1QCVA

Rubredoxin variant (pfrd-xc4) folds without iron
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
53
structure length
53
Chain Sequence
AKWVLKITGYIYDEDAGDPDNGISPGTKFEELPDDWVAPITGAPKSEFEKLED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (RUBREDOXIN VARIANT PFRD-XC4)
publication title Contribution of surface salt bridges to protein stability.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Electron transport
total genus 2
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 1999-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1qcvA00
3RZTA 1R0HA 4AR3A 1FHMA 1DX8A 1CAAA 1SMMA 3PWFA 1IU5A 5RXNA 3A44A 1CADA 5AI2A 2PYAA 1NNQA 4YWLA 4YWMA 1IU6A 2VL6A 1YUZA 1LKOA 1RDVA 1S30A 1R0JA 1E8JA 1LTLA 4ME3A 1RB9A 1S24A 3KYUA 1B13A 3KYWA 2DSXA 4POGA 2M4YA 2V3BB 1SMWA 2LCQA 3PZAA 1YV1A 4RXNA 1VCXA 1QCVA 2QL0A 4K9FA 1ZRPA 4TPUA 1T9OA 5IY0A 1R0FA 4AR6A 2KKDA 1B71A 1T9PA 1YK4A 1FHHA 1RYTA 1RWDA 3KYXA 2HR5A 8RXNA 5AI3A 1BRFA 1H7VA 6RXNA 2RDVA 1RDGA 1C09A 1BQ8A 1JYBA 1YK5A 1IROA 1DVBA 3KYVA 1BQ9A 3MPSA 2KN9A 2K2DA 1R0GA 1BE7A 1IRNA 1SMUA 7RXNA 2PVXA 4AR4A 3RYGA 1B2JA 1LKPA 1T9QA 3QVDA 3KYYA 2GMGA 2PVEA 3SS2A 1S2ZA 1QYBA 1LKMA 1BFYA 2MS3A 1R0IA 1B2OA 3RZ6A 1YUXA 4AR5A 4POFA
chains in the Genus database with same CATH superfamily
3S16L 5M5YL 5JVG1 1DX8A 2NVXL 2XJUA 1SMMA 5MF6A 5GAEc 4BBSL 1TWAL 3J7Y1 1IU5A 4A3ML 2XJSA 2ZIXA 2JA8L 1R9TL 5IYDL 2AYJA 4AI1A 1TWHL 4ME3A 5M3ML 1PFVA 2DSXA 4POGA 3PO3L 2APOB 2AQCA 4LHNA 4BXXL 5MFZA 1QCVA 4K9FA 5GAGc 2XJRA 1OWBA 5M5XL 1ZRPA 3GTML 3H9CA 1R0FA 1I50L 2KKDA 2Z3RB 4ZN1B 1B71A 2RFKB 5FLML 3WWLA 4AI3A 2R7ZL 1YK4A 3PKJA 3PIP1 3HOVL 1OWCA 3FDJA 5K2ME 5GAHc 2JI2A 1PFUA 1Y1VL 1JYBA 3HJYB 3GTGL 4ZN3B 1BE7A 3LPEB 1SMUA 5IYCL 5AN9H 3RYGA 1LKPA 1T9QA 3S1RL 2E2HL 1S2ZA 1PFYA 5IP7L 3ZG6A 1LKMA 3HJWB 3LWRB 4V196 3S14L 1R0IA 4U671 1TWFL 4XXBB 4A3LL 3P2AA 4XGHA 1CAAA 4AHZA 3PWFA 2XJPA 1SFOL 2VUML 5AI2A 3LWQB 4A3KL 3LWPB 3HAXC 4BY1L 3MSUA 4YWMA 3I4NL 3K35A 2VL6A 1WJVA 1YUZA 5C4XL 1LKOA 1K83L 1RYQA 1RDVA 1S30A 3GTOL 3RZDL 2WB1P 2JA6L 4GS7D 4A93L 3GTKL 4AHWA 5MGNA 2L0ZA 2V3BB 3P8BA 4RXNA 4AHXA 3VPBE 2QL0A 2A69D 5GADc 5M5WL 1NXEA 1T9PA 2B63L 1FHHA 1RYTA 3HOWL 8RXNA 1BRFA 3S15L 2C6AA 2C6BA 1C09A 3GTQL 1BQ8A 2JA5L 1YK5A 1IROA 3H9BA 3HOYL 4JAEA 4A3JL 3MPSA 3WWNB 3I4ML 1R0GA 5C4JL 4C2M1 4Y7NL 1IRNA 2J9UB 3FKIL 4JAGA 4A3GL 2JA7L 2PPTA 3M3YL 2GMGA 2PVEA 1F4LA 2CR8A 1Y1WL 1BFYA 3HOZL 1ODHA 3S2HL 3CQZL 1I6HL 3RZ6A 5C44L 2B5ID 5MLC3 3LNLA 4POFA 2CKCA 3RZTA 5DM61 4BY7L 3HOXL 2A68D 3NFPI 4C3JL 3JR7A 2E2IL 3A44A 3K7AL 2BE5D 3H99A 4AI0A 3PO2L 2NVQL 2Y0SP 2NVYL 1PZXA 4YWLA 1IU6A 4UY81 1VZHA 3J7Z1 1E8JA 1R0JA 3H97A 4C3IL 1RB9A 4G6BA 1SMWA 2NVTL 2O5JD 3PKIA 4TPUA 3H3VM 5IY0A 4A3CL 4AR6A 1YUXA 5JVH1 1QQTA 5M3FL 2R92L 4X6AL 1RWDA 3KYXA 5IYBL 2M6PA 1IW7D 5AI3A 1H7VA 6RXNA 4A3BL 1VZIA 4E6YA 1DVBA 2ERJA 1BQ9A 3QQCE 5C3EL 2WAQP 5EIOC 2ERSA 1TWCL 2YU9L 3S17L 3HOUL 2R93L 3PIO1 2PMZP 5EINC 3GTLL 5FJ8L 3LWVB 4WFN1 4JADA 2PVXA 4AR4A 2JI1A 3QVDA 3KYYA 1TWGL 2CKAA 4TVMA 2MS3A 5MFPA 1PFWA 3S1QL 1R0HA 2Z3QB 4AR3A 1FHMA 2A6HD 4A3DL 2V0EA 2V0FA 5RXNA 3IU3I 2HVYC 1CADA 4Y52L 2PYAA 4LHLA 1NNQA 1Z92B 3GTJL 5DM71 4JAFA 1NXGA 4A3EL 1LTLA 1P7PA 1S24A 3KYUA 1B13A 3KYWA 3B08B 2M4YA 3S1ML 2LCQA 4A3FL 3PZAA 1YV1A 2H12A 1VCXA 3GTPL 3MQKB 4QIWP 3H0GL 1T9OA 3B0AB 3RZOL 2XJVA 4A3IL 3S2DL 4C3HL 3PL5A 1I3QL 2HR5A 5H1Sc 2RDVA 4AYBP 1RDGA 2EY4E 2M6OA 2XJTA 3KYVA 4AHYA 3LWOB 2KN9A 2K2DA 4BBRL 3M4OL 2JI3A 2AUSB 4AI2A 7RXNA 3HKZP 1WCML 3S1NL 1B2JA 2NYDA 2XJQA 3SS2A 2A6ED 1QYBA 1VZGA 2PSMC 5IP9L 4B8CD 2E2JL 2M4VA 1B2OA 4AR5A
chains in the Genus database with same CATH topology
3P2AA 2CKCA 3RZTA 4XGHA 1R0HA 5JVG1 2Z3QB 4AR3A 1FHMA 5DM61 1DX8A 2A68D 3NFPI 1CAAA 2A6HD 2XJUA 4AHZA 1SMMA 2V0EA 3PWFA 5MF6A 5GAEc 3J7Y1 2V0FA 1IU5A 5RXNA 3A44A 3IU3I 2XJPA 2BE5D 1CADA 2XJSA 4AI0A 5AI2A 2ZIXA 2PYAA 4LHLA 1NNQA 3MSUA 4YWMA 4YWLA 1IU6A 1Z92B 4UY81 1VZHA 3K35A 2VL6A 5DM71 4JAFA 3J7Z1 1WJVA 1YUZA 1NXGA 2AYJA 1LKOA 1RYQA 1RDVA 1S30A 1R0JA 4AI1A 1E8JA 1LTLA 4ME3A 1RB9A 1S24A 3KYUA 4G6BA 4GS7D 1B13A 3KYWA 2DSXA 4POGA 3B08B 2M4YA 4AHWA 5MGNA 2L0ZA 2V3BB 1SMWA 2LCQA 3PZAA 1YV1A 2H12A 4LHNA 3P8BA 4RXNA 4AHXA 5MFZA 3VPBE 1VCXA 1QCVA 2QL0A 2O5JD 4K9FA 5GAGc 2XJRA 1OWBA 2A69D 1ZRPA 3PKIA 5GADc 4TPUA 1T9OA 5IY0A 1R0FA 4AR6A 2KKDA 2Z3RB 4ZN1B 5JVH1 1NXEA 3B0AB 1B71A 1T9PA 2XJVA 3WWLA 4AI3A 1YK4A 3PKJA 3PIP1 1FHHA 1RYTA 1RWDA 1OWCA 3KYXA 2M6PA 2HR5A 8RXNA 1IW7D 5AI3A 5GAHc 1BRFA 5K2ME 1H7VA 6RXNA 5H1Sc 2JI2A 2RDVA 2C6AA 1RDGA 1C09A 2C6BA 1BQ8A 1JYBA 1VZIA 2M6OA 2XJTA 4E6YA 1YK5A 1IROA 1DVBA 2ERJA 3KYVA 1BQ9A 4AHYA 4JAEA 4ZN3B 3QQCE 3MPSA 2KN9A 5EIOC 2K2DA 3WWNB 2ERSA 1R0GA 1BE7A 3LPEB 2JI3A 1IRNA 2J9UB 4JAGA 5EINC 1SMUA 3PIO1 5AN9H 4AI2A 7RXNA 4WFN1 4JADA 2PVXA 4AR4A 2PPTA 3RYGA 1B2JA 1LKPA 2JI1A 2NYDA 1T9QA 3QVDA 3KYYA 2GMGA 2PVEA 2XJQA 1S2ZA 2A6ED 3SS2A 1QYBA 2CKAA 2CR8A 4TVMA 1LKMA 3ZG6A 1BFYA 1VZGA 2PSMC 2MS3A 1ODHA 4V196 5MFPA 1R0IA 1B2OA 4B8CD 4U671 2M4VA 4XXBB 3RZ6A 2B5ID 5MLC3 3LNLA 1YUXA 4AR5A 4POFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RZT A;  1R0H A;  4AR3 A;  1FHM A;  1DX8 A;  1CAA A;  1SMM A;  3PWF A;  1IU5 A;  5RXN A;  3A44 A;  1CAD A;  5AI2 A;  2PYA A;  1NNQ A;  4YWL A;  4YWM A;  1IU6 A;  2VL6 A;  1YUZ A;  1LKO A;  1RDV A;  1S30 A;  1R0J A;  1E8J A;  1LTL A;  4ME3 A;  1RB9 A;  1S24 A;  3KYU A;  1B13 A;  3KYW A;  2DSX A;  4POG A;  2M4Y A;  2V3B B;  1SMW A;  2LCQ A;  3PZA A;  1YV1 A;  4RXN A;  1VCX A;  1QCV A;  2QL0 A;  4K9F A;  1ZRP A;  4TPU A;  1T9O A;  5IY0 A;  1R0F A;  4AR6 A;  2KKD A;  1B71 A;  1T9P A;  1YK4 A;  1FHH A;  1RYT A;  1RWD A;  3KYX A;  2HR5 A;  8RXN A;  5AI3 A;  1BRF A;  1H7V A;  6RXN A;  2RDV A;  1RDG A;  1C09 A;  1BQ8 A;  1JYB A;  1YK5 A;  1IRO A;  1DVB A;  3KYV A;  1BQ9 A;  3MPS A;  2KN9 A;  2K2D A;  1R0G A;  1BE7 A;  1IRN A;  1SMU A;  7RXN A;  2PVX A;  4AR4 A;  3RYG A;  1B2J A;  1LKP A;  1T9Q A;  3QVD A;  3KYY A;  2GMG A;  2PVE A;  3SS2 A;  1S2Z A;  1QYB A;  1LKM A;  1BFY A;  2MS3 A;  1R0I A;  1B2O A;  3RZ6 A;  1YUX A;  4AR5 A;  4POF A; 
#chains in the Genus database with same CATH topology
 3S16 L;  5M5Y L;  5JVG 1;  1DX8 A;  2NVX L;  2XJU A;  1SMM A;  5MF6 A;  5GAE c;  4BBS L;  1TWA L;  3J7Y 1;  1IU5 A;  4A3M L;  2XJS A;  2ZIX A;  2JA8 L;  1R9T L;  5IYD L;  2AYJ A;  4AI1 A;  1TWH L;  4ME3 A;  5M3M L;  1PFV A;  2DSX A;  4POG A;  3PO3 L;  2APO B;  2AQC A;  4LHN A;  4BXX L;  5MFZ A;  1QCV A;  4K9F A;  5GAG c;  2XJR A;  1OWB A;  5M5X L;  1ZRP A;  3GTM L;  3H9C A;  1R0F A;  1I50 L;  2KKD A;  2Z3R B;  4ZN1 B;  1B71 A;  2RFK B;  5FLM L;  3WWL A;  4AI3 A;  2R7Z L;  1YK4 A;  3PKJ A;  3PIP 1;  3HOV L;  1OWC A;  3FDJ A;  5K2M E;  5GAH c;  2JI2 A;  1PFU A;  1Y1V L;  1JYB A;  3HJY B;  3GTG L;  4ZN3 B;  1BE7 A;  3LPE B;  1SMU A;  5IYC L;  5AN9 H;  3RYG A;  1LKP A;  1T9Q A;  3S1R L;  2E2H L;  1S2Z A;  1PFY A;  5IP7 L;  3ZG6 A;  1LKM A;  3HJW B;  3LWR B;  4V19 6;  3S14 L;  1R0I A;  4U67 1;  1TWF L;  4XXB B;  4A3L L;  3P2A A;  4XGH A;  1CAA A;  4AHZ A;  3PWF A;  2XJP A;  1SFO L;  2VUM L;  5AI2 A;  3LWQ B;  4A3K L;  3LWP B;  3HAX C;  4BY1 L;  3MSU A;  4YWM A;  3I4N L;  3K35 A;  2VL6 A;  1WJV A;  1YUZ A;  5C4X L;  1LKO A;  1K83 L;  1RYQ A;  1RDV A;  1S30 A;  3GTO L;  3RZD L;  2WB1 P;  2JA6 L;  4GS7 D;  4A93 L;  3GTK L;  4AHW A;  5MGN A;  2L0Z A;  2V3B B;  3P8B A;  4RXN A;  4AHX A;  3VPB E;  2QL0 A;  2A69 D;  5GAD c;  5M5W L;  1NXE A;  1T9P A;  2B63 L;  1FHH A;  1RYT A;  3HOW L;  8RXN A;  1BRF A;  3S15 L;  2C6A A;  2C6B A;  1C09 A;  3GTQ L;  1BQ8 A;  2JA5 L;  1YK5 A;  1IRO A;  3H9B A;  3HOY L;  4JAE A;  4A3J L;  3MPS A;  3WWN B;  3I4M L;  1R0G A;  5C4J L;  4C2M 1;  4Y7N L;  1IRN A;  2J9U B;  3FKI L;  4JAG A;  4A3G L;  2JA7 L;  2PPT A;  3M3Y L;  2GMG A;  2PVE A;  1F4L A;  2CR8 A;  1Y1W L;  1BFY A;  3HOZ L;  1ODH A;  3S2H L;  3CQZ L;  1I6H L;  3RZ6 A;  5C44 L;  2B5I D;  5MLC 3;  3LNL A;  4POF A;  2CKC A;  3RZT A;  5DM6 1;  4BY7 L;  3HOX L;  2A68 D;  3NFP I;  4C3J L;  3JR7 A;  2E2I L;  3A44 A;  3K7A L;  2BE5 D;  3H99 A;  4AI0 A;  3PO2 L;  2NVQ L;  2Y0S P;  2NVY L;  1PZX A;  4YWL A;  1IU6 A;  4UY8 1;  1VZH A;  3J7Z 1;  1E8J A;  1R0J A;  3H97 A;  4C3I L;  1RB9 A;  4G6B A;  1SMW A;  2NVT L;  2O5J D;  3PKI A;  4TPU A;  3H3V M;  5IY0 A;  4A3C L;  4AR6 A;  1YUX A;  5JVH 1;  1QQT A;  5M3F L;  2R92 L;  4X6A L;  1RWD A;  3KYX A;  5IYB L;  2M6P A;  1IW7 D;  5AI3 A;  1H7V A;  6RXN A;  4A3B L;  1VZI A;  4E6Y A;  1DVB A;  2ERJ A;  1BQ9 A;  3QQC E;  5C3E L;  2WAQ P;  5EIO C;  2ERS A;  1TWC L;  2YU9 L;  3S17 L;  3HOU L;  2R93 L;  3PIO 1;  2PMZ P;  5EIN C;  3GTL L;  5FJ8 L;  3LWV B;  4WFN 1;  4JAD A;  2PVX A;  4AR4 A;  2JI1 A;  3QVD A;  3KYY A;  1TWG L;  2CKA A;  4TVM A;  2MS3 A;  5MFP A;  1PFW A;  3S1Q L;  1R0H A;  2Z3Q B;  4AR3 A;  1FHM A;  2A6H D;  4A3D L;  2V0E A;  2V0F A;  5RXN A;  3IU3 I;  2HVY C;  1CAD A;  4Y52 L;  2PYA A;  4LHL A;  1NNQ A;  1Z92 B;  3GTJ L;  5DM7 1;  4JAF A;  1NXG A;  4A3E L;  1LTL A;  1P7P A;  1S24 A;  3KYU A;  1B13 A;  3KYW A;  3B08 B;  2M4Y A;  3S1M L;  2LCQ A;  4A3F L;  3PZA A;  1YV1 A;  2H12 A;  1VCX A;  3GTP L;  3MQK B;  4QIW P;  3H0G L;  1T9O A;  3B0A B;  3RZO L;  2XJV A;  4A3I L;  3S2D L;  4C3H L;  3PL5 A;  1I3Q L;  2HR5 A;  5H1S c;  2RDV A;  4AYB P;  1RDG A;  2EY4 E;  2M6O A;  2XJT A;  3KYV A;  4AHY A;  3LWO B;  2KN9 A;  2K2D A;  4BBR L;  3M4O L;  2JI3 A;  2AUS B;  4AI2 A;  7RXN A;  3HKZ P;  1WCM L;  3S1N L;  1B2J A;  2NYD A;  2XJQ A;  3SS2 A;  2A6E D;  1QYB A;  1VZG A;  2PSM C;  5IP9 L;  4B8C D;  2E2J L;  2M4V A;  1B2O A;  4AR5 A; 
#chains in the Genus database with same CATH homology
 3P2A A;  2CKC A;  3RZT A;  4XGH A;  1R0H A;  5JVG 1;  2Z3Q B;  4AR3 A;  1FHM A;  5DM6 1;  1DX8 A;  2A68 D;  3NFP I;  1CAA A;  2A6H D;  2XJU A;  4AHZ A;  1SMM A;  2V0E A;  3PWF A;  5MF6 A;  5GAE c;  3J7Y 1;  2V0F A;  1IU5 A;  5RXN A;  3A44 A;  3IU3 I;  2XJP A;  2BE5 D;  1CAD A;  2XJS A;  4AI0 A;  5AI2 A;  2ZIX A;  2PYA A;  4LHL A;  1NNQ A;  3MSU A;  4YWM A;  4YWL A;  1IU6 A;  1Z92 B;  4UY8 1;  1VZH A;  3K35 A;  2VL6 A;  5DM7 1;  4JAF A;  3J7Z 1;  1WJV A;  1YUZ A;  1NXG A;  2AYJ A;  1LKO A;  1RYQ A;  1RDV A;  1S30 A;  1R0J A;  4AI1 A;  1E8J A;  1LTL A;  4ME3 A;  1RB9 A;  1S24 A;  3KYU A;  4G6B A;  4GS7 D;  1B13 A;  3KYW A;  2DSX A;  4POG A;  3B08 B;  2M4Y A;  4AHW A;  5MGN A;  2L0Z A;  2V3B B;  1SMW A;  2LCQ A;  3PZA A;  1YV1 A;  2H12 A;  4LHN A;  3P8B A;  4RXN A;  4AHX A;  5MFZ A;  3VPB E;  1VCX A;  1QCV A;  2QL0 A;  2O5J D;  4K9F A;  5GAG c;  2XJR A;  1OWB A;  2A69 D;  1ZRP A;  3PKI A;  5GAD c;  4TPU A;  1T9O A;  5IY0 A;  1R0F A;  4AR6 A;  2KKD A;  2Z3R B;  4ZN1 B;  5JVH 1;  1NXE A;  3B0A B;  1B71 A;  1T9P A;  2XJV A;  3WWL A;  4AI3 A;  1YK4 A;  3PKJ A;  3PIP 1;  1FHH A;  1RYT A;  1RWD A;  1OWC A;  3KYX A;  2M6P A;  2HR5 A;  8RXN A;  1IW7 D;  5AI3 A;  5GAH c;  1BRF A;  5K2M E;  1H7V A;  6RXN A;  5H1S c;  2JI2 A;  2RDV A;  2C6A A;  1RDG A;  1C09 A;  2C6B A;  1BQ8 A;  1JYB A;  1VZI A;  2M6O A;  2XJT A;  4E6Y A;  1YK5 A;  1IRO A;  1DVB A;  2ERJ A;  3KYV A;  1BQ9 A;  4AHY A;  4JAE A;  4ZN3 B;  3QQC E;  3MPS A;  2KN9 A;  5EIO C;  2K2D A;  3WWN B;  2ERS A;  1R0G A;  1BE7 A;  3LPE B;  2JI3 A;  1IRN A;  2J9U B;  4JAG A;  5EIN C;  1SMU A;  3PIO 1;  5AN9 H;  4AI2 A;  7RXN A;  4WFN 1;  4JAD A;  2PVX A;  4AR4 A;  2PPT A;  3RYG A;  1B2J A;  1LKP A;  2JI1 A;  2NYD A;  1T9Q A;  3QVD A;  3KYY A;  2GMG A;  2PVE A;  2XJQ A;  1S2Z A;  2A6E D;  3SS2 A;  1QYB A;  2CKA A;  2CR8 A;  4TVM A;  1LKM A;  3ZG6 A;  1BFY A;  1VZG A;  2PSM C;  2MS3 A;  1ODH A;  4V19 6;  5MFP A;  1R0I A;  1B2O A;  4B8C D;  4U67 1;  2M4V A;  4XXB B;  3RZ6 A;  2B5I D;  5MLC 3;  3LNL A;  1YUX A;  4AR5 A;  4POF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...