1QD0A

Camelid heavy chain variable domains provide efficient combining sites to haptens
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
128
structure length
128
Chain Sequence
QVQLQESGGGLVQAGGSLRLSCAASGRAASGHGHYGMGWFRQVPGKEREFVAAIRWSGKETWYKDSVKGRFTISRDNAKTTVYLQMNSLKGEDTAVYYCAARPVRVADISLPVGFDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords VHH-R2 ANTI-RR6 ANTIBODY
publication title Camelid heavy-chain variable domains provide efficient combining sites to haptens.
pubmed doi rcsb
total genus 24
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 1999-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qd0A00
2HFGL 2SEBB 2VR5A 4ZAKD 3JSSA 4PTUB 4JDVA 4IJ3B 4AENB 5IW1B 4PJ9B 1LGVA 4RBPH 4F7PA 1YNLL 4OLYL 3O6FC 3V9FA 4NN6C 1ZHLA 3AAZB 3NCJL 5K9QI 5EWIL 1NFDE 4PGDB 1K2DB 3TN0C 4BFIA 4C56E 1X5AA 3CFDB 1ZA3B 1ACYL 4YK4B 5EOTB 1B4JL 2QQQA 1YPZE 1IGJB 3G04A 1MLCB 4XP1H 1IQDA 3BUYA 1W0VA 3MR9B 3DYPA 4G6FD 4ZAKB 3WDHA 5HD8D 4L9LA 1X5XA 1L7IH 1BQHB 5C07A 3ZL4L 1YJDC 1HEZB 1BAFL 1PYWA 3GMRB 4Z7UB 4V1DA 4PJCE 3EJZD 4H1LH 2J8HA 1BM3H 4KJYB 1X5JA 3TA3A 3ULSA 5L6YL 4WWKD 4LSTL 4ZOAA 4L3CB 4HFUH 1SYVB 3D3VD 4G6FB 1XF4A 4FMFA 1RZIA 1WWBX 2MQ0A 4RQQB 1ZLSL 2H8PA 4OLEA 1KULA 5JQHC 5FUOH 1GGYA 3UXFA 5I17B 1PVHA 4Q7DA 4WU7B 5I75B 3QCUL 2BSTA 4YDIL 4WWKB 2LTQC 2VDPH 4XNMB 4DUVA 3HNTH 4MNHB 5F6HI 3MUGB 4OZ4B 3C5ZD 4PG9A 3D3VB 1FL5B 3PWPB 4TULL 1JMXA 3U0TB 5FEBA 4K07A 5CBEB 4OCLC 1KCLA 3HUJA 4P99A 4DJMA 1MCLA 5DUML 4LQ1A 5FGCE 4DK6A 1RZFH 4NRYA 3BKYH 2C1OB 2OZ4H 4UMGA 5C0NC 1A7QL 3GMOB 1KIQB 2R1WA 4K2UL 5IB5B 3RAJH 3MV7A 3ULVH 2A6IA 5GS0H 1OCWH 1F3JA 3C5ZB 4GS7C 4Y1AA 2WNGA 3MGTB 3BQUD 4PJ7E 4CVZB 2AKRB 3AY4A 4S0SD 1S9KC 4KU1A 5ITFB 4KFZC 1QFWI 5E8EB 1LE5A 3GKWL 2DS4A 4C56D 3BYTA 1FH5L 4FG6D 3AC0A 1S9XA 3MMEA 3JWOH 1GPOL 1K4CA 1P2CB 3G5ZA 3ARWA 4G3YL 2UVEA 5IB2A 1KPVB 3E6HA 3QDHA 3HLAB 3OBAA 2P42B 3OG6B 1NMAH 3BQUB 4QRPA 2ZUVA 1Y0LA 1D5MA 4X5XA 1YYMH 1KB9K 1JRHI 2NY1D 1JCKA 4ODUA 5EIVA 2VQ1B 3ARVA 4C56B 4Y16A 1HXYB 3DGGA 3SKUD 4G9DB 3SKNA 1YPZB 4Y8AA 2W9DH 3MLZH 3QEGL 4MYWB 2J7LA 4ZO8A 2DQHL 5GRJL 4K3DH 4LFHD 5IMLB 4NQVA 4KQ4H 4E5XB 3HCVA 1JNJA 1I9JL 5JUEH 5JTWA 2XPGA 4KH2A 2NY1B 2CIIB 4CW1B 4LQFH 3WIIL 2HFTA 1MHHA 4X5WA 1FL6B 4BA8A 3PIQA 1M71A 2WAHA 3FQXB 4Q6IC 1B0GB 5BOPA 3NH7L 3MCG1 3O45A 4ELMF 4Z7VF 1EHAA 3P73B 1RZKH 1IILE 3L3KA 2R2EA 1ZHBB 2DQJL 1Z3GL 2VXVH 1I7TA 4JFZH 1LK3L 4NCC2 1F4YL 4OIIL 4XXDA 4K7FA 3NVQA 3CFBB 3PGFH 3L6FA 1KNOA 4N0RA 5BRZE 1T3FA 1LO3L 4PRNA 4CDGC 1CR9L 4D9LL 1DUYB 4P23C 2CSPA 3I75B 3Q5YA 4HWUA 4J3TA 2DYPA 4K94C 4YDVB 1RD6A 2CO6B 5FGCB 2BX5A 1C12A 3LCYA 2IANE 3OL2A 3NZHL 5HYIA 5KS9B 3OPZH 4LGPB 1RJYB 1IAKA 3UAJD 4P9MH 1F13A 4TUJB 3WLWD 1BEYL 5D1XC 1J1XH 1JK8A 4GBXA 1PX3A 1V5JA 2GFBA 5DC9B 4Z5RA 2E7LC 2FD6H 3QDGE 3AMLA 4FQXD 4OM1H 4ZS7L 1UADC 2BSSA 1A3RH 4F7CB 3ARDD 3MCLL 3VFNB 3TH2T 4WI8A 2YEZA 4Z7OE 5GGRB 5F7WC 3DO7B 3B2UC 1J0YA 2HT4C 4ZTOH 3MLVH 5MP6L 2KL6A 3C5JB 4PGJA 4GMSH 3L5HA 1XGYH 3QDME 1H3PL 4TOYH 1EX0A 3WFDH 1MFEL 1GJIA 1ZT7B 5DXWA 4LLMA 4FQXB 3L7EB 1CFTB 4Z0XA 4LIQH 4X7TB 4UB0L 3C09C 5I0ZA 5I16A 4X5LA 1U8JB 3ARDB 4L8DA 4A6YB 5IROA 4MX7B 2VR4A 1T4KA 1LP9A 4JG1L 1FNHA 3U36B 1J0JA 1FNAA 5HSFA 2A9NL 1EO8L 5TPWH 3NGBB 4X9GA 4OZFB 4PJGA 2UWEE 3BZEA 4IOFC 4J3SA 9CGTA 4ZO7A 3N0PB 4L4VA 6FABH 2DLIA 5CEZE 4LHUA 3MODL 5CKGA 5B38G 1NDGB 3VFUA 4LL9A 3CVHA 3TBYA 3KS0J 2H32B 5I6XB 1VFBA 1ZLWK 4EN3D 5T3XH 4MCZA 3L7FB 2IAND 4QWWD 4ZOEA 4IMKC 3A67L 1LQSR 2DRUA 4NQSB 4YXHL 1RIVL 4Y4KB 3BH8B 3ZDXF 3KNBB 4OAWB 1OAZH 4OBSA 4UINL 1AO7D 1DFBH 1JNLH 2X89D 1CGSL 3FTGA 3R06B 3VGFA 5F44A 4H1LA 2DWDB 4NHUA 4P4KD 1LEIB 4K8RD 1MQ8A 2YUWA 2IANB 5C6WH 4PREB 3QT2A 1O7SA 1DL7L 4HMCA 4RMSA 1AHWC 2ATKB 5GPRA 1I7RA 1CQKA 5EZOH 3W81A 3U0PB 4DAGL 2V9QA 3CVIH 1AO7B 3QDMD 4K9EL 3CXHK 4RMTA 4WO4A 2GJ6A 2WZPD 1T1XB 3VWKD 3VE0B 2ARJQ 4PJHA 3PHOB 4URTB 1HQRB 2VH5L 4P4KB 5FECA 1UEMA 3LQAC 1KJVB 1OT2A 1E6JL 4P5TA 3T0EE 1ZVYA 1EA9C 1FLTX 1FHGA 5CMAB 2IQ9L 2FHBA 4GXVL 4ZQKA 5DURD 1R3JB 5D1QA 3SY0B 4KY1L 1WICA 2A6KB 2AABL 3QDMB 3VRJA 2BC4A 3I9GH 3UPCA 2IQAB 2JJTC 3E8UH 3VWKB 4MGXA 3HC0B 1AD0A 4GUPA 3LS5L 3OB0H 2OZ4A 4I77L 5F8RC 2XQBL 5GJTL 4UT6H 5B39B 1GIGH 4C55A 3LEYH 1NSNL 4S1DC 5F9DC 5FO8B 5DVNA 3OKLA 2BRRL 4JM2D 1BD2D 1OP9A 4IIQC 1TJHL 2DM4A 2EXWC 2ICWA 4IS6A 2UWEB 2VAAB 4HS3B 1QG3A 4LSVH 3KPNA 3A6BL 2ED9A 2BFVH 5JIKA 1QSFE 3SKMB 5FK9A 1XCTA 1P4BH 3P0YL 3TBTA 3VXRE 1MH5A 4F7TB 3FKUS 5FO9B 3H42L 3OR7A 2R8SH 1OD7A 3VFRA 4Y88A 4QXTB 3O2DA 1U36A 4J8RB 4D0DA 4OD2B 2MQ3A 4F57L 1ES0A 4AL8H 3MBEA 4JM2B 1HHHA 1BD2B 1FORH 4KQ3H 3P9MB 5CD3B 2W59A 3NAAL 3QUKB 5HHPB 3V5HA 1E4JA 3GRWH 1NGQH 1UA6H 2P43B 4JKWA 3FOLB 4YIQB 3EOAB 4QTIH 4GRLC 3RWEB 3NABL 2VDQL 4P57A 4QXUH 4EI5D 3GSRA 5DQJA 4TNWK 5J12C 3LAFA 2E9JA 3KJ6L 4G8EA 4L8SC 3OWEA 1DEEB 3LB6C 4LCCA 3KPSA 4TNWF 2PYED 1INEH 3T0ED 1DBBH 1OB1A 3CFKA 4BSVA 4UV7H 5EU7E 4JFXB 5I1JL 5I8CA 3IRPX 3VRIA 3D39D 3QEQA 4X6FA 4EI5B 2RCSH 5C0CE 3VGAC 4ONFH 3P77B 4NM4H 1KCSL 3AMKA 3LMJH 4Y5VC 1UM6H 5IV2B 3OR6A 2PYEB 3IDMA 3QIWC 1YUHB 4YE4L 3RUGF 3B9KA 3T0EB 3PP3H 4G7YH 1YEFH 2UY7A 3BZ4A 2XACC 4B41A 1F5WA 4QNPE 4N0YH 1ZWIA 4LMQE 3T0VA 3U82B 5IWLA 2HLFD 1IGMH 1NBVL 5JLZB 1OSPL 3M1BA 4I48A 4YLQT 5FYKD 1QSFD 5FF6A 1FO0A 1BECA 4PRPE 1RFDH 3S35X 3VXRD 1IKNA 1ED3A 4RZCA 5GGVY 1Z0MA 4BH7B 3ULUD 2IPTH 1URLA 5JNYA 2OSLB 1G0DA 2Y23A 5GRZA 5TE4H 1F11A 4RNRB 4YHZL 3C5SA 4UQ3B 5E5RB 4HIHB 4F2MB 1B88A 4LAQH 5BZWA 1J12A 1GGIH 1QSFB 5CIPA 1VERA 1D3CA 2CKBB 3VXRB 3TC9A 3H2WA 4GW5A 1Q0YH 1X6LA 1A5FH 1NANI 4PRAA 5FYLL 5EBLA 1JPGA 5GRWA 4NQEE 2FJGA 4HGMA 1JF1A 2F5BH 4IJ3C 3UTOA 5IBUG 4B50A 2RAMA 3QEUB 1S7SA 4JB9H 5I1CL 1EJ6A 4HUWA 3ZKMD 1E4XI 4HKZB 1W0WA 4X4YA 1U8QA 1MCSA 3IDJA 1AJ7H 2YD8A 4OGYH 3SN6N 2DTMH 1QLRB 4JDTL 1V8HA 4KTYA 4TSCH 4ZAKC 2RFXB 4I9WE 5BVJB 4GMTH 1IT9H 4D94A 1NC4D 5E2TL 1C5BL 3REVB 2FX9H 1CIUA 1I8KB 4L9LC 1K8DA 3TVMD 1HIML 4MNQE 1A6AB 3DECA 4XBGB 4PRHA 3GMMA 2VDRL 3STLA 4O2CA 1TQCC 3S36H 5C0CB 4MMXC 1XGRA 4HZLA 1NC4A 2R0LH 4QGYA 4ZFFA 3CXDL 4PRPD 1G9NL 5DUPH 3VFPB 3RKPA 5A16A 4PJXE 3CZFB 4NDMA 5DYOA 3V8OA 3UJJL 3QCVH 3UDWA 4XMKH 1U93A 2VZ3A 2PW2A 3PV6B 4FP8L 5I75C 3TVMB 3EJZC 3QQNA 1FBIL 3FQTB 4WWKC 5F6IC 2WP3O 25C8L 4PGBB 2EZ0C 5I74B 5CD5D 3DVNA 3BYYA 3O4LA 3O11B 4TNVK 4PRPB 3PABB 1Q72H 1JPST 4KZEH 4R90H 4XH2B 5EUOA 1J87A 1OSZB 2RBLA 4LCUB 5CZKA 4NQED 4PV8B 3V7AG 3V0VB 1NDMA 4KAQL 4OUOA 5GRUH 3RWGA 4L3EA 1MJ8H 3H3KA 2VE6B 4ZUUA 3VXQB 3TT1L 3ZE2E 1JWSB 3P40A 1NEZB 2J3SA 3BE1H 5I15H 2FECL 5IJKA 4XGZB 4OBRA 1CFVH 1OAYH 3ISWA 2GJZA 1SJEA 4G6ML 4WI2A 3AU1B 3UJTL 4ZYKB 4NQEB 4NQCE 3UBXB 2DL9A 5C0GB 3FO0H 1OGAA 2QSCL 4CMHB 1C7TA 1FC1A 2VMFA 3GSXA 4ZOBA 35C8H 2XV6B 2E5EA 3S3SA 1SM3H 1R3LB 3WSQL 2PKDA 3MRRB 1XGUB 4NKDB 4MS8D 1B0WA 2DQDL 4FG6C 1V7NH 4OGAD 3TO2B 2A1WH 4W6XB 4M6NL 3QXAA 4Y16C 1KACB 3ZYIA 5IFAH 3RNKB 3FN0H 1FJ1A 4HLJA 4Z7WF 1U8MA 3FL7A 4RFOH 1JHLL 5FHBH 1NKRA 4JPIA 1TETL 4UIMB 2V2XB 1ZEAH 3DOSA 4Q0XL 4D9QD 5HI5D 2VDLL 5IIEB 4UAOB 1YEEH 3LEXB 1F4XL 2L4OA 2HTKD 2JCCA 3QFJD 4ZUSB 3MUHL 2JB5L 2X4RB 1RZ7L 1SY6H 1Z5LB 3CLEL 4PJXB 3P4LA 4WHCA 3I50L 3DRTA 3MFGB 3RVUD 1KENL 4H26B 1Q9OA 1K8IB 5ID1A 4OJFH 5T1DH 5KSBA 3HI5H 2H2SD 3IF1B 4HJ0C 2Z92A 2ADGA 2DQUH 3FQUA 2Y06H 2VLLA 2F53A 1C08A 1E4KA 1KB5H 2QKIB 4Y4FD 5FO7B 3WYRA 5EU5A 1VGEH 3DHMA 3U4EB 1NCCH 4OCYL 3LSOB 1Y6MR 2XRAH 1JGEA 2ILLA 1CL7H 4NQCD 3WFEH 4DCQB 2ERJB 3IDYB 1L7IL 3RBSA 1Z6JT 4XVUD 1HOCA 4KMTH 2YRLA 1U95B 1CU4H 2B20A 3CU7A 2NTFA 4U6YB 2XG5A 4W81A 1A6ZB 4Y4FB 1BM3L 5ISZA 2X70B 4P49A 2E8YA 5DMGD 2VISA 2P4AB 5DJ6A 4Y5YB 5HGAB 4RAVB 3O3UN 1U8OA 4HHAB 3RPIA 1NCWH 4FHBD 4NQCB 4D0BB 2ZOKB 1I3UA 3B5GA 5FUOL 4M7KH 3TYGH 3DX6A 2QSVA 1F45A 3O41B 5E5MB 2NMSA 1BJMA 4UUJB 3WNPA 1EPFA 3N50A 3O3BB 2F19H 4YUEH 1MCEA 3TV3H 1CDGA 1YNTA 2AJVH 2ARWA 2GITB 3HNTL 4JJ5A 5DEFB 3LKQB 5EPMA 4AY0A 5IROC 3VMPA 1S7QA 2DQFB 3FOMB 5GSVA 2OQJA 4U31A 4ZD3H 2J6EL 4BFEA 4G8GE 3QG6B 4FFWD 5CILL 2OJZL 1RZFL 3SDYH 5HYJE 4MLIA 2MHAA 3G5XB 3RAJL 3VFOA 4Q9RL 3ULVL 1F90H 1FYHB 1OCWL 2X42A 4J6RH 5IM7A 4UIKH 1ZHNA 2F54E 3HZKA 1JWMA 1G6RH 2X9XA 4P3CH 2E8ZA 2EEAA 1OARH 4S1QL 4R96A 4NNYA 3VCLA 5I6XC 4NQXB 5C0BE 1WBXB 4X6DF 1W72A 4UOW0 1S7VA 3QXDA 4WFEE 2V9RA 4N8VA 4QRQB 5DA4A 1ZMYA 5F72S 1NMAL 4HUVA 3VH8A 3S4SA 1RVFL 3BN9D 5AUMA 2Z8RA 4MSWB 1A1NA 1AGEB 4CVWA 4LVNB 4EN3C 1XCQA 1CDJA 4DOHB 2VC2H 5HGGS 1HCVA 7FABL 3ZYOA 1D5IH 4F7EA 3HI1B 4PJ5A 2VLRA 4KQ4L 3EZ8A 1S7XB 4XCYB 4XPHL 5JUEL 3KPOA 1TNNA 1YECL 5HPMA 3BPOB 2P48B 4LQFL 2HJFB 2DB8A 3OKKA 5GJSL 5DJYB 3EYSH 5HTSA 4WO4C 4P4KC 1DJSA 2DICA 2FBJH 3OKEB 1P1ZB 2VZUA 2JJUA 2BVUA 5F7LB 1Z0NA 2D7QA 5GRVL 4YFLF 4AEEA 4Y89A 1QEWA 1YEKL 3B43A 4W6YB 1S7RB 4OCRH 5F7EH 1A7RH 3MRNB 4FS0A 2VXVL 1TZIA 5D1QC 4G8GD 2DD8H 3PGFL 2WINB 1FG2A 3I6LE 5ITBH 4XP6L 2EYTA 4ERSH 1WFTA 3QQ4A 2AEQH 4K23L 3VDAA 5CEYA 1J5OL 2F54D 1NFIB 2WQ8A 3ZKNC 4P59H 5C0BD 4G8GB 2EYSA 2IFGA 5HYJB 3OPZL 3LOWA 2HP4A 1KC5H 5HDBF 4S1RH 1RHHA 5EBWB 3L9RA 4AIOA 1H8OA 2ORBH 2JE8A 1JNHB 2A0LD 5B4MC 1I7UB 4WUUE 2YK1L 3WFHA 2F54B 4OF3A 2FD6L 4S2SB 5ACZA 1NC2A 3VFWA 2O93L 3SE3C 5E8OB 1A3RL 5IVOA 2LAAA 5C0BB 1J05A 5DVLA 5EO1A 4QRRA 3GSOA 5F96L 3GB7A 4GLRH 1HCFX 3AS3A 3UTTA 3MLVL 2CK0H 1R3HB 4ORGB 5D6CA 3SKJL 2G5RA 1EBPA 3P4MA 1XGYL 4M8QA 1KCVH 4X98B 4L29B 5IQ9A 3JTSB 1F97A 1MLBB 5DD1H 1B0RA 1Q94A 3CAFA 5DFVD 2WWKO 4W68A 3VFTB 4QYOB 2C4FU 4D8PB 1E0OB 1RJLB 5JORB 5HJ3A 5DJ0A 2O61B 1UKSA 4PLJD 4M6MH 1MCNA 3QHFL 5CEXB 5ESAA 2VN7A 2HG5A 4GSDH 4EI5C 2ADJA 5I0DA 4TVSa 6FABL 2EIEA 1CXEA 4LCWE 1CCZA 3PDGA 4OLWH 3VI4E 1BJ1J 3MRFB 4DGVL 3NCYP 5TQ2L 4CRPA 2DM7A 3P9LA 4Z77A 3WEXB 3B9KC 1EHLL 4HCRH 1WZMA 1J1OH 2Z9TA 4JN1L 1A8JH 1IEAB 3KWWB 4JO2H 3T4YB 2J8UE 4LCIH 4TTDD 3O3AA 1T7XA 4NN7B 1X5YA 3QXTA 3SE4A 5CP3A 5CUSH 5TGBB 4FQIH 4S0TD 2OR7A 3VD5A 3VXMA 4JFQB 4FQLL 4PJ8D 4KHTL 3P4OA 1CF8L 1RUQH 1IKNC 5JDSB 4BZ1H 1HHKB 1T6WA 4L8BB 1T7YA 4F37K 3GSUB 2HLFC 4IHOA 1HILA 1WT5A 1TCRB 4KDTA 1L4IA 1IGTB 4GRWE 4F37F 1FL3A 3MCKA 1RZ8B 3SE9H 1DN2A 1A2YA 2JIXD 3CVIL 4PRBA 3WUWB 4PJ8B 1JUFB 5T5NG 3ULUC 4MAUH 2NNAA 15C8H 4PJFE 5GGUA 5C0RH 5C07E 4EVNB 4RAUA 3LQZA 4PGCA 1S5HB 1Q9KA 2ESVE 4HQQL 1JTPA 4V1DE 1E27A 1V05A 5T3ZH 3T8XA 5E1HB 5DMYA 3HZVA 2AXJA 3BDXA 1OM3H 2GY5A 4J3VA 4OZIA 3MRKB 2NCMA 3C9NB 3RWCA 1CFSB 5IK3A 3I9GL 4XWGH 5IB4B 2FATH 4U1HB 5ICXA 3NN8A 4ZPTB 4HDIB 4LHQB 4XRCB 2FX7H 2ICWJ 1IKFH 4XX1G 4JFPA 4LCWD 3LKNA 2BVPA 2CDFB 4FQHA 5GHWL 2HT3D 4WGVB 1EVTC 5IJVB 4RMUA 1CT8B 4KI5C 4WTWA 1KJ3L 4X80L 3IETB 4LSVL 1FRGH 2GY7B 1X4XA 4PS4L 2XKNA 5AAWA 1MFAH 2W65B 3W0WE 1CDIA 3L95A 4HC1H 3HUJE 1J8HD 1YDPB 4BQ8A 1Y6KR 3IKCA 4LPWA 3EOBA 3HKFA 4LCWB 4JHAL 4M43L 1HQ4B 1XR8A 2VLKE 1HDMA 1FNSL 4KDVA 3WUZA 3P4NA 5FYLE 1HHGA 1V3MA 3M8OH 3TVMC 4Y1AE 5CJ8A 1EHXA 2EC8A 3VD9A 5E6ID 4KQ3L 4MAYA 4YHIB 1DBMH 3GBNH 4PUBL 2BOBB 1SBSH 5I74C 3GRWL 1UA6L 1TTUA 1J8HB 3BGFB 2JJWA 4QTIL 1R5WA 5CP7A 4F58H 1AP2B 3G08A 3SDAA 4WU5A 3BPNB 3HC4L 3MLRH 4I1NB 1XIWD 3BKJH 2ITCB 4WNQB 1UENA 4Z9KB 3SDCA 4QRPE 1D6VH 3T0WA 1BZQK 2IF7A 3B6SB 2VLME 3F7VA 3GI8H 4LRNL 5DUBA 4HIXH 1INEL 2ESVD 4MD4B 2W0KA 3O3DA 1DDHA 4HS6A 1KJ2H 1XGQB 1U92B 4GRWB 3VW3H 2VSDA 1S7WB 3RVWC 3FRPA 4LPUA 3WXWH 2RCSL 1TVBB 1X7QB 3BUYB 1FNLA 1W0VB 1XIWB 4ONFL 1KBGL 1OTTC 4JRYD 4PJFB 5C07B 4WHTB 4H8WH 2ESVB 3MRQB 1JPFA 1GCFA 4G7YL 4XTRD 2GI7A 1YEFL 1X5HA 3THMH 3TA3B 2WLYA 1I8IB 4LGSB 1F8TH 5GS3A 4JFHE 1FYTA 4N0YL 5IF0A 1KV3A 1NUGA 4BH8B 4X7DC 4GAGL 1MRFH 1CFNA 4JRYB 3QUXA 5DT1L 1MWAH 3W0WD 4LLVA 4GJTB 1ZXQA 1RFDL 3NZ8A 4PBVC 4CL7A 3RTQA 1L9NA 4L1DA 5FM5O 1UCBL 5E8PA 4FTVA 5FYLD 2FZ3B 1Q9WA 4L5FH 2CMRH 3B9DA 2XA8L 5D7IF 3BEVA 2AS5M 5F88B 5AZEL 4DQOL 4LAQL 5AYQA 4JANA 4UQ2A 2OK0H 2CLVB 3W0WB 4B7IA 3V6FB 1IC7H 1Q9LA 5B8CB 1ADQA 2IFFL 2WIIA 2PTTB 3OXRB 5SX4H 2X4NB 1Q0YL 4FXKB 5HXMA 4N9OB 2VLKB 5DQ9A 3KPTA 4N1EA 1A5FL 2EDQA 2R1WB 4QRUB 4HKXA 1GAFH 1R6VA 4Y1AB 1CFQB 4ISVA 3UYPA 5HI5C 2F5BL 5DEZA 3MJ7A 4JB9L 4DZ8A 4ZDHA 2HTKC 1EFXA 1T0PB 1EJOH 5E2JA 5DRWA 1T66D 1N5AB 3QRGH 4ETYA 4BJLA 2X4TB 3T3PF 2FJFA 1E4KC 4OGYL 2R2HA 2DTML 3NACH 3RVUC 4OV5A 3KPPA 4NN5C 2ENYA 3GO1H 2Q7YA 1KOAA 3RWJA 5I76B 4GMTL 1IT9L 3UTZB 3IDXH 2H2SC 3IDYC 3RZWA 4JHZA 1U8LA 2F74B 3LV3B 4FN0A 2HH0H 5JOPD 3GK8H 4IRZH 5E99L 3BP5B 4YBHA 1SHMA 1LP9E 4JCMA 1P69B 4Y5XA 4KTEH 3S36L 2BNUA 5DD3H 3VG0L 2EDWA 3WNKA 3IU4H 5ICYB 3RZCD 1A7OH 1PD6A 1U6AH 3ZE0E 4RMQA 2R0LL 1H0DA 4Y5YC 4PR5A 4MJ4A 4F9LA 5KSVB 4GKSA 1YEHH 3WE6A 4D3CH 1IFHH 4RFNB 4XVUC 4HK3J 3O6KH 3ECBB 3D9AH 2X4OA 5SWQA 1U8PA 1TJIL 4PTTB 4L4VE 5FV2A 5D5MA 3PIQB 4ZFGH 2JTDA 4XI5D 3TPUB 3RZCB 1PKQB 2XWJB 3CH8A 4I18A 5CGYC 5DJXA 1ZANH 4NO5A 3WIHH 1E6OL 5EU4A 1G7IB 3VXUA 4XC3L 5CZVH 3M45A 3WFZA 1ROWA 1MRDH 5JOFA 2A73B 2WBKA 5BQ7A 4XXDB 3SBWA 5TE6L 4KZEL 4R90L 4YDJA 2P8PA 4XWOD 1S7UA 2UY6A 3LVEA 2YC1A 4PRNB 2VZOA 1ZLVH 5ETUA 4UDUA 1MJ8L 5ESQA 1XF2B 3H3PH 4QY8B 4D9RE 3OKMB 1MEXH 3TCLB 4PFEA 3BE1L 4OZHE 5I15L 4POZD 1PZ5A 1ND0B 5E2UH 1RZJH 4NWUL 4YHNA 1CFVL 5DVMA 4O2EA 3HZMB 4XNZB 2YN3A 4FFWC 1IAKB 5DJCB 4R3SB 3SKOB 5F3BA 2DI9A 1OP3H 3IXAA 3FO0L 1T22A 3C8DA 3OF6A 4C57C 5IOPA 3LKPA 5IFHL 2CJUH 1SM3L 1ZGLP 5DO2D 4X7SH 2KPNA 3BP7B 4UNVA 1UKQA 2PCPA 2ZPKH 1RK1A 1V3KA 2AV7A 2A1WL 3IFNH 3G5YA 3L3JA 1N0LA 1NCUA 1T21A 2GT9A 5IFAL 3C6SB 3FN0L 2YRPA 5CINH 4IOIB 4RFOL 2UYLA 4LLMB 4HWBL 5FHBL 1VFUA 2HTLD 4Z0XB 4U6XA 5ESVB 2QHRH 4U1MA 1BJ8A 3BPOC 2RGSA 4JRXD 5MENA 3OJVC 3ULVE 2OL3H 3DIFA 1ONQA 4HWEH 3BEWA 2WBJD 3BD4A 1S5IH 1A6VH 3WS3A 1NCDH 3VFVB 2VDNH 2AQ1A 2ZNWA 3KYNB 2ZKHH 4P3DB 1NGZA 2DQIH 4XNYL 1SY6L 4BELD 2Z8SA 2FBOJ 3DUSA 1H3UA 4I0CC 2AXFA 3MRIA 5JW5B 1CXKA 1IC4L 4L4VB 4ZUTA 4U2YA 4LSPL 1I3RA 4JRXB 3HI5L 4TQEL 2WBJB 4Z95H 3UTQA 2DQUL 2Y06L 1T1WB 5SV3A 4JFOB 5EZLA 3HPLA 3T09A 1VFBB 1KB5L 4D9RD 3C2SA 3W11C 5HGDB 3WO4B 5IMMA 3PDOB 3DX7A 1GC1H 1OLLA 5T5NF 1CWVA 3MLSH 5C3TA 4EOWL 5T1KA 5E08H 4NBZB 2XTJE 2ZUYA 2XRAL 2KQMA 3ZDZE 1X44A 3TBWA 2IH1B 5SWZE 2BZDA 2C9AA 2DBLL 1BLNA 2EDRA 4LSSL 2XXCB 2LQRA 4U1JA 2MFNA 1EXUA 3VXSA 1CU4L 4ODXA 2B5IC 4BK5A 5DJZA 4YGVB 3KPSE 3GSWA 4NHUB 4LLQA 4OZHB 2JJVA 5IEKB 1FIGH 3MACL 2LABA 1D5BB 1ZT1A 4F33B 3MRJA 5FAAA 1NCWL 5LGHL 1QFWM 2R0ZL 1MWAA 4WW2A 2FO4A 3O4OB 5C0FA 3W82A 4MD0B 4M6OH 4M7KL 1DQQA 3OJMB 1TIUA 3DV4A 1R5IB 1NFDF 1ZKAA 5H2BB 5IB3A 5JXAL 3F58L 2AJVL 4KUCF 4QHUA 3ULVD 1MHCA 4HIEB 4PRIE 1CGWA 5DVKA 1OHQA 2FX8H 2IADA 3JBG7 1UG9A 1JRHH 5CS7A 3OMZA 4QOKA 1AXSA 3BPCB 4JVPA 3HAEG 4GKZA 4OI9A 3TO4D 4YJZL 3RRQA 1YEJH 4GW1A 3SDYL 5CJBA 5TDOB 4YO0A 4PJCF 5DFVC 5DD6A 2FJHA 4J6RL 5F97E 5HVHB 5GGSY 4UIKL 2AK1H 2R1YB 1CG9A 3L5WA 1DN0A 2VUOA 1G6RL 1N3NB 2H2PD 2MCG1 3CFJB 4U3HA 4NIKB 3TO4B 1G7QB 3DX9A 5C0AA 5DJDB 3IVKA 2A83A 4AMKL 4WTZG 2HFEB 2XTJD 3ME0A 3ROLA 3TP4A 2M8XA 3OR7B 3S37H 1U41A 4GXUM 5SWZD 1KXVC 4N0FA 4TSAL 1N5YH 1CD8A 1KN2H 4WI4A 1P5VA 3MBEB 2DM2A 3IDGA 3WBDA 4LIQE 3S34L 5GS1A 3SE4C 4NC0B 3C60D 2AJ3B 5C0IB 1ZA6B 3S5LA 5J13B 3LD8B 1MJJA 2BJML 3BFOA 2VC2L 2XTJB 5DJ8B 3GBLA 3JV4A 4G7VL 4MDIA 5D93C 5SWZB 3ZO0A 5F1IB 4AIZA 4JN2B 4BZ2H 4PJ7F 1Q1JL 4ELME 32C2B 4LCCB 4Z7VE 3KPSB 1P4IH 4FZ8H 4JGUA 4NRZA 2FBJL 3ZSSA 4ENEC 4PRID 1QLFB 2X9YA 2VABB 3D69B 1TZGH 2ADFH 2JB6A 2WIMA 3ARRA 3MRMA 5K93A 2O5XL 4PRHE 4OCRL 5F7EL 5D7IA 3DBXB 5T1MA 1HHIB 1X4ZA 5T3XE 3VGBA 2DD8L 1F2QA 5GGRY 1D6EA 5TDNA 4ERSL 2AEQL 3M07A 2PTUA 4NNPL 4ZPVB 1CD9B 4NZUL 5ID0B 5JZ7D 4PRIB 3G6AB 3R0NA 3OJDB 4W4OC 3VA2C 4H20L 5C3LD 3RBGA 3H9HB 1AQDB 4LPCA 4P59L 2XZQL 3NCEB 3O4LE 5F8QC 1NLBH 5EO9B 2EEDA 4J1UA 1EDQA 1KC5L 5DWUL 4S1RL 1DSFL 3GIVB 1CD0A 1SJVA 2D4FA 3CDYA 2ORBL 4EUPA 4RZCB 5IVZB 3BZDA 1FIEA 4YAQB 2OXHA 3QZWB 3LDBB 3GUTA 2B1AH 2YS4A 4M62H 4YDLC 2ATPB 4JAMB 5I1LB 3GM0A 4HH9B 1EGJH 3HE6D 1T1ZB 4NPYA 4M7ZC 1MHPL 5DS8B 2FLBT 3KGRA 1JI1A 3ZHLA 2BSRA 3T77A 4QTHA 2FO1A 1EERB 3RDTD 4ONHB 4MAYC 1NCNA 1KCVL 3Q3GA 1D5XB 1PEZA 2AEPH 3HR5B 3BPLB 3EDFA 3PQYA 5GGTH 2HVJA 1OGAE 3HE6B 3LKRB 5C70A 12E8H 4PJAF 1QKZH 5E6IC 4O51B 3CSYB 4D0CB 3SDCC 5F7FA 4XBPB 3QWQB 4X4YB 1J8KA 3IDJB 1X4YA 2EH7H 4ODWA 1UB6A 5GISH 1TZHA 4GSDL 1E4WL 1JE6A 1QQDA 4M7LH 1Y6NR 4ELMB 4Z7VB 4OLXH 3L3DA 1F4AA 1AR2A 2Z4QA 4JLRB 2YBRB 4JRWA 2QSTA 4XZUB 5IB1A 4OSUH 4XBEH 1IAII 1H3VA 1WJ3A 1G9EA 3WS6A 4FZEH 4X4ME 4HCRL 3UTSA 1J1OL 3J7HA 5GGVH 4LLUA 3FMGL 4JO2L 4XP5H 5A16B 1I1RA 5DZLA 5IW6B 3OX8B 4NDMB 1CLYH 4R4ND 4OLZL 1F4HA 3N85L 3I6KA 2PW2B 1DTUA 4NT6B 4FQIL 5JIIA 1I1YA 5C9KA 2CDEB 5L8KB 1PDKA 1T89C 4RGMC 5EUKB 5HHQA 4LVHC 3RTQC 4BZ1L 1UXSB 1RULH 4HFWB 1N0XL 4DKAA 5J1AB 5KVEH 1T0MB 5HHOD 2AGJL 5B22A 1PFCA 3MQIA 4L4TA 1XZ0A 3VRLE 2A74B 1LO5B 3HI6H 2BVOA 3EO9H 3SE9L 4HX1A 1M1SA 4MNGB 2VDKH 4U1SA 5DD5H 5DEGA 3VXPB 3RWFB 1QSZA 4MAUL 2UZXB 1S3KL 1A0QH 4GG6A 1M05A 2CRYA 1F00I 4NHCH 5T3ZL 5ISZE 1I1FA 2H26A 3EJYC 5C6TH 2Y36H 2VWEE 5TH2A 2WUCH 1MQKH 4XWGL 4LSRL 2EO1A 4QRTA 2VZSA 3BIKB 3QSKB 1G7PB 1KEGL 4G6KL 1C5DB 1IEBA 4RWYH 2FX7L 1QHPA 1GXEA 1IKFL 1T83C 3GSXB 5J56B 4LKCA 3CJJA 2V6HA 4U0RB 1ERNA 1H3XA 4OLUH 1G7LB 4MQ7A 4ZOCA 1EVUA 1T66C 2P5WA 2D31B 3TYFB 3JV0A 2V2WA 1WEJH 4HC1L 1U8MB 3PJSB 4OI7A 1R3KB 2VAJA 4LMQI 4Y5XC 3DVGB 3RIAF 1G9NC 3Q6FA 4DW2H 3RQ3A 2IBZX 2GAZA 5E9DA 5EULV 4F9LC 1K5NB 1TENA 3IRZA 5DHXB 2V5TA 2G75A 4OFYA 1X5GA 2V5RA 4PJBA 3QA3A 2O5YL 3GBNL 4HV8A 3FB7B 1SBSL 5DK2B 3MX0A 3TPKA 3P0GB 1HSAA 3M17A 4H25B 4F58L 2VKWA 3QEHA 3FT3B 5EBGA 1CFBA 4I18C 3UX9B 3MLRL 4JKPH 1JN6B 3T3MF 2J1KA 1J0HA 1DBKL 2A2QT 2N4IA 4P3WA 1KT2A 4PB9L 3BKJL 5C0EB 4KWUA 1J1PL 1BOGB 1D6VL 3BVNB 2X4UB 2VITA 3SBWC 4LASL 3CUPB 5T1LD 4HIXL 4DZBA 3PWJA 2PR4H 1KJ2L 1S78D 5IMOB 3VW3L 5L0QC 4KPHH 3GSVA 3RUGE 3UBXI 1JL8A 2YA1A 3AS1A 4LNRA 3WXWL 1OY3B 3B9VA 2ADIA 4XNZC 4XWOC 5IKCA 4KKLD 2NY5H 2VLRE 3RY4A 2O5ZH 4H8WL 5T1LB 2VTFA 4ZFOA 2ED8A 1SYSB 1MHEA 3THML 2I27N 3PL6D 4JPWH 1IL1A 5DLML 5ISZB 1NANH 1F8TL 3X3GH 3EDDA 2ZSVA 3JWDC 5JW3H 4LPTA 4K3JL 3VD4A 2NXZC 2YD9A 5B3NA 4LEXL 5I1IH 1NBYB 3PNWA 3MBXL 5IVXA 3FT4A 4NRXB 3BGMB 2AV1A 1R5VB 5C08D 2Z35A 5D4QA 2DQEH 1LEKB 3PL6B 3RI5F 2Z31D 2P49B 1VA9A 3CCHB 4N8PA 1YN7B 4U0QB 2C3HA 4JJ5B 4L5FL 4JO3L 1G7HB 1KPUA 3ARZA 5GRYA 1BGXH 5TF1L 1EUTA 3ARBD 3CMOL 1VFAB 3V6OC 4JZOB 1N2RB 3BRFA 1WIUA 1IGYB 1HH6A 1YYLH 1YY8A 2Z31B 5EFIB 1UWXH 4JM4H 4R8WH 1GAFL 5IBLC 3DI3B 5GGTA 1F3RB 3ARSA 4Q2ZB 5JR1H 5C09D 1PLGH 3ARBB 2WBJC 5A40E 2NW3B 1YMME 2OI9C 2DKUA 1I3VA 4EQ2A 1UJ3B 5GXBB 1QBLH 2HVKA 3VCLB 1EK3A 3DXAD 3QRGL 4NQDE 4NC1C 3UTTE 1DQJA 3NACL 2B4CC 3GO1L 3BIAX 4CMMA 3L3GA 4JY4A 3KYMB 1RK0A 1NCTA 1VB9A 2H1PH 3O9WA 3QQ9D 3IDXL 4LF3A 5C09B 5D2LA 3C8KA 4PV9B 5D8JH 3AS0A 3MNWB 3I6GB 43C9B 1JFQL 4JREB 3AB0C 3QWRD 3OGOE 4GXUN 2VNCA 1C1EL 3FO1A 3GK8L 3U7WH 4IRZL 4BQ6A 3RUGB 2VR9A 2OP4H 4ZMAT 1AD9B 4KTEL 5DD3L 3D5OF 3IU4L 3QG7L 5EU3A 2XFXA 3BP4B 3HAEH 3IDNB 4F7EB 2BOCA 1OW0A 4OFIA 4QCIB 2VLRB 5LCVL 4R0LB 4R4BA 2AJXH 4I4WA 4NOBA 2AJUH 1ORQB 4YHOH 2EE9A 1YEHL 2I9TB 3MRBB 1LEGB 1WZKA 3QIBD 4JPVH 4UDTA 2IAMD 3U0WH 1KUMA 1T5XA 4WW2C 3DVIA 5D6DC 4ZFGL 3V8CA 1QO3B 1I8MB 1TPXB 3MXWH 1QLEL 4EIGB 2JJSA 3MJ6A 1ZANL 3H0TB 3HRZB 5EU6A 3U4BL 3WIHL 5CZVL 1N59A 3V6ZA 1WVZA 1I4FA 3QNZB 1NKOA 1ZT4A 5H8DA 3QIBB 1RJCA 1QPXA 2IAMB 3EO0A 2NZIA 4NCDA 2IALB 4TUOB 4QHLB 2IBBA 5IEHB 3FO2A 2L7JA 1BBDL 4MDJA 2A6JB 1ORSA 4HIJA 2F8VA 3MLTA 4V2BA 3DTXA 4HJGB 4N5UA 3VXME 5BO1H 1CXLA 2J88L 1YMMD 3H3PL 1JGUH 1NAMH 4F8TA 1EH9A 5I8KH 1U8HA 1RZJL 5HYSA 4NQDD 3JUYA 4HUNB 5FKAB 3TO4C 4PJAA 4R7DB 3VD7A 4AQOA 5IT2H 4MXVF 5EC2A 2HRLA 3FB6A 1FAIL 4X6BA 1VSCA 1YMMB 2M1KA 5DGQA 4XHJD 1HSBA 4TN9A 2EE6A 4NO2A 4X7SL 4KKCD 4Z7WE 1KG0B 5E00B 3WNNA 3ILPA 2OLDA 3D1MC 4NQDB 3FAXA 1GOGA 2P44B 2ZPKL 3FONA 4OUUA 5ALCL 3IFNL 2BCKB 5J13C 3LD8C 2K9UA 4BFBD 1WCBB 4KK5D 1HK6A 2CGRL 5GS1C 4WI6A 2XTJC 5CHNB 5JPNB 4ZSOA 4DGIH 2BMKA 1YJDH 2BY2A 5HYQA 1RUML 4IDLA 1BZ9A 2QHRL 5AYUH 2GCYB 1BVKB 2OL3L 4HWEL 3C60C 1LE9A 4FQ1H 4S10A 1S5IL 1A6VL 3MNZB 1NCDL 3I3DA 4OCWH 2VDNL 3QPXH 3W39A 1WAAA 2DI8A 2ZKHL 5SX5K 5J6GA 1WTLA 5IHZA 2I24N 2X9WA 2X7LB 1HNGA 4CN4A 2YZ8A 3V5DA 4ODVH 4WEBH 2VIRB 3DX8A 3WHE1 5FOBA 2NLJA 3D0VB 5ICZA 4M3KB 2P45B 3CK0H 2KUTA 3O2VL 2P7TB 3LIZL 1EFQA 3EUUA 4JG0H 1KB5B 1TFHA 2IPKA 4QT5B 4F7MA 1AGBA 5BMFH 1KLUB 4MD5B 5ECJE 1I85C 5E08L 3O3AB 3HNSH 1PW3A 4L3AA 4JFDA 5EIQA 3GJFH 2CDGB 5LQBL 1NUDA 4NQUA 3DUUA 1XGPA 5CFHA 3HG1A 4O02H 1KTLB 3Q6GH 3V5KA 3MJ8A 4OKDA 2B0SH 2R69H 3DMMA 3K8MA 3W9EB 3WFBH 5ENWA 1OWRM 1EEUA 1TJGH 3FQRA 1FIGL 2P8MA 5HHVH 2Q8BH 4Z7QF 4PP2B 3UPRA 5IBTL 4FFZH 4M1GH 4K3GA 4HPYH 1Q0XH 1FNEB 2WLZA 1OD9A 4OZGF 1A2YB 2VXUH 4PRBB 4M6OL 5KBNC 1PJ9A 1CXHA 3ES6A 1T04A 2DL2A 4AEHH 5HYEA 5GGUB 3IU3B 4RAUB 3HA0A 5B38B 1MCHA 3KS0H 5BV7C 4Z7WB 4CKVX 5BJTA 3BRDA 2WMPA 3HE6C 5I1EH 3QUYA 5KSUA 3T8XB 3B5TA 2FX8L 3HZVB 1FYTE 2V7NB 4MJID 4Y4HD 4LLYA 2IG2L 1T1YB 3RDTC 1MUJA 5D1ZD 1YEJL 4AM0A 4WEMB 5DJAB 2X44D 4I5BB 3QAZC 3X11B 3ARGA 1YN6B 2HN7B 3RNQA 1CICA 2WK2A 3EO1B 1G7MB 5E4EB 1R3IH 2PW1B 3IJSB 5MI0B 4NKOB 4FTVE 4IRSA 3LZFH 2AK1L 1WITA 3GMNB 3OAZH 2P47B 4J2XA 4MJIB 4Y4HB 1G6RB 3RL1B 3MRLB 2X4PA 4S1SH 2AAVA 1GZQA 3F8UB 4TUKH 4HJJH 4HWZA 5I1DB 3JV6A 3S37L 3MGOA 1LO2H 3BT2L 4TSBH 4LSQH 3NA9L 1A7PH 4G5ZL 5F3HA 1KN2L 1UWGH 3F65A 5D71H 2WWMD 1IZKA 1C16A 1T7ZA 4P48A 4ZO9A 4OF5A 3BH9A 4K94H 4WJ5A 3L3HA 4KROD 3EYVA 4H0IA 3KLHC 4ONGH 1H8SA 4LFHG 3BHBB 4HK0B 5D2NE 4G8FA 4YHLH 4EDXB 2COQA 4BZ2L 4R4NC 3BJLA 3LS4H 5C9JB 3FFCD 1QA9B 5BZDB 1LK2A 3VDCA 3WFCH 1SEBB 1P4IL 4UOJA 4FZ8L 1WF5A 1CVSC 1FN4B 4KROB 3H9SA 1M7DB 4N90D 3GMPA 4O4YH 1TZGL 2ADFL 3U9UB 2ZJSH 3TZVD 4JFYB 2XYCA 2CRIA 4HKBA 2IBGA 1GGBH 3BGAA 5HHNB 1P6AB 3OTTA 4YHML 3R8BB 4XT1C 4MJ2A 1KIUA 3CPLB 3FFCB 2DWEA 3D85D 4IEFB 1UH3A 3FB5A 1Z9MA 4V2CB 1UZ8A 5EOQL 3T2PA 4GAJH 1JI2A 1RUPH 2N7AA 4ZUVB 3QI9A 2ZWLT 1E28A 4X4XA 3TZVB 5HDBE 1I9IL 3PGCA 3HZYA 2D9CA 2W0FB 4YFDB 3WJJA 1NAMA 1WTGT 5GS2D 4I8DA 1CFNB 5M95B 3CMGA 1NLBL 3D85B 3QUXB 4J4PD 2QR0A 1BQLL 4LLVB 3VXUE 1ZVSB 1ITBB 1VKXA 2GUOB 4X6DB 1PSKL 3C8HA 4JDZA 3OG4B 4ZFZA 4GKOA 1P84K 3SDXF 3HMXH 4M00A 1KB9J 4LLWB 2B1AL 4M62L 4YQXL 4NOFA 4JZJB 5I19H 4NFBA 1EGJL 3VA6A 1WC7B 3TN0A 2XKSA 1FNGA 2AQ3A 5T5FH 2IPUG 4KZDH 5T3ZE 5JW4M 5CSBA 2Q87A 4E0RB 3MV8E 4K7PY 1PQZB 3MLUH 3R8QA 3VFSB 4GAYB 4M7LT 3GI9L 1R0AH 1VACA 4MHHI 1P9MC 4JFEA 4QF1A 4HIIA 5SWSA 2VLJA 3NPZB 1DR9A 2R9HC 4KMQA 3ZTJG 2EKSA 2APVA 2CLRB 1IGFH 5CSZA 2EECA 2XT1B 1T2JA 5I71C 5D2NB 4EJ1C 4KJPD 3V0AC 1EZVY 3AREA 4OFDA 4PY8I 1A6TB 2LU3A 5GISL 3RY6C 3LRHA 1N64H 3FHAA 4M7LL 3SGDH 5MEOA 1F6AA 1RU9H 3GGWB 5ILTL 1QUNA 1RPQA 3LQAH 4Q97A 4G80A 1P6FA 1UXWA 1ZS8B 4JFFE 4R97B 3V7AE 2QBWA 4OSUL 1XMWA 5F6HJ 5MENE 3CX5K 1NLDH 3F5WB 2ICCA 1UC6A 1FFPA 4U6HA 3KLSA 3PF2A 4WY7H 5EC1A 2FHFA 5GGVL 4CNIA 5JDJA 4OB5H 1U3ZA 1U0QA 2QQNH 3BKCL 3GJFA 1UH4A 1QSED 1A3LH 1CLYL 3IJHA 4PIRF 5E8DH 1U8PB 1U8IA 1CGVA 4CN1A 1R24B 4GRMB 5EORH 3KDMB 2AXGB 3D25A 3VFMB 5IBUB 4YBLB 3WNOA 3Q2CA 4J7RA 1BBJB 3CH1B 3X12B 5DJXB 1RULL 5KVEL 2ZOLB 3KJ4C 5KSAA 1KLGA 5T3ZD 3T4AB 1QSEB 2A6DB 5ACMA 5F7YC 1NCAH 1QBML 3MV8D 3MOBL 4PY7B 1S7UB 1TQBB 2VDKL 1FFQA 1GHFL 4LEOA 1F6LL 1BIIB 4WFHE 1H15A 1A0QL 2NY6D 4OM0H 4YFEA 1MCDA 5ESQB 3QUMA 3VXSE 3S96B 1YY9D 2J4WH 2ICEB 4NHCL 5JO5B 3QHZL 4X6CA 5L2KE 5CCKH 1UJ3C 5HDQL 5C6TL 2Q86A 3EFDL 2DLFL 2Y36L 3MV8B 5FA4B 2WUCL 1MQKL 3NFNB 4QRSA 4PJDF 5TDPB 1N6UA 3DURB 3U6RA 1MJUH 1QTYT 4X0KA 4HUUB 3VJ6A 4RWYL 2NY6B 5D7LD 3STZA 4U1NB 2IJ0C 1SJHA 2NXYB 5CLTA 5F21B 5EG6C 2R56H 3H7BA 2X4QA 2YHGA 3TIDA 5DZOA 2EICA 4OLUL 4F9PC 4JREC 5A2LH 3F7PC 3O9WC 4KVNL 3FO9B 1XF1A 2AV7B 3PHQA 2C3VA 2WWKT 1D9KB 5BOZG 2R39A 2GSGB 4MWFA 4JKKA 5D7LB 4Z7UF 5TQ0H 4GG8B 4R0LC 3QQ9C 4JFFB 2R4SH 1WV7T 3UO1H 1A4KA 4DW2L 4KGLA 5FYJH 5AD0B 1DVFD 5DMIH 2EKJA 3OAUH 3MRDA 1WBZB 3MLWL 3ZZ1A 1MAKA 3BX7C 3O81A 4Y8DC 4Y2OA 1I1AD 8FABB 1TPXC 4ELKB 1B6UA 4IBLT 5C1MB 3L5IA 3KPQB 5DR5H 1IGCH 3BXNB 2DTSA 3DRQA 5C0AE 5JHDA 5C8JB 1UVQA 3WJLC 2JJSC 2V5SA 4LVEA 5AAMA 4OQTH 3BW9B 4JKPL 3CXHJ 4NP4L 1DVFB 3T2OA 1QRND 5IFJA 2IAMC 5EO0B 2E7LA 4WFHD 3P30L 3NPSC 2KDGA 4FQQB 4XMLH 2FECI 3U7YH 1I1AB 5CEZL 3SQOH 3I02B 4PJIA 3DETD 3QFDA 2ZG1A 4TVPH 1KJ2B 5FGBC 4KPHL 1FZOB 4UU9A 1MFCL 1EEZA 2YOCA 4I2XA 5L2KD 1MPAH 5D9SA 1QFUH 1BF2A 5GSRB 5HY9A 3HPJA 3Q48A 1QRNB 2X05A 3I3EA 2E9WA 2CLZB 2NY5L 1CK0H 43CAA 1KIRA 4EI6A 2E7BA 3GNMH 3BD5A 1PBYA 5KTEH 4OKVB 3MRGB 5F7UA 4MZ2A 4JKLA 5DI8B 1L6ZA 5L2KB 5JA9A 1NGXA 4XPFH 3R1GH 4E42B 3FT2A 5I1IL 1XFPA 3JUZA 4NO0A 5KVDL 4TTGA 4NZJA 4PD4K 2NY3B 3VGHA 5D7IE 2OR9L 1DEDA 1M6OA 2DQEL 4P2QA 2YPLD 1KJMB 2EEBA 4KJQC 4FOMA 4RSVA 2E27H 4XHJC 3UYOD 1BZ7B 3B2VH 3RVVD 1MHCB 3CNKA 5FUCE 1FFOA 5DTFA 4HG4K 1L0YA 1XEDA 4HUMB 4P2OD 2NY0C 2E6PA 4KK5C 1CLOH 4YDKH 3BZFA 1AGCA 1ZHKA 3KXFD 1MJ7L 2YPLB 1YYLL 4WFGE 4NC2B 3RIFK 2R4RL 3RGVA 3BISA 3MTRA 1P7KA 1NGYA 3QH3B 3MJGX 4JM4L 2D7TH 3VXTA 1OLZA 4XCNB 4C83B 5K9JL 5TE7H 3RIFF 1XF3A 3T3PE 5JR1L 1NMCB 3RU8H 3CSGA 1MNUL 4P2OB 4X7FC 1EZVX 3WHXA 4OFKA 2XWBA 3FQNA 1A9EA 3SOBH 3ARFA 5E2VH 3KXFB 2A83B 1T80A 4FFYL 1T20A 2BNQE 1NGWB 3PWUA 3QIUD 5CJOH 5DHVA 3BAEH 3U30C 3MA7B 2MTPA 2H1PL 2XKUA 1GGCH 3SGJC 5D8JL 2PXYA 3W2DL 5BVPH 3MV9E 1ACZA 3Q1SH 2X41A 3IDIB 4BUHA 4KJWD 1OP5H 2OP4L 3ALPA 3QIUB 4R26L 5FM8A 3AFLA 1BWWA 3DMMC 3QDJE 2EYRA 1HH9B 4MDIB 2FR4A 3OZ9H 2JJTA 2WUBH 3ZSTA 2QTEA 5EZIH 1AKJD 2RIKA 5DC4B 1FZMB 3ZKSD 5CWSB 5ALBL 4XCCH 4HXBH 1JNNL 4KI1A 4NUJA 1QNZH 4O58H 4JPVL 4MXWH 3V52L 2AJZB 4Y2DD 3BO8B 2W1NA 3QXVA 1MCFA 3SDXA 1O7VA 1ULVA 1EAPA 3EIFA 4KVCH 3TBSB 4FQ2H 2B2XL 2YPKA 1AKJB 5F89A 4JZNB 3UTSE 3ZT7A 4WFGD 2NYYC 3KPMA 4Y2DB 3EDJA 1KEML 1WFUA 2DBJA 1CE6B 3L3OB 4M9OA 1OAQH 3F7YA 4NYLA 2Y07H 5I8OL 5DHYA 4YPGA 2BXYA 5E4EC 5EIIB 1LP9F 3ARGC 5D96B 3GMQA 1BOYA 4MMZC 1FVEB 4BSWB 4E41A 2AK4E 1FGVL 2CD0A 3T1FB 5I8KL 1DLHB 4WDIB 2WBWB 4GRLA 3C2AL 4PJGF 5D1ZC 3DSFH 2BNQD 5I1AA 4L4TE 5IT2L 4Z76B 3EOYG 3GJEA 2R29H 4RBPK 1PY4A 2EIBA 1S9WB 4Y19A 1YNKH 5E1AA 4POUB 4WHDA 4Z8FH 3RWHB 3MV9D 1UACH 1MREH 2E6JA 4RMVA 5L2JA 1M4KA 2E3VA 4NSKA 1DQMH 1QSVA 2BNQB 4U1IB 4JHBA 1OT1A 4F3FA 3KYKH 3T77B 3OKNB 4QTHB 3QDJD 3WN5A 2HMID 2EH8H 2ITDA 2VZVA 3S88H 2BERA 1FV1A 4FQCH 1VADB 4Y5VA 2B1HH 3MV9B 5DQDL 5JW4N 1GZPB 2WWMC 3G5VB 1OPGL 4I0PD 4UT9H 1CD1B 2J5LB 4X6EA 5AYUL 5E0QA 4CVXA 2OL3B 4PJEB 4FQ1L 2VDMH 4IRJA 4JQIH 4KROC 1WWWX 2APXA 4OCWL 1QR1A 3QDJB 1ZVHA 5FA3A 3QPXL 5E94B 3TNMB 1A9BB 1KTDB 2LE9A 4ODWB 3SO3C 2FCBA 3BWAB 4K3EL 2P5WE 4JKMA 1QQDB 2QSQA 4I0PB 4ODVL 4WEBL 1J10A 1UM4L 3L3DB 4NQTA 4PJHF 1J0IA 2NX5A 2YSSA 2G9HA 3ARYA 4WEUD 1HZHH 3CK0L 4IMLB 2X4SA 2J8OA 2PYFA 4XNUH 3B8YA 4JG0L 2AK4D 4RISH 4H5SB 1AH1A 3KPLB 3QI9C 4PJ9D 2G5BA 2PO6D 5E8NB 2DJUA 1T0NA 2YR3A 3HNSL 3WJJC 4MQSB 4GQPH 4XPTL 1AFVH 5EB9A 4N9GA 5D7JA 2R2BB 1I9RL 3NBNA 2SEBA 4M1CD 5GGQH 4PJDA 1LDPL 4PTUA 2W60B 4AENA 2B0SL 2AK4B 2R69L 3ZTJH 5IW1A 4X8JB 3WFBL 5D72H 1N8ZB 3GSQB 3AAZA 2DQCL 2H32H 2W92A 3E1F1 4KK8D 2PO6B 4P5MB 5IGXL 5KG9A 1K2DA 4ZUWB 2MPAL 3CVHH 3CFDA 1ZA3A 4HZAA 5F70A 1Q0XL 3RVTD 1CZ8H 1OAUH 5EOTA 1IGJA 1MLCA 3ESUF 3EYQC 3MR9A 4ZAKA 5F7HA 2X10A 1BJ1H 4QO1A 4XNQA 4AEHL 1K4DB 4AYFA 1S8DB 1BQHA 4M61B 1XH3B 1HEZA 4WV1B 3GMRA 4Z7UA 5JMOC 4U1KB 4DEPB 1G84A 4MVBD 1RY7B 3FJTA 2YD3A 1RJZB 1D5ZB 5C7XH 1U3YA 3I3BA 4L3CA 1TITA 1YQVH 4QXWA 1T7WA 3ZDZF 2KQNA 1SYVA 3QPQD 1U8NB 4QRTB 3MRPB 4RQQA 5IVXE 5LBSH 3MO1B 3AREC 4C58B 2GEEA 5I17A 3PWPD 4WU7A 3QULB 5GRVK 1KXTB 4FXLA 4N8VG 3LZFL 1GVIA 4WWKA 4XNMA 4R97C 2HRPH 5EOCJ 3VH8G 3S4SG 4MNHA 3MUGA 4OZ4A 3MJ9A 2JK5B 4KJPC 3D3VA 3UZQA 1FL5A 3PWPA 2DQTH 2ZUQC 3JVGA 4HJJL 4JO1H 3U0TA 1T03H 2D0HA 2APBA 5EH1A 1QFHA 3OXSB 4RX4D 4PGEB 1H3TA 2XZCL 4TSBL 1IBGH 3Q6FB 2C1OA 2UZIH 3WL9B 2IWGA 3GMOA 1KIQA 3EGSA 5D71L 2ZCKH 2DI7A 1U2HA 3D2UD 1MCPH 3C5ZA 3MGTA 2YUZA 3QA3B 4CVZA 1IJ9A 3EYOB 2AKRA 1S7TB 4K94L 4L8CB 4YBLC 4PBXA 1A6PA 5ITFA 2ZSWB 4ONGL 1EEYB 4G6JH 2R1XB 4YHLL 4KUCD 4U49A 1N6QL 1P2CA 5KSAC 2B39A 3E3QC 2EIDA 1KPVA 1H5BB 3BKMH 3DI2B 3D2UB 3LS4L 4JY6B 2FSEB 3HLAA 1AGDB 3ABZA 4X9FA 3WKML 1EO7A 5LWYH 3BQUA 2NY4C 1AXIB 1JGVH 3OHXA 3WFCL 1G7JB 2IEPA 3O2DH 2EDJA 2VQ1A 2X09A 4C56A 2FH6A 1HXYA 3O6LH 2ZJSL 4G9DA 1NFDB 1YPZA 1GGBL 5HHXH 4WW1B 5KVMC 3ULUF 4Q9QL 1VESA 2F5AH 1X5FA 5K9KB 5IMLA 1A1OB 5GGSA 1DP0A 2H41A 3DLQR 1OTUD 4E5XA 2RR3A 3QNXB 1F2XK 5JPMB 1RUPL 2CIIA 3CU1A 2NY6C 4AEIH 4CW1A 5A2JH 1IL1B 1YY9C 3WO3B 2EDEA 2ZSVB 4PJCB 3FQXA 4NKIH 1CXFA 1HKLH 4APQB 1MCWW 4FMKA 1B0GA 3SGKC 3T0XA 5C2UB 3P73A 3QHTC 3DYMA 3N1PC 1ZHBA 4B0MM 3P11H 4JQVA 3X14B 4K55A 4KI5F 4N0UE 3CDGB 3HMXL 3BMVA 1NBQA 4ODSL 4JQXC 4DFIA 3RX5A 1HINH 4ZO6A 1JGDB 2HKFH 1DUYA 2YPVH 3HE7D 3JV5A 4ALAH 5BS0E 1IC5L 4OGXH 3I75A 2XZAL 1ETZB 1VGKB 5T5FL 3QUZD 4KZDL 4YDVA 2BHYA 3QJFB 2XZZA 2RJMA 1JPTH 1RI8A 4PJAE 5KS9A 3MLUL 4XMPH 4TUJA 1FO0H 5MEPB 3N1GC 4LP4A 1RUAL 3HE7B 4M5ZL 5KVFH 5C0DB 5J8OA 3CSBA 4PJ7B 3QUZB 1DE4B 4I3RH 1IGFL 1S9YB 5INDB 2C3GA 2JELL 1P7QD 4F7CA 3VFNA 4DTGH 5FYKH 4HGWB 4MA3B 3WLBB 5GGRA 1VEMA 1DQJB 3DO7A 1AC6A 2VQTA 4XP4H 5EUOF 4U7MA 5CIPH 3C5JA 3ULUH 1J18A 1RU9L 5JXED 1RK0B 3NIGF 4XPAH 2D7OA 1ZT7A 3U9PH 4FQXA 1CFTA 4H8WC 4PYGA 1DBAH 4XVJH 5E7FA 2DDQH 4M4RA 4X7TA 2YKLH 3F62A 2FYYB 1P7QB 3DETC 1ODAA 1U8JA 3ARDA 1FZKB 4A6YA 2Y7QB 4MX7A 1NLDL 5C6PB 4DN3L 3DROB 3U36A 1L9MA 4RWHA 3OB0K 1FCCA 1KN4L 1IM3B 1MVUB 5H35A 4OZFA 2QQNL 2AI0H 1A3LL 5E2WH 4UDTB 5E8DL 2ZUTA 5EORL 5F9OH 4G9FE 5DJ2A 1NDGA 4Y4KD 5BRZD 5BS0D 5I66B 2H32A 5BW7C 4OD1H 3ARUA 1CDUA 4U7SA 1II4E 3L7FA 4JR9H 1INDL 1NCAL 4N0UB 1N7MH 4FXGB 4LKXB 4BQCA 4JFDE 3BH8A 3IT8D 3KNBA 4OAWA 1L0QA 1A6WL 3BDYH 1FQ9C 5BRZB 2FGWH 5GZOD 3RGVC 2EDBA 3RVVC 4L4JA 1FG9C 4OM0L 5BS0B 5CBAB 3K8KA 3R06A 3RL2A 1HYSD 2W07A 3BJ91 1PAMA 4NZDA 4ODBD 5T33H 3G9VA 3LN4B 2JCCF 3EOTH 5BXFB 1CDBA 3GSNL 4EN3A 1LEIA 3QDGD 2DJSA 2IANA 5CCKL 5KW9H 3MLPA 4PREA 4PJAB 1AGFB 3D0LA 4NUGL 1SQ2N 2ATKA 4HS8H 3ZT6A 3U0PA 1MJUL 3ARFC 3U2SA 3G9AB 1AO7A 5HGHB 2YWZA 2X89A 3FB6B 5DDHB 5KSBF 1T1XA 1INQB 4U1GB 3VE0A 3AXLB 3PHOA 1MAMH 1HQRA 4P4KA 1KJVA 3QDGB 1J0KA 2PETA 1KIPB 2WANA 5CMAA 5E95B 2D03L 3IYLW 2PXYC 3VRLF 3C6LD 1U91A 3SY0A 1LO0H 4LRIA 4NFCA 3DV6B 1A1MB 3VG9B 2A6KA 3QDMA 3PP3K 4G43B 5TQ0L 2BMKB 2IQAA 3U46B 5KN5B 3VWKA 1UWEL 3HC0A 5HYQB 2P24B 4U6VH 1XAUA 3CZJA 2R4SL 3UO1L 5FYJL 4HBCH 4HH8A 1FZJB 5DMIL 1OF2B 3OAUL 5B39A 4G9FD 3C6LB 3SDDD 4KJWC 1I3GL 3PP4H 5CEZD 3T3ME 1C5CH 5FO8A 3W39B 5LAXA 5J6GB 3BD3A 5I9QB 5DR5L 1IGCL 2BSED 2UWEA 2VAAA 4HS3A 5EA0L 3S3PA 4GKNB 1OAKH 3D48R 4OQTL 3SKMA 3DX8B 1U3HD 2YD5A 5FOBB 4OLVH 4F7TA 3FRPG 5FO9A 2G2RA 2HT2C 4MCYB 2GK0B 4G9FB 4LDOB 4QXTA 3SDDB 4J8RA 1HXMB 4OD2A 3SQOL 3SE8H 3SE3A 3EYFB 4JM2A 1BD2A 4TVPL 4MQXD 2OJEB 2FB4H 2PN5A 3PWLB 2Z91B 1MPAL 5CD3A 3QUKA 5HHPA 3ETBF 5ERWB 1U3HB 3FOLA 3EOAA 1FFNB 1XR9B 1HWGB 2CR3A 3RWEA 5ABDE 1CK0L 3DUUB 2HFGH 4Z0BL 1UGNA 4QGTA 4OFPA 5F9JB 5KTEL 4QHKI 1DEEA 3RX7A 4EXKA 3F12B 2NZ9D 2P8MB 1OL0A 2XWTA 3H9SE 5EWIH 4HPOH 3UPRB 3FRUB 5F7DB 4XPFL 3B83A 3R1GL 1ACYH 4JFXA 1WZ1L 1B4JH 2EIZB 1RSFA 3V4VH 5I1KH 4EI5A 4XB8A 2C5DC 5J4MA 3OKOB 3P77A 3CSPA 2I25N 1CLZH 4GW4A 3SHSA 3INUL 3O6ML 5IR1B 3WN5C 5IV2A 2E27L 3E0GA 4CADB 1BAFH 2PYEA 3B2VL 1YUHA 3T0EA 4M02A 1VENA 2J5LC 3RHWF 3MRCB 5L6YH 1G9MC 1YEDB 4RGNE 1DANU 1DCLA 1SVCP 3KR3H 3D39A 4NBYB 3CFEB 1IAOB 4PLNC 4P9HC 4IRJC 2JLLA 5JLZA 4HT1H 4LVOB 2RQ8A 1CICB 3KAAA 1CGUA 2D7TL 4I0PC 1EBAA 3SQBA 4OIAA 5TE7L 2KKQA 4RA0C 3SCMD 5CJXA 2OSLA 4LU5L 4RNRA 4N1CA 3CLFH 4UQ3A 4F2MA 4HIHA 3SOBL 5E2VL 4LSUL 2GTZB 1QSFA 3ET9F 3T0DA 3JWNC 4AQ1B 1QFPA 2CKBA 3PWVB 3VXRA 5CJOL 3JV6B 1N4XL 1BFVH 1TTFA 3SCMB 5FXCH 5HDOA 1A7QH 5F3HB 4K2UH 3MROB 1UKTA 5BVPL 1TVHB 4JFEE 3LRGA 3BH9B 3NFPA 5D7JC 3V4UH 5SWSE 2VLJE 5LXGH 3E2HB 3QEUA 4PJ9C 3HAEB 3QO1B 4HKZA 4HULB 2WUBL 3MNVB 5EZIL 5E03A 3OAYH 3HMWH 2NW2B 4XCCL 1W72H 1WISA 3WIFA 1QLRA 1LNUA 1S9VB 1LHZA 5H94A 4YK4C 1QNZL 4O58L 3DUHA 1MIML 3KLAA 4M1CC 4MXWL 2RFXA 5C0CD 5BVJA 2XQYG 1BF8A 1HI6B 3REVA 2IC2A 4AH2A 4KK8C 4RGND 5F1NB 4KVCL 4HKBB 3RVTC 1A6AA 4FQ2L 5DA0B 4KTDH 4B53A 3O8XD 2DQHH 2DWEB 3IAGC 2E9IA 3A6OA 1UB5B 4NNXB 3VFPA 4RIRA 2I07B 3REWB 1OAQL 3CZFA 5FKPB 1MCJA 1PG7H 1MVFA 2GTWB 5HD8C 3L3IB 3WIIH 3PV6A 4RGNB 3L5XH 4IOSD 3TVMA 3WHE0 4MVBC 3MYJB 3FQTA 3O6FD 5K9OA 3SPVB 4M1DH 3HS0B 4MXVE 4PGBA 3O8XB 2LU7A 3NH7H 3O11A 4NGHH 3QPQC 1JWUB 4DWHA 4OCMC 3DSFL 4PRPA 3PABA 2R29L 1CIDA 4OIIH 5JW4Q 1YNKL 4ZFZB 4XH2A 1JV5B 1OSZA 4LCUA 3JVGC 4NKMB 4Z8FL 2GQHA 4PV8A 3O6FB 3V0VA 4NN6B 4D9LH 1MIEH 1RV6X 1F6FB 4MB5A 1MREL 4LLDB 2VE6A 1FNGB 1JWSA 2AVGA 3BP6B 1NEZA 3H3BC 3C5ZC 4XGZA 2Q76B 3NZHH 3S88L 3AU1A 3FCTB 4ZYKA 4KXZI 4NQEA 3X17A 2B1HL 3V7MA 3UBXA 5C0GA 1H5BC 2XOTA 3HB3D 1KPRB 1K6QH 4NWTL 4TRPH 1XF5B 1A6UH 2ARJB 2HWZH 4CVUA 4I9WD 2VDML 2EKSB 4JQIL 4ZS7H 1UEYA 1T6VN 5MERB 3BQUC 3MRRA 4MJ5B 2XI9A 2H9GA 4NKDA 1BHGA 1ZSDB 4OD3H 3HRPA 4TPRH 3TO2A 4PBWD 4MNQD 4AT6A 1P4LB 2AQ2A 1B2WH 2VDOL 3SJVE 4ZNEA 4UIMA 3N06B 4UB0H 5AG8A 2V2XA 1CTOA 4RGOH 3K80A 3T1WA 3VD3A 3P0VH 4ODTL 4JG1H 4XNUL 3T08A 3LEXA 5IIEA 2NY1C 4PRDB 4RISL 4U6HB 5GRXG 1K3IA 4MNQB 3TIEB 3I2CL 4OZIF 1EO8H 2YXMA 1U42A 2X4RA 5JHDE 5B3JF 1Z5LA 3GJFB 5CGMA 1OTUC 1AFVL 1G0YR 4Z7QE 4H26A 4P46D 1K8IA 4GS7B 1FVCB 3D25B 5GGQL 3MODH 4LLAA 3N9GH 4JQVC 5K59F 3IF1A 4OZGE 3NTCH 2P8LB 2YMXH 3QFJA 1J11A 4GT7A 2XN9E 4PJIE 4K7PH 4LCYB 1KGCE 3A6CH 2QKIA 4JO4H 3CVHL 4YX2H 5FO7A 1UFUA 1MCBA 1MCQA 4YXLH 2YRZA 3U4EA 3FB8B 3LSOA 4P46B 4YXHH 4G6AD 2Z93B 5GIRB 5L88H 2AEWA 4XP1L 1A4JB 3KPRE 4DCQA 1SMOA 1H15B 3D18B 1U95A 3HE7C 5CP3H 4U6YA 5F93C 2V2TB 1A6ZA 5IG7A 4Y4FA 4OF0A 2D0FA 3TH4T 2X70A 3QJHA 4PGZA 1WBYB 1DL7H 4Y5YA 4RAVA 5HGAA 2FIKB 4QRSB 3S36X 4HFUL 4NQCA 4DAGH 2FL5B 4D0BA 2VXTH 5AWNH 3OKDB 2ZOKA 5INCB 1A64A 4HK3N 3UAJC 5I2IB 3O41A 5E5MA 4UILH 3SJVD 3WLWC 4UUJA 3O3BA 2VH5H 4Q6IB 2BNRE 3N1MC 2HRPL 5DEFA 2GITA 3LKQA 4P23D 4FQXC 1IM9D 3PHQB 4Z7NF 4GXVH 2VDPL 1QVOB 3E6FB 1PX4A 2KZWA 3ARDC 1M7IB 2X1WL 4JO1L 2DQFA 4OV6F 3FOMA 3S5LG 3IFOB 4HUXB 4XAKE 3QG6A 3SJVB 1IBGL 2UZIL 5DRXB 1RZGB 3NGBC 2VL5B 4P2RE 5D1XD 2XQBH 2ZCKL 3G5XA 5GJTH 5TFSH 2CRMA 3BKYL 2WV3A 4E9LA 2OZ4L 4P23B 1IM9B 4HKJB 1CE1H 5GS0L 2EXYD 2XN9D 2BRRH 2EC9U 1TJHH 1FVDB 2HA1A 1WBXA 3B2UD 3BWUC 1LILA 2BDNH 5D1XB 1ZAGA 3JWOL 3BKML 3AROA 2W9LA 3KPRD 4QRQA 1JGVL 2LAGB 4OZGB 3O2DL 4MSWA 2XN9B 4Y4KC 4IDJH 1AGEA 4NZRH 2DF3A 5DGRA 1YYML 2ICES 4YC2B 3NAAH 1MI5E 5KANG 3QQ3B 2E6QA 5HBBA 3K4AA 2W9DL 3W9DB 4WUKH 3HI1A 3KPRB 4LBEB 2VDQH 1U58A 2JKXA 3MLZL 4QWWC 3ZDYF 1WWAX 1S7XA 4IOFD 4XCYA 1RURH 4K3DL 4XVSH 3KJ6H 5EZJB 2NY7H 4AEIL 4K3HA 2YD7A 4U1GC 4EUPG 5J6HB 5DJYA 3OB8A 2BNRD 3VWJD 4QHMB 2VOTA 4NKIL 1HKLL 3OKEA 1P1ZA 3NIFF 3SDXE 4XP9H 4K8RC 2HJLB 5L8LB 2DKMA 2BVEA 3B5HA 3EAKA 2FEDD 3DWTA 4FNLH 1S7RA 5IESH 3EYUH 2NR6D 3MRNA 5KAQG 3P11L 2M2DA 3VG9C 2DIBA 1I9EA 1RZKL 4LRIC 2WINA 1BFOB 4JFZL 4P2RD 5J7CC 2BNRB 4YE4H 5EN2A 3VWJB 5K9QG 5HYJD 2HKFL 3VWKC 4U1LB 2YPVL 1JHTB 4ALAL 3F7QA 1FGNH 1NFIA 1JP5A 1FP5A 1JTOA 3BRGC 1NBVH 1JPTL 4G8GA 3TJEH 3PXHA 3LKOB 1MELA 1P7KB 4P2RB 5EBWA 4ZXBD 1NBZB 1FO0L 1LD9B 1JNHA 1I7UA 5D5MF 4P9ML 4WFED 5KVFL 2F54A 1F58H 3QO0B 1CN4A 1J1XL 4S2SA 3KYOA 2GK2A 1OGTB 1QYGH 2XWBB 2XQYK 2CPCA 5FGSA 5C0BA 1Y18B 4OM1L 1AHWB 1MI5D 2A77H 4R7NB 4U4BA 4X8XA 4ORGA 1R3HA 4JM2C 4XP4L 5DRZB 4ZXBB 1MFNA 1U3HC 3T0BA 1ADQH 4ZTOL 4P4RA 4WFFE 1ZGLB 2DQGH 3EFFB 4N0CD 4X98A 4L29A 1JYNA 4X99A 1MLBA 4GMSL 2EDHA 3U9PL 5ANME 3CDFA 1DBAL 4TOYL 2DDQL 4RFEB 3WFDL 2YKLL 5L9DH 3IJYB 5FYJE 4J3UA 3VXOB 4LIQL 3VFTA 1HNFA 4QYOA 1MI5B 4S1DD 5I1CH 3TCXA 4D8PA 3KG5A 1RJLA 5MEQB 5JORA 3K2MC 2O61A 4WHYG 2EXWD 2AI0L 3UROR 5TPWL 5IMKB 3MREB 1A7NH 5CEXA 3O3EB 4JDTH 5E2WL 1RAMA 1NL0H 1GSMA 2HAZA 5LGJA 1PY9A 5F9OL 5E2TH 2NZ9C 2APFA 2P5EE 3I6LD 2D4DA 5SX4I 1HIMH 3VGDA 5ADOH 4IIQB 1SEQH 1Q38A 2R2CA 4OD1L 3T0EC 3WEXA 4TVPE 5AZ2H 2OM5A 1IEAA 2H6PB 1IGIH 3KWWA 1MCIA 3LPFA 3MV01 1N7ML 3GIZH 3T4YA 4ETQB 5T3XL 4HWNA 5AEAA 2GSIA 3HC3H 2X1OA 4G8IB 3BDYL 2R23B 2FGWL 3LKSB 5TGBA 4FP8H 2CIKB 4HEME 5B21A 5A2KH 4JFQA 1OAZL 4PJDE 4WUUD 4WIQA 1JIBA 1DFBL 1JNLL 5T33L 5FB8B 1HHKA 3GSNB 4L8BA 5CJXC 3GSUA 1O0VA 2WSKA 1T5WB 3JTTB 5C92A 1TCRA 3CC5A 1F42A 2OX5A 1IGTA 4HS8L 4OF8A 1RZ8A 1TMCB 4L8SB 2EDLA 5EZOL 3WUWA 2AJYH 4PJ8A 2MCPH 3SCMC 2K7PA 1JUFA 5EBMB 4WUUB 3QIWD 4M3JA 1MAML 3H7LA 4EVNA 3T65B 5FYJD 4NO3B 4YR6B 3IGAB 4Z7UE 1S5HA 4CBPA 5J9PB 1QRKA 1LO0L 3MXVH 1JPSH 3VGAB 3MRKA 3C9NA 1CFSA 2JIXA 3QWOB 1J86A 5IB4A 2OTWA 5FUZH 4ZPTA 5ANMB 4R4FH 3QIWB 2X1QA 4G42A 4HDIA 1H9VA 4XRCA 1IC1A 4HBCL 3E8UL 3RWDB 4YEFA 4W4OA 3QNYA 2CDFA 5I8EB 2GKIA 3JWDH 3PP4L 2ZUWA 1C5CL 4UT6L 1CT8A 1GIGL 1G6VK 2XXMB 3LEYL 2HJKA 3IETA 4TVPD 3ZKXB 1MY7A 3ZKMC 4WW2F 5EU7C 4HGKC 1WWCA 2HFFB 2W65A 1VPOH 1YDPA 5J3HD 1NUNB 4LPYA 4LCWA 2BFVL 1P4BL 2P5EB 3TJHD 1JZ2A 4OIBA 4TYUA 2R8SL 3X13B 3SE8L 3B3IB 3MV7E 4XCEB 1RIHH 2F58H 1PZUB 2FB4L 4OCNC 4YHIA 4AL8L 4DUXA 2BOBA 3O8XC 4U33A 1J8HA 3TNNB 3UP1A 1RZ7H 1FORL 1AIFB 1AP2A 1NGQL 5J11B 4N9GB 2J8UB 1L7TH 3I50H 4QLRA 4Z78B 4ORZC 4PJDB 1I1CA 3SGEH 2ITCA 4QXUL 4WNQA 2GJJA 3B6SA 4GAFB 5E6IA 4JDVB 4Z18A 3TF7C 4MD4A 5KG9B 4HPOL 1QOKA 5C07D 4F7PB 1XGQA 1ZHLB 3RWIA 1U92A 2R0WH 5CD5C 1DBBL 1L0XA 4V1DD 2FEEL 1S7WA 4BFIB 3V4VL 1X5IA 2B4CH 4UV7L 3TA3D 5I1KL 4OCYH 4OT1H 1TVBA 1X7QA 1P7HL 2W0PA 1XGTA 1XIWA 2I9LA 5D7KE 3G04B 1CLZL 2I5YH 2M26A 4XNQB 1IQDB 2C4XA 4PJFA 4WHTA 4NM4L 4L9LB 3V6BR 2ESVA 1AI1H 3MRQA 3LMJL 1UM6L 4OF7A 4Q6YA 1PYWB 3RFZC 1I8IA 3KR3L 1TQCB 4V1DB 4CMHC 2EZ0D 4W4NA 4BH8A 3ULSB 5MHSE 4HT1L 4JRYA 1IVLA 3MA9H 3ZT5A 4JPKH 1IGML 1ZK9A 4X7CC 4ONOA 1XF4B 1RZIB 5F9AC 3HB3C 2H8PB 5JW4R 1T89A 3H9ZA 5F6IB 2FZ3A 3TBVA 2BSTB 2VLKD 2IPTL 3CLFL 5TE4L 3MV7D 5F88A 1EEQA 3MGAA 4PG9B 2CLVA 4Y1AD 1XT5A 3W0WA 4MS8C 3V6FA 5B8CA 4UAOC 4OGAC 1ZLVK 2J6EH 2PTTA 1GGIL 1BFVL 3OXRA 3B4NA 5CILH 2OJZH 2X4NA 4FXKA 3HUJB 2VB5A 5KS9E 2VLKA 1FSKB 2N56A 3EGSB 4QRUA 4Q9RH 4NRYB 1CFQA 3MV7B 1FAKT 3V4UL 4J3WA 2A6IB 3JXAA 4EQ3A 2IH3A 5LXGL 1F3JB 2V7HA 4QRPD 2VLMD 4S1QH 2MOVA 5SV4A 1LVEA 1OP3K 1N5AA 1LE5B 1J7VR 4Y16D 2X4TA 3W5MA 5DK3A 4CU6A 4DGYH 1S9XB 3MMEB 3HMWL 1W72L 4EXPX 5D7KD 3S7GA 4P46C 1BP3B 4XXCA 1K4CB 3G5ZB 1AJ7L 4LDLB 1T83A 3S6CA 5IB2B 3OHXB 5I76A 1RVFH 1AY1H 3UTZA 5E6ZA 3E6HB 4TSCL 1K85A 3ZHKA 5LGKA 1NJ9A 4QRPB 2F74A 2Q7NA 3LV3A 1GRWA 1Y0LB 3GBMH 1D5MB 2ERJC 5KAQF 4X5XB 3WXVH 4ODUB 3ARPA 3BP5A 2FX9L 4Y16B 3DGGB 7FABH 4KTDL 3SKNB 4MXQD 5MHSD 4JFHD 5ICYA 4Y4FC 4G6AC 5GGSB 1DLFH 2P1YA 5HYFA 5KSVA 1UJTA 5HYSG 4XPHH 2I26N 3SEPA 1YECH 4NQVB 1G1CA 1PG7L 3HCVB 5DUPL 3ECBA 4PJGE 4PTTA 2XPGB 4DKEH 5GJSH 3L5XL 2B8OT 3QCVL 3LN5A 4HJ0D 4XMKL 1MHHB 4M1DL 4X5WB 3TPUA 3RZCA 1PKQA 2XWJA 3UPAA 1M71B 4FFVD 2CRZA 1A21A 4NGHL 1DQLH 1G7IA 5DMGC 1YEKH 3O45B 2A73A 4KGJA 2DYPD 3L3KB 1Q72L 2R2EB 1LDSA 2W9EH 1V3LA 3HFMH 4KV5F 1I7TB 2VZ1A 4XP6H 4K23H 4K7FB 1KLFA 3L6FB 1KNOB 1MIEL 1T3FB 1J5OH 5KVGH 1A7BA 4GBXD 1XF2A 5GRUL 4QY8A 3OKMA 3TCLA 2P46B 1KYOK 1ND0A 2DYPB 2Z8WC 3HZMA 2YN5A 1C12B 5DJCA 4R3SA 4KHXH 3SKOA 1OAYL 5AG9A 1AR1D 2YK1H 3ALWA 1AO7E 1K6QL 2Y5EA 4TRPL 1LWRA 4EUPH 1A6UL 4GBXB 1JK8B 5C2BH 2HWZL 2E7MA 2GFBB 4Z5RB 2EXYC 2GJ6E 35C8L 3BP7A 4PJHE 4OD3L 4RMRA 5F96H 2CXGA 2BSSB 4TPRL 4YC2C 5FDWA 3SKJH 2YEZB 4UZGA 1V7NL 3C6SA 4PP1D 4WI5A 1B2WL 1NCBH 4LVNC 5C86A 4IOIA 2EDFA 4LNVA 3KLDA 5BV7H 2BXZA 3MLYH 4GG6F 5ESVA 4RGOL 3BN9C 4U05A 3PG2A 3P0VL 4BYHA 5I16B 4L4VD 1ZEAL 2FH8A 4L8DB 3VFVA 4LHUD 1T4KB 1LP9B 1YEEL 3V6OA 5H35B 3KYNA 4P3DA 3RGHA 3QHFH 1FCGA 1FPTH 1BIHA 5JW5A 1BVZA 4PJGB 3K3QA 4JVUA 3BZEB 4JRXA 5I1HH 5FDYA 3N9GL 2ED7A 2WBJA 4OJFL 5DJ2B 3VWJC 4DKFH 3NTCL 2YMXL 5T1DL 4DGVH 4LHUB 1T1WA 5TQ2H 2Y4SA 4JFOA 4K7PL 3A6CL 3VFUB 1BD2E 4JO4L 4YX2L 1EHLH 1JF5A 1HE7A 3CVHB 5HGDA 4RMWA 3PDOA 3TBYB 4JN1H 2FEDC 4HF5H 4RA3A 4YXLL 2NR6C 4RDQG 1B90A 4M8VA 1UH2A 5L88L 4MCZB 1VGEL 2VL4A 2XIDA 3IFPA 4EKXA 1NCCL 2QL1A 3S35H 2IH1A 1CL7L 1QBAA 4FQLH 3RL2B 3WFEL 4KHTH 4PJBF 1CF8H 4M6AA 4YGVA 4WO4D 3FTGB 4EN3B 4OZHA 2GJ6D 4KMTL 3JZ7A 4WHYH 5IEKA 1Z9SA 4H1LB 1D5BA 4F33A 5F71A 4P5TD 3D0LB 4H0HB 1UT9A 3AM8A 2Z8VC 3U2SB 4N68A 2VXTL 3TH3T 5AWNL 2EE3A 5D1QD 4ZXBC 4MD0A 1I7RB 3QEQE 2C3WA 4UILL 1QFWH 5D6DA 2A0LC 4WO4B 1ZOXA 3TYGL 2GJ6B 1R5IA 2PYEE 1YMHA 5H2BA 4UTAH 4HQQH 4PJHB 4HIEA 5FECB 2F19L 4YUEL 1U91B 4P5TB 4AJ0A 3TV3L 3D39E 3ZKND 5GS0D 1O5DT 4ZQKB 3ROOA 5D1QB 3BPCA 5J57B 4CJ1A 1CVRA 2J6EA 4CU8A 4HSQA 4N0CC 3VRJB 2BC4B 4ZD3L 5TDOA 5B4MD 5TFSL 5D7SH 1AD0B 4GUPB 2Y5TA 4UI2A 5GHWH 1CE1L 5DURB 3MOAH 4UTBH 2R1YA 1F90L 4PG2C 1N3NA 1KJ3H 5LAXB 4X80H 3CFJA 5FV1L 3TO4A 1G7QA 5IVXF 4P3CL 4PS4H 1AXTH 4YZFF 3OKLB 5DJDA 3MBED 3EJJX 5FYKE 1OARL 2ICWB 4IS6B 2BDNL 4PLJC 2HFEA 3KPNB 1FFRA 2G2RB 4JHAH 4M43H 1XCTB 5FK9B 3TBTB 1MH5B 3ULUE 1FNSH 1ZLWH 5DZNA 3VFRB 4IDJL 4NN7C 4NZRL 1JYVA 4D0DB 2AJ3A 1ES0B 5C0IA 1ZA6A 5IHLB 4PUBH 5FOJA 1HHHB 3KPSD 2IBZY 5DJ8A 4U3XA 4WUKL 1U2CA 3V5HB 2GHWB 2E9BA 3HC4H 5SWZA 3EBAA 5F1IA 4QHNA 4JN2A 4JEGB 1J0ZA 1D5IL 1RURL 4TTDC 4XVSL 4XPGH 4P57B 3QEQD 4P2CG 2NY7L 3GSRB 5DQJB 1PGRB 32C2A 2L7UA 1MSPA 2Q6WA 4WCYH 3C60A 4LRNH 4G8EB 4K9EC