1QD0A

Camelid heavy chain variable domains provide efficient combining sites to haptens
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
128
structure length
128
Chain Sequence
b'QVQLQESGGGLVQAGGSLRLSCAASGRAASGHGHYGMGWFRQVPGKEREFVAAIRWSGKETWYKDSVKGRFTISRDNAKTTVYLQMNSLKGEDTAVYYCAARPVRVADISLPVGFDYWGQGTQVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VHH-R2 ANTI-RR6 ANTIBODY
publication title Camelid heavy-chain variable domains provide efficient combining sites to haptens.
pubmed doi rcsb
molecule tags Immune system
total genus 24
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 1999-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qd0A00
2FH8A 3IB4A 1RZKC 3C6LD 2V2WB 3PQYA 4F7EA 2AJXH 4YC2C 1MJ8H 1ACYH 3GJEA 2YPKB 3O6KL 4U7MA 3K4ZA 2AEQL 4HJGB 1I8KA 1ED3A 3RA7H 4JR9L 1QLEL 5EFIA 5CINL 3W0WB 4P3WA 5JORA 4X7FC 4P2OC 1BQHG 4YK4C 5J1AA 5K59F 4RMQA 4HBCL 2CKBB 1QSED 1T4KB 1OP3H 3O8XD 4XCYB 3QWRA 3LHPL 5C7XH 3TT3H 3EHBC 4HS3B 1GPOH 4OLEA 2ZCHH 1CE6B 4R4FH 4XAWH 3H9SB 4U1KB 1IZKA 3BUYB 3PWPA 2CGRL 4MMXC 4ODUB 2LVCA 5J13C 4MA8L 1BQUA 2DQCH 1WZMA 3BH8B 4M00A 3P4OB 3FO2A 1SEQH 3ZDZE 4HUKB 1C5CH 4XZUB 1BVLA 1MQKL 3HLAA 3DNKA 4PY8J 3X14B 1TCMA 4YHOH 1A4KA 3EDDA 5DFVC 1A3LL 5FO7B 3AXLB 3G6AB 5JIKA 1DVFA 3C2SA 3PWJB 5CGTA 5EC2B 4RAVA 2WZPD 5ADPL 5D7IB 4F7PA 2Q8BL 2DL2A 5K93A 4P4RB 4I0PC 4L3AA 4NQCB 4EOWH 2GTWA 5E94B 2GJ6B 1U0QA 4NQDB 1NJ9B 4ONFH 4YWGL 1UB6B 5GPRA 5GS0L 3HNSL 3AMKA 5FYKE 5HDLA 1N59A 5EBWA 3CVHA 3F5WB 4LNRA 1LK3L 1UQSA 2AXJA 4NZDA 3H9ZA 2P5WD 2NY6D 3ZSSA 1W8OA 1CVSC 3FO9B 4JM4L 5C0NC 4FQXB 2O5ZH 3Q3GB 2R0ZL 5C0IB 2HRLA 5D93B 4IOIB 2BOBB 4YQXH 3F7YA 5E8PA 1AQKH 3G6DH 4X9HA 2R0WH 4YBHA 1U8IB 3FO1B 2HG5B 3V79C 1PG7H 3WSQH 4HT1L 3HNVH 1JHLL 2WWMD 3MBEC 4AK1A 3KNBA 4JHWH 1A7NH 1HHGB 1BJ8A 5KS9A 4NQEA 1M7IB 3SGJA 1QBMH 5GS1A 2XZAH 2NQCA 3QEHA 4K23H 3B5TA 4EIZC 4WI5A 4PJBF 2HT4D 5JIPA 3MLSH 2OMNA 3H0TA 2OP4L 4N9GA 2GYSA 3HRZA 4PJDB 4JRYD 1EVTC 1QYGL 25C8H 2FL5B 1NMBH 2OR9L 5CJXC 3U0PB 1QVOA 4NN6C 4ONGH 5B22A 4RZCB 2NY7L 4N8CL 4J3TA 1P2CB 4FXKA 1KEGH 1BZQK 4NQSB 4J3UA 3V0AC 3CLFL 4YFEA 2GFBB 3G6JA 1LEKB 2NTSP 2NXYC 4FS0A 1KYOJ 1T03H 4XVJH 5KOVC 4HUUA 2HAZA 4HDIA 2J8OA 2DQTH 3T4YB 2OJZH 3I75B 3CGTA 4P3DA 1X5HA 4XCFL 1ZVSB 1KBGL 4R4NC 4NO2B 3LEXA 1A64A 4U1NB 2EIBA 1Z9SA 5B8CC 1ZHNB 2BC4B 4EI5C 3LN4A 3VFVB 4P9HH 5K9QG 1R5VA 3VGGA 4NJ9H 4N0UB 4WDIA 4E0RA 1NGPH 3LKPB 2JIXA 3QUMA 1T7WA 3BSZH 3QIBD 2OQJA 5EPMB 3VGBA 5CILL 4UT7L 3FFCA 2L7UA 3V7AG 1HILB 5JPNB 1TCRA 4L5FH 4EN3A 1X6NA 2F5BH 2YXFA 2EDTA 2VQ1B 3MLXH 4KTEL 4E41B 1K4CB 4NQEE 5KS9E 3T3ME 1VFBA 3MUZ1 2A74A 5DURB 1F6AB 5DRWB 4RIRB 4GRWB 1FYTB 3TWCL 2VDNL 4ZOEA 4U0RB 2YBRA 4TUOB 2R56H 1FG2B 3IETA 5ESQA 4QHLA 5EB9A 1I8LC 5K9OB 3KXFD 3WFEH 2V7NB 3AY4C 3MFFB 3RDTA 3NGBC 5TE4H 5HHME 4M1GL 4QRUB 2H2PC 3OAZK 2HWZL 3AREB 1BD2A 3P4MA 2AI0L 1JN6A 3U1SH 3SE9L 1EAJA 4PYHA 3U2SA 3MMEA 3RVTD 1LE9A 1IEAB 3LPWA 3RVVC 4L4TA 1KN2L 3UTPD 3S34H 2DBLH 4C56B 2NY2B 1INDH 3OKKA 5I71B 5CP3A 4ODHH 2PYED 1KJVB 1HXMA 3SDDC 3CZJA 5BMFH 1ZGLA 5DC4B 5ISZE 4UAOC 1AGCB 2CKBL 2IH1A 1AD9B 5BRZB 1GL4B 1BVKA 1OLZA 5I8CA 3F58H 4UDTB 1F90H 1IILE 4XVTH 2H41A 3K8KA 3VFTB 2P8MA 4CNIA 4FP8H 2ADFH 4I0KA 4JO4H 4U7SA 1RUMH 5I2IA 1G9MC 4JKWA 4JQVA 2PTUA 2A77H 3CSPA 1CI5A 1WAAF 1WQVT 1MCIA 4NQVA 1NBZB 5JHLH 1CGSL 5E6YA 4HKZA 3KYMB 1N0XL 2XNAA 2Q86B 3LMJH 3AAZB 2E3VA 5J6HA 3G04B 3K46A 3ZKMD 3VJ6B 3SJVB 3QNZA 2EDDA 3PXHA 3TF7C 2VWEE 3UJTH 3D3VB 3OKMA 4R8WH 3RWGA 5KG9A 2X70A 1FZOA 3Q6GL 5DA4A 2QJDA 5LGJA 1BD2E 2F74A 3ABZA 1DE4B 2Z91A 2ORBL 1IAIH 2X4OB 3OPZL 4H5SB 4XPTH 1P84K 3C6LC 4BQ6A 1WWAX 3RWDB 2E8ZA 3BX7C 4L4TE 1JPST 1HZHL 2JCCA 5DLML 4DK3A 5F9OL 2VSCA 1QBBA 1ZT7A 3O3AB 3EOBA 3QXDA 5FK9B 1Y0LB 4X99A 1VFUA 3FB8B 2DL9A 4FABH 3PABA 2AERT 4OI9A 4DZBA 1MUJA 3HUJF 1NDMA 1B0RB 4OJFL 3WS6C 3O45B 4OZHF 5HHQA 2NY3B 5IEKA 2VXSL 2UYLA 1K6QH 1CT8B 4XAKD 4PJ5D 5LCVH 4NWUH 3MRFB 4QRRA 1A14L 4BSVB 5IB2B 2B1HL 3TESA 2FSEA 3IDYC 3QDGA 4BH8B 1JGDA 3D69B 4LFHD 4OLZL 1Z9MA 5JDJA 2EDXA 4XVUD 5CKAA 3OSKA 5D7JA 3LH2H 4P5TC 2HT2C 2AJXL 4JFFB 3BZDA 4U31A 1HHHA 3OAYH 4JAMA 3T4AB 3NN8A 4G8IB 2PXYD 2P48B 1U8HA 1T7VA 3I02A 1IC4H 4EBQH 4ZOAA 5GIRA 1VFOA 2XKNA 4OUOA 4KJYB 1DDHB 5DT1H 5IVOA 4K3JL 3D48R 1KPRA 2CLZA 1GPOL 2VLKD 4LLMB 2F54A 2ZCHL 3HNTH 1VDGA 3F7VB 3MROA 4XAWL 1U3HD 1U8MA 5I8KL 4H8WH 5F7WC 4KUCF 2E6PA 2NY6C 3O4LD 1YNTA 4LPCA 2EZ0D 4D8PA 2JCCE 4KGLA 3BOVA 4HC1L 1KPUA 4PFEA 4QHKJ 5TDOA 1HYSD 3NACL 1C5CL 4WO4B 1HHIB 4LF3A 1WTLA 4L4VE 3BP6B 3U0WH 1FE8L 3MR9A 3EOAB 4GAYB 4PREA 3NABH 5TH2A 4HQQH 4RGMC 1JHTA 2RCSH 4UNUA 1RAMA 4Z78B 1A9BA 4ONHB 1U8LB 5C08E 4PGBB 4EOWL 3NCBB 3B6SA 3QDGE 5EIIA 3U83A 1IC7H 4P59L 1IL1B 4GS7B 2HVKB 4BSWB 1NDGB 2VZOA 3S5LB 1OPGH 1K3ZA 1WT5C 2J8HA 1OB1B 2HT4C 5IB3B 1IKFL 5H94A 4BH7A 3IVKA 3IF1B 1ND0B 4N5EC 4HS8H 3WUZA 1JGLL 2B0SH 4NSKB 4TVPH 5IEHB 1YPZF 3GHBH 5JPMB 1IM3B 1R3HA 3FRUB 2E6JA 3MRNB 1TZHA 1WFNA 4YQXL 5CIPH 5ID1A 1AQKL 3KPOA 2EDEA 4P2CG 2VXUH 2BNRA 4LCWA 3MO1B 2YD5A 1TZIA 4LLVA 3SQBA 1J18A 1PG7L 3MRHB 3HNVL 2F54E 1JL8A 1OGAA 2FD6L 4HWBL 1HYRC 1ULVA 4NNPH 4RRPA 5ID0A 2QQQA 4LIQH 3V4VH 4C57C 4JJ5B 4RAHA 3DBXB 1RVFL 1QBML 2XZAL 2CRZA 4R0LB 4CKVX 3MRCB 4GRMB 1B4JH 4K23L 4U6YA 5MEPB 3TPKA 1YNLL 4DGYL 4XI5D 2B5IC 1BFOA 3L7EA 3AB0B 1MCHA 5DI8B 5F6IB 1YJDC 3MLSL 1GH7A 3BEVA 1JGUL 3KJ6L 2ZG1A 5EG6C 2CD0A 1G9NC 4Y19B 4XNQB 1LO2L 3P3YA 1H8SA 4RMWA 3LEVH 3QIBC 3WDIA 3B9KD 3H7BB 4JY4A 3QPQD 1KEGL 2XWTA 3RGVD 3LKRA 4QWWC 1IGYA 3DX6B 4JM2B 3AVEA 2DJUA 2ZOKA 2FO4A 2BSTA 3KYNB 3I2CL 2CIIB 4OFVA 4I13B 1HQ4B 1JPFA 5DMKB 5IVZB 1S9XB 4XP9H 3CUPB 4EDXA 2J8UF 1G7PB 1MCCA 5FOBA 2CKNA 3L3JB 3DX8A 4WWKB 3N1FC 4W70A 3X13A 2HLFC 2X1QA 5GZNC 1MFBH 4MXVF 5ESVB 2EDFA 2ZUVA 4PLJD 3SOBH 2XQYK 1NFDE 4OIIL 4LHQB 4AL8L 4EQ2A 1DZBA 2EEAA 2BNRE 4LCWE 5FYKD 1T1WA 2YRZA 1ZLVK 1VACA 2ZUQC 4L9LB 2R2HB 3C60B 2RR3A 3L3DA 3PDOA 4NKIL 1OGAE 2VZ1A 2F5BL 1HQRB 3UPAA 3KJ4C 3NH7L 1KTDB 3IFPA 4W4OC 4M7JH 3QQ3A 5CEZH 5DTFA 2E7LC 3MYJB 4GW1B 2PR4H 4IS6B 3GSXA 3UX9B 4X8XA 2R56L 3OKEB 4MB4A 3QI9A 1C16A 4PRHA 1NCWH 3TGXA 3TVMA 3QWRD 5EOTA 3TN0A 1ZSDB 1HKLL 1XGQB 3BDBA 3WFEL 5A40E 3DSFH 5I76A 3R1GL 1RV6X 3FN0L 4K7PH 1TVHA 1SBBA 2GJJA 2GK0A 1RD6A 2PUQT 4WI9A 1XIWD 3TYFB 1EEUA 1W0WA 3BP7B 1MRCL 4V2CB 3MRRA 2R0KL 5CWSA 4P0DA 5EZLA 3RZWA 3HAEG 3VGAC 3GRWL 3QXAA 2X4QB 2G5RA 3I3DA 1EH9A 3QWQB 2B2XH 1OTTD 3DVGB 1BZ7A 1N8ZA 4BK5A 1DVFD 3KYKL 5C0BB 4LFHG 2D7PA 4ZFOA 3RIFK 4PJCB 2ZUTA 4NFCA 3E6FB 5HHVL 3CFCH 3N1GC 5L2KE 4P4KA 2HFGL 3LSOB 1J7VR 1Z5LB 5IW1A 1IFHL 1ONQA 1D5BA 3PGDB 4XP5H 2NY1D 4H20L 4YXLL 4LP4A 3BDXA 5F3BB 1QR1A 1RUAH 4X4XB 2X5PA 4XVTL 4PJEA 5IW3A 3LDBB 5C3LD 5C9KA 1CGTA 2Z4QB 1NCBL 2XOTA 5D8JH 3FO0H 4ZD3L 2YUZA 3GSRB 4QNPF 5EOCH 3UBXA 2EDHA 4JO4L 4TSBH 1IKNC 1ZHBA 3EDJA 4KI5E 4N90E 1H3PH 5TDPA 3JBG7 5JHLL 1H3UA 2CDFA 4BJLA 5MP6L 2ZPKL 4O4YH 1CDCA 2WIIA 5BZDB 1SEBB 3DXAB 5JDSA 5DQJA 3INUL 2XICA 3QNYA 4ZTOH 3RIAF 4LKCA 2XTJC 4MCZB 3Q6FB 3MJGX 4OQ1A 1MLBB 4EVNA 1EO8H 4J4PA 5DRNA 2GAZB 4NQED 3P11L 1EDQA 1I7TA 4B53A 3M07A 2R4RH 2XPGB 4L8BA 1YEFH 1OAYL 5C6PB 1VADA 4YZFF 2J3SA 2ATKB 3MLWH 4XVUC 1D6EA 2KUTA 3BKJL 5CEYB 1S7QB 3L3IB 2V9RA 1GHFL 2SEBB 3PWUB 4TNWF 5HHMD 3DHMA 3O3EB 2PO6C 1KCVL 4JPKH 5DEFB 2NY0B 1YN7A 4DGIL 3ARBB 5AUMB 3RL2A 5ICXB 4JO1H 4XMKH 2ITCB 2G5BB 4M61A 1DUZA 1INEL 3SY0B 1DN2A 1F00I 1YA5A 4PJEE 4GBXB 2CR3A 3M17A 3PL6A 1NEZB 2VIRA 5FF6B 5C0AB 3JZ7A 3IDJA 2CUHA 3C09B 3HS0A 4Q58C 3BWAA 4KKCD 1HYSC 4WHYG 2ED8A 4G6KH 4B50A 2A9NH 3K81A 3TBSB 1WZLA 3LKQA 4JB9H 5ISZD 4LSQH 1KCLA 4AIZB 3WJLC 3ZYJA 5D1XB 2VRAA 3EOTH 2A1WH 2FDBP 3W0WA 4FG6C 5D2NC 5SWZB 4YIQB 3NCJL 4EBQL 1RJZB 2CKBA 4EN3D 5BS0B 5H8DA 4XCYA 3VFUB 4PG2C 5KAQF 5DT1L 1I4FB 4NM4H 4X6BB 4HS3A 1MRDH 1CE6A 1EIBA 1N5AB 3IDIA 3S96B 1EEZB 5IFJA 4OFPA 5E6IB 3A67H 4H8WL 5D2LF 2D4FA 4PR5A 3TIDB 4S1QH 2W60B 2VLLB 3ZT7A 2NY5C 3ZDYE 2VR9A 3TH4T 2UUDK 1A5FH 3L5WB 3R8BB 4XZUA 5DJDA 4OZIE 3IJSB 3KPSA 3X14A 4ESKA 4F15B 4LRNL 2FECI 1MVUB 1RY7B 3P0GB 1T2QH 4ZUSA 4X6CB 1BD2D 1Z9LA 3ROOB 1QUNA 3SGKC 1JRHL 4MNGB 2OLDA 4HQQL 4YXKH 5EC2A 5EWIH 1KFAL 3IDNB 5D7IA 4MAUH 3HC3H 3N85H 4OZGB 4HULB 1MFCH 3LRSA 4P4RA 3KPRA 1WUNT 1KNOB 1FVCB 2Y72A 4YDKH 2GJ6A 4L4TD 4D9LH 4JFYB 1NJ9A 4FFVD 3MV9B 3MLYH 1IC7L 4Y16B 4K94L 5IK3A 5J9PB 1IGTA 1FCCA 3ARVA 2EE2A 5FHBL 3W9EB 3BAEL 4HXAH 3DSNA 3DYOA 1KIRA 3RVUD 5I1LB 2B0SL 4MJ6B 5FHAH 4WFGE 2XWBB 3V5KA 3W0WE 5DQ9B 1BEYL 2VTFA 4P57A 3FQRB 5TQ2H 4IOIA 4JPVH 5E70A 4ACPA 1L7TH 3RVWD 4XNYL 4FQHB 2VXUL 4YHYB 1F3JA 3FO1A 1OD7A 2HG5A 4FMKA 4XCEA 5MEOA 3D6GA 1LO5B 4G3YL 4LHUB 4I48A 2N56A 2FR4B 3RY6A 3H9SE 2OM5A 1YEIL 3P73B 4PJBA 1HHGA 4Q9RL 2IG2H 2Z92B 4OZFB 3MGAA 1LE5B 4LIQL 1PZUB 4J3SA 4AEFA 1JVKA 3RX8A 1MCOH 4KTYA 4O02L 2W9DL 5D70H 3B4NA 2VISB 2DKUA 1F8TL 1UG9A 2LU3A 4OZ4A 3GIVA 2PTTB 3ULVH 1CZ8H 1X5KA 1E4KC 2JJWA 3K80A 4LLAA 4P2RB 4PLJC 4Z7OE 2E27H 3B8YA 3FT4A 2FH6A 3L5XL 4PRPB 5D7IE 1S5IL 2IBBA 4G6JL 2A38A 3LEVL 4OCLC 3ULUC 1I9IH 3QYCA 3EJYC 5BOPA 2MCPL 4NQSA 4RDQG 2GJ6E 1S7SB 4OM0H 5EU5A 5GGSB 1I1FA 3E1F1 4C83A 1AH1A 2GFBA 2ZCLH 3IDMA 1LEKA 3IDUA 4L4VD 4Z0XA 4Z7UF 2E9BA 4HC1A 2G75B 3SPVB 3X3GL 1J0IA 3HFML 5IJVB 3VXPB 1KACB 1Q9WA 5IGXH 4OT1H 4DGVL 4U1NA 1NGWB 3WFHA 1TTFA 2EO1A 2Q6WA 1YY8B 1JIBA 4G7VH 5C08D 1U8NB 3GSUA 3VFVA 1DQJA 4YFLI 1E27A 4MNQB 5GRUH 4N0UA 3SOBL 3TNNB 3QDGD 2Y25A 5IB1B 1SMAA 4NPYB 3CLEH 4YHKH 1FL6A 1MVFA 5EPMA 2R4SL 2RJMA 2V5TA 2EDBA 5I30L 3CX2A 1HILA 1MRFL 5JPNA 1OAZL 1RHHB 4OGZA 2MPAH 1JYVA 5D7JD 3SQOH 4LLWB 1YEKH 2VQ1A 4E41A 1I1RA 1K4CA 1LK2A 4KHXL 4ZS7L 4KVCH 2KKQA 1I1AB 4HUXA 4LU5L 1AJ7H 1HN1A 5DRWA 2ZZUT 4AENA 2UWEF 1CGXA 4RIRA 3ZE0E 1BJ1J 3BZEB 1KXVC 1R24B 5ETUB 2ID5A 2PR4L 2XN9B 4QHMB 2APVA 3RY5A 2ARJQ 4E9LA 3T1FA 4LSTL 4FQ2H 4PJDE 4ZUTA 2V7NA 4QHUB 5INDB 5BO1H 4M7KH 2F54D 4QRUA 3NIFF 4NGHL 5FEBA 1GZQA 4AMKL 4K7PL 3NFNA 4Y4KC 3QUXB 3ZL4H 3O4OB 3F7QA 4H0IA 3C08H 3WIFA 2DF3A 4OI7A 3VXMA 1OGTA 4XPFH 1KTRL 2UY6A 1QOKA 1IEAA 5FUZH 1INQA 3GMQA 2XXCB 2OBGA 1ZLWH 1B4RA 5BOZG 2B2XL 2HYMA 4ODVH 5DJAB 4PJ8A 3ES6A 2IANB 4MD5B 4KJWC 1L0QA 2FZ3B 1YY9D 2WBJD 1R3LB 5JR1H 4PLOB 3IRZA 1TPXB 2BVOA 2H9GA 1AGCA 3VXQA 4N0UE 3WL9B 4A6YH 2EH8H 3SDAA 4PGDA 5M7QA 1ZANH 3D39B 3DV6B 3O6FB 3ARDC 3VFTA 3FO0L 1BOGB 4S2SA 3B5HA 4PBVC 3ZO0A 4TSBL 4E41E 4OLVH 5HGGS 1GC1C 5CJOH 1Q9KA 2QQNL 5FOJA 3PHQB 3V6OA 2NW3B 2D7OA 2B1AH 2A73A 4GRWE 1H3XA 4AIOA 2F19H 3RY4A 2Q86A 4X7SH 3U36A 2BNRD 1HSAA 3ILQC 4KI1A 4LCWD 3ZYIA 1J8KA 3BD4A 4R26H 4O4YL 3H2WA 3LRHA 4RBPH 4WI7A 4KRMB 1F6LL 3KYAA 3D3VA 4BZ1L 4JVUA 1OGAD 1UXSB 1XCQA 3MREA 1TJIH 2M2DA 5BZWB 1GIGL 5E2TL 1DE4A 1UGNA 1KG0A 3K4AA 2R4RL 3VXME 3CX5J 4H5SA 4ZNEE 4KKCC 1AXTH 2Z93B 4GQPH 1DLFL 2QSQA 4R7NB 1QKZL 4OGYL 3RWDA 2ZP0T 2AJYH 4XNZB 1S9YB 1G7QA 3LS5H 1QSFB 2ZKHL 5B21A 5JZ7C 3GDBA 2FRGP 4U1MB 4C56E 5FK9A 3MQIA 5GSVB 1PAMA 1PSKL 2I60H 1CFBA 1JF5A 1F3DH 3T0EA 1YECH 3FHQA 3DIFB 4GRLD 4KHTH 4QO1A 4Y5XA 2H6PB 3O45A 4JPKL 5EH1A 1K4DB 4YC2B 1I3VA 5F97E 4PBWD 5BRZE 3GBLA 3ZHKA 4WGVB 3A6CL 4LGRB 1FORH 3T77B 4HKJB 3HC0B 5ILTH 2V9QA 5JO5B 3NAAL 5F72S 3UXFA 3FCTA 3S37H 2YEZB 4M7LT 3GRWA 1VKXB 3RZCD 5LBSH 5JUEH 1T89A 3V6OE 1F4YH 5L2KD 1U8JB 1ZK9A 2WINB 3OKLB 4H1LH 5DFTA 1HCVA 2GJZB 5BJTA 3QIWC 1S78D 5T1KB 3T4AA 1PYWB 3DGGB 3EOTL 3TO4C 3MODH 4YDLB 1VB9A 2EYSB 4ZO6A 3SJVE 1ZEAH 4CRPA 3HTLX 5F9WC 2QHRH 3D3VE 1JNJA 4MJIB 3IU4H 5GS0D 2VO5A 2EXWC 1N6QL 1DDHA 4FFVC 4KI5D 4N90D 1BVZA 3ZKND 3S9DB 4NZTH 2H32H 4EUPA 5HHOB 3VD9A 3BPNC 3X11B 4UTBH 5TDNB 4KRPD 3H3KA 3KPNA 3QI9D 5CGMA 1OAQH 4I0PB 3TVMD 1I9EA 3QHZL 3TN0D 1U41A 1KN4H 4WO4A 1F02I 1TTUA 1UM4H 4M6OL 3BP6A 2Z31C 2EKSB 3EOAA 5KSAB 4WWID 5BVPH 2ICES 2R15A 4R2GD 1AY1L 4M4PA 3L9RB 3RVWC 5A2IH 4I2XA 4OI8A 2ATPB 5L8LB 3N85L 4WW1B 1E28B 4MA7H 3SHSA 3RWHB 4X98A 4X4ZA 4XMPH 1MFCL 5FDYA 3SDCC 1J10A 1QBLL 4PGBA 4M7ZC 1U36A 4D9LL 3TBYB 3EYFA 3G08B 1HEZB 1YPZA 2FLBT 4PJ9A 3IGAA 3S5LA 3WDHA 1UYWH 4E5XB 1J1PL 1OB1A 1H3TA 1EHLL 4P4KD 5C3TA 2A6IB 3IF1A 4P23C 2MKWA 1DL7H 4D3CL 4NSKA 2OTPA 4NRXA 4HEPG 1YMHA 4BFEA 3HZYA 1IM3A 5EDXA 4APQB 4ZFGL 1MIML 3OX8B 3JWOL 2FEEL 4LVNC 5I1IH 5IG7A 1L7TL 5B39G 2QSCH 1L7IH 4ONOA 4WU7B 2L7JA 1A6UH 5C0JB 3L3OB 4LLQB 5I6XC 4OCYL 3DRTB 5KJRH 4XPAH 1CCZA 1HIMH 5IROC 2J12B 1CFSB 3L1OH 4GRMA 4PRIA 5DUML 5MEPA 4MAYA 4LCUA 3U46A 3OAUH 4H1LB 5DI8A 3MOAH 1CZ8L 3U9PL 2NXYB 1GGIH 4CADA 4J4PD 5I18H 4Y19A 3JXAA 4LSUL 1NBQA 3CCHB 3QUZB 2E7HA 4XNQA 1DFBH 1FDLH 4Q7DA 2PKDA 2IC2A 3T8XA 4XX1E 1QA9A 1KIPB 1YN6B 5DJ0A 2X7LB 1I9IL 1FGNL 5GS2H 4X80H 3AC0A 1WEJH 5B8CB 2VKWA 3MLTB 4UQ2A 2VDKH 3GIZL 5HGHB 2ZCLL 4RISL 4CJ0A 2HT3C 4R3SB 4JKPH 2IGFL 4XBEH 3KYNA 3QULB 4DUXA 1HQ4A 1MAMH 4HKBA 5DMKA 1QZ1A 5IVZA 5E1HB 4BZ2L 4DN3H 3FJTA 1B3JA 2DBJA 3HE6B 5IGXL 3A6BH 1A7QL 5LGKA 4OT1L 1JV5A 2Q87A 1UWEH 5C0CB 4N0YH 4LAQL 1OF2B 4RSVA 3WIIL 4RNRA 4TNVF 2MSPA 5DD5L 1UZ6E 3THML 1CLYH 5ELIA 4LBEB 4WHDA 3PIQA 1Z3GH 5F1IA 3QEQB 4NP4H 4L9LA 3NVQA 3VA2C 2UZXB 5F7EH 3WLWC 1HQRA 3BKYL 3NGBB 1KTDA 3QP3A 4RRPG 3LN9A 4JQIH 5B3JE 2KQNA 4O9HL 3MCKB 4WFGD 1NLBH 2Z8RA 1AJ7L 1PZ5B 4OIAA 2MWCA 5DD1L 3SO5A 3W0WD 1XEDA 3FN9A 3MYJA 4PRIE 1P5UA 3QSKB 2FCBA 3M8OH 5I74B 4IS6A 4DZ8B 4XT1C 2DKMA 1YY9C 2WBJC 3OKEA 3BVNA 4XWGL 3O6LH 1K3IA 3Q1SL 3UTTB 3A0OA 3QO1B 1D3CA 5KVFH 4Y19E 1REIA 1AKJA 1ZSDA 5T3XL 3HC4L 1XGQA 5DXWA 4YNYA 3H9SD 3ZHLA 1YNKH 2LE9A 1XF2A 3ZYZA 3BGFC 1BBDL 3WXVH 1CD1B 1U91B 1XGTA 2O5XH 3SDDB 4N5UA 4MD0A 5ENWB 3NCMA 2D7MA 3B83A 4UAOB 3OTTA 5EOQH 1LD9B 1RK1B 5IBLD 5HDOA 2X4QA 5FUCC 3DVGA 3EKCA 3GJFA 3FQXA 4JY6A 3EYSL 1BX2A 4Z7WF 4UOW0 1DQDH 4R4BA 2ICEA 2EDJA 4YHMH 4HGMA 3IDXH 3WNPA 3N50A 5AYUH 3IU3B 1MSPA 3HCVA 2BY0A 5DO2D 3LSOA 5TGBA 1YZZA 2DRUA 1Z5LA 2GJ6D 5FGCE 3TJHC 1FPTL 3LB6D 3QUKA 1HH9B 3PGDA 5DA0B 1P7KB 1BFSA 4UILL 3P30L 5F3BA 5K9QI 3BKMH 3MUJA 3SEPA 5AWNL 2Z4QA 5D1ZC 1JPSL 2W65A 4XPHH 4NKOB 1IC5L 1TNMA 2K7QA 3HUJB 5DJCB 4YH6A 5CJOL 4FQXD 1FVEA 3ARUA 4RFOH 2VSDA 2XI9A 5F9DC 2F19L 5DC0A 1DBJH 4GRLC 4X7SL 4D9RE 3VFOB 1M7XA 5HYJA 4HK3N 3KLSA 2Z8WC 4R26L 3DXAA 1JNLH 4DVBB 4UBDD 3Q6FA 2F5AL 3I6GA 4MXQD 5EO1B 4F58H 4LLDB 5E8OB 5DK0B 3DV4A 1WV7T 2GT9A 1OLLA 1Y6KR 1CGWA 3BGMA 4OD2A 1MNUL 4LARL 4PJAF 2XPGA 3NCCB 2Q8AL 4HZAA 4PRDB 2Y23A 3MNZA 5TQ0L 2VN7A 3RZCC 1ZTXH 1RZ8B 1TJHH 4LIQE 1IGML 2XQBL 1S7QA 5CEYA 3L3IA 4NQTA 5DK3A 2DB8A 4HPOH 1S78C 5DZNA 1X5LA 5DHYA 3IDYB 1U6AL 2I60L 5C0BE 3O3EA 4OM1H 3T3PF 4PJCE 2J6EH 2R2EB 3OZ9L 4MDJA 5CMAB 5ESAB 1E4XI 3ARBA 2A83A 1DQTA 5ICXA 4P5TB 4P2QA 1FJ1B 2HLAA 2CH8A 3CC5B 4W4NA 3SY0A 4Z8FH 1YEEH 4GBXA 5ECJE 3IJYB 1FORL 3DURB 3TA3C 1NEZA 3BZ4A 3QEGL 5C0AA 1OVZA 1BGXH 2ZCKL 3UBXG 3AUVA 1YYLH 2AW2A 4DN4H 3S37L 3PHSA 4UT6H 5D7SH 5I1HH 2YWYA 1F4YL 4Z7VB 1P6AB 3WO3B 5ICZB 4FQJH 3KLAB 4O51A 1TDQA 4ZOBA 5D1XA 4POZC 4O5LH 4UNTA 2ICWI 4TTGA 4X6FA 4AEIH 2NY4C 1Q0YL 3ZSTA 5SWZA 4HFWB 3DXAE 1MH5A 4M5YL 4Y5YC 3QCUH 4FZ8L 1RJZA 2KPNA 1OW0C 3VFUA 1QSZA 1FL3B 4E41D 3S4SB 4WW2A 4P3CH 5ITFA 1HXYB 4AH2A 5IFAH 5DURD 4P5MB 1IGFL 3WFCL 5GJTL 4L8CB 1EA9C 5C1MB 4MVBD 4YEEA 4M6AA 1EEZA 5IESL 5E6IA 1JF1A 4UTBL 3CXDL 1CG9A 3GSOA 3BPCA 2W60A 5IBUB 2VLLA 1DLHB 2VLRA 1JPTH 3DETC 2JJVA 3O2VH 1KUMA 3L5WA 4YBLC 1FNEB 1H3GA 1KN4L 3IJSA 2C3HA 1E6JH 1I1CA 1UM4L 2HJFA 3VFSB 2DQFA 5E7FA 3EJZD 3ARED 4P5KB 4MDIB 1DP0A 4JEGB 4NBXB 4XC1L 1I9RH 3VXMD 3IDNA 4OZGA 2V17H 3DX9A 3LKOA 5D72H 2WUCH 3Q48A 2YXMA 4KUZH 1FVCA 1IAKB 4JRXB 1KYOK 4JFYA 1MREH 1F6FB 3V2AR 2AVGA 5C0EA 4KAQH 3GSWB 4GMTH 4C56D 3WIHH 5C0AE 2NY2D 5HHXH 3T65B 4PJ8D 3SO3B 3UTSA 4Y16A 5J9PA 1MWAH 3B5GA 4HH9A 4AY0A 1U92A 3HB3C 3LQAH 1DBMH 3P4NB 3C5SA 3W39A 4A2MA 1AC6A 1WTGT 4HEME 5I66B 5L7XH 5FO8B 5I1LA 1JPGB 2PW2A 4LVEA 4MJ6A 1KTLB 5BRZD 2XWBA 4WFHE 4N1EA 5EA0H 3BEWA 5SWZE 3FQRA 1D9KA 2DMKA 4Q74A 5FCUL 1HDMB 2ED9A 2QSCL 4FQHA 2B5IB 1W0VB 1A2YB 4IMKA 3MRDA 4EQ3A 1RZ7H 1EBPA 4RMUA 3VWJB 1LO5A 3DECA 1O7SA 3MA9H 3RPIA 2FR4A 2BMKB 4GQ9L 3CDGB 3DROA 3P73A 3AS1A 1OM3H 5JNYB 5F21B 4LPUA 4OZFA 4KRNA 2Z8SA 1W2KT 1WWCA 2FJHB 4XPAL 1S9VB 5E2WL 3ARFC 2NYYC 1JFQH 4WHCA 3VU2A 2Z9TA 3L1OL 3MRBB 5EBLB 1LO4L 5FM4A 4YHIA 3SJVD 1H5BC 2PTTA 1UM6H 3MRGB 3D3VD 3OAUL 1JP5A 4BYHA 5B3NA 3MOAL 1G9ML 2P45B 8FABA 4MS8C 4P2RA 4PUBH 1GGIL 1VGEH 4X6CE 5HY9B 4LLYB 3NFSH 4PYGA 5AG8A 1QTYT 2FHCA 4Q2ZA 5CZVL 1FDLL 4PRPA 1LDPL 4OZGE 1CXHA 4KZEL 3CPLA 1UWGL 3WKMH 1RJLB 1EJ6A 4GFTB 1ORQB 2V2XB 4DVRH 3GMNB 2R0LL 2DTSA 4EXPX 4X80L 1BLNB 1WEJL 1FFQA 1XFPA 2EDNA 4U1IB 4R90H 3V95A 3VW3L 1AE6H 2BY3A 3T08A 1Q94B 5HJ3A 2VDKL 2CSPA 4KK6D 2N7BA 4JKPL 4OGXL 4NKDB 3ROLA 3QXVA 5C6TH 2ZUQB 3TZVA 2G75A 3FKUS 1EV2E 3MRQB 4YO0B 5IJVA 2NY3D 1EXUA 1Q0XL 1GGCH 5CJ5A 4UTAH 3V4PL 1NCAL 1EAPA 1H0DB 1LGVA 2BOCA 3KJ4B 3P0VH 2IQAB 1K2DA 4N0YL 1YY8A 4PJFF 3PDDA 2AJVL 1U8NA 1JYWA 3BMVA 4M5ZH 3HZVB 4MNQA 4ZG1A 4XGZA 2IAMB 5HVFB 3TNNA 1J1XH 3FB5A 5IMKB 3NZ8B 1XH3A 1G6RA 1CLYL 5IB1A 4NPYA 3DRQA 4NP4L 1FGVH 3KYOA 2UWEA 5C71A 4GSDH 4N8VB 1FFRA 1BECA 2BCKA 3D0LA 4JFFD 5DVOA 4FA8A 5LJYH 1HHKA 4LSSH 3N1PC 2HTLD 5EO0B 3QG7L 3QDJA 3JSSA 2V7HA 4Q0XL 1QO3A 1I1AA 3BRFA 5D5MB 1MWAB 2QKIB 1B0WA 1U8PB 2YA1A 4XNUH 2FIKB 1A6WH 1R24A 2X4TB 3M8OL 2AK1L 2XN9A 4QHMA 3GI8H 2OSLA 3ZDXF 1DJSA 2HFEA 2FJFA 4LCIL 2O61A 2O5YL 4P2RE 3CD4A 3K7UA 1FNSH 5I1CL 5KVFL 3S35L 2MHAB 4QHUA 3VRJA 5INDA 1UXWB 4PRPE 3F6IA 2VKXA 1TVBB 3I6KB 4EI6B 3QUXA 4UV4L 5CBEA 4K2UH 3RRQA 3Q5YA 3S37X 4AM0B 3VXUA 4MJ5B 4WO4D 2YD1A 4FQXC 3DI3B 4NCDA 4LCYA 2DD8H 3AU1A 2P42B 5DJAA 5HI4C 5HDBF 1Z2KA 2Q7NA 4MD5A 4X7TB 1X5XA 3FOMA 2E8YA 4ZUUA 1OAXH 4WCYH 1JGVH 4UBDC 2ZSWB 1R3LA 2D03L 1C7TA 1UVQB 4Y0GA 1Z6JT 3RWEB 1CQYA 4MNQE 2VXTL 3T2PA 3QG6A 3WL9A 1FV1A 3BKML 3DV6A 3PP3H 2VC2L 2ICCA 3HG1B 3FL7A 3O6FA 4JFEB 2DTMH 5JXAL 3LD8C 4K9EH 1BOGA 1BFTA 3GSNB 3SKNA 3S88L 3LRGA 3QDJE 1MHCB 5EO9A 3UYPA 5TFSL 5F93C 3OJVC 2NW3A 2RBLA 4YGVA 1DBBH 2HJLB 1V7NH 2AEPH 3KWWA 1S7RA 1EMTH 2XN9E 3MRJB 2V5YA 1DBJL 1EO7A 3BESR 5A1AA 3ILPB 3K8MA 3VMPA 4Q9CA 4JFDA 3T0BA 4Y4FC 5HYSB 1JNLL 3ELAT 2B4CH 1AIFB 4Y2DB 5E9DB 2BRRL 5BZWA 4MD4B 4XP4L 3C2AH 3QA3B 5EU7E 3GSQA 2PO6B 2VXQH 1MCWM 5GISL 4M6NL 4PRID 5TF1L 4LEOB 2Z93A 3VXUE 5IBTH 4R7NA 4LPTA 5DRXA 1E6OL 3WN5C 1ZTXL 3QISA 5AZ2H 3V9FA 3VRIA 3REWB 1XR8A 3UP1A 2OL3H 3MA7B 4U1MA 3UZQA 1IAMA 3PV7A 4Y19D 1OP9A 5GSVA 3BN9C 1UT9A 2YPLB 2WMPA 3MNWA 4WV1B 4DKDC 2D9QB 3O0RH 5I15H 1ZA6B 5C0RH 2CMRH 5HHNA 1K4DA 4PY7B 5HYEA 3PWLB 4NC0B 3VRLE 4MJ2A 1N3NA 3OMZA 1YJDL 3ARGC 4CMHB 4XXCC 3STZA 2PYFB 43CAB 1T7XA 1F4XH 3T77A 3HC0A 1G9NL 2NR6D 4P2OA 4NO3B 1P4BH 3QHTC 1PQZB 3EFDL 3MUHL 4DUVA 1QFWI 1CL7I 4HMDA 2P47B 2VE6A 1UWXH 4WWKD 2YEZA 1VKXA 4UT6L 4Z95H 2B39A 2CUIA 1H9VA 2WINA 3OKLA 8CGTA 4BKLA 3D2UA 2GJZA 3AREC 4GKOA 2GSIA 2DLFH 1KJ3L 1CDUA 1PYWA 2BNUB 4TOYH 1DN0A 4EJ1C 1WF5A 4KJPC 4KKNA 3VCLB 1SJEB 4L3CB 3T04D 3VXRB 3C60D 1D5IL 3QCUL 4N0FA 1MJ7L 1RURL 4MJIA 1Q9LB 2GUOB 4KK9C 2WUBH 3GKWH 3IKCA 4ZUVA 2FBJL 5HGAA 2NY2C 1T21A 5DFWH 1ZT1B 1KIUA 1P7QB 5FM5M 5TDNA 4ZUWA 5SX5H 4D9RD 1HE7A 4G8GB 4Y4HB 4PGJA 4I0PA 1I7UB 1JUFB 3N9GH 5EU4B 1E6JL 4NUJB 2E5EA 3RHWK 5IVXB 1A21A 3IFOA 3C8DA 5HI3C 1S7XA 4KKBD 5DMIL 3RNKB 4M43H 5I1DA 1AO7B 5DRZB 4AZ8A 4X5XB 5H37H 3L9RA 2Y6SD 1A3QA 4JFXA 4ZOCA 5HDQL 5T3XE 1I9RL 2YC1B 3FRPA 5E1AB 4JG0L 1AR1D 1E28A 1IGJB 2V17L 4IOFC 1UKSA 5I8OL 2WUCL 4JJHA 4KUZL 4Y2OA 5C92A 5FAAA 5LWYL 4O2CA 1MREL 5KSBB 1JWUB 3TBYA 1T1YB 5C0BD 1JMXA 3BDYH 1MWAL 3BQUB 5JA9A 1PKQB 3WJJC 1D5ZB 4GMSH 4P9HC 4OV6F 3MBEA 2IBZX 3JTTB 3MGOA 3SBWC 3S35X 3FONA 2Q76A 3ARZA 3G5YB 4DCQB 5SWQB 5EUOB 5EA0L 5J1TC 3ZDZF 4JO2L 1RUPH 3UJIL 3OX8A 3ZHDA 5BW7C 2Z35A 4MJIE 5DC9B 4RX4A 5T5FL 4ELMA 3UO1L 3D0VA 4URTB 4YHPA 3L3OA 3VXSB 1IAOA 4KK6C 1A3RH 4MXWH 4PP1D 3MA9L 3BH9B 1JZ7A 2CK0H 3DRTA 5HHOE 5CJXA 4M8VA 3M1BA 4EUPG 4OSUL 5F7KC 4TSAH 1CFSA 2NY3C 3O41B 1E4WH 3DXAD 2FO1A 4K8RH 4QXUH 3U7AA 4WJ5B 5AD0B 3QCTL 5IFHL 3FQWB 2H8PA 4PUBL 1ZGLP 1EPFA 2WP3O 4ZS6C 3CCHA 5C70A 1X44A 3P0YH 5CZKA 3KR3L 5HVWA 5CGYC 2W0FA 5IT2L 1BQLH 1R0AL 1KIPA 3WKML 1T22B 5B8CA 4AYFA 4EI5A 3GSNL 3MLTA 4HWZA 4R90L 1AE6L 3UYRL 3BRGC 5F8QC 5FO9B 5DSCB 5HGHA 5KW9H 2HP4A 2VR4A 2DN7A 3QULA 2UZIH 3QNXA 3HZKA 5IHUL 5C6TL 2BNQB 3S5LG 2Y5TB 4LK4A 3QAZB 4NO5B 4TRPH 1EGJH 3ARBD 2DMBA 2BSRA 4U0QB 4UTAL 2G2RA 4UZGA 3PWVB 3ZYOA 3JV5A 5C0CA 3P0VL 5DJ6A 3MRLA 1QFHA 1R5WB 2DQHL 5DGRA 4GBXD 4U6HA 1KELH 4LBEA 5C0AD 4ELME 5I19L 3K2MC 2EIZB 4LSVH 2BK8A 3QEQA 1LDSA 1UM5L 3U48A 1I8LA 2VMFA 4GSDL 3LKNB 4WTZA 1PEZA 3BISA 1BIIB 5D1QB 3AY4A 5TE7L 1TETL 1W72A 2D7NA 2Q1EA 1FG9C 4RDQF 4GAGL 2R8SL 1JGEB 5D1XD 4Y4KB 3NZHH 5MEQB 2CIKA 2EKJA 2IPTL 1V7MH 5SWZD 1TQBB 3V8OA 1A6WL 3CJJA 3GKZA 5DS8B 4YX2L 1EFQA 4TQEL 3T0DA 1NL0L 4HCRL 3QO1A 2YMXL 4JFZH 4XWOD 1XF3B 1FNSL 3GMOA 4U1JB 2WLYA 3MRPB 2EH7L 1JTPA 1VGKB 4GS7C 1KENL 3CFBB 2M1KA 2DI9A 4OLWH 2AJZB 3S6CA 1HNFA 2HFTA 2FX7H 2P24B 5GS1C 5E6ID 2CDGB 4IDLA 3GSVA 1CD1A 2UZYB 4XCNB 4K2UL 1BF2A 2AABL 3SDDA 1GCFA 1V05A 3W81A 2OZ4H 2C3XA 3FT3B 4ISVA 3RBGA 2FX8H 2VDMH 2DJ4A 4XMLH 4NZRL 5FYJH 1IMHC 4I4WB 1CF8H 2JF1A 1AD0B 5H2BA 2P5EB 5KS9F 2JJTC 3T3MF 4X8JA 5C0CE 3ALPA 1JGVL 5K9KA 3EO0B 3VI4E 2GY7B 4G6FB 4PGCA 4XPBL 5DMJB 5J0BA 3G5ZB 1CBVH 1HH9A 3EYVB 4HUWA 2PETA 1JHKH 3QUYB 2EYRA 5I8EB 3BFOA 1G84A 4DKEL 4RMSA 4Y16D 4R0LC 3QEQE 4G6ML 3HPJA 1YUHA 2NZ9C 1MHPL 3DOSA 3EYQC 2ZUSA 5CZXD 4KKAD 3TV3H 1YEDA 3AB0C 5F6IC 3KPMB 2FHFA 1J8HA 1I7RB 5FGBC 3WYRA 5DJCA 4DQOL 1MJJB 1DBKH 4QRTB 1HHJB 1QQDB 1DBBL 5D96C 1UCTA 3CFKB 4NHUA 1WVZA 2P4AB 3GMLA 5GGUA 3FQTA 5FDWB 1EMTL 4F7TB 3RX7A 3C6LA 3UTTE 1NGXB 4M1CC 2CLVB 1A02N 4HX1B 4LHUD 4ENED 4JM2C 3EAKA 3UPRB 5EO1A 1CK0H 4V1DB 1BREA 1RU9L 4HJJH 1BOYA 2B4CL 5E8OA 5MERA 2YSSB 4H8WC 7FABL 3CDCA 3K2UL 4U1HA 3MXWL 4YDVB 1NKOA 3C2AL 1F97A 1XGRB 3WS6A 3RUGB 2AXFB 4M7LL 4OCSL 4PRDA 2D7QA 1AP2B 4WWKC 5IBTL 4ZYKB 4DJMA 3RX5A 1S7UB 4P2RD 2D4DA 1OP5H 1JTTA 2CXGA 3OKDB 1F11A 5IHBA 1YDPB 1EVUA 1WIUA 4PRPD 4ODXB 3O0RL 5LXGL 2Q20A 2R2EA 3C60C 3FHAA 2X05A 4HWNA 2DJSA 4F3FB 1TMCB 3LQZB 5CMAA 15C8L 1MCWW 4P5TA 2VDLH 5FFLA 3D85B 1FJ1A 4N1CA 1FZJB 3CFJB 3QIWB 4KDTC 5FKPB 4S11A 2R29H 3HMWH 5KN5A 4LCCB 4J1UB 5EZIH 1F4XL 4L8DB 1S7WB 3TZVD 1P1ZB 1P4BL 3S36X 1G7LB 2VLJB 4Q6YA 4UB0H 4C4KO 4PG9B 3ULUL 2VDRH 1CLZH 2LV4A 2WBKA 2Y07H 3ZE1E 3RWCB 4JHAL 4LQFH 3BGAA 4MNQD 5ACMA 4F8TA 3U6RA 1F5WA 1CFTB 4JFOA 3BPNB 4TOYL 1P53A 2NW2A 3NA4A 1BQHB 1IQDB 4HFWA 3ZTNL 5C09B 2VH5L 4CVUA 3CH8A 3HI1B 1V3LA 1TQCC 1G7JB 4JQVC 2IH3B 2Z31B 1FL3A 4QYOB 1XF4A 4S1SH 4I3SL 1I1AD 1IBGH 2WSKA 2VABB 3MRMB 4O2FB 4L8CA 2D7TH 1WBXA 2C1PB 3C8KB 4JO3H 1A9EB 4OQTL 5CJQH 5LQBL 2XN9D 2HMIC 3V0WL 1IAIM 1MIEH 4GXUM 2NZIA 3SDCB 4GG6B 4X4MA 3MTRA 4M7ZB 1JF6A 3MACL 3WEXB 1DEEB 1IZJA 1FNEA 1A7PH 2AKRB 3FAXA 4PV8B 5B38A 5DUPH 1S3KL 4NRYB 1Q1JL 5GGVY 5DR5L 1NMAL 3IFNL 3QH3B 3QUXD 1X7QA 4CJ1A 1WT5A 4AJ0A 5F88B 2E6QA 1XZ0B 4HWEL 4JFHE 3VXUD 4OUUA 3EIFA 4X9GA 4PP1C 5IP4A 3O2DH 1IAKA 5IKCA 2FGZA 4ETQA 1EJOL 3ARQA 3VG0H 1F58H 3GSWA 3OR6A 1DQQB 4FNLH 4WI2A 1NEZG 2F53A 3T65A 2FX9L 5FUOH 3WHXA 4M1DH 2HVJB 4S1DC 4HIEB 4U4BA 3U4EA 4IM8A 1O7VA 4LGPB 1Q72H 3PDGA 4JCLA 4FZEH 4HLZG 1JWSB 1HNGA 1JPGA 1KTLA 4L3EA 5FA3B 1G0DA 1S7VB 1OSPL 4GXVH 5JLZB 2JCCF 3NOIA 1OTUD 2BJML 5KAQG 3MLUL 4WFEE 4P99A 1RUPL 2DMCA 3O6FD 5SWSB 5DZOA 4KMTH 2HA1A 1A2YA 1NAMB 4NKMB 1NBVL 2M26A 1AFVH 4GW4B 4QKXB 2VQTA 5ICYA 2GQHA 1D5MB 3RTQB 4QOKA 2F58H 4XHQA 1A3RL 2BMKA 4FFZL 1IGIH 4HKXA 1PBYA 3QIBA 4YDIH 1P4LA 5GGTH 4OFKA 3CMOH 1YQVH 2NY0C 1ZT4A 1IARB 4TSAL 3MRBA 4U33A 4X4ME 5L8KB 4WUKH 1XAUA 1E4WL 1PLGH 2PF6A 2VL5B 3MRGA 2MCG1 4UUJB 1Q38A 4K8RL 4QXUL 5FGRA 4JY5L 5DHXB 1BIHA 2VR5A 1EHNA 2X4UA 3RNQA 5HY9A 4LLYA 5ERWA 4WGWB 1HSBB 4KK5C 3W2DH 3C09C 3QO0B 1ETZB 1BQLL 1T20B 1GJIA 1RJLA 3BE1L 3OJDB 1ORQA 1OAKL 1JNHB 3OL2A 4JRXE 3UROR 1BLNA 4KGJA 2O93L 3O6ML 3NIDE 2F53E 3QPXL 4J6RL 5KW9L 5MENA 2DDQH 1QBAA 3PP4L 3B9DA 1AHWC 1GZPA 2VITB 1F2XK 5C07B 4PJFA 5HGBB 3EBAA 4YO0A 3UZVB 4NQXB 5LGHH 1MCQA 4TRPL 1BHGA 2AQ1A 5T3XD 5FB8B 5IHZB 1F4AA 1GGBL 4L3EE 2BERA 1IQWL 5EZOH 4W4OA 3RIFF 1P4IL 2E7LA 3HZVA 4RQQB 3MUGA 2GITB 5DVMA 3NZ8A 4JN2B 3MNVA 4G8FA 1FN4A 4QOKE 3UTZB 3L5HA 1OARH 1RJYA 1G7HB 5B4MC 2HJKA 1MCEA 3EHBD 4Z7WB 5DJ8B 1MCKA 5EO0A 3H8NA 4U6VL 3ZKQD 3LZFH 2EIDA 4OZFG 5T1KD 4LEXH 4Q6IA 2QKIA 4HF5H 2C3VB 1U8PA 1R3IH 1MLCB 1ZA3A 2X4TA 3GHEL 1QLRB 3E2HB 2VXVH 4KK8D 4MJID 2EYTB 5M94B 5DFVD 2MHAA 3PG2A 1CGYA 1LMKA 3KVQA 4CVXA 1RMFH 4G6AC 1RQ5A 1B6UA 1UXWA 1NEUA 4WEMB 5HHOD 1PG7W 1TVBA 3CX5K 1CXEA 1X9QA 4KY1H 3MLZH 2YZ1A 4I0PD 4AM0A 5C2BH 2OR7A 1NFDF 2MNUA 1AXIB 5MENE 2OZ4L 3O11B 5KSAD 4PS4L 5E5RB 32C2B 3QBTB 2VZUA 2KZWA 4YHYC 1KJMB 2RIKA 4TSCH 4IDJL 1XR9B 3X3FH 5J4MA 1KB5H 4LKXB 4ZSOB 1IKNA 1ZKAA 4PJIF 4PGEA 4PJAB 3JVGC 5D4QA 1BAFH 5GGRY 1RK0A 4Y1AB 3MLRL 4LSRH 3L7FB 1AGBA 3D25B 3PGCA 4J3WA 4NNXA 5I75C 3GSNA 5DJZB 4PJ5A 3WHE1 3MBED 3HMXL 3WNOA 1MHCA 3PJSB 5D5ME 4BUGA 2ICWB 4XRCB 3C6SA 1LP9B 4ZTPH 2ZUYA 3CNKA 5AZEH 5JMOC 4Z5RB 3MRJA 3DYPA 4RX4D 2UVFA 3ILPA 3PV6B 2DWEA 1ADQL 3KLDA 5IV2B 2ENSA 5HYSA 1A1OA 2IWGA 3ALWA 1FO0H 1AIFA 1FRGH 4ELKA 2YPVL 4HJJL 1F4WL 3REVA 3VXOA 3MJ6A 2F8OA 4QT5B 3OR7A 4MD4A 3SE8L 3JUYA 2PO6A 2CJUH 5HYQB 2EO9A 3KPQB 2AV7A 1UENA 1A6VH 1SY6L 5JXEC 2ZJSL 1RZGB 3WS3A 5DQDH 4DAGL 4MWFB 4Q97A 3S3JA 3Q5OA 5HHPA 1SBSH 1KLFA 2NXYD 2VLKA 2XA8H 4PJGB 4X7DC 3MA7A 2IPKB 4K3EL 3QUZD 3TA3B 3QFDA 2I5YH 4M48H 1MFDH 4KI5F 1ZA6A 4FQIH 4HCRA 2GCYB 1C7SA 1T5XB 4LL9A 4MQTB 1M71B 3W9DA 4PY7A 2X4NA 3PWLA 4Z0BH 1FVDB 3DTXB 3TPUB 2C26A 3RU8H 1NAML 3RVXC 3RAJH 4KQ4L 3WJLA 5HVGB 1ZMYA 4HPYL 3HI6H 2PYFA 2K3TA 2DLEA 4HUVB 4JFEE 5D2NA 4UINL 1PX3A 1PQZA 2CLRB 2D31B 4H25A 3TIEA 1MY5A 2XTJE 3HR5B 4PJ5E 5EBMB 5A16A 2ENYA 1RPQA 5C0CD 4EDWH 4NBZB 4PG2A 1UKQA 4EXKA 3DO7A 3RP1A 1MF2H 3D9AH 2VZSA 5EU7C 4G9DB 4YPJA 3P9LB 1KB5B 5IM7A 3QEQD 1LEGB 1SJEA 5INCA 3NFPA 2FATL 4CN4A 5FECB 1DBAH 2EDKA 4YBLB 4OLXL 4XP6L 1KULA 5F3HB 4W68A 5IQ9A 2JK5A 5DK2A 3MCLH 1DQLL 2H2PD 4JRYB 3C5JA 1QNZL 1IBGL 5FM5O 3SGKA 1A0QL 3DVFA 1ROWA 1UB5A 1P7QA 3ULVC 4AQOA 1T1XB 5E7BA 2XIDA 1MHEB 3GUTB 4F7MB 3UTTD 2Z0BA 1QRNB 4PJEF 1LO0H 2VLKE 1A7BA 1TJGH 4G43B 3RVVD 1RIUH 4F7CA 5L8JB 1T0MA 4P48A 3FB7B 2YPLE 4NUJA 5DUPL 5IVXA 1OTUC 1LNUA 1U58B 2HN7B 4HGWB 1AO7A 2I26N 3RL1B 4ZPVB 5DRZA 1DANT 4ODBD 3LEYL 3QZWA 4UIKL 1AGEB 3SDDD 5E1AA 5KANG 1FO0B 5GS3A 1IGJA 1MFAL 4OAWB 5J3HD 2V9TA 5DEGB 4HWUA 5KSUA 5J6GB 3U7WH 3O2DL 5DVNA 1I3RA 1NBYB 4MNHB 3HZMA 1LO3H 4BQ9A 1RUQH 2BSSB 5D2NE 2ZUUA 3VG0L 1JWUA 1T1YA 2KDGA 3MJ9A 2LABA 4JE4B 1B0GB 4YDJB 2YD7A 5FXCH 3EUUA 1PKQA 2E7BA 2MQ3A 4KQ3H 1VEPA 3JTTA 3PWNA 5A2FA 1L9NA 3UAJC 4GXVL 1FZMA 3FFDB 4OD1H 3ZDYF 5EUOA 1W0YT 3VXRE 3IAPA 3B2VL 4OZIF 3OGCA 1GOGA 1MCLA 5EORH 1JYNA 4JN1H 1NAKL 3VD7A 1CR9H 3KXFB 1E4KA 3VXSA 2QQLL 3TO2B 1I7ZA 2HH0L 3BH9A 3HAEH 1FCGA 2BY1A 1QLFB 1WFTA 2JB6B 1MFNA 4HIHB 5GGTL 1T1ZA 5CSBA 4G8GE 1S7TA 2CO7B 5BV7H 3U7YH 1E4XL 1OAUH 1HINH 1MCDA 1UH3A 3QDMB 3MFGB 1G7MA 4KMLB 1WGOA 1RHFA 4ZDHA 5IVXE 1UJ3B 4LLUB 1S8DB 1AO7E 3FQWA 2DQDH 1WFOA 2LTQB 3UJJH 1FSKC 3DLQR 2LAGB 1QFWH 1CL7H 3FRPG 4XH2B 3K74B 4QEGA 4XXDB 1ITBB 4PRBA 1T22A 3SKOB 3ZLQC 4JANB 1FZKA 5E0QA 5K9JL 2FWOA 2IQ9L 1GVIA 2RHEA 1NFKA 5KSBE 5FO9A 1C1EL 4JREB 1EO5A 4PRNB 3C87A 2ZG2A 1KJ2H 4UQ3B 4OQTA 4YDLC 3CFEB 1XIWA 4Z9KB 4GKSB 5HTSA 1PKQE 2BNQA 4FQ1H 2XZQH 2Y5TA 4OCMC 3RPKA 1ORSB 3LKSA 4KK8C 1I8MB 5LGHL 1YEJH 1M05B 4P5TD 2HT2D 4TULH 4NHCH 1EERB 3PWVA 1QHOA 4JFHD 2AGJL 3L3GB 2YK1L 2EEBA 4QRPB 5EUOE 2IALB 1RIHL 2R1XB 4CW1B 1OCWL 3PHOA 2EIZA 4HZLB 3IFLL 1KPVA 3VXSE 4OKVB 4Z7OF 1OARL 3LKNA 2EDQA 4NC1C 1KF9B 1BIIA 9CGTA 2BX5A 3FOLB 1CQKA 2BHYA 5D7IF 5KSAC 3DGCR 1FAIL 4ZAKB 2FGWH 4YPGB 3LZFL 4X5WA 2XWJB 4Y4KA 4ODWB 5ITBL 3ULUE 5I1KL 2X9YA 2A6KB 3JWDH 3HE7B 4WFED 3OV6A 4OGAD 3ME0A 3ZZ1A 2BVQB 2ADIA 3RFZC 3WXWH 1DUYA 5DHVH 2JTDA 2VXVL 4I1NB 4M8QB 2NTFB 4OLYH 4PTUA 4UU9A 2VL4A 4U1JA 3MRPA 3I50L 4IEFB 3V4UL 3OGOE 3T2QA 1UACL 3AFLA 5C8JA 4WY7L 3WFDL 1KEMH 4ALAH 1T3FB 4KVNH 3ZTJG 4U3XA 4RGOL 4HIIB 4XCNA 5JW3H 3P40A 35C8L 5C2BL 5ADOH 5CBAA 4WHYH 5L6YL 3HAEB 3FT3A 3PNWA 4JLRB 1A1NB 2D0GA 1U95B 4APQC 4Z76A 4HIJB 1U8OB 2BNQE 5BV7B 2LQRA 2X6MA 4I4WA 1FLTX 1WBYA 2N7AA 3VGEA 3ARDA 3WO4C 3LD8B 2AS5M 3H3PH 5DDHB 4N5ED 1HH6B 2HTKC 1KB5L 3KPLB 5DYOB 3Q5TA 3FB6A 1EFXB 3TYGL 5IR1A 3SGDH 4JRXD 3ZE0F 1JZ2A 1BAFL 3JTSB 3MOBH 5E08L 5D9SB 3T0WA 1GOHA 2F53D 5I8EA 3VI3E 4LSRL 5KSVB 2PXYB 4I3GA 2VQUA 5J56B 1S5HA 4PJDF 2R2CA 1MCNA 4HXBH 4KROB 4Y4FB 2HRPH 1NGYA 4WTZG 3VFGL 4GG8B 4IOSD 5IW6B 1X5JA 1KJ2B 2I9TA 4L3ED 3ULSB 2VDOL 4QRTA 3QUZC 1SYVA 4KZDH 4JG1L 2IFFL 3CFKA 1JZ4A 4P9MH 2AV1B 4XCCH 5IMOA 1L4IA 4NUGL 2C5DC 2OTUB 3WN5B 3AROA 1NGXA 5F7DB 3VWJD 2CLVA 4HX1A 1FL5B 4QOKD 5ISZA 1P9MC 3UPRA 4V1DA 2P8PB 1FO0L 5HXMA 1FRGL 5A43C 2A6JB 2YSSA 3K0WA 2R69L 1JZ8A 3EO9H 4XC3L 2XFXA 4GAJH 3TFKC 4YXHH 3IDGA 3RUGA 2AXFA 3WLBB 3HE6C 4XNXH 5FYKH 2QR0B 4QWWD 1I9JH 5EN2A 4RMTA 3LAFA 3ARGB 4NM8H 5GJSL 12E8H 1FIGL 1WK0A 2XA8L 1CFVL 4DW2H 2VUYA 3OKDA 2X89A 1U3ZA 4PJHB 4L1HA 3OAZH 4ODXA 1NANI 4YHZH 5DHVB 3UTOA 1J1OL 1MFDL 4F33B 5I1EH 2EEDA 2GSGA 4JZJA 2HLFD 3LQZA 4FTVB 4RWYH 5GZND 4GRWF 3ARYA 4U6XB 1I3GH 2VZVA 2NXZB 3RU8L 1FZJA 3CFJA 1J0HA 3QIWA 4I0CC 3RAJL 5KVGH 3NA9H 5MEND 1ZVHA 2C4FT 2LFGA 4LSPH 5KOMC 3TO4A 3BZFB 3BP5B 3L95B 4GJTB 5I74C 5EUKB 4MQSB 4I5BB 4LPXA 4PB0H 2MMXA 2VLJA 2PW1B 4P46B 3TJEL 1BBJB 4PG9A 2WBWB 3O3DB 5IHLB 3RWCA 4JPWH 5HVHB 5F7YC 5CUSL 2IAMD 1AQDB 3DWTA 3SDAC 4U2YA 2C1OB 4HFUL 1WWWX 3EYUL 3NCEB 4UIMA 1Q8MA 3TBWA 2H3NB 1DBAL 4V1DE 5J3HC 1UC6A 5L88L 3EO1B 2Z31A 4QCIA 4HK0A 5E8NB 5C0GB 3RUGE 4U1GB 4Y88A 1N2RB 3MRMA 3QQ4A 4ZXBC 2EECA 5JOPE 2C1PA 3C8KA 3CVHH 5L9DH 1X5ZA 3TBVB 3HMXA 1ZLSL 3JV4A 4Y89A 3SDCA 2I24N 1TJGL 4G80B 1DEEA 2AKRA 4FHBD 4PV8A 5BVJA 1KLUA 5DD3H 5DD0L 4QF1B 3VWKC 1KCRH 1B2WL 1EEQA 1ADQA 3QH3A 1OY3B 4RGNC 5F44A 3DX7A 3FN3A 4CAGA 3SDXB 4P23A 3TCLA 1XZ0A 4U1LA 4WEBL 4JGMA 3NBNA 4CMMB 4XPGL 1RZJH 5IB5B 3ESUF 1HI6B 2ITDA 3FMGH 4NJAH 1ZHLB 1SY6A 3BHBB 3E8UL 2XZZA 3T0EC 2VLJE 4BUHA 2DIAA 3V52H 2DQIH 3PQYB 4LMQE 1VESA 4ETYA 5I1GH 2R1WB 3ARWA 1X5YA 3GJEB 4L4VA 5IF0A 1S7VA 1I8KB 4D0DB 1ED3B 3B9AA 5EOCJ 5JW5A 5EFIB 5T5NF 5JORB 5IROA 4KJQD 5J1AB 3HG1D 4JFED 1NCCL 4QTIH 4I3RL 2XTJD 1NAMA 4ODSH 4NKMA 1QFOA 1IT9L 5C08A 1D5MA 1MFEH 3BD5A 1U2HA 5IOPA 3ECBA 3PWPB 1XF5A 2DOCA 1CXFA 4M02A 4PP2B 3V6ZA 4H26B 4GUPB 3FO2B 5BV7L 3GO1H 3QEUA 1BVLB 1ZE3C 1YEHH 4O58H 1MJ8L 1ZAGA 4QHNB 1ACYL 1VCAA 4ERSH 5B38G 1A4KB 3B2UD 1VA9A 3RA7L 4XNMA 4HMCA 4G42B 2JLLA 2PO6D 1HSBA 4Y5VC 1AC0A 3QR2A 3WNMA 3QO0A 1ETZA 4NQUA 4F7PB 3QUMH 1CL7L 3OJDA 3V0VA 2DM2A 4YUEH 5C7XL 1WZ1H 3TT3L 5DD6A 4X9BA 4NYLA 1OWWA 3H42H 5GGQH 4R4FL 3U79A 2NY1B 4NCC1 2YPLD 3MV7A 3R0MA 5EBWB 2GK2A 2VITA 1A7RH 1OT1A 4LNRB 1HOCB 1UQSB 2I9LB 2DQCL 4OGAC 5F1NB 2YRPA 1SEQL 4RA0C 3QQ9C 2MQ0A 4NQXA 1YEJL 4UV7H 4XP1H 1TZGH 4YHOL 4CVZB 5GRJH 4ZO9A 4BFIB 3UTQB 5EU3A 4MGXA 4OF8A 4RQQA 4FG6D 2BVTA 2GITA 2F9BT 4M62H 2WBJA 4FFWC 3WD5H 4XTRC 3MLVH 3KNBB 5I17B 4ONFL 1ES0B 4FXGB 5F7LB 5DJ8A 4TUJA 4NQEB 2WANA 5CP7A 4JQXC 2IADA 1ZLUH 4IRJC 5GS1B 5DMYA 1JNNH 4P49A 1MCSA 2C3VA 5I16A 1MLCA 3ZMRA 4PJ7B 4J3OC 3VXRD 2D2OA 3N1QC 2DQUH 1FNHA 5CP3H 1KCSH 2C7UB 1QLRA 2Y36H 3WXWL 3KPPA 4OLYL 4QTHA 2O5ZL 5CFHA 1K8DB 2EYTA 5HD8C 4G7YH 4F9PC 1NFDA 3SO3C 3G6DL 1UH4A 1BQSA 1QVOB 2R0WL 1P7QD 4ALAL 4TTDD 4Y4HD 4G8GD 5JW3L 3WSQL 3FZUC 3CH1A 1ZHKB 4KTDH 1UZ6F 2FHBA 4JHWL 3G6JB 1A7NL 4QRSB 1NGQH 2FIRT 3MV7E 4NKQB 3O11A 4PJIA 4V2BA 3VH8A 4DFHA 4HUUB 5C07E 1AO7D 4HDIB 1SJVA 32C2A 5D1ZA 1YEGH 3EDKA 3C9NB 1YYMH 3VWJC 3H3PL 1RFDH 3GBMH 4LKXA 5B3JF 1CFNA 5GRVL 1AI1H 1AXSB 2WAHA 3LN4B 1T83C 25C8L 4E0RB 3QIUC 1NMBL 5D96B 3VFRB 3MOBL 2JIXB 3FQNB 5T1LB 4ONGL 1MCBA 3L7FA 4GRLA 3QUMB 3D25A 2OQJB 3FFCB 2F15A 3BQUD 4HXBL 4BSJA 4GAFB 3T2OA 1J5OH 2HKHH 2LVEA 1VFBB 3PJSA 1T03L 1PW3A 4XVJL 4XRCA 1LP9A 4KZDL 2DQTL 4XBGB 2OJZL 1VFAB 1HCFX 5T33H 3TT1H 5ESQB 1SQ2N 1GOFA 3RZCA 3PV6A 4GKNA 1NCTA 1ZLVH 2R2BA 5L2KA 4XHJD 3VXSD 4Z7QE 5FUCE 3RDTB 4P9HL 2PNDA 4JDTH 4NJ9L 3BT2H 1VERA 5BXFB 1NGPL 4QT5A 4IBLT 1SYSA 3VDCA 3BSZL 4YXHL 3MBXH 3KPQA 3ULUD 4GO6B 3EJYD 3SDYH 3DO3A 5E00B 3U2SB 3GMMA 4L5FL 2DWDA 3DMMC 1A8JH 3MLXL 5IJKC 2APBA 4PJIE 4NM8L 1FLRH 4AG4H 3LQMA 12E8L 4WFFE 2IAMC 3TA3A 4J3VA 2NNAB 3CAFA 5L2JB 3OKKB 2IJ0C 3MUY1 1Y18A 5C2UB 1FBIH 5LAXB 4ZSOE 4YHZL 2GCYA 5I1EL 4JZOB 3MYZA 1JWMA 2IH1B 1FVDA 4Y1AE 5TE4L 4QXWA 5CIPB 3T2NH 3VA6A 1BVKB 6CGTA 2X09A 1NH6A 1ZWIA 2OTWB 2ILLA 4CDHA 3MJ8B 2BFVH 2W9EH 5J7CC 3LQAC 4HUVA 1I8IA 2P8MB 3U1SL 4CNIB 2BNQD 2D31A 4Y5YA 1AGFB 1Q9OB 1OW0A 2W1NA 1TQCB 1I75A 3G5VB 2AJSH 4NQVB 4NDMB 3NPSC 2E9IA 1LP9E 4WNQB 3S34L 2DBLL 1INDL 2XNAB 2NX5A 1JJUA 4G9DA 3EW3B 5J6HB 3P9LA 5F96H 4ODHL 2RFXB 2I07B 5GRWA 3F12A 1LEGA 5BMFL 3QNZB 1CLOH 3S97C 3HA0A 5HYSG 1DANU 3BD3A 3OKMB 3RWGB 1FZOB 2J88H 4PJCF 5LGJB 1XF1A 3F58L 1F90L 1EX0A 2F74B 3VE0A 4FFYH 4Y4KD 2Z91B 5E6ZA 2GIYA 1SM3H 4D9QE 3MRIA 4FP8L 2ADFL 3F62A 1FNFA 1RUML 5L9DL 3MZTA 2A77L 4F7MA 4ZFFA 1QRNA 5E4EC 5T3ZH 2DQJH 5CJBA 1IGCH 3EOBB 4X99B 5D71H 1D6VH 2C3GA 3A6OA 3CSBA 3FB7A 3V5HB 3PABB 1RUKH 3LMJL 4CU8A 1U58A 2ERJC 4KJQC 1NDMB 4HGWA 4NNYB 4DZBB 3E6HA 4ZPVA 4KJWD 1GXEA 3GB7B 4KWUA 3ETBF 5GQBA 5IEKB 2UYLB 1RZIA 3UJTL 3UYOD 1C5BH 4BFGA 4R8WL 3VXNB 4OAWA 5DEGA 4QRRB 4S1RH 3GGWB 3NTCH 5C86A 3MPCA 4NWTH 3BWUC 2QTEA 4MNHA 5JW4R 2FSEB 2L0DA 4NJAL 1BM3H 1NLDH 1IAIL 1JGDB 5C0DA 5D7LB 4XPTL 3SKJH 2AJUH 5FIEA 3ARDD 3DPBA 3R06B 2R39A 4WHTB 1X3DA 4K8RD 2CK2A 3V52L 2X9XA 4OBSA 4OZIA 4TYUA 3B2UC 3HHRB 4Y2DC 1HHHB 3CZFA 4G6FD 4L29B 4JAMB 2AEQH 4YBQC 2NX5E 4FABL 4JR9H 3QUYD 5CINH 3SCMC 3FFDA 3ARFA 3BP4B 4HUMB 1U8HB 3ILQD 1DTUA 1S9WB 4DEPB 4X6DB 5B39B 4W6WB 3K3QA 5GIRB 1PG7X 1K6QL 1H5BA 2XKNB 3GFUA 1G1YA 5LCVL 4RAUB 4NWUL 5KVEH 1KPRB 2F54B 4WV1C 4R97C 1KGCE 1V3KA 2YA0A 4I8DA 4MA8H 1YNTB 3LS4H 2AJ3B 4D8PB 1EUUA 4KXZI 2V2WA 1EUTA 1QRNE 3STBA 4IRSC 3LH2L 3KPTA 1FFPB 2V5RA 4YGAB 1YEHL 3QDMA 4M9OA 5JZ7D 1N6UA 2YPKA 4V1DD 4CMHC 4HJGA 1XMWA 5CLTA 1QEWB 5JOEA 4FMFA 3E3QE 1AHWB 4NZUH 5TH2B 1JHTB 3UC0H 1IC4L 1ITCA 5ADPH 2FB4H 2Q8BH 1T4KA 3QZWG 5DEZA 3QUML 5JOPD 2GKIA 3HKFA 4PLKC 2J4WH 1F3DJ 2UUDH 4YWGH 3H9SA 4U1KA 4CVWA 2XXMB 5GS0H 3BUYA 3HNSH 3HNTL 2P44B 2EXYC 4PRNA 2X89D 4ODUA 4M6MH 4LPWA 1NQBA 1P7HL 4WW2F 1FP5A 1WFUA 3BH8A 4BA8A 4GKSA 3P4OA 1KCKA 5H94B 3IVKB 1I8MA 5JA8B 1M05A 2Z8VC 1CD9B 3U0WL 1TZGL 3D85D 3L3GA 5HGDB 2R0ZH 3OKNB 3QIWD 3NABL 5FO7A 3AXLA 3G6AA 4QRPA 2JB5H 2IALA 3PWJA 2WWKO 4K9EC 1C5DB 3TO4D 4CW1A 5BQ7B 2RCSL 5ID1B 2NLJB 4TTDC 2VLJD 4Y4HC 5DZLA 4NQCA 1TZIB 4X6CF 5E94A 3WD5L 4F9LA 1J05B 4OKVA 4NQDA 2EXWD 1JHLH 5FGSA 3OXRB 2CRYA 3MLVL 1UB6A 1OGAB 2VNCA 3RWJB 5ID0B 4OZGF 5AYQA 3F5WA 4ODWA 1OPGL 5DJYB 4U6YB 2I27N 3FO9A 2B4CC 3QDME 1BFOB 4HS8L 4TVPL 2OP4H 3SKUD 4FQXA 5CCKH 4M8QA 3Q3GA 2Z31D 3GHBL 3QQNA 5JQHC 5C0IA 4HS6B 5E03A 4G7YL 3CSYB 1QYGH 3KS0J 2BOBA 1WBZB 2OR9H 2GI7A 4JRWA 1U8IA 2NY7H 4N8CH 4F37K 1G9EA 5IWLC 1KCUH 3BQUC 4HIIA 4YHLH 1KB9J 1IM9B 3WCYA 1T66C 3LKRB 3SDCD 1IGYB 5FYLH 1JZ5A 5HYFA 3B3IB 4M3KB 1JTOA 2ZOKB 5AEAA 4NNPL 1NGQL 3IJHB 1M7IA 3V4VL 1A1NA 4AEEA 1U95A 1U2CA 3RBSA 2CDEB 1U8OA 1B4JL 2YZ8A 5I75B 4D94A 5GZOD 1KBGH 5DDHA 4P23D 1HH6A 4XHJC 2AEWA 3O3BB 2D0FA 5DYOA 2BHZA 3BYYA 1PFCA 5GRZA 4PJDA 4QRPE 3R0NA 2FL5A 5E5MB 3U0PA 4I18C 5D9SA 1FH5H 4PBXA 4RZCA 1VACB 5KSVA 1PGRB 1P2CA 4NQCE 5CILH 3W11C 5JTWA 1R3JB 4NQDE 1OQXA 3PDOB 4Y4FA 4OCXH 3AS3A 3C5ZC 5TPWH 4KTEH 5IW6A 3ULSA 3QQ3B 5DTFB 3N1MC 5GHWH 3T4YA 1L0XA 4XP9L 3I75A 2OX5A 5SWSD 1ZVSA 4GLRH 4NO2A 3MGTB 2OTUA 4PRHB 3WN5A 3TVMB 1MFBL 1ZHNA 1WLHA 2BC4A 1XCTB 1FL5A 3DI2B 1MI5B 1MCRA 4M1GH 1R5IB 2L4OA 5I76B 2A6JA 3BT2L 2HWZH 3LKPA 1TVHB 2AI0H 2GK0B 3MBXL 4QGYA 1T7ZA 2C4FU 3B9VA 3QAZC 4MQXC 1NC2B 2ED7A 3V6FB 5J11B 1CGVA 4U2ZA 3MRRB 3VGHA 5CWSB 1KN2H 4M7JL 3ARGA 1F6AA 2HT3D 4H0HB 5CEZL 4XXCA 1GSMA 1FYTA 2OJEB 4TUOA 1J12A 4ZFOB 1FG2A 4K71C 1NCWL 3RHWF 4P4KB 4FTVA 5K9OA 5D1QC 1RULH 5IW1B 2CKBH 3MFFA 1ONQB 1KTKE 3DSFL 3AREA 3AS2A 4L9DA 2WM0A 3MV7D 4KMQA 2BFVL 2EE3A 1TQBC 3BZFA 2JELH 3L95A 5C07D 5EUKA 4ZNEA 3IYLW 4I5BA 4PJXB 4LSDA 4IMLB 4AEHH 4HWBA 1BBJA 4KH2A 3EJJX 1ZHBB 3WLWD 1IEBB 4PPTA 2XZCH 1H15B 3U30B 1X5GA 5TDPB 1CGSH 1Y6NR 2DM4A 4C56A 3WHE0 1AQDA 2C1OA 1CVRA 3GBNH 1KJVA 1VENA 2ZWLT 4WEUD 1PD6A 3CFCL 2WIIB 1F13A 5JDSB 5DQJB 2H3NA 3RQ3A 4OF3A 1CLOL 4NBYB 1AD9A 5BRZA 3Q6GH 3EO1A 4EVNB 3NCFB 4OFYD 4XP5L 4UDTA 1UJTA 2J88L 5DRNB 5E8NA 1U93B 4N1HB 1I7TB 1RUAL 5C0GA 1JCKA 2ORBH 4L8BB 3OPZH 5D8JL 2DM7A 4RFEB 3VRLF 5EOCL 4K8RC 1VADB 2V5MA 4R6UA 3OQ3B 1J0YA 1BFVH 1HZHH 1R3KB 1H3PL 4UDUB 2FNBA 5F9OH 1NBZA 4AIXA 1GGUA 4HSQA 1CN4A 4G80A 2ZUWA 5T3ZL 1FYTE 2DQJL 3ZE2E 1IGCL 3KYMA 4NO0B 3QUYC 4QF1A 3AAZA 5DWUH 2FLRT 2X10A 4OJFH 3G04A 2QADB 4FTVE 1YN7B 3VJ6A 3SJVA 2DYPB 3WJJA 2VXSH 2FJGB 3RL2B 4ZTOL 4JPIB 1IRAY 1XGPB 3SBWA 3TJHD 1EO8L 1A14H 4S1RL 3NTCL 3IAQA 2B1HH 2W91A 3X17A 5E8EB 3PL6B 2X4OA 4WFFD 3BHBA 2VIRB 5BW7A 5GGVH 1CDHA 1YEFL 1LEIB 3SKJL 5D1ZD 3HS0B 3BWAB 3MLWL 1CU4H 1U42A 2R1WA 3LKQB 3O3AA 1Y0LA 3RJDA 3FB8A 3GMRB 4Y1AD 1CIDA 3LY6A 4D0DA 1B0RA 1X5AA 2RQ8A 5CS7A 5JHDB 5IVNA 3H7LA 4OIBA 3IRPX 4MLIA 4JO1L 4XMKL 4XB7A 4XB8A 1CT8A 1EEYB 3FT2B 5HI5C 3MRFA 4K3JH 4BSVA 5IB2A 5KVEL 5E2UH 4BH8A 3S7GA 1OP3K 3IDIB 2CPCA 3D69A 3O2WH 5I8KH 5IFJB 4PP2A 1FSKB 1FC2D 3FQUB 4PR5B 4H26A 1NANH 3LS4L 4GUPA 4HC1H 4S10A 1JI2A 4D0BB 4G6KL 3NACH 5ACZB 2A9NL 2YN5A 1N5YH 5DJDB 4JFFA 3KPSB 4QHNA 4JB9L 1FE8H 4LSQL 4G8IA 4LCCC 4ZUSB 2A1WL 3OXSB 4G42A 2BY2A 2J1KA 4NZUL 4F57H 1N4XH 3UC0L 4J12A 4UMGA 4D9QD 3SDXE 2FB4L 2YD2A 2ESVB 2MKLC 3LRSB 4X5LA 4A6YB 4KJYA 3KPRB 1JZ3A 5C6WH 5KANI 4NM4L 4LLMA 2J4WL 1MRDL 3F7VA 4P59H 3TA3D 3A67L 3KS0H 4M6ML 5IK3B 1HOCA 4S1QL 1IGTB 2I9LA 4OB5H 3E0GA 3PQYE 4GRWH 1IKFH 4FN0A 5F1NA 2X4PB 1A5FL 4QGTA 1JGLH 1HHIA 1KIRB 3N06B 2ZOLB 3OKOB 4YR6B 4CVZA 4GAYA 2FYYB 1T2QL 2XQYG 3V5KB 4ZQKB 4BFIA 4P57B 4POZD 3UTQA 3VFPB 2JB5L 2XA3A 2NY4D 4YXKL 4U7KA 5EWIL 1G6VK 4LQ1A 4MAUL 3HC3L 1F3JB 4Z78A 4ONHA 5F6HI 1U8LA 5MEOB 4XCEB 4YDKL 4JHBA 4I48B 2W38A 1F42A 3U4BH 2Y7QB 4O00A 3ARPA 1ES0A 2FD6H 4HWBH 5I17A 4PJBB 3PWPE 4FXGA 4K7FB 1IL1A 3MLYL 2HVKA 2NX5D 4BSWA 5KZCB 1RVFH 1NDGA 4LVOC 4PTTB 4DTGH 5IB3A 1YNLH 5GZOC 4DGYH 4PJ7A 1ND0A 4JFFE 3DETD 4HXAL 4OZ4B 3GIVB 3V8CA 2C7UA 4ZFOL 5IEHA 5LG1A 5FHAL 1NUFA 1OD9A 5CCKL 5CLWA 1JGUH 5JPMA 1K8DA 1NKRA 3KJ6H 5GSRB 3FRUA 4ZFZB 2QV2A 4K7PX 5TQ2L 1LO2H 3MRNA 4JPVL 3FT4B 3WO4B 3MO1A 5GRVK 1KGCD 4KRLB 2JJTA 1KCUL 1CICC 2FEDC 2Q3ZA 4I9WE 2AK4B 3TH3T 4YHLL 3MRHA 5EU5B 4FQCH 1QRND 4OCRH 1I1FB 5FYLL 1ZHKA 4C83B 3IDMB 4QRSA 4UOW1 2IG2L 4Z0XB 1YC7A 4ELMF 4Z7NE 3I2CH 4JJ5A 3DBXA 4HJ0C 1MCOL 4R0LA 3MRCA 5D70L 3HB3D 5C9JB 1Q9WB 3C9NA 4RCAA 1JI1A 3O9WC 5J89A 3ULVL 3RTQC 3WFHB 5FGBA 2Q6WB 5EBGA 1AXSA 1CTNA 3GSUB 1T5WB 1DQJB 2E27L 1E27B 3EOYG 4W6YB 1NUDA 4OIIH 4AL8H 3VFRA 3FQNA 5T1LA 1FH5L 4N0CC 1FL6B 3H7BA 3RI5K 1A7OH 5EC1B 3P2TA 4OM0L 4NKIH 3TBTB 3DX6A 4OCXL 4JM2A 4EKXA 5TPWL 2H32B 3OG4B 3NH7H 1LK2B 1K9TA 4M3JA 4HUXB 2CIIA 4AENB 3ARFD 1S9XA 2NYYD 3CUPA 2OR8A 4PJ7E 5GHWL 1G7PA 4XBGA 1VFAA 3L3JA 1X5FA 4WWKA 5DF0A 4IHOB 3T1FB 5ESVA 5DJ2B 4G7VL 4ZUTB 1HKLH 5KBNC 4MS8D 1U3JA 1PKOA 5GRUL 3R1GH 3FN0H 5BXFA 1X4XA 1GZQB 3NFNB 3CLEL 4YHKL 2AXHA 2PTVA 2WLZA 1DSFH 2R2HA 3NIGE 3VI4F 3C60A 3WIFB 1V3JA 3VXMB 3BPLC 1OGTB 5E00A 2MPAL 3BRDA 1MRCH 1DEDA 3SQOL 3G6JE 2R0KH 3QDMD 1YEKL 4QRQB 3GRWH 1INQB 3GMQB 3VGFA 4KVCL 4KDTA 2Q7YB 4IJ3B 3VH8G 3KYKH 4GW1A 4PJ8B 2NNAA 3ES6B 5L2JA 4YJZL 5EIVA 1NC4B 2ZNWA 5HHVH 5LAXA 3X12B 1PEWA 2HFGH 4JZOA 3VDAA 4MHHG 4Z6AT 4FQ2L 3VDBA 1IFHH 1RULL 2BVOB 2H9GB 2VOTA 2F8VA 3VXQB 4BM7A 5BO1L 2OS7A 4M7KL 4YXLH 1CYGA 4H20H 5CIPA 3VG9B 2WP3T 3SDAB 2C9AA 4PGDB 2OTWA 3MJ8A 3ZL4L 3FFCE 2EDLA 1NCBH 3TYFA 2JELL 3C08L 4ZD3H 1KC5H 3BP7A 4S2SB 4EUPH 3MOQA 3E2HC 4XPFL 1AGFA 1Q9OA 4AEHL 4UI2A 1Q9KB 5FUZL 2BVYA 3G5VA 4JVWA 4NDMA 2XZCL 2A73B 1V5JA 4QRPD 2RGSA 3FAWA 4WNQA 4ODVL 4PV9B 2AP2A 1UA6H 3W5NA 5MP6H 5C0BA 1PY4A 1W8NA 2ZPKH 2XY2A 4IRZH 4ZXBB 4PJCA 3U36B 1HSAB 3E6FA 2RFXA 4OF5A 2I07A 3GBNL 4HMEA 4NQCD 5I73B 3INUH 5JR1L 2P1YA 3UDWC 4NQDD 2XV6B 1EZVY 3CFIC 1C08B 1XCQB 2X2YA 3MREB 4A6YL 2EH8L 4ZAKD 5I9QC 3P11H 1FNAA 4R96B 1BJMA 2DM3A 4X4XA 3VWKB 1ZANL 2Y4SA 1KG0B 1OAYH 3GSRA 4RGNB 5IUSA 3HE7D 4OLVL 4AT6B 4Y8DC 3BKJH 2YD3A 1BFVL 1G7QB 4OZHB 5F9AC 1GHFH 2B1AL 5GGRB 3V5HA 5DVLA 1X4YA 4J8RB 3GK8H 1V8HA 4TVPE 5HI4D 3T0EB 5DWUL 4NNYA 1KCVH 2ADGB 4M93B 3HPLB 2W0KA 3P77B 3GB7A 4Y5XB 4DGIH 1SEBA 5BZDA 3ZE1F 5EU6B 3BO8B 3O8XC 4MCZA 4OFDA 1WC7B 3VXNA 1MLBA 4G5ZH 1INEH 4MA1C 1TJIL 2OXHA 2GAZA 3GGWA 1X4ZA 2DKSA 5D7LA 5GGVL 1AXTL 3R06A 2UVEA 2ATKA 3FCTB 4WHTA 5T1DH 1P6FA 2NPLX 1CU4L 2AJYL 4OD3H 3LS5L 3I3EA 1EFXD 4MA3B 5DGQA 2SEBA 1H3WM 3PWUA 4L29A 5BJTB 3TEUA 2CR6A 1YECL 1K8IB 2AAVA 3BP4A 4KHTL 5DEFA 1S9WA 1KXTB 3NCJH 5B39A 4X6DA 5AUMA 3OAYK 1II4E 2ITCA 4KROD 2LU7A 4Y4FD 2G5BA 3EDFA 2Y5EA 1WIOA 4RAUA 3AS0A 4UT9H 5E2UL 5FF6A 5ILTL 4EUPB 3O2WL 4Y5VB 3DJ9A 5H35B </