1QCPA

Crystal structure of the rwj-51084 bovine pancreatic beta-trypsin at 1.8 a
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (BETA-TRYPSIN PROTEIN)
publication title Structure of the RWJ-51084-bovine pancreatic beta-trypsin complex at 1.8 A.
pubmed doi rcsb
molecule tags Hydrolase
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qcpA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qcpA02
1BBRH 2G55A 4MPWA 1DDJA 4BXWA 2GZ7A 1TGSZ 5TCAA 3SQHE 2D2DA 4WVPE 1CVWH 1F0RA 1MMJN 5ESBA 1ZJDA 1UTLM 4DY7B 1W3CA 4R0IA 1GG6B 1LHCH 4WH6A 1GBMA 5EODA 1L4ZA 4D9RA 1BA8B 1O2UA 3VB7A 4YT6H 2A2XH 3L33A 3F68H 3SUDA 4NIYA 2QAAA 2R9PA 3LC5A 1WYKA 2ZFTA 3SNCA 2VIWA 3RXCA 4OS7A 1F0TA 4THNH 4ZKOU 5E8EH 2GP9B 3UY9A 2XYAA 4R8TB 4A5TS 4JMYA 3URCA 1EOJA 2ZDAH 2O8UA 2QGRA 4CHAB 5L2ZH 1ANBA 3LPRA 1G3EA 1A3BH 1Q3XA 1QR3E 1YPLH 2CGAA 2XBWA 4NZQA 1O3HA 2A2QH 1C4Y2 1MQ6A 1P9UA 3D23A 2G4UA 3GCTF 3D49H 1EJMA 4OS2A 5AHGH 1GDQA 2Y82A 1OX1A 2CF8H 2HLCA 5JBCS 2GCTB 5A8YA 3C27B 2M5TA 1O31A 1K1MA 1O34A 3RXKA 1C2FA 3LOXA 3RM0H 3UOPA 1V2JT 2VVUA 2BDBA 3ATMA 3E1XB 1UK3A 2ALVA 4K60A 3SORA 2A7JA 1O2RA 1VITF 1T7CA 2H9EH 5GCHF 3ZZCA 1FNIA 2TIOA 3ZV9A 2ZECA 1RTKA 1SGRE 1UO6A 1O2HA 3A84A 3QLPH 1MCVA 3SN8A 1TLDA 1DLEA 1JRTA 2BX3A 3CS7A 4Y8ZA 3MO3A 3MU5A 1PPBH 3U8RH 2ZPRA 2FS8A 5EW1H 2B7DH 1ZGIA 5B6OA 1PYTC 1FIZA 3KQEA 2QN5T 1YC0A 5JBBS 6ESTA 1HJAC 3GDVA 1O5AB 4ABHA 2A4QA 1DWBH 2AERH 2P3FH 4D7FA 1C5UA 2BY9X 1V2UT 2ZHEH 4BAMB 4O97A 1SLUB 4NG9H 4Y76A 2GV6A 2ZDLA 4CBNA 2Q1JA 2EC9H 2HPPH 4VGCB 1TNKA 1LVMA 1O3IA 2P8OC 3KHVA 3O8BA 1GCDA 2A4OA 1UVPA 5CMXH 1ELEE 3MTYA 1AWFH 3U1JB 5HGGA 3BTGE 4YLUA 3ZZDA 1AZZA 1ZPCA 1HUTH 1G2MA 3Q77A 1SG8B 3GDUA 2YNAA 1RTLA 1LQDB 1O32A 1TNGA 1BRUP 1CA8B 1FDPA 3RXGA 1HAHH 2ULLA 3AASA 5GDSH 1O2OA 2ZGXH 4OS6A 4FVDA 1AUJA 2TRMA 4UONA 4DT7B 1NZQH 1O3JA 1IQGA 2BD9A 3E6PH 5PTPA 1AGJA 1GHAF 2FO9A 1LVBA 4ZMAH 3KQCA 1BHXF 1K1PA 1EZXC 3FVFB 4Y7BA 4NSYA 1EX3A 1O5DH 3EA8A 4B74A 1QQUA 1THPB 6GCHF 2RCEA 2BD8A 1GI0A 4GHQA 2QXHA 1CT2E 1J17T 4AN7A 2A5KA 2FM2A 1O30A 2UUYA 2Z3DA 1DFPA 1BRAA 1O2JA 2CMYA 1LQEA 2JETB 2AGGX 1GG6C 1MCTA 1O5EH 1UCYE 3DHKH 4J1YA 3TJOA 2SGFE 4FUBA 1GBEA 3SU1A 1XUJA 3KQBA 2Z6BD 2TBSA 1D3TB 1NRRH 5T6GA 1AU8A 1LPKB 1OSSA 2IOTA 1IQNA 1CGHA 4ABGA 3RXMA 2J94A 3ZVFA 1TGBA 2HPQH 1BDAA 3A8AA 4BAHB 3M36A 7KMEH 2NU3E 5F03A 2GTBA 1UTPA 4I8KA 1SHYA 4CHAC 3CP7A 3SI3H 3S9CA 1QRWA 4MPXA 2AH4X 3RC5A 2BDHA 2C4FH 3EA7A 3M5LA 2V0BA 5C5OA 1S6FA 3RLYH 5ETXA 1ETTH 2Y5GA 1IQFA 1XUGA 3A83A 4UE7H 3MH5A 1GBJA 1O2KA 7LPRA 1E38B 2GCTC 3VFEA 3T5FH 1J9CH 4YOGA 2QV1A 1B0FA 1MTUA 2KAIA 1GBHA 2BXUH 1WAYB 3P17H 1TONA 2JH6D 1W7GH 5FPSA 2W3KA 3V7TA 1EUFA 4I8GA 1RRKA 1HB0B 3LC3A 4ISHH 4X2VA 4ZHMU 1DICA 3SI4H 3SJOA 1XVOA 1EXFA 1BTWA 1Z8JB 1SLXB 5CE1A 2F83A 3BTKE 4U30A 1DE7H 1ZMNA 2TGAA 3F9EA 4X1SU 1O2WA 1HV7A 1C5ZB 3M35A 2OC7A 2R0KA 4X6NA 2BD5A 2UUKB 1EQ9A 3EYDA 1TPOA 4NWKA 3R3GB 1O2VA 3PTBA 4GPGA 4MVNA 1GJ9B 2OP9A 1G3CA 1DY8A 4JYTA 4YO9A 3MHWU 1G2LA 1OP0A 1Q31A 1P12E 5EQSA 1ANEA 1IHTH 3A8DA 4IN1A 3G01A 4VGCC 3TPIZ 1IQKA 1L2EA 3A7VA 2A4RA 3Q76A 3TGIE 1KXCA 3VB5A 1GHVH 2G52A 2XWAA 1MZAA 3P8GA 4SGBE 4X8TH 4I8LA 2XW9A 1CSOE 1F0SA 2VWNA 4UFGH 1VCPA 1OKXA 2FP7B 4U32A 3LGYA 1ELBA 1AD8H 5F6MA 2FOEA 1S6HA 1GMCF 1DVAH 2O8LA 2DUCA 1GHZA 3F1SB 2AFQB 3SGBE 2NU0E 3QGJA 2J92A 2XCNA 4CRFA 3RC6A 5DP5A 4Q7XA 2HVXA 1BTZA 3RU4T 2F9BH 1FMGA 1XX9A 4FVBA 2PHBA 2WUBA 1C5MD 1P2QA 2C8XB 5DG6A 2H6MA 1H9LB 4AGJA 3SUFA 4CH8B 1MUEB 2FOMB 1KYNA 2PWXA 1YCPM 1TQ0B 3AAUA 3MWIU 1GPZA 2Y81A 1QJ1B 3U1IB 2H5DA 1EPTB 4KTUA 3RMOH 1O0DH 1ZHPA 1W0ZU 1EP6A 2JETC 4ISNA 3SU6A 1NRQH 2ZGCA 2ZKSA 1ESTA 1AVXA 3MFJA 3ZZ5A 1A0HB 4K3JA 3T25A 3OSYA 1KIGH 1UHBB 2ZU3A 3AW0A 3PLKA 1GI5A 5C1XA 1OP8A 2ZCKP 3QO6A 3A89A 2AIPA 1VR1H 5LPEA 1FY3A 3BTHE 4CRAA 2HGTH 1FAXA 1IQJA 5GWZA 1QA7A 2VINA 4DCDA 2BLWA 1SLWB 4CH2B 2ALPA 3ATWA 3KNXA 4O9VA 4YOJA 2GDEH 1O5CB 1XXDA 1ETRH 1S82A 3A82A 3AW1A 4FUEA 1HAPH 5TCCA 1Z8IB 1V2LT 3SU4A 3M7UA 4AX9H 1B0EA 3Q00A 3KCGH 4ABEA 3MU8A 4X8UH 1TX6A 5GJ4B 3MYWA 1O37A 1P2JA 4KELA 3SHCH 1QHRB 4ZH8A 2SGAA 1C9TA 1TALA 3T28A 3GCTG 4TWWA 1RIWC 1L0ZA 1MBMA 1GBIA 1PQ7A 1PJPA 1TOCB 2WV5A 1HXFH 2STAE 3QK1A 4CREA 4MNWA 1C2IA 2HOBA 2FPZA 4J2YB 3UQVA 1MZDA 4YT7H 4SGAE 1VJAU 1TAWA 5L6NH 3MNSA 4NSVA 3HATH 2LNCA 1HPGA 1O2TA 4ABBA 4F4OC 2AGIX 1C1TA 3K9XB 4NWLA 2XXLA 1VITG 5GCHG 3EA9A 1WU1A 2XC4A 2ZDVH 1TMUH 2GGVB 4NFFA 2HRVA 1DOJA 1DWCH 2XC5A 3VXFH 3GY6A 1V2MT 5TJXA 2TPIZ 3T62A 1ZMJA 1QB9A 4DGJA 2ZI2H 2FXRA 4E7RG 4OS1A 5GIBA 4Q2KA 4WY3A 4E06H 1HJ8A 1D9IA 1VGCB 3L6PA 2SGPE 1XUFA 1DS2E 3UIRA 3UPEA 3JZ2B 5C1YA 5C1UA 1O2SA 2FX6A 1MKWH 2P3TB 2XNIA 1S0QA 2ZGHA 3T2NA 1HAZB 1QQ4A 5A8ZA 6CHAB 1KXFA 4ZUHA 1QNJA 3TK9A 1AVGH 1MD7A 1W11U 3M5NA 2RG3A 2FX4A 5FCRA 1BTYA 3MU0A 1FV9A 4X8SH 2VH6A 2VWLA 4MQAA 3U98H 3O8DA 2WPHS 4Q7YA 1J16A 1IAUA 1HNEE 2VU8E 1HGTH 1ZJKA 2GKVE 2ZGBH 1G9IE 2THFB 1VCWA 2B0FA 4XE4A 1GDNA 1D3DB 3SUGA 1TNHA 3CS0A 1XVMA 1SQAA 4BTIB 3BTQE 2GD4B 3QX5H 1YKTA 2FYQA 3U9AH 4QT8C 1O2QA 2P93A 2PW8H 1NRNH 1C1OA 5F8XA 2ANWA 1EPTC 3BEUA 2WPIS 1C2HA 3E3TA 4GCHG 2PV9B 3BIUH 2FTMA 4MDSA 3FANA 5BRRE 3GY5A 1O3BA 1RS0A 2FOFA 1BMAA 1GBBA 6GCHG 2PR3A 1D6WA 2BY5X 4Y11E 1D4PB 1L4DA 1MD8A 1TGNA 2C8WB 2ZGJA 3PO1C 5SGAE 4BAQB 4K1SA 4INHA 2G5VA 5A8XA 8ESTE 3KEEA 3PMBB 2ODQA 1UVUH 1ABIH 1O2NA 5IDKA 3BIVH 1ZRKA 2HNTE 3PWBA 1SGTA 1GMDF 2XWBI 2PKSB 1Y3UA 4ZKSU 5L2YH 4GSOA 1SGNE 5FPTA 4A6LA 1GWAA 4A7IB 1ANDA 5C3NA 2BLQA 2FLBH 2KAIB 1C2EA 5K0HA 1OPHB 5EXMA 1AQ7A 1EP5A 1OYQA 3H5CB 3LGIA 1Q2WA 1TBQH 3M5OA 1FLEE 1GJ6A 1O5FH 4I33A 1QFKH 3FP8E 5H4IB 2C8ZB 1UK2A 2FOBA 1AN1E 1KXBA 3QTVH 2Z9JA 1H8IH 1O3MA 3S9BA 4RN6A 1GHWH 4E05H 1GL0E 2A0QB 1W14U 1WCZA 1WSSH 2FOGA 4AYYB 2PSXA 1WV7H 4KP0A 4X1QU 1IQMA 3E90B 5LPFA 1H8DH 3SZNA 4TY7A 3K6YA 1WUNH 2G4TA 1DWEH 1EPTA 2FDAA 4FUHA 1C5SA 2OD3B 3UTUH 1TX8A 1ZRBA 1A4WH 1FUJA 2FI3E 3BTME 2D26C 3D65E 2FZZA 1NFWA 2QXGA 2W3IA 1XUHA 2FTLE 2GT7A 4ABJA 1NFUA 5DJ7A 1CQQA 1J8AA 3RMLH 1S0RA 1P02A 3PLBA 2P3UB 1UHBA 1NN6A 4GAWA 5I25A 1TRMA 5EW2H 1EOLA 4IN2A 3GCNA 3SGAE 1TE0A 4CR9A 3SV9A 2J34A 2BX4A 1VGCC 3DA9B 3SBKA 1W8BH 1EKBB 2GZ8A 4K1TA 3OY5U 4CBOA 1V2WT 1V2VT 1OWDA 2F9NA 1GJAB 1MTVA 2FEQH 5FX5A 1GI9B 2AGEX 1QGFA 2ZCHP 3MNCA 1BMNH 3SOSA 6CHAC 2P94A 1GI6A 2PTNA 5HMAA 3MO6A 2PFEA 3A7XA 4RKOB 1OS8A 3BG4B 1MAXA 4Y7AA 2Y5FA 1H9HE 2VWMA 2P95A 1ZTJA 2O8TA 2G5NA 2O9QA 1W0YH 2ASUB 3SNBA 4AFQA 1AVWA 1C5VA 3P70B 4MLFB 4TPYA 3RXHA 3S0NA 1BIOA 1GMHF 3SJ8A 1PPHE 3GYMA 1GBCA 2BMGB 1SLVB 1GMCG 3P95A 1LHEH 2ZU2A 1G36A 3HGPA 1D6RA 3KF2A 3GY3A 2P16A 3PWCA 1TNLA 2UWOA 1TRYA 3P8FA 1NRPH 4MNXA 2AIQA 3FP6E 2STBE 1A61H 3ZZ8A 1MU6B 3NKKA 1GJ4H 3V12A 3RXEA 1FY4A 4HTCH 2BZAA 1K1LA 1UVOA 5DGJA 1SL3A 1YLCA 1NS3A 1CT4E 3M61U 5G4BA 3FP7E 2V3OH 1TMTH 1DXPA 1N6XA 2BDAA 1AE5A 2ZG0H 1IQIA 4ABFA 1SHHB 1C5XB 4H6TA 1DLKB 4HFPB 2WPMS 4ZKRU 5A0CA 3Q3YA 1BRCE 1ETSH 1P2NA 5AFYH 4OS4A 1XKBC 3SV6A 2SNVA 2A4GA 2EA3A 2HNTF 4GVUA 1DITH 4B2BA 2J2UA 1RJXB 5EQQA 3RM2H 3U69H 1Z6JH 2PKSC 5EG4A 2GX4A 2YOLA 1MTNB 1C5WB 2W7SA 2WPLS 2BVSH 3D62A 1ARBA 4TYDA 1UCYK 1X7AC 1JIRA 1P09A 1SFQB 2PLXA 1BBRE 3TLOA 3V13A 4JK6A 1T4UH 3A8BA 3RXOA 4B71A 2ZWLH 1O36A 4IC6A 5A2MH 3QUMP 2ZCLP 1Z8GA 1SGEE 2QC2A 1IQHA 5FAHA 1P11E 3VB6A 5FBIA 1ELGA 1F5KU 1ZHRA 1QRZA 2W26A 1PPGE 4X0WU 4JK5A 1A46H 5EU8A 3VB3A 1HAVA 1NRSH 5K7RA 3O8RA 1SB1H 4BTUB 4X6OA 1J15A 1YPGH 1DY9A 4D8NA 3NWUA 1TX7A 1B5GH 3SV8A 2ZQ1A 3ESTA 4K5ZA 3RXFA 1PPEE 4U01A 1L1JA 1DANH 3TNTA 3P92A 1LKAA 1HRTH 4AORA 1O33A 2FOAA 4MG3A 4IMZA 4TWYA 1O38A 3A86A 4XBBA 3RMMH 4AFSA 1S83A 2UWLA 4I31A 3DUXH 1FN8A 1MBQA 5EOKA 3OX7U 2CJIA 4UEHH 1S85A 3B8JA 1LHDH 1EZSC 1A0JA 2A32A 2GCHF 3TIUA 1P2OA 2AMPA 3F9FA 3B23B 8KME2 1TPPA 3TH2H 1MU8B 1GJBB 2G00A 4D76A 2QCYA 1OWKA 2OBQA 3TK5A 2BZ6H 3BG4C 2G8TA 1V2NT 1SSXA 2GT8A 3RXTA 2OUAA 2VVVA 5AF9H 1C2MA 2ZF0H 5EGMA 3M3SA 5FCKA 1AUTC 3KN2A 2F9UA 1O3EA 1ZGVA 2NU4E 3ODFA 3KL6A 1K28D 2BDCA 1YLDA 3DD2H 1F5LA 1O3CA 1GHBF 3IG6B 1HAIH 8GCHF 4BAOB 4ESTE 1HIAB 2Z7FE 3ATLA 3ZZ6A 4AOQA 1RD3B 1ELVA 3GY4A 1F2SE 2BOKA 2AYWA 2ZHDA 1AMHA 5EXNA 2ANMH 4DURA 2A31A 1GJCB 3E0NB 7ESTE 2XCFA 4AG1A 2HWLB 5C20A 1LTOA 1P9SA 5GPIB 1IQLA 4YM9A 2AS9A 2JH0D 4X1PU 1W10U 4AB9A 4FU7A 3TH3H 1E37B 4Y0YE 1C1PA 3TGKE 4DIIH 1UVSH 3SJIA 1UTJA 5JBAS 1PQ8A 1A5IA 1C2GA 3HKIB 1TNJA 1ZLRA 2Z94A 4I7YH 4YESB 2SFAA 2EI8A 1JRSA 4FU9A 1QBVH 3GCHB 2XRCA 1O2PA 4X6MA 3TU7H 1MTNC 1C1RA 2BQWB 1LDTT 5L30H 1JBUH 4K8BA 2QXIA 3TITA 5ESTE 4B73A 3RUOA 2SNWA 4WJG2 1KTTB 1P2KA 1MKXK 2GMTB 3ENSB 4M7GA 2F9OA 1GMDG 1CBWB 3RXLA 3ZYEA 3ZVDA 1O2MA 1YPHE 1Y5AT 1AKSB 2J95A 1GCTB 2B5TB 1SGPE 1NROH 3LONA 3PLPA 3STJA 2ZPSA 3UOUA 1YPJH 4H6SB 1LHGH 1YF4A 2SGQE 5FBEA 3TGJE 3ZVEA 2XC0A 4RKJB 1VITH 2ZTXA 1YM0A 5DP7A 3LKWA 1K1IA 2C8YB 1Z8RA 3BG8A 1TABE 1A0LA 1A2CH 2BXTH 1G30B 4B2AA 1SPJA 3PM3A 1TYNA 1TFXA 1GBTA 5A0BA 1CU1A 2ZDMA 5T6DA 3ZZ9A 1WTGH 2CF9H 4DW2U 1B7XB 3W94A 1ELCA 2ZHQH 4JYVH 1ZPZA 1Y3YA 2TGPZ 3FAOA 1FONA 2CXVA 1BTPA 1Y3WA 1BRBE 2AMDA 1KY9A 5EPNA 3TJUA 2BOHB 2RA3A 1N1LA 2EEKA 2QY0B 4ZHAA 1K9OE 2GVFA 2TGDA 1BB0B 4Y79A 3ZZ7A 4WF8A 5JYIA 2W5EA 1NTPA 2ZFRH 3PMJA 4B75A 4NZLA 2BLOA 4X8VH 1OWIA 2PUXB 4Z0KA 2PSYA 3ZVCA 2O8MA 2VH0A 1AI8H 4ZXYH 1V2KT 2VIPA 1DSTA 4Z6AH 1T8OA 3UNQA 5C67A 4X2XA 3M37A 3SGQE 2C3SA 2BDYA 2FI5E 1GHXH 5LH8A 1SR5C 1JOUB 1QCPA 4IW4E 3QTOH 2H2ZA 2ZHFH 1WQVH 1EJAA 2Z9KA 3LGTA 3GICB 3KIDU 3SV7A 1YCPK 1P8VC 2VIOA 1EJNA 1WBGB 2GV7A 4FUCA 2EI7A 1C5TA 3NPSA 3P6ZB 3RMNH 5GXPA 1H9IE 4GHTA 5C5NA 3MNBA 3PMHB 1ZSLA 2DE8A 5JBTA 2PGQB 1XM1A 1D3QB 1EATA 4ABIA 1ESBA 4DG4A 2UUJB 1TPSA 1FN6A 2F9PA 4FUFA 3N7OA 4AGKA 2FS9A 3GCHC 4KTSA 3BTEE 3RXRA 1PQ5A 2BYAX 3TJVA 5LPRA 1CO7E 1C5LH 5DP8A 3BTFE 2J38A 3S7KB 4A1XA 1C5PA 3EQ0H 2SGEE 1PPCE 4KKDA 2I6QA 3LU9B 2BY6X 2GMTC 2K1QA 3V3MA 4CRBA 1C2KA 4IS5A 4AG2A 3MH6A 1C5YB 1YBWA 5DP9A 2QIQA 1CBWC 1UJ1A 4YZUA 4NA9H 3HK3B 1C1UH 3RXPA 3BSQA 4PROA 4WMFA 1HAVB 3T26A 3BEFB 3RXDA 1QIXB 1P10A 1HFDA 1KDQB 4Q80A 1GHAG 1NFYA 1HIAA 3A8CA 1MAYA 3BN9A 1GJDB 5A09A 1ELFA 2D1JA 1EZQA 3GDSA 1WQSA 1DT2A 2TGTA 1NT1A 2UUFB 3M3VA 4MPUA 2G51A 1CHOF 4INLA 3F9HA 4JZEH 2ZDKA 4INKA 1SGCA 3PMAB 3RDZA 4BNRA 1VZQH 4O3UA 2BQ7B 5J4QA 1EB2A 4YTAA 2BY7X 3NUMA 1BJUA 4WXVA 1SBWA 5ABWA 1P04A 1NPMA 1Z71A 1IOEA 1SGYE 1AO5A 3DFLA 1GI3A 2ZFQH 1S81A 1GI1A 4B2CA 1L1NA 2H5CA 2NU2E 2P59A 1VJ9U 2BLVA 4NA8A 1P57B 1ANCA 1HAGE 1V2TT 1ZSJA 3LDXH 4X1NU 5FHTA 1FY1A 2BDGA 2VGCB 3SJKA 3SU5A 3MI4A 1JIMA 1O3FA 3MMGA 4ZXXH 3E16B 3TK6A 1FQ3A 4B1TA 3C1KA 4DIHH 1LHFH 3HPTB 1EAIA 1C1SA 1K1OA 2Y80A 1SI5H 5EPYA 2A5IA 2ZNKH 1V2ST 1TWXB 1W7XH 4ISLA 1TBZH 1NC6A 1JXPA 2J4IA 3GISB 3K65B 4O3TA 1SC8U 1AHTH 1QL8A 3E0PB 1INCA 3RLWH 1F0UA 1KSNA 2GCHG 3BF6H 1U6QA 3ZVAA 5T6FA 1A5GH 3L3TA 3OU0A 1Y59T 5LGOA 5AVDA 1BJVA 1AKSA 1E0FD 1HYLA 2FWWA 4JZFH 4UFEH 2VIVA 3SNEA 1H4WA 2VNTA 1O39A 1QA0A 3PYHA 2HALA 1XXFA 2FESH 1A5HA 1ID5H 4AYVB 3I29A 2ANYA 4TPIZ 3SNAA 1A3EH 1V2PT 2A7CA 1BTXA 3A88A 4FUIA 2R3UA 2RDLA 4X2WA 4NGAH 5C2ZA 1TGCA 2IPHA 1GHBG 1JWTA 2ZU1A 2ZDNA 8GCHG 1SMFE 1D3PB 3UWJH 5JPMH 1IQEA 2Z3EA 1UCYH 3MH7A 1Y8TA 1O2IA 7GCHF 3A7ZA 3B9FH 3BEIB 9ESTA 1EAXA 2Y6TA 1C2LA 3EGKH 5DK1A 2OINA 1BCUH 2JKHA 1LMWB 3BV9B 1ZOMA 3ZZ4A 3P8OA 1C2DA 2PGBB 2ILNA 3KGPA 9LPRA 1V2RT 1GGDB 4XFQA 1LPZB 1V6DA 3VXEH 3S7HB 1Z6EA 2CHAB 4IGDA 2FODA 3ZZBA 1ORFA 2ZIQH 4MNYA 2Y7ZA 2F9VA 5EQRA 1P0SH 1C5RA 1QB1A 3SU0A 1P3EA 4NIVA 3STIA 2V6NA 1C9PA 2JH5D 1W13U 5DP3A 1LPGB 2QF3A 2WUCA 3E8LA 3SJ9A 8LPRA 2AMQA 3ATKA 3LJJA 4GLYA 1ZMLA 1V3XA 1GJ5H 1HBTH 4ZKNU 1TMBH 1IHSH 5DP6A 3GY7A 2FLRH 2VB0A 6LPRA 5T3HA 2A1DB 2PKAB 2QXJA 5E2OA 3U8OH 1O3PB 2A45B 2OXSA 4FU8A 4K1EA 1UTQA 3GY2A 2HNTC 4JYUH 1FJSA 1GBFA 2ZTYA 4JCNA 1P2MA 1KLIH 1BBRK 3A7TA 1O5GH 1O3AA 2R3YA 1T31A 2Z9LA 3OTJE 1AFQB 1GL1A 3NK8A 2Q6GA 1EB1H 4Y10E 1SFIA 2BVXH 3LJOA 1BTUA 2FOHA 4H42U 4KGAA 1UTOA 5HYOA 3RXJA 1SQOA 1V2OT 2VGCC 2Z9GA 3RXAA 1L1GA 3VGCB 4UDWH 1P05A 4WMEA 4LOYH 4Q7ZA 4X1RU 1BT7A 1NO9H 2ZU5A 1A7SA 3SU3A 3A85A 1AB9B 1UTNA 1O3KA 3PTNA 3RXSA 1ELAA 1UTKA 2IN2A 5JB9S 1KXDA 1TGTA 2BM2A 1TOMH 1MH0A 2XBYA 3LGVA 2RA0A 1F5RA 4YOIA 2OQ5A 5AFZH 2AEIH 4WWYA 3GY8A 1OYTH 1EAWA 1HCGA 4GCHF 1TA6A 1C4V2 2ODPA 2D8WA 4YLQH 3NZIA 5FPYA 1GJ7B 3FZDA 5I46H 1ZZZA 1PFXC 3PB1E 3UREA 1ZYOA 2GDDA 3UQOA 3IWMA 2XBXA 3RXUA 4F49A 1KDQA 3RU4D 3T27A 4A1VA 1BUIA 3MU4A 1CT0E 2C90B 3NXPA 1CHGA 1K21H 2VIDA 1QJ6B 5E0JA 2FOCA 2Y7XA 3NCLA 1OWHA 1QURH 3WY8A 1KTSB 3GCOA 2CV3A 1QRXA 4CRGA 1LKBA 3K6ZA 4HZHA 3DT0H 3RXVA 2Y5HA 1PYTD 4O03A 2LPRA 3AAVA 1E36B 3T29A 2C93B 4XBCA 3TNSA 3LH1A 2ZZUH 4ABDA 1PPFE 1TPAE 1YYY1 1GI2A 1MKXH 1QL7A 1O2ZA 1PQAA 2FI4E 1O2XA 4DVAU 1AZ8A 1C1MA 2Q6FA 2B8OH 1P03A 4ISIH 4NIXA 3S69A 3UNRA 5J4SA 1EZUC 1GGDC 2BB4A 4UD9H 1YP9A 1SQTA 3SV2H 2ODYB 3SU2A 2ZU4A 1SGDE 4U2WA 1GVZA 2CHAC 1C5NH 2NU1E 2ZTZA 3LT3A 3QZRA 1ZHMA 1W2KH 4FXGH 5HXFA 3URDA 1N8OB 3FFGA 2R2MB 1O2GH 1THRH 4AB8A 1DWDH 4ISOA 1QTFA 4I8JA 1O3LA 1C5QA 1GBLA 3EAJA 1S84A 4K8YA 3KQDA 1TA2A 4HGCA 1C1QA 2VIQA 1RIWB 1YPKH 3H7OA 2BTCE 2BD7A 2ZA5A 1DPOA 4X2YA 3UR6A 5E2PA 1SOZA 3ZVGA 3SNDA 1HAYB 3MNXA 1P3CA 1SOTA 1ACBE 3F9GA 2ESTE 2ZO3H 1KLJH 3GYLB 3RC4A 4DJZB 5HM9A 2H9TH 4DOQA 4JZDH 1OXGA 3TJNA 2QA9E 1EAUA 3U8TH 1LVYA 4CRDA 1BITA 2OTVA 1AFQC 3MU1A 1KLTA 1T32A 1ZR0A 2G81E 1YPMH 1HJ9A 4FUJA 5F8ZA 3TVJB 2ZQ2A 1BMLA 1CHOG 3MH4A 1NU9A 4K2YA 4BXSA 1T8MA 2XTTB 1SGFA 1FY8E 3Q3KA 3QN7A 3VGCC 1QJ7B 1CA0B 2CN0H 4Y71A 3SHAH 1C1VH 3I77A 5A0AE 3A7WA 1NY22 2Z9IA 2ZP0H 1AB9C 2V3HH 1ZTLA 1C4U2 1M9UA 5CHAB 2FMJA 4BANB 3SO3A 3E91A 1A1RA 3SW2B 2H9HA 2ZFPH 1O3OA 4CRCA 1Z1IA 1AIXH 4Y8XA 2UWPA 4UFDH 3BTDE 1GDUA 4HI3A 3FZZA 1YCPH 3PV4A 1Y3XA 2BY8X 4AFUA 2OC0A 3LGWA 3EDXB 4IMQA 1GI7B 1KXEA 1UTMA 4JZIA 1JMOH 1CGIE 3JZ1B 1RTFB 4E7NA 1G3BA 4H4FA 3LH3A 1QB6A 2OC1A 3HKJB 1J14A 2BVRH 2OC8A 2O8WA 1GHYH 4FUGA 3EE0B 1K2I1 1T8NA 3LIWA 2SGDE 4CR5A 4IC5A 3M7TA 4I32A 4XDEA 1O2LA 1UMAH 2PKAA 1SVPA 1Y5BT 3O8CA 1O3GA 1W12U 1DXWA 1Y3VA 3UWIA 4XOJA 1RFNA 1LO6A 3ZV8A 1YGCH 1LCYA 2VJ1A 1WTHD 4ABAA 1FZZA 1THSH 2WYGA 1SGQE 3PO1B 1XKAC 1DX5M 1OOKB 1DM4B 1OP2A 1YPEH 4I8HA 3UFAA 1P01A 3OY6U 4AFZA 3RXQA 1K1JA 1NESE 4OGYA 2BDIA 2VVCA 1HAOH 1DUAA 4IBLH 1OWEA 3RXBA 3AVZA 4AZ2B 4XBDA 1BZXE 2QYIA 2DE9A 4K69A 4WMDA 5DP4A 3RP2A 2ZHWH 5JB8S 3P8NA 3QZQA 4GUXA 1CE5A 1WOFA 4OS5A 7GCHG 4NFEA 3RXIA 4NA7A 2A7HA 1BOQA 4ZAEA 4UFFH 2Z3CA 2WPKS 5FX6A 2B9LA 2F3CE 1AWHB 1AY6H 1N8OC 3F6UH 1HAXB 1TBRH 3BTTE 4A92A 1E35B 3VEQB 1FIWA 3A7YA 4A1TA 2I6SA 4B76A 1KXAA 1O2YA 1GVKB 3ATIA 3Q3XA 3H7TA 1TNIA 3M7QA 1GMHG 4NIWA 2PTCE 3HK6B 1XUKA 4Y0ZE 4ZROA 3VB4A 4ASHA 1TB6H 4KTCA 4MPVA 2OLGA 3CENA 1Z1JA 1GBDA 1O5BB 5DKMA 1H1BA 3R0FA 3MOCA 4BAKB 3A87A 3SUEA 4LZ4B 1QL9A 4BOHA 4D9QA 1XUIA 3LGUA 5EXLA 4MNVA 1Z7KA 1G3DA 2J9NA 2ZPQA 4LK4A 1F92A 1RGQA 1T8LA 3ZZAA 1CGJE 1HDTH 1P06A 1BMMH 3DFJA 1MQ5A 2BHGA 2IJOB 1QY6A 1ZTKA 2ZC9H 1GJ8B 3M3TA 1ABJH 1Y5UT 1DUEA 3QWCH 4FUDA 1CA0C 1DSUA 2OQUA 4X6PA 1FPHH 1GBAA 2NWNA 2ZFFH 2BD2A 1YPHC 2BQ6B 1UVTH 2WINI 2PUQH 3BTWE 1MTSA 5CHAC 2EI6A 2H1UA 4Y6DA 3A81A 1BQYA 1FAKH 3S9AA 2OBOA 1C2JA 4BTTB 1GCTC 5FXLA 1C5OH 2WYJA 5HM2A 5IYTA 1NM6A 1RXPA 3ODDA 1HXEH 2A5AA 1V2QT 2R0LA 3V0XA 4LZ1H 2FIRH 2ZFSA 1O35A 2XBVA 1QBOA 2BD3A 3GOVB 3PROA 3UR9A 1EASA 1ARCA 1P2IA 1ZSKA 4RSPA 5DPAA 1VCQA 1ELTA 2W7UA 2V35A 1TQ7B 1K1NA 1G37A 3RU4E 3ZZ3A 3MO9A 1OWJA 3I78A 1T4VH 2FYRA 1NU7B 2Q6DA 4ZHLU 2QF0A 4Y8YA 1GBKA 1HJAB 2ZEBA 2YNBA 2WPJS 1FY5A 3ELAH 2GZ9A 3OYPA 4NCYA 1O3NA 3QDZB 4D7GA 2OCVB 2P8OB 3K2UA 1F7ZA 4LXBH 2VWOA 2ANKH 1FPCH 1GI4A 1SGIB 3ZYDA 3QGNB 5E0GA 3UUZA 4OGXA 2WV4A 3HGNA 1MTWA 1K22H 1FXYA 3M5MA 1FI8A 3VPKA 1O3DA 5JDUB 1AFEH 4WH8A 3ZVBA 1UK4A 3IITA 4WXIA 3W95A 5DO4H 1TRNA 1GI8B 1HLTH 1ZPBA 1C1WH 1XMNB 1ESAA 1GVLA 3ITIA 1N6YA 5BPEA 3TH4H 1PPZA 1BHXB 4TY6A 4XSKU 5F8TA 3A80A 4MTBA 1NFXA 5E0HA 1TIOA 2R2WU 1AE8H 1ELDE 1E34B 1BTHH 1G32B 4JZ1A 3UNSA 2BD4A 1MKWK 1C1NA 1S5SA 2F91A 1QBNA 1LVOA 3SQEE 1SGFG
chains in the Genus database with same CATH superfamily
1BBRH 2G55A 4MPWA 1DDJA 4BXWA 2GZ7A 1TGSZ 5TCAA 3SQHE 2D2DA 4WVPE 1CVWH 1F0RA 1MMJN 5ESBA 1ZJDA 1UTLM 4DY7B 1W3CA 4R0IA 1GG6B 1LHCH 4WH6A 1GBMA 5EODA 1L4ZA 4D9RA 1BA8B 1O2UA 3VB7A 4YT6H 2A2XH 3L33A 3F68H 3SUDA 4NIYA 2QAAA 2R9PA 3LC5A 1WYKA 2ZFTA 3SNCA 2VIWA 3RXCA 4OS7A 1F0TA 4THNH 4ZKOU 5E8EH 2GP9B 3UY9A 2XYAA 4R8TB 4A5TS 4JMYA 3URCA 1EOJA 4F48B 2ZDAH 2O8UA 2QGRA 4CHAB 5L2ZH 1ANBA 3LPRA 1G3EA 1A3BH 1Q3XA 1QR3E 1E1RD 1YPLH 2CGAA 2XBWA 3PRDA 4NZQA 1O3HA 2A2QH 1C4Y2 1MQ6A 1P9UA 3D23A 2G4UA 3GCTF 3D49H 1EJMA 3EE7A 4OS2A 5AHGH 1GDQA 2Y82A 1OX1A 5C0TA 2CF8H 2HLCA 5JBCS 4ZCNA 2GCTB 5A8YA 3C27B 2M5TA 1O31A 1K1MA 1O34A 3RXKA 1C2FA 3LOXA 3RM0H 3UOPA 1V2JT 2VVUA 2BDBA 3ATMA 3E1XB 1UK3A 2ALVA 4K60A 4B6EA 3SORA 2A7JA 1O2RA 1VITF 1T7CA 2H9EH 1E1QD 5GCHF 3ZZCA 1FNIA 2TIOA 3ZV9A 2ZECA 2HVYB 1RTKA 1SGRE 1UO6A 1O2HA 3A84A 3QLPH 1MCVA 3SN8A 1TLDA 1DLEA 1JRTA 2BX3A 3CS7A 4Y8ZA 3MO3A 3MU5A 1PPBH 3U8RH 2ZPRA 2FS8A 5EW1H 2B7DH 1ZGIA 5B6OA 1PYTC 1FIZA 3KQEA 2QN5T 1YC0A 5JBBS 6ESTA 1HJAC 3GDVA 1O5AB 4ABHA 2A4QA 1DWBH 2AERH 2P3FH 4D7FA 1C5UA 2BY9X 1V2UT 2ZHEH 4BAMB 4O97A 1SLUB 4NG9H 4Y76A 2GV6A 2ZDLA 4CBNA 2Q1JA 2EC9H 2HPPH 4VGCB 1TNKA 1LVMA 1O3IA 2P8OC 3KHVA 3O8BA 1GCDA 2A4OA 1UVPA 5CMXH 1ELEE 3MTYA 1AWFH 3U1JB 5HGGA 1FX0B 4XRNA 2J5UA 3BTGE 4DT4A 4YLUA 3ZZDA 1AZZA 1ZPCA 1HUTH 1G2MA 3Q77A 1SG8B 4AC9A 3GDUA 2YNAA 1RTLA 1LQDB 1O32A 1TNGA 1BRUP 1CA8B 1FDPA 3RXGA 1HAHH 2ULLA 3AASA 5GDSH 1O2OA 2ZGXH 4OS6A 4FVDA 1AUJA 2TRMA 4Q63A 4UONA 4DT7B 1NZQH 1O3JA 1IQGA 2BD9A 3E6PH 5PTPA 1AGJA 1GHAF 2FO9A 1LVBA 4ZMAH 3KQCA 1BHXF 1K1PA 1EZXC 3FVFB 4Y7BA 3KYFA 2JIZD 4NSYA 1EX3A 1O5DH 3EA8A 4B74A 1QQUA 1THPB 6GCHF 2RCEA 2BD8A 1GI0A 4GHQA 2QXHA 1CT2E 1J17T 4AN7A 2A5KA 2FM2A 2XNDD 3DSPA 1O30A 2UUYA 2Z3DA 1DFPA 1BRAA 1O2JA 2CMYA 1LQEA 2JETB 2AGGX 1GG6C 1MCTA 1O5EH 1UCYE 3DHKH 4J1YA 3TJOA 2SGFE 4FUBA 1GBEA 3SU1A 1XUJA 3KQBA 5CHBA 2Z6BD 3WW7A 2TBSA 1D3TB 1NRRH 5T6GA 1AU8A 1LPKB 1OSSA 2IOTA 1IQNA 1CGHA 4ABGA 3RXMA 2J94A 3ZVFA 1TGBA 2HPQH 1BDAA 3A8AA 4BAHB 3M36A 7KMEH 2NU3E 5F03A 2GTBA 1UTPA 4I8KA 1SHYA 4CHAC 3CP7A 3SI3H 3S9CA 1QRWA 4RI0A 4MPXA 2AH4X 3RC5A 2BDHA 2C4FH 3EA7A 3M5LA 2V0BA 5C5OA 1S6FA 3RLYH 5ETXA 1ETTH 2Y5GA 1IQFA 1XUGA 3A83A 4UE7H 3MH5A 1GBJA 1O2KA 7LPRA 1E38B 2GCTC 3VFEA 3T5FH 1J9CH 4YOGA 2QV1A 1B0FA 1MTUA 2KAIA 1GBHA 2BXUH 1WAYB 3P17H 1TONA 2JH6D 1W7GH 5FPSA 2KCPA 2W3KA 3V7TA 1EUFA 4I8GA 3AK5A 1RRKA 1HB0B 3LC3A 4ISHH 4X2VA 4ZHMU 1DICA 3SI4H 3SJOA 1XVOA 1EXFA 1BTWA 1Z8JB 1SLXB 5CE1A 2F83A 3BTKE 4U30A 1DE7H 1ZMNA 2TGAA 1KMHB 3F9EA 4X1SU 1O2WA 1HV7A 1C5ZB 3M35A 2OC7A 2R0KA 4X6NA 2BD5A 2UUKB 1EQ9A 3EYDA 1TPOA 4NWKA 3R3GB 1O2VA 3PTBA 4GPGA 4MVNA 1GJ9B 3DSGA 1G3CA 2OP9A 1DY8A 4JYTA 4YO9A 3MHWU 1G2LA 1OP0A 1Q31A 1P12E 5EQSA 1ANEA 1IHTH 3A8DA 4IN1A 3G01A 4VGCC 3TPIZ 1IQKA 1L2EA 3A7VA 2A4RA 3Q76A 3TGIE 1KXCA 3VB5A 1GHVH 2G52A 2XWAA 1MZAA 3P8GA 4SGBE 4X8TH 4I8LA 2YMSD 4ACAA 2XW9A 1CSOE 1F0SA 2VWNA 4UFGH 1VCPA 1OKXA 2FP7B 4U32A 3LGYA 1ELBA 1AD8H 5F6MA 2FOEA 1S6HA 1GMCF 1DVAH 2O8LA 2DUCA 1GHZA 2EY4C 3F1SB 2AFQB 3SGBE 2IPQX 2CK3D 2NU0E 3QGJA 2J92A 2XCNA 4CRFA 3RC6A 2PP6A 5DP5A 4Q7XA 2HVXA 1BTZA 5FL7D 3RU4T 2F9BH 1FMGA 1XX9A 4FVBA 2PHBA 2WUBA 1C5MD 1P2QA 2C8XB 5DG6A 2H6MA 1H9LB 4AGJA 3SUFA 4CH8B 1MUEB 2FOMB 1KYNA 2PWXA 1YCPM 1TQ0B 3AAUA 4OM9A 3MWIU 1GPZA 2Y81A 1QJ1B 3U1IB 2H5DA 1EPTB 4KTUA 3RMOH 1O0DH 1ZHPA 1W0ZU 1EP6A 2JETC 2WPDD 4ISNA 3SU6A 1NRQH 3F2FA 1UW7A 2ZGCA 2ZKSA 1ESTA 1AVXA 3MFJA 3ZZ5A 1A0HB 4K3JA 3T25A 3OSYA 1KIGH 1UHBB 2ZU3A 3AW0A 3PLKA 1GI5A 5C1XA 1OP8A 5DSFA 2ZCKP 3QO6A 3A89A 2AIPA 1VR1H 5LPEA 2WHXA 1FY3A 3BTHE 4CRAA 2HGTH 1FAXA 1IQJA 5GWZA 1QA7A 2VINA 4DCDA 2BLWA 1SLWB 4CH2B 2ALPA 3ATWA 3KNXA 4O9VA 4YOJA 2GDEH 1O5CB 1XXDA 2KCAA 1ETRH 3W1EA 1S82A 3A82A 3AW1A 4FUEA 1HAPH 5TCCA 1Z8IB 3SYJA 1S6LA 1V2LT 3SU4A 3M7UA 4AX9H 1B0EA 3Q00A 3KCGH 4ABEA 3MU8A 4X8UH 1TX6A 5GJ4B 3MYWA 1O37A 1P2JA 4KELA 3SHCH 1QHRB 4ZH8A 2SGAA 1C9TA 1TALA 3T28A 3GCTG 4TWWA 1RIWC 2L74A 1L0ZA 1MBMA 1GBIA 1PQ7A 1PJPA 1TOCB 2WV5A 1HXFH 2STAE 3QK1A 4CREA 4MNWA 1C2IA 2HOBA 2FPZA 4J2YB 3UQVA 3F0OA 1MZDA 4YT7H 4SGAE 1VJAU 1TAWA 5L6NH 3MNSA 4NSVA 3HATH 2LNCA 1HPGA 1O2TA 4ABBA 4F4OC 2AGIX 1C1TA 4ASUD 3K9XB 4NWLA 2XXLA 1VITG 5GCHG 3EA9A 1WU1A 2XC4A 2ZDVH 1TMUH 2GGVB 4NFFA 2HRVA 1DOJA 1DWCH 2XC5A 3VXFH 3GY6A 1V2MT 5TJXA 2TPIZ 3T62A 1ZMJA 1QB9A 4DGJA 2ZI2H 2FXRA 4E7RG 4OS1A 5GIBA 4Q2KA 4WY3A 4E06H 1HJ8A 1D9IA 1VGCB 3L6PA 2SGPE 4Z1MD 1XUFA 1DS2E 3UIRA 3UPEA 3JZ2B 5C1YA 5C1UA 1O2SA 2FX6A 1MKWH 2P3TB 2XNIA 1S0QA 2ZGHA 3T2NA 1HAZB 1QQ4A 5A8ZA 6CHAB 1KXFA 4ZUHA 1QNJA 3TK9A 1AVGH 1MD7A 1W11U 3M5NA 2RG3A 2FX4A 5FCRA 1BTYA 3MU0A 2KR7A 1FV9A 4X8SH 2VH6A 2VWLA 4MQAA 3U98H 3O8DA 2WPHS 4Q7YA 1J16A 1IAUA 2QE7D 1HNEE 2VU8E 1HGTH 3N99A 1ZJKA 2GKVE 2ZGBH 1G9IE 2THFB 1VCWA 2B0FA 4XE4A 1GDNA 1D3DB 3SUGA 1TNHA 3CS0A 1XVMA 1SQAA 4BTIB 3BTQE 2GD4B 3QX5H 1YKTA 2FYQA 3U9AH 4QT8C 1O2QA 2P93A 2PW8H 1NRNH 1C1OA 5F8XA 2ANWA 1EPTC 3BEUA 2WPIS 1C2HA 3E3TA 4GCHG 2PV9B 3BIUH 2FTMA 4MDSA 3FANA 5BRRE 3GY5A 1O3BA 1SKYE 1RS0A 2FOFA 1BMAA 1GBBA 6GCHG 2PR3A 1D6WA 2BY5X 4Y11E 1D4PB 1L4DA 1MD8A 1TGNA 2C8WB 2ZGJA 3PO1C 5SGAE 4BAQB 4K1SA 4INHA 2G5VA 5A8XA 8ESTE 3KEEA 3PMBB 2ODQA 1UVUH 1ABIH 1O2NA 5IDKA 3BIVH 1ZRKA 2HNTE 3PWBA 1SGTA 1GMDF 2XWBI 2PKSB 1Y3UA 4ZKSU 5L2YH 4P00A 4GSOA 1SGNE 5FPTA 4A6LA 1GWAA 4A7IB 1ANDA 5C3NA 2BLQA 2FLBH 2KAIB 1C2EA 2EQNA 5K0HA 1OPHB 5EXMA 1AQ7A 1EP5A 1OYQA 3H5CB 3LGIA 1Q2WA 1TBQH 3KQ5A 3M5OA 1FLEE 1GJ6A 1O5FH 4I33A 1QFKH 3FP8E 5H4IB 2C8ZB 1UK2A 2FOBA 1AN1E 1KXBA 3OEHD 3QTVH 2Z9JA 1H8IH 1O3MA 3S9BA 4RN6A 1GHWH 4E05H 1GL0E 2A0QB 1W14U 1WCZA 1WSSH 2FOGA 4AYYB 2PSXA 3OFND 1WV7H 4KP0A 4X1QU 1IQMA 3E90B 5LPFA 1H8DH 3SZNA 4TY7A 3K6YA 1WUNH 2W6JD 2G4TA 1DWEH 2VBCA 1EPTA 2FDAA 4FUHA 1C5SA 2OD3B 3UTUH 1TX8A 1ZRBA 1A4WH 1FUJA 2FI3E 3BTME 2D26C 3D65E 2FZZA 1NFWA 2QXGA 2W3IA 1XUHA 2FTLE 2GT7A 4ABJA 1NFUA 5DJ7A 4TSFD 1CQQA 1J8AA 3RMLH 1S0RA 1P02A 3PLBA 2P3UB 1UHBA 2YMSB 4FETA 1NN6A 4GAWA 5I25A 1TRMA 5EW2H 1EOLA 4IN2A 4YXWD 3GCNA 3SGAE 1TE0A 4CR9A 3SV9A 2J34A 2BX4A 1VGCC 3DA9B 3SBKA 1W8BH 1EKBB 2GZ8A 4K1TA 3OY5U 4CBOA 1V2WT 3VG8A 1V2VT 1OWDA 2F9NA 3FOAA 1GJAB 1MTVA 2FEQH 3PRBA 5FX5A 1GI9B 2AGEX 1QGFA 2ZCHP 3MNCA 1BMNH 3SOSA 6CHAC 2P94A 1GI6A 2PTNA 5HMAA 3MO6A 2PFEA 3A7XA 4RKOB 1OS8A 3BG4B 1MAXA 2K8IA 4Y7AA 2Y5FA 1H9HE 2VWMA 2P95A 1SQRA 1ZTJA 2O8TA 2G5NA 2O9QA 1W0YH 2ASUB 3SNBA 4AFQA 1AVWA 1C5VA 3P70B 4MLFB 4TPYA 3RXHA 3S0NA 1BIOA 1GMHF 3SJ8A 1PPHE 3GYMA 1GBCA 2BMGB 1SLVB 1GMCG 3P95A 1LHEH 2ZU2A 1G36A 3HGPA 1D6RA 3KF2A 3GY3A 3OE7D 2P16A 3PWCA 1TNLA 2UWOA 1TRYA 2JDID 3P8FA 1NRPH 3F2GA 4MNXA 2AIQA 2RFKC 3FP6E 2STBE 1A61H 3ZZ8A 1MU6B 3NKKA 1GJ4H 3V12A 3RXEA 1FY4A 4HTCH 2BZAA 1K1LA 1UVOA 5DGJA 1SL3A 1YLCA 5EJZA 1NS3A 1CT4E 3M61U 5G4BA 3FP7E 2V3OH 1TMTH 1DXPA 1N6XA 2BDAA 1AE5A 2ZG0H 1IQIA 4ABFA 1SHHB 1C5XB 4H6TA 1DLKB 4HFPB 2WPMS 4ZKRU 5A0CA 3Q3YA 1BRCE 1ETSH 1P2NA 5AFYH 4OS4A 1XKBC 3SV6A 2SNVA 2A4GA 2EA3A 2HNTF 4GVUA 1DITH 4B2BA 2J2UA 1RJXB 5EQQA 3RM2H 3U69H 1Z6JH 2PKSC 5EG4A 2GX4A 2YOLA 1MTNB 1C5WB 2W7SA 2WPLS 2BVSH 3D62A 1ARBA 4TYDA 1UCYK 1X7AC 1JIRA 1P09A 1SFQB 2PLXA 2RDEA 1BBRE 1YLNA 3TLOA 3V13A 3OTPA 4JK6A 1T4UH 3A8BA 3RXOA 4B71A 2ZWLH 1O36A 4IC6A 5A2MH 3QUMP 2ZCLP 1Z8GA 1SGEE 2QC2A 1IQHA 5FAHA 1P11E 3VB6A 5FBIA 1ELGA 1F5KU 1ZHRA 3F3BA 1QRZA 2W26A 1PPGE 4X0WU 4JK5A 1A46H 5EU8A 3VB3A 1HAVA 1NRSH 5K7RA 3O8RA 1SB1H 4BTUB 4X6OA 1J15A 1YPGH 1DY9A 4D8NA 3NWUA 1TX7A 1B5GH 3SV8A 2ZQ1A 3ESTA 4K5ZA 3UB0A 1W0KD 3RXFA 1PPEE 4U01A 1L1JA 1DANH 3TNTA 3P92A 1LKAA 1HRTH 4AORA 1O33A 2FOAA 4MG3A 4IMZA 4TWYA 1O38A 3A86A 4XBBA 3RMMH 4AFSA 1S83A 2UWLA 4I31A 3DUXH 1FN8A 1MBQA 5EOKA 3OX7U 2CJIA 4UEHH 1S85A 3B8JA 1LHDH 1EZSC 1A0JA 3PV5A 2A32A 4ACBA 2GCHF 3TIUA 1P2OA 2AMPA 3F9FA 3B23B 8KME2 3SZEA 1TPPA 3TH2H 1MU8B 1GJBB 2G00A 4D76A 2QCYA 1OWKA 2OBQA 3TK5A 2BZ6H 3BG4C 2G8TA 1V2NT 1SSXA 2GT8A 3RXTA 2OUAA 2VVVA 5AF9H 1C2MA 2ZF0H 5EGMA 3M3SA 5FCKA 1AUTC 3KN2A 2F9UA 1O3EA 1ZGVA 2NU4E 3ODFA 3KL6A 1K28D 2BDCA 1YLDA 3DD2H 1F5LA 1O3CA 1GHBF 3IG6B 1HAIH 8GCHF 4BAOB 4ESTE 1HIAB 2Z7FE 3ATLA 3ZZ6A 4AOQA 1RD3B 1ELVA 3GY4A 4M9FA 1F2SE 2BOKA 2AYWA 2ZHDA 1AMHA 5EXNA 2ANMH 4DURA 2A31A 1GJCB 3E0NB 7ESTE 2XCFA 4AG1A 2HWLB 5C20A 1LTOA 1P9SA 5GPIB 1IQLA 4YM9A 2AS9A 2JH0D 4X1PU 1W10U 4AB9A 4FU7A 3TH3H 1E37B 4Y0YE 1C1PA 3TGKE 4DIIH 1UVSH 3SJIA 2V3MA 1UTJA 5JBAS 1PQ8A 1A5IA 1C2GA 3HKIB 1K0HA 1TNJA 1ZLRA 2Z94A 4I7YH 4YESB 2SFAA 2EI8A 1JRSA 4FU9A 1QBVH 3GCHB 2XRCA 1O2PA 4X6MA 3TU7H 1MTNC 1C1RA 3WWBA 2BQWB 1LDTT 5L30H 1JBUH 4K8BA 2QXIA 3TITA 5ESTE 4B73A 3RUOA 2SNWA 2JJ1D 2OK5A 4WJG2 1KTTB 1P2KA 1MKXK 2GMTB 3ENSB 4M7GA 2F9OA 1GMDG 3FKSD 1CBWB 3RXLA 3ZYEA 3ZVDA 1O2MA 1YPHE 1Y5AT 1AKSB 2J95A 1GCTB 2B5TB 1SGPE 1NROH 3LONA 3PLPA 3STJA 2ZPSA 3UOUA 1YPJH 4H6SB 2JJ2D 1LHGH 1YF4A 2SGQE 5FBEA 3TGJE 3ZVEA 2XC0A 4RKJB 1VITH 2ZTXA 1YM0A 5DP7A 3LKWA 1K1IA 4B6FA 2C8YB 1Z8RA 3BG8A 1TABE 1A0LA 1A2CH 2BXTH 2KFWA 1G30B 4B2AA 1SPJA 3PM3A 1TYNA 1TFXA 1GBTA 5A0BA 1CU1A 2ZDMA 5T6DA 3ZZ9A 1WTGH 2CF9H 4DW2U 1B7XB 3W94A 1ELCA 2ZHQH 4JYVH 4RT1A 1ZPZA 1Y3YA 3UAIC 2TGPZ 3FAOA 1FONA 2CXVA 1BTPA 1Y3WA 1BRBE 2AMDA 1KY9A 5EPNA 3TJUA 2BOHB 2RA3A 1N1LA 2EEKA 2KM0A 2QY0B 4ZHAA 1K9OE 2GVFA 2TGDA 2GJGA 1BB0B 4Y79A 3ZZ7A 4WF8A 5JYIA 2W5EA 5HIZA 2LP6A 1NTPA 2ZFRH 3PMJA 4B75A 4NZLA 2BLOA 4X8VH 1OWIA 2PUXB 4Z0KA 2PSYA 3ZVCA 2O8MA 2VH0A 1AI8H 4ZXYH 3FN8A 1V2KT 2VIPA 1DSTA 4Z6AH 1T8OA 3UNQA 5C67A 4X2XA 5C17A 2WV9A 3M37A 3SGQE 2C3SA 2BDYA 2FI5E 1GHXH 5LH8A 1SR5C 1JOUB 1QCPA 4IW4E 3QTOH 2H2ZA 2ZHFH 5KGOA 1WQVH 1EJAA 2Z9KA 3LGTA 2W6ID 3GICB 3KIDU 3SV7A 1YCPK 1P8VC 2VIOA 1EJNA 1WBGB 2GV7A 4HG6A 4FUCA 2EI7A 1C5TA 3MQKC 3NPSA 3P6ZB 5T1VA 3RMNH 5GXPA 1H9IE 4GHTA 5C5NA 3MNBA 3PMHB 1ZSLA 2DE8A 5JBTA 2PGQB 1XM1A 1D3QB 1EATA 4TT3D 4ABIA 1ESBA 4DG4A 2UUJB 1H8HD 1TPSA 1FN6A 2F9PA 4FUFA 3N7OA 4AGKA 1NBME 2FS9A 3GCHC 4KTSA 3BTEE 3RXRA 1PQ5A 2BYAX 3TJVA 5LPRA 1CO7E 1C5LH 5DP8A 3BTFE 2J38A 3S7KB 4A1XA 1C5PA 5HIYA 3EQ0H 2SGEE 1PPCE 4KKDA 1YWUA 1YY3A 2I6QA 3LU9B 2BY6X 2GMTC 2K1QA 3V3MA 4CRBA 1C2KA 4IS5A 4AG2A 3MH6A 1C5YB 1YBWA 5DP9A 2QIQA 5B6LA 1CBWC 1UJ1A 4YZUA 4NA9H 3HK3B 1C1UH 3RXPA 3BSQA 4PROA 4WMFA 1HAVB 3T26A 3BEFB 3RXDA 1QIXB 1P10A 1HFDA 1KDQB 2XOKD 4Q80A 1GHAG 3NRLA 1NFYA 1HIAA 3A8CA 1MAYA 5C0UA 3BN9A 1GJDB 5A09A 1ELFA 2D1JA 1EZQA 3GDSA 1WQSA 1DT2A 2TGTA 1NT1A 2UUFB 3M3VA 2KCYA 4MPUA 2G51A 1CHOF 4INLA 3F9HA 4JZEH 2ZDKA 4INKA 1SGCA 3PMAB 3RDZA 4BNRA 1VZQH 4O3UA 2BQ7B 5J4QA 1EB2A 4YTAA 3DSOA 2BY7X 3NUMA 1BJUA 4WXVA 1SBWA 5ABWA 1P04A 1NPMA 1Z71A 1IOEA 1SGYE 1AO5A 3DFLA 1GI3A 2ZFQH 1S81A 1GI1A 4B2CA 1L1NA 2H5CA 2NU2E 2P59A 1VJ9U 2BLVA 4NA8A 1P57B 1ANCA 1HAGE 1V2TT 1ZSJA 3LDXH 4X1NU 5FHTA 1FY1A 2BDGA 2VGCB 3SJKA 3SU5A 3MI4A 1JIMA 1H8ED 2HLDD 1O3FA 2M2AA 3MMGA 4ZXXH 3E16B 3TK6A 1FQ3A 4B1TA 3C1KA 4DIHH 1LHFH 3HPTB 1EAIA 1C1SA 1K1OA 2Y80A 1SI5H 5EPYA 2A5IA 2ZNKH 1V2ST 1TWXB 1W7XH 4ISLA 1TBZH 1NC6A 1JXPA 2J4IA 3GISB 3K65B 4O3TA 1SC8U 1AHTH 1QL8A 3E0PB 1INCA 3RLWH 1F0UA 1KSNA 2GCHG 3BF6H 1U6QA 3ZVAA 5T6FA 1A5GH 3L3TA 3OU0A 1Y59T 5LGOA 5AVDA 1BJVA 1AKSA 1E0FD 1HYLA 2L6OA 2FWWA 4JZFH 4UFEH 2VIVA 3SNEA 1H4WA 2VNTA 1O39A 1QA0A 3PYHA 2HALA 1XXFA 2FESH 1A5HA 1ID5H 4AYVB 3I29A 2ANYA 4TPIZ 3SNAA 1A3EH 1V2PT 2A7CA 1BTXA 3A88A 4FUIA 2R3UA 2RDLA 4X2WA 4NGAH 5C2ZA 1TGCA 2IPHA 1GHBG 1JWTA 2ZU1A 2ZDNA 8GCHG 1SMFE 1D3PB 3UWJH 5JPMH 1IQEA 2Z3EA 1UCYH 3MH7A 1Y8TA 1O2IA 7GCHF 3A7ZA 3B9FH 1EFRD 3BEIB 9ESTA 2QF5A 1EAXA 2Y6TA 1C2LA 3EGKH 5DK1A 2OINA 1BCUH 5EJ1A 2JKHA 1LMWB 3BV9B 1ZOMA 3ZZ4A 3P8OA 1C2DA 2PGBB 1BMFD 2ILNA 3KGPA 9LPRA 1V2RT 1GGDB 4XFQA 1LPZB 1V6DA 3VXEH 3S7HB 1Z6EA 2CHAB 4IGDA 1W0JD 2FODA 3ZZBA 1ORFA 2ZIQH 4MNYA 2Y7ZA 2F9VA 5EQRA 1P0SH 1C5RA 1MABB 1QB1A 3SU0A 1P3EA 4NIVA 3STIA 2V6NA 1C9PA 2JH5D 1W13U 5DP3A 1LPGB 2QF3A 2WUCA 3E8LA 3SJ9A 8LPRA 2AMQA 2IJD1 3ATKA 3LJJA 4GLYA 1ZMLA 2F4LA 1V3XA 1GJ5H 1HBTH 4ZKNU 1TMBH 1IHSH 5DP6A 3GY7A 2FLRH 2VB0A 6LPRA 5T3HA 2A1DB 2PKAB 2QXJA 5E2OA 3U8OH 4P02A 1O3PB 2A45B 2OXSA 4FU8A 4K1EA 1UTQA 3GY2A 2HNTC 4JYUH 1FJSA 1GBFA 2ZTYA 4JCNA 1P2MA 1KLIH 1BBRK 3A7TA 1O5GH 1O3AA 2R3YA 1T31A 2Z9LA 3OTJE 1AFQB 1NBMD 1GL1A 3NK8A 2Q6GA 1EB1H 4Y10E 1SFIA 2BVXH 3LJOA 1BTUA 2FOHA 4H42U 4KGAA 1UTOA 5HYOA 3RXJA 5F53A 1SQOA 1V2OT 2VGCC 2Z9GA 3RXAA 1L1GA 3VGCB 2KZ4A 4UDWH 1P05A 4WMEA 4LOYH 4Q7ZA 4X1RU 1BT7A 1NO9H 2ZU5A 1A7SA 3SU3A 3A85A 1AB9B 1UTNA 1O3KA 3PTNA 3RXSA 1ELAA 1UTKA 2IN2A 5JB9S 1KXDA 1TGTA 2BM2A 1TOMH 1MH0A 2XBYA 3LGVA 2RA0A 1F5RA 4YOIA 2OQ5A 5AFZH 2AEIH 4WWYA 3GY8A 1OYTH 1EAWA 1HCGA 3OEED 4GCHF 1TA6A 1C4V2 2ODPA 2D8WA 5HKKD 4YLQH 3NZIA 5FPYA 1GJ7B 2J98B 3FZDA 5I46H 1ZZZA 1PFXC 3PB1E 3UREA 1ZYOA 2GDDA 2LELA 3UQOA 3IWMA 2XBXA 3RXUA 4F49A 1KDQA 3RU4D 3T27A 4A1VA 1BUIA 3MU4A 1CT0E 2C90B 3NXPA 1CHGA 1K21H 2VIDA 1QJ6B 5KECA 5E0JA 2FOCA 2Y7XA 3NCLA 1WXRA 1OWHA 5DN6D 1QURH 2J97A 3WY8A 1KTSB 3GCOA 2CV3A 1QRXA 3OAAD 4CRGA 1LKBA 3K6ZA 2YMSC 4HZHA 3DT0H 5EJLA 3RXVA 2Y5HA 1PYTD 4O03A 2LPRA 2F43B 3AAVA 1E36B 3T29A 2C93B 4XBCA 3TNSA 3LH1A 2ZZUH 4ABDA 1PPFE 1TPAE 1YYY1 1GI2A 1MKXH 1QL7A 1O2ZA 1PQAA 2FI4E 1O2XA 4DVAU 1AZ8A 1C1MA 2Q6FA 1VKYA 1P03A 2B8OH 4ISIH 4NIXA 3S69A 3UNRA 5J4SA 1EZUC 1GGDC 2BB4A 4UD9H 1YP9A 1SQTA 3SV2H 2ODYB 3SU2A 2ZU4A 1SGDE 2QF4A 4U2WA 1GVZA 1WDIA 2CHAC 1C5NH 2NU1E 2ZTZA 3LT3A 3QZRA 3U28C 1ZHMA 1W2KH 4FXGH 5HXFA 3URDA 1N8OB 2V7QD 3FFGA 2R2MB 1O2GH 1THRH 4AB8A 1DWDH 4ISOA 1QTFA 4I8JA 1O3LA 4FOUC 1C5QA 1GBLA 3EAJA 1S84A 4K8YA 3KQDA 1TA2A 4HGCA 3WWFA 1C1QA 2VIQA 1RIWB 1YPKH 3H7OA 2BTCE 2BD7A 2ZA5A 1DPOA 4X2YA 3UR6A 5E2PA 1SOZA 3ZVGA 3SNDA 1E79D 1HAYB 3MNXA 1P3CA 1SOTA 1ACBE 3ZIAD 3F9GA 2ESTE 2ZO3H 1KLJH 3GYLB 3RC4A 4DJZB 5HM9A 2H9TH 4DOQA 1COWD 4JZDH 1OXGA 3TJNA 2QA9E 1EAUA 3U8TH 1LVYA 4CRDA 1BITA 2OTVA 1AFQC 3MU1A 1KLTA 1T32A 1ZR0A 2G81E 1YPMH 1HJ9A 4FUJA 5F8ZA 3TVJB 2AHME 2ZQ2A 1BMLA 1CHOG 3MH4A 1NU9A 4K2YA 4BXSA 1T8MA 2XTTB 1SGFA 1FY8E 3Q3KA 3QN7A 3VGCC 1QJ7B 1CA0B 2CN0H 4Y71A 3SHAH 1C1VH 3I77A 5A0AE 3A7WA 1NY22 2Z9IA 2ZP0H 5KEDA 1AB9C 2V3HH 1ZTLA 1C4U2 1M9UA 5CHAB 2FMJA 4BANB 3SO3A 3E91A 1A1RA 3SW2B 2H9HA 2ZFPH 1O3OA 4CRCA 1Z1IA 1AIXH 4Y8XA 2UWPA 4UFDH 3BTDE 1GDUA 4HI3A 3FZZA 1YCPH 3PV4A 1Y3XA 2BY8X 4AFUA 3N7DA 3KYGA 2OC0A 3LGWA 3EDXB 4IMQA 1GI7B 1KXEA 1UTMA 4JZIA 1JMOH 1CGIE 3JZ1B 1RTFB 4E7NA 1G3BA 4H4FA 3LH3A 3PV2A 1QB6A 2OC1A 3HKJB 1J14A 2BVRH 2OC8A 2O8WA 1GHYH 4FUGA 3EE0B 1K2I1 1T8NA 3LIWA 2SGDE 4XD7D 4CR5A 4IC5A 3M7TA 4I32A 4XDEA 1O2LA 1UMAH 2WSSD 2PKAA 1SVPA 1Y5BT 2K0QA 3O8CA 1O3GA 1W12U 1DXWA 1Y3VA 3N7EA 3UWIA 4F55A 4XOJA 1RFNA 1LO6A 3ZV8A 1YGCH 1LCYA 2VJ1A 1WTHD 4ABAA 1FZZA 1THSH 2WYGA 1SGQE 3PO1B 1XKAC 1DX5M 1OOKB 1DM4B 1OP2A 1YPEH 4I8HA 3UFAA 1P01A 3OY6U 4AFZA 3RXQA 1K1JA 1NESE 4OGYA 2BDIA 2VVCA 1HAOH 1DUAA 4IBLH 1OWEA 3RXBA 3AVZA 4AZ2B 5EIYA 4XBDA 1BZXE 2QYIA 2DE9A 4K69A 4WMDA 5DP4A 3RP2A 2ZHWH 5JB8S 3P8NA 3QZQA 4GUXA 1CE5A 1WOFA 4OS5A 7GCHG 4NFEA 3RXIA 4NA7A 2A7HA 1BOQA 4ZAEA 4UFFH 2Z3CA 2WPKS 5FX6A 2B9LA 2F3CE 1AWHB 1AY6H 1N8OC 3F6UH 1HAXB 5GNDA 1TBRH 3BTTE 4A92A 1E35B 3VEQB 1FIWA 3A7YA 4A1TA 2I6SA 4B76A 1KXAA 4Q4LA 1O2YA 1GVKB 3ATIA 2J98A 3Q3XA 3H7TA 1TNIA 3M7QA 1GMHG 3F0PA 4NIWA 2PTCE 3HK6B 1XUKA 5CDFE 4Y0ZE 4ZROA 3VB4A 4ASHA 1TB6H 5C94A 4KTCA 4MPVA 2OLGA 3CENA 1Z1JA 1GBDA 1O5BB 5DKMA 1H1BA 3R0FA 3MOCA 4BAKB 3A87A 3SUEA 4LZ4B 1QL9A 4BOHA 4D9QA 1XUIA 3LGUA 5EXLA 4MNVA 1Z7KA 1G3DA 2J9NA 2ZPQA 4LK4A 1F92A 1RGQA 1T8LA 3ZZAA 2KX4A 4I86A 1CGJE 1HDTH 1P06A 1BMMH 3DFJA 1MQ5A 2BHGA 2IJOB 1QY6A 1ZTKA 2ZC9H 1GJ8B 3M3TA 1ABJH 1Y5UT 3DCLA 1DUEA 3QWCH 4FUDA 1CA0C 1DSUA 2OQUA 4X6PA 1FPHH 1GBAA 2KCOA 2NWNA 2ZFFH 2BD2A 1YPHC 2BQ6B 1UVTH 2WINI 2PUQH 3BTWE 1MTSA 5CHAC 2EI6A 2H1UA 4Y6DA 3A81A 1BQYA 1FAKH 5IK2D 3S9AA 2OBOA 1C2JA 4BTTB 1GCTC 5FXLA 1C5OH 2WYJA 5HM2A 5IYTA 1NM6A 1RXPA 3ODDA 1HXEH 2A5AA 1V2QT 2R0LA 3V0XA 4LZ1H 2FIRH 2ZFSA 1O35A 2XBVA 1QBOA 2BD3A 3GOVB 3PROA 2WZQA 3H09A 3UR9A 1EASA 1ARCA 1P2IA 1ZSKA 4RSPA 5DPAA 1VCQA 1ELTA 2W7UA 2V35A 1TQ7B 1K1NA 1G37A 3RU4E 3ZZ3A 3MO9A 1OWJA 3I78A 1T4VH 2FYRA 1NU7B 2Q6DA 4ZHLU 2QF0A 3FO8D 4Y8YA 1GBKA 1HJAB 2ZEBA 2YNBA 2WPJS 3F2HA 1FY5A 3CNRA 3ELAH 2GZ9A 3OYPA 4NCYA 1O3NA 3QDZB 4D7GA 2OCVB 2P8OB 3K2UA 1F7ZA 4LXBH 2VWOA 2ANKH 1FPCH 1GI4A 1SGIB 3ZYDA 3QGNB 5E0GA 3UUZA 4OGXA 2WV4A 3HGNA 1MTWA 1K22H 1FXYA 3M5MA 1FI8A 3VPKA 1O3DA 5JDUB 1QZ8A 1AFEH 4WH8A 3ZVBA 1UK4A 3IITA 4WXIA 3W95A 5DO4H 1TRNA 1GI8B 1HLTH 1ZPBA 1C1WH 1XMNB 1ESAA 1GVLA 3ITIA 1N6YA 5BPEA 3TH4H 1PPZA 1BHXB 4TY6A 4XSKU 5F8TA 3A80A 4RT0A 4MTBA 3GS9A 1NFXA 5E0HA 1TIOA 2R2WU 1AE8H 1ELDE 1E34B 1BTHH 1G32B 4JZ1A 3UNSA 2BD4A 1MKWK 1C1NA 1OHHD 1S5SA 2F91A 1QBNA 1LVOA 3SQEE 1SGFG
chains in the Genus database with same CATH topology
1BBRH 2G55A 4MPWA 1DDJA 4BXWA 2GZ7A 1TGSZ 5TCAA 3SQHE 2D2DA 4WVPE 1CVWH 1F0RA 1MMJN 5ESBA 1ZJDA 1UTLM 4DY7B 1W3CA 4R0IA 1GG6B 1LHCH 4WH6A 1GBMA 5EODA 1L4ZA 4D9RA 1BA8B 1O2UA 3VB7A 4YT6H 2A2XH 3L33A 3F68H 3SUDA 4NIYA 2QAAA 2R9PA 3LC5A 1WYKA 2ZFTA 3SNCA 2VIWA 3RXCA 4OS7A 1F0TA 4THNH 4ZKOU 5E8EH 2GP9B 3UY9A 2XYAA 4R8TB 4A5TS 4JMYA 3URCA 1EOJA 2ZDAH 2O8UA 2QGRA 4CHAB 5L2ZH 1ANBA 3LPRA 1G3EA 1A3BH 1Q3XA 1QR3E 1YPLH 2CGAA 2XBWA 4NZQA 1O3HA 2A2QH 1C4Y2 1MQ6A 1P9UA 3D23A 2G4UA 3GCTF 3D49H 1EJMA 4OS2A 5AHGH 1GDQA 2Y82A 1OX1A 2CF8H 2HLCA 5JBCS 2GCTB 5A8YA 3C27B 2M5TA 1O31A 1K1MA 1O34A 3RXKA 1C2FA 3LOXA 3RM0H 3UOPA 1V2JT 2VVUA 2BDBA 3ATMA 3E1XB 1UK3A 2ALVA 4K60A 3SORA 2A7JA 1O2RA 1VITF 1T7CA 2H9EH 5GCHF 3ZZCA 1FNIA 2TIOA 3ZV9A 2ZECA 1RTKA 1SGRE 1UO6A 1O2HA 3A84A 3QLPH 1MCVA 3SN8A 1TLDA 1DLEA 1JRTA 2BX3A 3CS7A 4Y8ZA 3MO3A 3MU5A 1PPBH 3U8RH 2ZPRA 2FS8A 5EW1H 2B7DH 1ZGIA 5B6OA 1PYTC 1FIZA 3KQEA 2QN5T 1YC0A 5JBBS 6ESTA 1HJAC 3GDVA 1O5AB 4ABHA 2A4QA 1DWBH 2AERH 2P3FH 4D7FA 1C5UA 2BY9X 1V2UT 2ZHEH 4BAMB 4O97A 1SLUB 4NG9H 4Y76A 2GV6A 2ZDLA 4CBNA 2Q1JA 2EC9H 2HPPH 4VGCB 1TNKA 1LVMA 1O3IA 2P8OC 3KHVA 3O8BA 1GCDA 2A4OA 1UVPA 5CMXH 1ELEE 3MTYA 1AWFH 3U1JB 5HGGA 3BTGE 4YLUA 3ZZDA 1AZZA 1ZPCA 1HUTH 1G2MA 3Q77A 1SG8B 3GDUA 2YNAA 1RTLA 1LQDB 1O32A 1TNGA 1BRUP 1CA8B 1FDPA 3RXGA 1HAHH 2ULLA 3AASA 5GDSH 1O2OA 2ZGXH 4OS6A 4FVDA 1AUJA 2TRMA 4UONA 4DT7B 1NZQH 1O3JA 1IQGA 2BD9A 3E6PH 5PTPA 1AGJA 1GHAF 2FO9A 1LVBA 4ZMAH 3KQCA 1BHXF 1K1PA 1EZXC 3FVFB 4Y7BA 4NSYA 1EX3A 1O5DH 3EA8A 4B74A 1QQUA 1THPB 6GCHF 2RCEA 2BD8A 1GI0A 4GHQA 2QXHA 1CT2E 1J17T 4AN7A 2A5KA 2FM2A 1O30A 2UUYA 2Z3DA 1DFPA 1BRAA 1O2JA 2CMYA 1LQEA 2JETB 2AGGX 1GG6C 1MCTA 1O5EH 1UCYE 3DHKH 4J1YA 3TJOA 2SGFE 4FUBA 1GBEA 3SU1A 1XUJA 3KQBA 2Z6BD 2TBSA 1D3TB 1NRRH 5T6GA 1AU8A 1LPKB 1OSSA 2IOTA 1IQNA 1CGHA 4ABGA 3RXMA 2J94A 3ZVFA 1TGBA 2HPQH 1BDAA 3A8AA 4BAHB 3M36A 7KMEH 2NU3E 5F03A 2GTBA 1UTPA 4I8KA 1SHYA 4CHAC 3CP7A 3SI3H 3S9CA 1QRWA 4MPXA 2AH4X 3RC5A 2BDHA 2C4FH 3EA7A 3M5LA 2V0BA 5C5OA 1S6FA 3RLYH 5ETXA 1ETTH 2Y5GA 1IQFA 1XUGA 3A83A 4UE7H 3MH5A 1GBJA 1O2KA 7LPRA 1E38B 2GCTC 3VFEA 3T5FH 1J9CH 4YOGA 2QV1A 1B0FA 1MTUA 2KAIA 1GBHA 2BXUH 1WAYB 3P17H 1TONA 2JH6D 1W7GH 5FPSA 2W3KA 3V7TA 1EUFA 4I8GA 1RRKA 1HB0B 3LC3A 4ISHH 4X2VA 4ZHMU 1DICA 3SI4H 3SJOA 1XVOA 1EXFA 1BTWA 1Z8JB 1SLXB 5CE1A 2F83A 3BTKE 4U30A 1DE7H 1ZMNA 2TGAA 3F9EA 4X1SU 1O2WA 1HV7A 1C5ZB 3M35A 2OC7A 2R0KA 4X6NA 2BD5A 2UUKB 1EQ9A 3EYDA 1TPOA 4NWKA 3R3GB 1O2VA 3PTBA 4GPGA 4MVNA 1GJ9B 2OP9A 1G3CA 1DY8A 4JYTA 4YO9A 3MHWU 1G2LA 1OP0A 1Q31A 1P12E 5EQSA 1ANEA 1IHTH 3A8DA 4IN1A 3G01A 4VGCC 3TPIZ 1IQKA 1L2EA 3A7VA 2A4RA 3Q76A 3TGIE 1KXCA 3VB5A 1GHVH 2G52A 2XWAA 1MZAA 3P8GA 4SGBE 4X8TH 4I8LA 2XW9A 1CSOE 1F0SA 2VWNA 4UFGH 1VCPA 1OKXA 2FP7B 4U32A 3LGYA 1ELBA 1AD8H 5F6MA 2FOEA 1S6HA 1GMCF 1DVAH 2O8LA 2DUCA 1GHZA 3F1SB 2AFQB 3SGBE 2NU0E 3QGJA 2J92A 2XCNA 4CRFA 3RC6A 5DP5A 4Q7XA 2HVXA 1BTZA 3RU4T 2F9BH 1FMGA 1XX9A 4FVBA 2PHBA 2WUBA 1C5MD 1P2QA 2C8XB 5DG6A 2H6MA 1H9LB 4AGJA 3SUFA 4CH8B 1MUEB 2FOMB 1KYNA 2PWXA 1YCPM 1TQ0B 3AAUA 3MWIU 1GPZA 2Y81A 1QJ1B 3U1IB 2H5DA 1EPTB 4KTUA 3RMOH 1O0DH 1ZHPA 1W0ZU 1EP6A 2JETC 4ISNA 3SU6A 1NRQH 2ZGCA 2ZKSA 1ESTA 1AVXA 3MFJA 3ZZ5A 1A0HB 4K3JA 3T25A 3OSYA 1KIGH 1UHBB 2ZU3A 3AW0A 3PLKA 1GI5A 5C1XA 1OP8A 2ZCKP 3QO6A 3A89A 2AIPA 1VR1H 5LPEA 1FY3A 3BTHE 4CRAA 2HGTH 1FAXA 1IQJA 5GWZA 1QA7A 2VINA 4DCDA 2BLWA 1SLWB 4CH2B 2ALPA 3ATWA 3KNXA 4O9VA 4YOJA 2GDEH 1O5CB 1XXDA 1ETRH 1S82A 3A82A 3AW1A 4FUEA 1HAPH 5TCCA 1Z8IB 1V2LT 3SU4A 3M7UA 4AX9H 1B0EA 3Q00A 3KCGH 4ABEA 3MU8A 4X8UH 1TX6A 5GJ4B 3MYWA 1O37A 1P2JA 4KELA 3SHCH 1QHRB 4ZH8A 2SGAA 1C9TA 1TALA 3T28A 3GCTG 4TWWA 1RIWC 1L0ZA 1MBMA 1GBIA 1PQ7A 1PJPA 1TOCB 2WV5A 1HXFH 2STAE 3QK1A 4CREA 4MNWA 1C2IA 2HOBA 2FPZA 4J2YB 3UQVA 1MZDA 4YT7H 4SGAE 1VJAU 1TAWA 5L6NH 3MNSA 4NSVA 3HATH 2LNCA 1HPGA 1O2TA 4ABBA 4F4OC 2AGIX 1C1TA 3K9XB 4NWLA 2XXLA 1VITG 5GCHG 3EA9A 1WU1A 2XC4A 2ZDVH 1TMUH 2GGVB 4NFFA 2HRVA 1DOJA 1DWCH 2XC5A 3VXFH 3GY6A 1V2MT 5TJXA 2TPIZ 3T62A 1ZMJA 1QB9A 4DGJA 2ZI2H 2FXRA 4E7RG 4OS1A 5GIBA 4Q2KA 4WY3A 4E06H 1HJ8A 1D9IA 1VGCB 3L6PA 2SGPE 1XUFA 1DS2E 3UIRA 3UPEA 3JZ2B 5C1YA 5C1UA 1O2SA 2FX6A 1MKWH 2P3TB 2XNIA 1S0QA 2ZGHA 3T2NA 1HAZB 1QQ4A 5A8ZA 6CHAB 1KXFA 4ZUHA 1QNJA 3TK9A 1AVGH 1MD7A 1W11U 3M5NA 2RG3A 2FX4A 5FCRA 1BTYA 3MU0A 1FV9A 4X8SH 2VH6A 2VWLA 4MQAA 3U98H 3O8DA 2WPHS 4Q7YA 1J16A 1IAUA 1HNEE 2VU8E 1HGTH 1ZJKA 2GKVE 2ZGBH 1G9IE 2THFB 1VCWA 2B0FA 4XE4A 1GDNA 1D3DB 3SUGA 1TNHA 3CS0A 1XVMA 1SQAA 4BTIB 3BTQE 2GD4B 3QX5H 1YKTA 2FYQA 3U9AH 4QT8C 1O2QA 2P93A 2PW8H 1NRNH 1C1OA 5F8XA 2ANWA 1EPTC 3BEUA 2WPIS 1C2HA 3E3TA 4GCHG 2PV9B 3BIUH 2FTMA 4MDSA 3FANA 5BRRE 3GY5A 1O3BA 1RS0A 2FOFA 1BMAA 1GBBA 6GCHG 2PR3A 1D6WA 2BY5X 4Y11E 1D4PB 1L4DA 1MD8A 1TGNA 2C8WB 2ZGJA 3PO1C 5SGAE 4BAQB 4K1SA 4INHA 2G5VA 5A8XA 8ESTE 3KEEA 3PMBB 2ODQA 1UVUH 1ABIH 1O2NA 5IDKA 3BIVH 1ZRKA 2HNTE 3PWBA 1SGTA 1GMDF 2XWBI 2PKSB 1Y3UA 4ZKSU 5L2YH 4GSOA 1SGNE 5FPTA 4A6LA 1GWAA 4A7IB 1ANDA 5C3NA 2BLQA 2FLBH 2KAIB 1C2EA 5K0HA 1OPHB 5EXMA 1AQ7A 1EP5A 1OYQA 3H5CB 3LGIA 1Q2WA 1TBQH 3M5OA 1FLEE 1GJ6A 1O5FH 4I33A 1QFKH 3FP8E 5H4IB 2C8ZB 1UK2A 2FOBA 1AN1E 1KXBA 3QTVH 2Z9JA 1H8IH 1O3MA 3S9BA 4RN6A 1GHWH 4E05H 1GL0E 2A0QB 1W14U 1WCZA 1WSSH 2FOGA 4AYYB 2PSXA 1WV7H 4KP0A 4X1QU 1IQMA 3E90B 5LPFA 1H8DH 3SZNA 4TY7A 3K6YA 1WUNH 2G4TA 1DWEH 1EPTA 2FDAA 4FUHA 1C5SA 2OD3B 3UTUH 1TX8A 1ZRBA 1A4WH 1FUJA 2FI3E 3BTME 2D26C 3D65E 2FZZA 1NFWA 2QXGA 2W3IA 1XUHA 2FTLE 2GT7A 4ABJA 1NFUA 5DJ7A 1CQQA 1J8AA 3RMLH 1S0RA 1P02A 3PLBA 2P3UB 1UHBA 1NN6A 4GAWA 5I25A 1TRMA 5EW2H 1EOLA 4IN2A 3GCNA 3SGAE 1TE0A 4CR9A 3SV9A 2J34A 2BX4A 1VGCC 3DA9B 3SBKA 1W8BH 1EKBB 2GZ8A 4K1TA 3OY5U 4CBOA 1V2WT 1V2VT 1OWDA 2F9NA 1GJAB 1MTVA 2FEQH 5FX5A 1GI9B 2AGEX 1QGFA 2ZCHP 3MNCA 1BMNH 3SOSA 6CHAC 2P94A 1GI6A 2PTNA 5HMAA 3MO6A 2PFEA 3A7XA 4RKOB 1OS8A 3BG4B 1MAXA 4Y7AA 2Y5FA 1H9HE 2VWMA 2P95A 1ZTJA 2O8TA 2G5NA 2O9QA 1W0YH 2ASUB 3SNBA 4AFQA 1AVWA 1C5VA 3P70B 4MLFB 4TPYA 3RXHA 3S0NA 1BIOA 1GMHF 3SJ8A 1PPHE 3GYMA 1GBCA 2BMGB 1SLVB 1GMCG 3P95A 1LHEH 2ZU2A 1G36A 3HGPA 1D6RA 3KF2A 3GY3A 2P16A 3PWCA 1TNLA 2UWOA 1TRYA 3P8FA 1NRPH 4MNXA 2AIQA 3FP6E 2STBE 1A61H 3ZZ8A 1MU6B 3NKKA 1GJ4H 3V12A 3RXEA 1FY4A 4HTCH 2BZAA 1K1LA 1UVOA 5DGJA 1SL3A 1YLCA 1NS3A 1CT4E 3M61U 5G4BA 3FP7E 2V3OH 1TMTH 1DXPA 1N6XA 2BDAA 1AE5A 2ZG0H 1IQIA 4ABFA 1SHHB 1C5XB 4H6TA 1DLKB 4HFPB 2WPMS 4ZKRU 5A0CA 3Q3YA 1BRCE 1ETSH 1P2NA 5AFYH 4OS4A 1XKBC 3SV6A 2SNVA 2A4GA 2EA3A 2HNTF 4GVUA 1DITH 4B2BA 2J2UA 1RJXB 5EQQA 3RM2H 3U69H 1Z6JH 2PKSC 5EG4A 2GX4A 2YOLA 1MTNB 1C5WB 2W7SA 2WPLS 2BVSH 3D62A 1ARBA 4TYDA 1UCYK 1X7AC 1JIRA 1P09A 1SFQB 2PLXA 1BBRE 3TLOA 3V13A 4JK6A 1T4UH 3A8BA 3RXOA 4B71A 2ZWLH 1O36A 4IC6A 5A2MH 3QUMP 2ZCLP 1Z8GA 1SGEE 2QC2A 1IQHA 5FAHA 1P11E 3VB6A 5FBIA 1ELGA 1F5KU 1ZHRA 1QRZA 2W26A 1PPGE 4X0WU 4JK5A 1A46H 5EU8A 3VB3A 1HAVA 1NRSH 5K7RA 3O8RA 1SB1H 4BTUB 4X6OA 1J15A 1YPGH 1DY9A 4D8NA 3NWUA 1TX7A 1B5GH 3SV8A 2ZQ1A 3ESTA 4K5ZA 3RXFA 1PPEE 4U01A 1L1JA 1DANH 3TNTA 3P92A 1LKAA 1HRTH 4AORA 1O33A 2FOAA 4MG3A 4IMZA 4TWYA 1O38A 3A86A 4XBBA 3RMMH 4AFSA 1S83A 2UWLA 4I31A 3DUXH 1FN8A 1MBQA 5EOKA 3OX7U 2CJIA 4UEHH 1S85A 3B8JA 1LHDH 1EZSC 1A0JA 2A32A 2GCHF 3TIUA 1P2OA 2AMPA 3F9FA 3B23B 8KME2 1TPPA 3TH2H 1MU8B 1GJBB 2G00A 4D76A 2QCYA 1OWKA 2OBQA 3TK5A 2BZ6H 3BG4C 2G8TA 1V2NT 1SSXA 2GT8A 3RXTA 2OUAA 2VVVA 5AF9H 1C2MA 2ZF0H 5EGMA 3M3SA 5FCKA 1AUTC 3KN2A 2F9UA 1O3EA 1ZGVA 2NU4E 3ODFA 3KL6A 1K28D 2BDCA 1YLDA 3DD2H 1F5LA 1O3CA 1GHBF 3IG6B 1HAIH 8GCHF 4BAOB 4ESTE 1HIAB 2Z7FE 3ATLA 3ZZ6A 4AOQA 1RD3B 1ELVA 3GY4A 1F2SE 2BOKA 2AYWA 2ZHDA 1AMHA 5EXNA 2ANMH 4DURA 2A31A 1GJCB 3E0NB 7ESTE 2XCFA 4AG1A 2HWLB 5C20A 1LTOA 1P9SA 5GPIB 1IQLA 4YM9A 2AS9A 2JH0D 4X1PU 1W10U 4AB9A 4FU7A 3TH3H 1E37B 4Y0YE 1C1PA 3TGKE 4DIIH 1UVSH 3SJIA 1UTJA 5JBAS 1PQ8A 1A5IA 1C2GA 3HKIB 1TNJA 1ZLRA 2Z94A 4I7YH