;  3RW0 A;  1YJW V;  2FML A;  2L6L A;  1V55 B;  3CME V;  2BSK B;  5EIB D;  3ZRV A;  5K1X A;  4OGQ B;  2VQE B;  4ZKI A;  2ZE8 A;  4I5S A;  1SQB H;  1VQ5 V;  4HYO A;  1NJI W;  2DW4 A;  4IT5 A;  5L3F A;  5AG2 A;  4JAS A;  5E79 Z;  5LGN A;  3B8N A;  4J42 A;  2A3Q A;  4KXR A;  4CH4 A;  2W0X A;  5CA1 B;  3A8T A;  3J7A U;  2XOK G;  4X9Q A;  1B06 A;  4OXS A;  4UFZ A;  2X7R B;  3F7Y C;  4EEQ A;  5B66 Z;  1Q6U A;  1RSO B;  2EIK C;  2XHB A;  3CCU V;  5TIS Z;  3OEH G;  2ZM6 B;  3SYC A;  3RBZ A;  4YJ3 B;  1GM9 A;  5J9P C;  4HNA A;  4I4T A;  3ZBH A;  4LWS B;  5B1A C;  1S77 D;  3ABM B;  4P9O A;  3EXA A;  3JAM N;  4DK1 A;  1NU1 H;  5D5Q A;  1AR4 A;  2P67 A;  1Z5W A;  1JFF A;  1Y74 A;  1OCC B;  1WAZ A;  4XDK A;  2LQT A;  1VQ6 V;  1I94 O;  1BS3 A;  4X64 O;  3OGI B;  3ETE A;  1RPO A;  2ZD9 A;  2Z3Y A;  1XQ8 A;  4N23 A;  3WU2 Z;  2IU0 A;  2NN4 A;  1IXM A;  1PD3 A;  3M99 B;  1SQX H;  2F4V O;  1KBH A;  4JTD B;  4X1Y A;  2FL4 A;  5L3E A;  4WFE A;  1GKF A;  1Q3E A;  4X88 A;  1VMG A;  2WLL A;  3CRQ A;  2Y69 B;  4YHH B;  4FM1 A;  1BGY H;  2JGU A;  2R9R B;  3JAR A;  3SYO A;  2ZDI A;  4LF5 B;  4WFA V;  4ZBM A;  1SZT A;  2F43 G;  3KKY A;  3QVN A;  2E3C A;  4UUJ C;  3AK3 A;  3K0G A;  4MTG A;  4FIP C;  2JS3 A;  4MW8 A;  3JYC A;  2DQ0 A;  5KHH A;  3A0H Z;  2UXN A;  4FZ1 A;  5EYP B;  2HEP A;  1EFR G;  1L0L H;  2M7W A;  1KYO F;  2KG7 B;  3ETQ A;  3BEH A;  1B6Q A;  3P3N A;  4TV9 B;  5EBM C;  4IIJ A;  1UPG A;  3BRC A;  3JD0 A;  1K92 A;  3ASN C;  1R3K C;  3L70 H;  1KC8 W;  4QE7 A;  1IUR A;  4CH6 A;  4AQY B;  3CCS V;  4RO2 A;  3BVO A;  4GKK O;  4JYA B;  4DO2 A;  2VWK A;  4B3T O;  1SQF A;  2GHY A;  2CTQ A;  3H1I H;  5LGU A;  1IXB A;  3AG3 B;  4X66 O;  2Y0I A;  3B4S A;  1AJQ A;  2V4D A;  2FKX A;  1M56 C;  4PHZ A;  3JAW A;  4CBC A;  2QJ1 A;  4JGS A;  3QF7 A;  2JGD B;  2K9P A;  4NTX A;  4TUY A;  5B1N A;  4CZZ A;  2YID A;  5EK0 A;  1PKX A;  5LHH A;  4DR7 O;  2ZQM A;  1GMG A;  3ETD A;  4FM0 A;  5EZY B;  4FLU A;  3ZMU A;  4X1I B;  2Q69 A;  4U7O A;  3ZMV A;  1HNW B;  5J2T A;  3E2E A;  4LCU C;  3WB1 A;  3APO A;  3D3Q A;  1R73 A;  5C8Y B;  3L75 H;  5IJ9 A;  1JCH A;  3OUS A;  3H1J H;  4UCT A;  3FB7 C;  4KP4 A;  2XTA A;  3DC6 A;  2P06 A;  3X2Q B;  2W6J G;  4LF8 O;  1I94 B;  4X64 B;  1M90 W;  4GZR B;  1YIJ V;  3CRM A;  4H37 A;  1ZSP A;  4TT3 G;  4UVB A;  2KQX A;  4JI1 B;  3E8B A;  3CD6 V;  3OW2 U;  5KHK A;  4I55 A;  5DEC A;  4DR5 O;  3P30 A;  2E5L O;  2ZNI A;  1ENV A;  2WLK A;  3BPZ A;  2UXC B;  2M6Y A;  3MHH C;  1IBK O;  3N2G A;  3ZMZ A;  1MG1 A;  2PGG A;  1GM8 A;  3RN4 A;  5A2Q N;  2QTO A;  4CS2 A;  3B09 A;  1XI1 A;  4GCZ A;  2LP7 A;  1PM9 A;  1FKA O;  4TSF G;  1Y6X A;  4IGG A;  1I08 A;  2PTM A;  4DV6 O;  1KUQ A;  2DJV A;  2ZIO A;  3JD3 A;  1G8M A;  2QR4 A;  1DK1 A;  2R9A A;  1R6N A;  2O57 A;  3RVY A;  5L3D A;  1JR9 A;  3CMA V;  4JV5 O;  1HP8 A;  3UM7 A;  5FL7 G;  2E75 B;  1YJN V;  2UUA O;  4LF9 O;  1BHA A;  3CXH F;  1F23 A;  3K9S A;  4DV1 B;  3AG4 B;  3KCY A;  4JAA A;  5CA0 A;  4IL6 Z;  4MVU A;  2W0F C;  4RUF A;  3JAK B;  1YTF D;  3K0D A;  2DYR B;  3UO2 A;  3WG7 C;  2IH3 C;  1JQ0 A;  4UV9 A;  4B3T B;  3F7V C;  1QLE C;  2B1G A;  3K08 A;  4KL1 A;  2HVK C;  3OM3 B;  2EUL A;  2JEX A;  1IZ3 A;  3R66 A;  4JI5 O;  4K0K O;  1YHQ V;  5B3S B;  1RP3 B;  1GM7 A;  1Q6H A;  4X8A A;  3ZCC A;  3H01 A;  4EFB A;  1SET A;  2Q9L A;  3ABL C;  5FNV A;  5J2U B;  4NR1 A;  1BSM A;  4YY3 O;  4IHJ A;  3CRC A;  1L0N H;  2QM4 A;  1RM1 B;  4F6R A;  2P7T C;  5CBG A;  3SJA C;  4HNA B;  4I4T B;  4MTF A;  1DTO A;  5IJ0 B;  4LF6 O;  4LF7 O;  4CS3 A;  4JAV A;  4CH3 A;  5JJE B;  4MT8 A;  3ABK B;  1Q90 D;  3MDS A;  2GUZ A;  3MAQ A;  1BL8 A;  2PUS A;  4DUY O;  5LMU O;  2JRI A;  5BMV B;  5IY5 C;  3K59 A;  2EZP A;  3FAV B;  4BIU A;  2ARH A;  2F66 C;  5EC1 C;  4KUM A;  3VBB A;  1QVF U;  1Q82 W;  4I50 A;  4ICG A;  4LF8 B;  3BAA A;  3ETG A;  3OR7 C;  4LNU A;  3J80 N;  1B3Q A;  1SS3 A;  1FFT B;  2UXX A;  2HLD G;  3LSS A;  1LUV A;  3CC7 V;  2WAM A;  3E22 A;  1HR0 O;  2JJ1 G;  3AG1 C;  4O4I A;  1IX9 A;  4DRX A;  2Q68 A;  1AR1 B;  1P84 F;  2VQE O;  1IBM O;  4CS4 A;  2P5O A;  1XL4 A;  5KUM A;  5EC2 C;  4I0X B;  4QE9 A;  2JJ2 G;  4U7N A;  2LW1 A;  1AIL A;  5H6R A;  2E5L B;  1QU7 A;  2QEX V;  4FLX A;  2K1E A;  4IYH A;  2Q8V A;  2Q67 A;  4ASU G;  2DYS B;  2BE3 A;  1SA0 A;  5JJJ B;  2ODM A;  1PP9 H;  1OZ0 A;  5KAF Z;  3L72 H;  5L3C A;  4IIJ B;  1JVM A;  3B77 A;  3FB8 C;  3BCC H;  4DV6 B;  1XMO O;  1W59 A;  2FTK A;  2EJR A;  1XNQ O;  3OEE G;  4JV5 B;  4I7Z B;  2RJZ A;  3F5T A;  2RN9 A;  2BCC H;  4XDJ A;  4GX1 A;  1K33 A;  3CCE V;  4LF9 B;  1Y76 B;  2OCH A;  1TUB B;  4DYL A;  1E79 G;  3RFR A;  4O4J A;  2AGA A;  1N36 O;  2W6I G;  4FLY A;  3A0R A;  5B1B C;  1VQN V;  4E4E A;  2MK3 A;  3ABT A;  2RMK B;  3ZMS A;  3SGI A;  2VWJ A;  1Y66 A;  1JPX A;  4K35 A;  2E76 B;  4HZ3 A;  3ZRW A;  3C3T A;  4Z1V A;  1SQV H;  4RQF A;  5LA6 B;  1JOY A;  1SQQ H;  4MVR A;  3S3X A;  3ASO B;  3SDL A;  1FXK A;  2Q0O C;  1KQS U;  2WLI A;  1Q5O A;  1DLB A;  4I9Q A;  4TV8 A;  5BZB A;  5IYZ A;  1AI4 A;  1AVM A;  5DN6 G;  1K97 A;  4YHH O;  3HKC A;  3UO3 A;  5LOV A;  3CJH B;  4LR3 A;  4HAM A;  3DGE A;  1WA8 A;  1UJW B;  2IJI A;  4LF6 B;  2OIG A;  1N33 O;  1K9M W;  3ZHQ A;  4J80 A;  4BAY A;  4JZG A;  3ZX6 A;  3GVM A;  1V54 C;  2HFE C;  3ZS8 C;  4O2A A;  4YJ2 A;  3JCZ A;  3K5O A;  4DUY B;  1BHB A;  2UXB O;  4K8Z A;  5L3G A;  2BOC C;  1I0H A;  5JQG A;  1L1F A;  4I9W A;  4DR2 B;  4PA4 A;  2P22 C;  3LUT B;  4QIW F;  1P7B A;  3LNM B;  3DTU B;  5IE9 A;  5LMN B;  1OCR C;  3SJC C;  3CC4 V;  3FFQ A;  4NXM B;  4AQY O;  2WA3 A;  4B7K A;  4YXW G;  3AG7 A;  1HR0 B;  4GUN A;  3LSQ A;  4JYA O;  1H2M A;  5HFL A;  3RYI B;  3OTO O;  5KX5 B;  5JJN B;  5EBL C;  1IBM B;  1AP5 A;  4RUE A;  4JAU A;  1EM1 A;  1NKD A;  1QR8 A;  2CGO A;  4DV0 O;  4GX5 A;  1VF6 C;  2UU9 O;  1KMI Z;  2Q73 A;  1GN4 A;  3SPI A;  1DF4 A;  2LGQ A;  3ZHR A;  3N2K A;  3AK2 A;  2DWD C;  5CB4 A;  4C7U A;  4JI3 O;  1A32 A;  4QJF B;  1XMO B;  4NXN B;  4JI8 O;  3HKE A;  1ORQ C;  1COW G;  1J95 A;  1TUE B;  1XNQ B;  5JVD B;  3OD4 A;  4DV5 O;  2P6J A;  1SC5 B;  4B3S O;  1ZL8 A;  1HNW O;  5CA0 B;  2CK3 G;  1VEW A;  3MD0 A;  3LDD A;  1EBO A;  4ZOL B;  1KU9 A;  1MA1 A;  4OPA A;  4O4L B;  1N36 B;  2WWW A;  1VQ8 V;  4FLZ A;  4PI0 A;  3C3S A;  3S3W A;  3U10 A;  2DMX A;  3JAL A;  1FFX A;  4MTX A;  3BA8 A;  4FFB A;  2OT5 A;  5FNV B;  4PA3 A;  4LH6 A;  2EIN B;  1V55 C;  1H2L A;  3JSN A;  1ZX3 A;  2P90 A;  1Q8I A;  5DED A;  4JI1 O;  5EIB C;  2QSA A;  2XND G;  4P2Z A;  4FK5 C;  1FPO A;  5D5P A;  1GN3 A;  2Q5Z A;  4BIO A;  5LP6 B;  1SKV A;  3G6E V;  2UXC O;  4N21 A;  5BY1 A;  4X65 B;  1N33 B;  2YEV A;  3W7W A;  3JAT A;  1FD9 A;  4UCO A;  1OCO B;  2IH1 C;  1W0J G;  4RAI A;  4J7K A;  4FJC C;  1KP2 A;  5LHG A;  2WLM A;  2F95 B;  2AHZ A;  2UXB B;  4I50 B;  1NH2 B;  1VF7 A;  2ZR2 A;  4DW0 A;  3I56 V;  4U3F H;  2LFS A;  3RYH A;  3ZIA G;  3AG2 B;  1L8D A;  2N04 A;  4Z2W A;  4RQE A;  3T1H B;  1GN2 A;  3ABM C;  2XUM A;  2YSU B;  4DV1 O;  4PDL A;  4ZIB A;  1E1Q G;  3QO7 A;  2LGW A;  4ZI7 A;  3FX7 A;  4MSW C;  2CUG A;  4JYC A;  3HKD B;  3OTO B;  2QWO B;  1OCC C;  2CH7 A;  2R9I A;  3D36 C;  4WFB V;  1XUQ A;  4R7C A;  2DWE C;  3CB2 A;  3M7M X;  1ROP A;  5IYC O;  1QNM A;  5IT9 N;  3OR6 C;  3STL C;  4DV0 B;  4ZHQ A;  2OCC B;  4UB6 Z;  3E35 A;  5LL6 Y;  1YVW A;  4L8J A;  1M9N A;  2UU9 B;  4U3J B;  1JA8 A;  2VS0 A;  1VIB A;  3E8H A;  3LDE A;  3TXS A;  3D3I A;  4NTW A;  3WB2 A;  2Z0A A;  2X0L A;  3TXQ A;  1BT8 A;  2QWP B;  4ABM A;  2QE7 G;  5KMG B;  2X6A A;  2Y69 C;  3Q4H A;  3K5N A;  1NVP B;  5IDJ A;  2L35 A;  2UXD O;  4JI3 B;  4JI8 B;  1ZAU A;  3LDC A;  4DV5 B;  1F4M A;  4B3S B;  3E89 A;  4UB8 Z;  3IAY A;  1K5Q A;  3DXR B;  1N32 B;  3ZHU A;  3RYC B;  1XRE A;  2ZIM A;  2BTQ B;  4UCR A;  1EN5 A;  3JD4 A;  2OWO A;  4GX0 A;  4X20 B;  1S72 V;  1HWY A;  5ITZ B;  2PYJ A;  4PI2 A;  4H13 B;  3T2M A;  4XDL A;  1JX9 A;  1YZB A;  1WPB A;  4MVS A;  4W4K A;  3NXS A;  3CCM V;  1FXK B;  4EB6 A;  2EIL B;  4O4H A;  4H33 A;  4FZ0 A;  2ZIN A;  4GX2 A;  3QTC A;  2HR3 A;  2Q0A A;  2QWQ B;  1IBL O;  3IFX A;  1XMQ B;  5IYZ B;  3T1C A;  1OJH A;  2Q7G A;  3DC5 A;  1IVS A;  4WFG A;  1AJP A;  1HNX O;  3HKC B;  3VQW A;  3AG3 C;  1XHZ A;  4PEL A;  1V9P A;  1TVK A;  1M93 A;  4O2B B;  2P4K A;  3QO5 A;  1VQL V;  1X4T A;  3SYQ A;  1QHT A;  4LBE C;  2NR5 A;  1QQC A;  3RYF A;  1Q6I A;  3W7T A;  2BSK A;  1S76 D;  3JD2 A;  2HG5 C;  1JJO A;  3BHP A;  3K04 A;  4G27 B;  1F51 A;  4BR6 A;  5LXT B;  4PJ0 Z;  4AHC A;  1NBM G;  1H2K A;  2WSS G;  2ZXW B;  3BA9 A;  3IGA C;  1BCC H;  4R50 A;  1PL0 A;  3U0Z A;  4CC5 A;  3VQV A;  3K5L A;  2Y0P A;  3CPW U;  2QWR B;  2WLN A;  1NR7 A;  1M5I A;  5CA1 A;  3EHB B;  4LFA O;  3G4S V;  4TQD A;  1THZ A;  3X2Q C;  5L3B A;  3U11 A;  2WA4 A;  1MZF A;  2EIM B;  2XT9 A;  1JMK C;  4P30 A;  3JCU Z;  1YEW A;  4J10 A;  2ITD C;  1NTZ H;  1E1R G;  2QWN B;  4FPP A;  1R3I C;  2BTO A;  4PV1 B;  3HPL C;  4LWS A;  4LFB B;  5KLV H;  4EKW A;  3K57 A;  1NS1 A;  3SR2 C;  1YI2 V;  3APQ A;  1I5Y A;  4FM2 A;  1R1B A;  1R3J C;  4F6E A;  4X1K A;  4D7S A;  1WJZ A;  1DF5 A;  2ZT9 B;  1NT2 B;  3KZI Z;  3W7U A;  2YDE A;  5CMU A;  1US6 A;  2YUA A;  2UXD B;  3CS5 A;  2B9Z A;  2YXY A;  2HP8 A;  4X62 O;  4JI6 B;  4OX9 O;  3B2E E;  2D2C B;  2KKW A;  1NZ6 A;  2PYL A;  4JZ2 A;  4DV7 O;  3UQ8 A;  1JFF B;  1Y74 B;  4EFE A;  3JSL A;  1FXH A;  3L73 H;  1H8H G;  2Y48 A;  2X6B A;  4D7T A;  4DR2 O;  1S5J A;  4BWA A;  3OE7 G;  4A5U B;  3UKM A;  2Y4U A;  2C2A A;  3T4D A;  1ZWI C;  1D5N A;  3AG4 C;  5LGT A;  2AZ0 A;  5LMN O;  4Q20 A;  4YIO A;  3JAS A;  4NXM O;  4X1Y B;  1UFI A;  1IBL B;  2DYR C;  4NTY A;  3RWR D;  2WLL B;  3P32 A;  4X89 A;  5B1O A;  1HNX B;  4B7E A;  3QG5 A;  4QNH B;  4DV3 O;  3JAR B;  2IJJ A;  3NR7 A;  4G28 B;  3CWB H;  2KG7 A;  1H38 A;  1Q43 A;  4TV9 A;  2N74 A;  3HB3 B;  2XAQ A;  3GB7 C;  5B3S C;  4JTA B;  1YDX A;  5A9G A;  1WB8 A;  2MW2 B;  4LC1 A;  3RVZ A;  5GTH Z;  2DOS A;  1I7F A;  1D5A A;  1YJ9 V;  3ZMT A;  2IM9 A;  4NVP A;  1VF5 B;  1RM1 C;  2ZR3 A;  4TQF A;  4B3M O;  2R72 A;  1BZK A;  1P4R A;  2XAH A;  4NXN O;  5LBQ A;  1K5S A;  3ZHS A;  3ABK C;  4D6T H;  1CP9 A;  2YI8 A;  3IJ4 A;  1MNG A;  3AEI A;  2VQF B;  2LFR A;  2D3O W;  2RCV A;  3OMI B;  5IYD O;  1NQT A;  3B8M A;  1NI8 A;  3G71 V;  2FYU H;  2QKS A;  3FYE B;  1AJN A;  2CH7 B;  1FAF A;  5CBH A;  3OFN G;  1WP8 A;  2GSM B;  4LFA B;  2Z5U A;  1LR1 A;  4OPH A;  4QGP A;  3I55 V;  4MVM A;  5LHI A;  4GT1 A;  1MSD A;  2V1D A;  5EZY A;  4X1I A;  1O9H A;  2JS5 A;  3E8F A;  3JAW B;  3H1K H;  1KB9 F;  1YF2 A;  1VQM V;  3T1Y B;  2A0L A;  5C8Y A;  4TUY B;  4PA9 A;  3Q4H B;  5E1A C;  5GON A;  3TET A;  1SER A;  4MW3 A;  4DR4 B;  5KA6 A;  2WLJ A;  4WBN A;  4AIL C;  4NB5 A;  1M4U A;  5J2T B;  2JIZ G;  1S3J A;  4X65 O;  1YSC A;  4X62 B;  3EFF K;  2ADP A;  5JH7 A;  1LUW A;  1VQO V;  5IJ9 B;  4OX9 B;  2DYS C;  1S5L Z;  1URF A;  1N0J A;  1QCE A;  1D2D A;  4YIP A;  1AP6 A;  4DV7 B;  4H44 B;  3SJB C;  1QBZ A;  2QA4 V;  2NLJ C;  2FB5 A;  2LO1 A;  2Q4P A;  2EIK B;  3ZHV A;  4FVM A;  3B40 A;  1VQK V;  1MAB G;  3T1H O;  5KAI Z;  3OMN B;  2A06 H;  2GTA A;  5B1A B;  2A9H A;  3HKB A;  3EVK A;  2RQ6 A;  3CYO A;  4I55 B;  2R70 A;  3IC7 A;  1HNZ O;  1BQ0 A;  3FKS G;  3CP1 A;  2ITC C;  3G6B A;  1FJG O;  3SPH A;  4DV3 B;  3SPG A;  3N2G B;  2QKA A;  3BFR A;  2DN9 A;  2OYQ A;  1GTO A;  1K4C C;  2YIA A;  2ZE7 A;  3VQY A;  4JPR A;  1K73 W;  3ASO C;  3RYF B;  4Q6G A;  4G2K A;  1K4D C;  3WFV A;  2HJD A;  1XIL A;  3E83 A;  3H1H H;  2UUB O;  3O65 A;  1I5X A;  3W7S A;  3GWO A;  1R6K A;  2Q7E A;  2G38 A;  3JAK A;  1K8A W;  1VAR A;  4B3M B;  4GKJ O;  3THO A;  1ZTE A;  1N8R W;  4JI4 O;  3PN1 A;  2AXT Z;  3SPJ A;  1R6T A;  1CEZ A;  4FLT A;  3BAB A;  3WB0 A;  2KB1 A;  3W7X A;  1N32 O;  3TK1 A;  5J2U A;  4LP8 A;  4NYK A;  1QR9 A;  4MVO A;  3ML0 A;  2PI5 A;  2ILM A;  5CBF A;  2F1M A;  2IU3 A;  2CTW A;  2JDI G;  3K5M A;  4E2L A;  4J9Z B;  1NTM H;  2ADQ B;  5JCO C;  5IJ0 A;  5C93 A;  5GW7 A;  2ZKO A;  3ASN B;  1H2S B;  1F7Y A;  2HKO A;  4PD4 F;  4JI2 B;  4JYB A;  2CDY A;  5FPO A;  4X1K B;  1XMQ O;  1Z2G A;  4B3R O;  3MHS C;  4IHJ B;  5BMV A;  5H9C A;  4F6R B;  3E8G A;  3FAV A;  4DR6 B;  5JWP A;  1XOU A;  4PA6 A;  1N0N A;  1VQP V;  3GWK C;  5CA3 A;  4DUZ O;  2WLH A;  2Y4T A;  1K34 A;  4KFM A;  2GUZ B;  1EZV H;  1M56 B;  4GYC B;  1FXV A;  3F5W C;  4DW1 A;  5B5E Z;  1KP3 A;  3L9D A;  1NH2 D;  2KSD A;  2A7W A;  4TOI A;  3O9O A;  1G6U A;  1BQZ A;  4DR3 O;  1ARO P;  4I0X A;  3OAA G;  4DK0 A;  4LNU B;  3ZN1 A;  5IWA O;  1SF9 A;  2XAG A;  1QVG U;  1VQ7 V;  3JAS B;  3E22 B;  2PY5 A;  2H3O A;  4O4I B;  1ZUQ A;  4DRX B;  2VRZ A;  2YIC A;  1J5E O;  1XNR O;  3DSQ A;  2N05 A;  2CTR A;  3K03 A;  2A79 B;  5BR8 O;  4FFK A;  2YC0 A;  4FLV A;  3D8C A;  2F23 A;  3K58 A;  1PPJ H;  1HNZ B;  5EBW C;  3ICX A;  3A0B Z;  2LW7 A;  1Y67 A;  4LH7 A;  4F4L A;  1NR1 A;  3UCS C;  1FJG B;  1FS0 G;  1WPX A;  3R65 A;  2EBO A;  4JTC B;  4UCS A;  3SJQ C;  2EIN C;  1N34 O;  4JI0 O;  2EX3 A;  4LFB O;  3H1L H;  1SA0 B;  1Y76 A;  3T4Z A;  1TUB A;  5LYJ A;  2UUB B;  2UUC O;  2YS8 A;  1NVP D;  2IW5 A;  1H2G A;  5LP6 C;  2AW9 A;  2GBO A;  2WPD G;  4GKJ B;  3LSU A;  3HR0 A;  2CGN A;  4KHP O;  5H6Q A;  1WP7 A;  1TA8 A;  4HBN A;  3H9V A;  3UT5 A;  4JI4 B;  3OTF A;  3C90 A;  4JI6 O;  3M8A A;  4O4J B;  1TGO A;  1OCO C;  1SQP H;  2YIB D;  3SYP A;  5LA6 A;  2HJF C;  4K3A A;  4K8X A;  3VOU A;  2B1I A;  1VF6 A;  3K06 A;  3CCL V;  2OIE A;  2XAJ A;  3FB5 C;  3CCR V;  1MOF A;  3I5D A;  5H2F Z;  1H8E G;  2H8P C;  3ZRW B;  3CX5 F;  3AG2 C;  3ZN0 A;  3CJH A;  4XBF A;  1AI5 A;  4DV4 O;  1T5E A;  4JYY A;  5BXZ A;  1OHH G;  2YXL A;  1PNM A;  5GON B;  4MS2 A;  2WLI B;  2PZS A;  4TV8 B;  2JK5 C;  4B3R B;  4WBN B;  4IYI A;  4WCE V;  1DGS A;  4FMT A;  1W2B U;  5LOV B;  3WG7 B;  1WA8 B;  1YXB A;  1XBL A;  1QLE B;  4QPK A;  3QO8 A;  2Q6A A;  2EZO A;  5JH7 B;  4DUZ B;  3AK1 A;  1PL4 A;  2OCC C;  3L71 H;  1XL6 A;  2ZCE A;  2XAS A;  4O2A B;  1OCZ B;  4YJ2 B;  5JCO A;  1BMF G;  1QLN A;  3L74 H;  2NNU A;  1AB3 A;  2IJK A;  3VQX A;  2F4V B;  3ABL B;  5JQG B;  2HVJ C;  1EN4 A;  3OT7 A;  1PNK A;  3RYI A;  4DR1 O;  5KX5 A;  3OUF A;  1GRJ A;  4DR3 B;  4WFH A;  1XEQ A;  1HW7 A;  4UCU A;  5IWA B;  1OV9 A;  2YI9 A;  3HKB B;  3SYA A;  2VQF O;  2ZE6 A;  2QDO A;  1J5E B;  4W4L A;  4DXW A;  5HFM A;  4P9P A;  3IC9 A;  5KA5 A;  5KHI A;  1G4Y B;  1VQ9 V;  1XNR B;  3E86 A;  5BR8 B;  1N4C A;  5IY5 B;  5H5N A;  2LJ2 A;  2F93 B;  1GN6 A;  4DV2 O;  3BY6 A;  3CRA A;  2PF4 E;  1RSO A;  3KG2 A;  1FXK C;  2EIL C;  1P7G A;  5JVD A;  2QGN A;  4YJ3 A;  2ZE5 A;  1N34 B;  2QM7 A;  4JI0 B;  4ZOL A;  3PJS K;  3T1Y O;  4GKK B;  3AG1 B;  4O4L A;  3N2K B;  4BW9 A;  2UUC B;  1F4N A;  5CB4 B;  5K1P A;  4DR4 O;  1IDS A;  1GH6 A;  1RPR A;  4CC6 A;  1YTF B;  3HKE B;  2DE0 X;  2ETN A;  3ABU A;  1GO3 F;  3FYI B;  4X66 B;  4J41 A;  1ZL8 B;  2XAF A;  4KHP B;  3CXC U;  3D36 A;  1OCZ C;  3ZHT A;  4FLW A;  2HHH O;  5DM6 V; 
#chains in the Genus database with same CATH homology
 4MTO A;  2OTJ V;  2A0L A;  3ZMU A;  1JJ2 U;  4PA9 A;  5E1A C;  2Q69 A;  3TET A;  1Q86 W;  4U7O A;  3ZMV A;  3FB6 C;  1SER A;  4MW3 A;  5KA6 A;  3E2E A;  4LCU C;  4MTX A;  2WLJ A;  1KEC A;  4WFF A;  1R73 A;  2OT5 A;  4UXN A;  4PA3 A;  1JCH A;  2EIN B;  1V55 C;  3TCU A;  3OUS A;  2ZXW C;  2JIZ G;  1S3J A;  1YSC A;  3FB7 C;  4KP4 A;  4UVC A;  2P90 A;  3EFF K;  1VQO V;  2DYS C;  3X2Q B;  2W6J G;  2XND G;  4P2Z A;  1QCE A;  4FK5 C;  1GK9 A;  1S5H C;  1LNQ A;  1Q7Y W;  1K3E A;  3K79 A;  3G6E V;  1YIT V;  1M90 W;  4PDV A;  4TWK A;  3CC2 V;  2PI4 A;  1YIJ V;  1QBZ A;  2QA4 V;  1M57 B;  2NLJ C;  4N21 A;  4H37 A;  4TT3 G;  2EIK B;  2JEU A;  5B1B B;  4J9Y B;  5IYB O;  4UVB A;  2YEV A;  2EIM C;  5CN0 A;  3W7W A;  1KD1 W;  1PNL A;  1VQK V;  3OMA B;  1MAB G;  3E8B A;  3CD6 V;  1OCO B;  3OW2 U;  2IH1 C;  1W0J G;  3OMN B;  4RAI A;  5B1A B;  3ZRX A;  3P30 A;  2A9H A;  1SES A;  4FJC C;  1ENV A;  2YEV B;  1KP2 A;  4BW5 A;  5LHG A;  2WLK A;  2WLM A;  4MVQ A;  2AHZ A;  3CYO A;  4QPJ A;  3SPC A;  1NH2 B;  1S0V A;  3MHH C;  2ZR2 A;  2DQ3 A;  1VQ4 V;  3IC7 A;  3ZMZ A;  3I56 V;  2LFS A;  1MG1 A;  1GM8 A;  2QTO A;  3FKS G;  4L87 A;  3ZIA G;  3CP1 A;  1CPY A;  2ITC C;  3AG2 B;  4GCZ A;  4RQE A;  2LP7 A;  3SPH A;  3ABM C;  2ATK C;  3SPG A;  2YSU B;  4PA7 A;  4TSF G;  4PDL A;  3QNE A;  1E1Q G;  3QO7 A;  1GTO A;  1K4C C;  4JPR A;  1K73 W;  3JD3 A;  3ASO C;  3JD1 A;  1G8M A;  4MSW C;  4G2K A;  1K4D C;  3WFV A;  4JYC A;  1R6N A;  3E83 A;  3OGC C;  3RVY A;  5L3D A;  1OCC C;  3CMA V;  2R9I A;  3UM7 A;  1I5X A;  4WFB V;  4R7C A;  5FL7 G;  3W7S A;  2DWE C;  3GWO A;  1R6K A;  1YJN V;  1Q81 W;  1BHA A;  1ROP A;  1V54 B;  5KUK A;  1F23 A;  5IYC O;  2EIJ B;  1W0K G;  1R3L C;  3AG4 B;  1K8A W;  3OR6 C;  3STL C;  2X6C A;  2OTL V;  3STZ C;  4MVU A;  2OCC B;  2W0F C;  3E35 A;  4RUF A;  1N8R W;  1M9N A;  3SPJ A;  1YTF D;  3K0D A;  3CCQ V;  2DYR B;  1CEZ A;  3WG7 C;  2IH3 C;  3E8H A;  3LDE A;  1JQ0 A;  2KB1 A;  4R8C A;  2V7Q G;  3D3I A;  3F7V C;  4UV9 A;  1QLE C;  2B1G A;  2X0L A;  3K08 A;  3W7X A;  2HVK C;  2QE7 G;  1SRY A;  3OM3 B;  2X6A A;  2Y69 C;  1NVP B;  2JEX A;  3TK1 A;  1M57 C;  5IDJ A;  4LP8 A;  4BIZ A;  4WF9 V;  1QR9 A;  4MVO A;  1YHQ V;  5B3S B;  1GM7 A;  1OCR B;  3ML0 A;  2PI5 A;  1EZJ A;  4PDR A;  5CBF A;  2IU3 A;  2JDI G;  4X8A A;  3ZCC A;  3H01 A;  3LDC A;  1SET A;  3ABL C;  4J9Z B;  4UVA A;  4E2L A;  1F4M A;  3E89 A;  2ZDI C;  3K3W A;  1K5Q A;  2BOB C;  5C93 A;  5GW7 A;  3ASN B;  4Z1M G;  1RM1 B;  2P7T C;  2HKO A;  5CBG A;  2AHY A;  1AI6 A;  3JD4 A;  4MTF A;  4JYB A;  1DTO A;  4GX0 A;  3MHS C;  1S72 V;  4JAV A;  1HWY A;  3ZRS A;  5H9C A;  4MT8 A;  3ABK B;  3T2M A;  4XDL A;  1JX9 A;  3E8G A;  4MVS A;  1BL8 A;  4PA6 A;  3NXS A;  1VQP V;  3CCM V;  1FXK B;  2EIL B;  5CA3 A;  1K7D A;  5IY5 C;  4H33 A;  2WLH A;  4GX2 A;  1K34 A;  2IJH A;  2EZP A;  2HR3 A;  2H94 A;  1M1K W;  4KFM A;  3IFX A;  4BIU A;  4MVZ A;  3T1C A;  5EC1 C;  1M56 B;  4KUM A;  3VBB A;  1FXV A;  1QVF U;  4WFG A;  1Q82 W;  1AJP A;  3F5W C;  3AG3 C;  2QM8 A;  1KP3 A;  1WLE A;  3ETG A;  4PEL A;  3OR7 C;  2EIJ C;  1NH2 D;  1MSW D;  1FFT B;  4UV8 A;  2UXX A;  2HLD G;  3CCV V;  3LSS A;  3QO5 A;  3CC7 V;  1VQL V;  2WAM A;  1ARO P;  4PDM A;  2JJ1 G;  3AG1 C;  3OAA G;  3SYQ A;  3ZN1 A;  3CCJ V;  2Q68 A;  4LBE C;  2XAG A;  3K9A A;  1AR1 B;  4R6Z A;  1Y4M A;  1QVG U;  1VQ7 V;  4JF3 A;  1XL4 A;  1AI7 A;  5KUM A;  5EC2 C;  3ZJZ A;  3W7T A;  4QE9 A;  2B5U A;  1KKD A;  2JJ2 G;  4U7N A;  1S76 D;  3JD2 A;  5H6R A;  2HG5 C;  3K04 A;  3K03 A;  4G27 B;  1F51 A;  3RW0 A;  2A79 B;  2QEX V;  1NBM G;  1YJW V;  1V55 B;  3CME V;  5EBW C;  2K1E A;  2WSS G;  2ZXW B;  3ZRV A;  3IGA C;  4F4L A;  1NR1 A;  4ZKI A;  2Q67 A;  4I5S A;  4ASU G;  1FS0 G;  2DYS B;  1PL0 A;  4R50 A;  1VQ5 V;  1WPX A;  3R65 A;  4HYO A;  2EBO A;  2DW4 A;  4JTC B;  1NJI W;  1OZ0 A;  5L3C A;  3SJQ C;  3CPW U;  2EIN C;  1JVM A;  2WLN A;  3B77 A;  3FB8 C;  5L3F A;  1NR7 A;  3EHB B;  4JAS A;  2FTK A;  2EJR A;  3T4Z A;  3G4S V;  5LGN A;  3B8N A;  1THZ A;  3X2Q C;  3OEE G;  5L3B A;  2EIM B;  1NVP D;  2IW5 A;  1H2G A;  4XDJ A;  4GX1 A;  1K33 A;  3CCE V;  4P30 A;  1E79 G;  2XOK G;  2ITD C;  2WPD G;  2W6I G;  4OXS A;  1E1R G;  2X7R B;  3F7Y C;  4FPP A;  1R3I C;  3A0R A;  5H6Q A;  3HPL C;  2EIK C;  5B1B C;  3CCU V;  4EKW A;  1VQN V;  3OEH G;  2MK3 A;  1YI2 V;  3ABT A;  3SYC A;  3RBZ A;  1I5Y A;  3ZMS A;  1OCO C;  1GM9 A;  5J9P C;  1R3J C;  3SYP A;  1Y66 A;  1JPX A;  2HJF C;  5B1A C;  1S77 D;  3ABM B;  4HZ3 A;  4P9O A;  3ZRW A;  3VOU A;  1DF5 A;  2B1I A;  3K06 A;  3CCL V;  3W7U A;  2XAJ A;  3FB5 C;  3CCR V;  5CMU A;  1MOF A;  4RQF A;  1H8E G;  1JOY A;  4MVR A;  2H8P C;  3ASO B;  3ZRW B;  2P67 A;  1FXK A;  3AG2 C;  1KQS U;  2WLI A;  1OCC B;  3ZN0 A;  4XDK A;  4XBF A;  1VQ6 V;  1AI5 A;  1DLB A;  5BZB A;  1OHH G;  3ETE A;  1AI4 A;  1RPO A;  1PNM A;  2ZD9 A;  5DN6 G;  1K97 A;  2Z3Y A;  4N23 A;  4MS2 A;  2WLI B;  1FXH A;  4HAM A;  1H8H G;  2Y48 A;  2X6B A;  2IU0 A;  3DGE A;  1UJW B;  2JK5 C;  1IXM A;  1PD3 A;  2IJI A;  3M99 B;  4WCE V;  3OE7 G;  1K9M W;  4FMT A;  1W2B U;  4BAY A;  4JTD B;  3UKM A;  3WG7 B;  2C2A A;  1V54 C;  2HFE C;  5L3E A;  4WFE A;  1GKF A;  1ZWI C;  3T4D A;  3JCZ A;  3AG4 C;  1QLE B;  4QPK A;  4X88 A;  1BHB A;  3QO8 A;  5LGT A;  2Q6A A;  2WLL A;  4Q20 A;  2EZO A;  2Y69 B;  2OCC C;  5L3G A;  2R9R B;  3SYO A;  1XL6 A;  2BOC C;  2ZDI A;  4WFA V;  1L1F A;  2XAS A;  1OCZ B;  4I9W A;  1SZT A;  2DYR C;  4ZBM A;  2F43 G;  1BMF G;  3K0G A;  4MTG A;  4PA4 A;  4UUJ C;  3LUT B;  1QLN A;  2NNU A;  2WLL B;  1P7B A;  3P32 A;  2IJK A;  4QIW F;  4FIP C;  4X89 A;  5B1O A;  3ABL B;  4MW8 A;  3JYC A;  4QNH B;  2IJJ A;  3LNM B;  2DQ0 A;  4G28 B;  2HVJ C;  1H38 A;  1PNK A;  3DTU B;  3HB3 B;  2XAQ A;  3OUF A;  2UXN A;  3GB7 C;  5B3S C;  1OCR C;  3CC4 V;  4JTA B;  4WFH A;  1EFR G;  2M7W A;  4YXW G;  3BEH A;  3LSQ A;  1B6Q A;  5HFL A;  3SYA A;  5EBM C;  4LC1 A;  3RVZ A;  5EBL C;  3JD0 A;  1YJ9 V;  3ZMT A;  1K92 A;  3ASN C;  1R3K C;  4RUE A;  4JAU A;  1KC8 W;  1NKD A;  1RM1 C;  4DXW A;  2ZR3 A;  4P9P A;  5HFM A;  5KA5 A;  4QE7 A;  1G4Y B;  1VQ9 V;  1QR8 A;  1P4R A;  3E86 A;  2XAH A;  5IY5 B;  3CCS V;  4GX5 A;  4RO2 A;  5LBQ A;  3BY6 A;  1K5S A;  4DO2 A;  3ABK C;  1CP9 A;  3SPI A;  3AEI A;  1DF4 A;  2LFR A;  2D3O W;  3OMI B;  2GHY A;  3KG2 A;  5LGU A;  5IYD O;  3AG3 B;  1FXK C;  1NQT A;  3B8M A;  2EIL C;  3G71 V;  1AJQ A;  2QKS A;  3FYE B;  1AJN A;  5CBH A;  2DWD C;  2QM7 A;  3OFN G;  4QJF B;  3PJS K;  1ORQ C;  1COW G;  1J95 A;  1M56 C;  2GSM B;  2Z5U A;  1TUE B;  3AG1 B;  4CBC A;  3I55 V;  4MVM A;  2P6J A;  5LHI A;  4GT1 A;  1F4N A;  4JGS A;  2V1D A;  2CK3 G;  1RPR A;  3MD0 A;  3LDD A;  1EBO A;  1YTF B;  3ABU A;  1GO3 F;  3FYI B;  3E8F A;  5B1N A;  4CZZ A;  5EK0 A;  1PKX A;  2WWW A;  5LHH A;  2XAF A;  2ZQM A;  1GMG A;  3CXC U;  3D36 A;  1VQ8 V;  1OCZ C;  1VQM V;  3ETD A;  5DM6 V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...