1QDLB

The crystal structure of anthranilate synthase from sulfolobus solfataricus
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
195
structure length
195
Chain Sequence
MDLTLIIDNYDSFVYNIAQIVGELGSYPIVIRNDEISIKGIERIDPDRLIISPGPGTPEKREDIGVSLDVIKYLGKRTPILGVCLGHQAIGYAFGAKIRRARKVFHGKISNIILVNNSPLSLYYGIAKEFKATRYHSLVVDEVHRPLIVDAISAEDNEIMAIHHEEYPIYGVQFHPESVGTSLGYKILYNFLNRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of anthranilate synthase from Sulfolobus solfataricus: functional implications.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Lyase
molecule keywords PROTEIN (ANTHRANILATE SYNTHASE (TRPE-SUBUNIT))
total genus 54
structure length 195
sequence length 195
ec nomenclature ec 4.1.3.27: Anthranilate synthase.
pdb deposition date 1999-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00117 GATase Glutamine amidotransferase class-I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qdlB00
1C3OB 3L18A 3ER6A 4AJ9A 2AB0A 1A9XB 4B7AA 1KWGA 3ZR4B 2NV2B 4MGHA 4BFLA 3ZJ5A 4RKYA 1JDBC 3PQ4A 4L7QA 4AULA 4Y0NA 2GK3A 3EFEA 1KEEB 4K2HA 4ENQA 1FYEA 2VPIA 2VDJA 4N12A 1QVZA 4P35A 4ADSG 4Y1FA 2IUFA 4ZGGA 2ZUWA 2VRNA 3PQ8A 5E9AA 1GGJA 3UJNA 2VXOA 3L7NA 1T36B 4JQSA 1T0BA 2LXNA 4E5VA 3B3AA 1KA9H 3BHNA 4E08A 4ENUA 3B38A 5JZMA 2OR3A 4Y1RA 3L3BA 5SY6A 4ZDJA 4P36A 1SOAA 4L8FA 3EN0A 4LGYA 1I7SB 1PDWA 4UZSA 4ENSA 4AUEA 2YWDA 4ZDIA 3R76A 4RKWA 2YWCA 5JZOA 1ONSA 3P9QA 1CS0B 1QVWA 3WFZA 4I2NA 4OJYA 4ENWA 4I4NA 3TTTA 3NOQA 3MIIA 1T3TA 1QWSA 3TTWA 5DFAA 2H2WA 4S0ZA 5IP5A 4Y1EA 1BXRB 2R1VA 2R1TB 1IZYA 4L8WB 2V4UA 3TTUA 4ZDKA 3UGJA 1J42A 3P9PA 4B2YA 4HCJA 3UK7A 3TTXA 3KKLA 3F5DA 3PQ6A 3PQ7A 3SF8B 2AD5A 1GGHA 1GG9A 1PDVA 1I1QB 1U9CA 2A9VA 2YWJA 4XLLA 4P5PA 4QYXA 4Y1RB 3TQIA 4B31A 1I7QB 4ENTA 2FEXA 1GGEA 1OY1A 2R1VB 4P2GA 1C30B 4PXYA 3R74A 4AUNA 3D54D 1GPMA 4AUMA 1P7ZA 4WXYB 1OX4B 5SYAA 2VKTA 2GHRA 1N57A 3CYFA 2D7JA 4L8YA 1VCMA 2WJZB 4UOQA 3NORA 1R9GA 3B36A 1P5FA 4L95C 4R7GA 5SY4A 1VCOA 1KWKA 3NOVA 4I46A 4Y1GA 1L9XA 2R1UA 1UCFA 1KXJA 3GRAA 3SF8A 4B5KA 4D1YA 3NONA 3NOOA 1WL8A 4MTCA 4UNIA 4OFWA 1P7YA 3PQ3A 1S1MA 5SY9A 2RK4A 3NVAA 1P80A 3L4EA 1GGFA 3M3PA 3R75A 3TTYA 2YWBA 3OT1A 3CZ9A 3RHTA 1JVNA 1G2IA 3BWEA 3P9RA 1PV2A 1VCNA 1Q2UA 1FY2A 1CE8B 2NV0A 3P9SA 3PQ2A 2ZUSA 3PQ5A 1K9VF 4GE0A 1IPHA 1Q7RA 4GE3A 4BIMA 3CY6A 2RK3A 1IZZA 4WINA 4OIFA 3MGKA 3N7TA 4MNTA 3VU3A 4GUDA 1OI4A 3UMMA 1P81A 2ZUVA 5K4AA 4ENVA 3TTVA 3CNEA 4OGFA 1O1YA 1QVVA 3F71A 4B40A 1CF9A 4UOZA 1OX6A 2ISSD 2XF2A 3EJ6A 3UOWA 3SOZA 4BTEA 3EZGA 5BV2P 1OX5A 2ABWA 4OGGA 1GGKA 1PE0A 1QDLB 4N0MA 2ZUTA 4ENRA 1M6VB 2W7TA 3EWNA 2RK6A 1GPWB 1QF7A 2R1TA 2ZUUA 4OQ4A 3TTSA 1OX4A 5LIRA 3FSEA 4UCFA 4LRUA 4P34A 1SY7A 3ZJ4A 4ENPA 3OT1B 3FIJA 4L78A 4QYTA 3CZAA 1VHQA
chains in the Genus database with same CATH superfamily
5D84A 3DAOA 4NH4A 5BWOA 2YXPX 1FYXA 1K6IA 2Z5VA 5BQXA 5H68A 4LRYA 1GQ2A 2KLHA 1Y33E 2LKDA 3I8SA 1G8YA 1Z18A 2VRCA 5AOCA 2C9BA 2VP0A 2P9YA 3GJ7A 3U7EB 1R0WA 4M1EA 1S1CA 1RQNA 3I2GA 1K06A 4RVNA 1RYBA 3H13A 4XQ0A 1FLAA 1RVV1 1Z38A 1TZCA 1J90A 2Z8YM 1AZSC 4AJ4A 5EL0A 1L4UA 2ON6A 3F9CA 1DBVO 1N2OA 1PHRA 3OEEA 4G5RA 5GJWC 4KG7A 3UUFA 5CB4F 2XVYA 1QANA 2ZANA 5ICFA 3DMNA 5ALQA 4BLUA 4KAFA 1TCVA 3VTAA 3K0HA 3TQRA 3V4OA 4AP6A 3GN2A 3KKOA 3R0IA 1B76A 2GO7A 4QOEA 1QRRA 1KYIA 2OBXA 2PSSA 1ZA1A 3I1FA 4IOLA 4WOPA 4TTQA 4X7RA 4LGYA 4N6OA 2QE7A 4ZCRA 5EKSA 3ROPA 3Q6MA 3A05A 1XU9A 3V8PA 1RS0A 3R0JA 3H1FA 1GTVA 2HO5A 3LMKA 4HVAA 1ZN8A 3W4IA 5K6AC 2VJKA 1VP9A 1NW5A 3OTOB 4F2PA 4DUPA 1O77A 2Q62A 2RH8A 3ACDA 4UCXA 1BE8A 3PUKA 5K03A 3B52X 2J3DA 3S2ZA 2BIFA 4J1SA 1UDWA 1B8OA 3QENA 4WZBE 4XX0B 2VT6A 3A6JA 5FI0B 3TECE 4TTPA 1LC3A 1Y48E 5JS6A 5MN5A 1WMAA 2NPIA 1W0JD 2EG9A 5K05A 4BIIA 1RBQA 1JXMA 3GEBA 3DHWC 3G8YA 4KXQA 5LVAA 3KUXA 1SOMA 2J4FA 4KKXB 2O2DA 2YC4C 1IJBA 3B2NA 1JFLA 1GZUA 4CUJA 2D7JA 1NRXA 1U1IA 1TGVA 1VCMA 1DT3A 1ONNA 2XQFA 3PJFA 3B36A 4Q21A 5DM1A 1ISGA 1HR0B 1Y7IA 4FN5A 4KFTA 3K0CA 3E0QA 2F67A 3NDRA 4EYGA 1QR2A 3JWIA 1LBHA 1Z7GA 3CPJB 3DTVB 1CG6A 4KI7A 1D2RA 2QRQA 3OE7A 4OFWA 4OUDA 3DFKA 1QIGA 3KKEA 3CVUA 3TSWA 4C05A 1W7AA 4KMSA 2OK8A 2FFAA 4QX6A 3R7SA 2QLNA 3E9RA 1OJ7A 5FNVA 2IIPA 3C6BA 3G68A 1T6NA 1GKKA 1NW7A 2EC5A 2OCYC 5K3EA 1Q3TA 3M6XA 1JHMA 2Q28A 5KC8A 2ZUFA 2Y6VA 3JPWA 1XQWA 3KCNA 3A6KA 3MJHA 4MLCA 3S2YA 2P2CA 4U7JA 2VATA 1DCFA 2UKDA 2F6RA 1NMEA 4YQEA 1UM9A 3BBLA 3IQDB 4JLAA 5ALTA 5BURA 3AWDA 5AM1A 3H2JA 5E6RA 4B3HA 2WILA 4LZPA 3LY8A 5D86A 3L4KA 2QJTA 2I9PA 3KOZA 1GQRA 1V4NA 4ZO6A 4ZI7F 1KJYA 3BJIC 4FGJA 3PFBA 2I6GA 2YHAA 1JKMA 4FYYA 3MRVA 2IYAA 2JIRA 2D7CA 4UASA 4EY8A 5KDOA 1RZRD 1MBZA 2ZRNA 1E79A 2HJGA 4O2RA 3VDRA 3FKSD 3UAXA 2QG6A 3B89A 5AIBA 5DULA 3SC2A 2PKQP 3FCUB 1SD1A 2I62A 1U9YA 3REFA 2K87A 5AVRA 4E30A 1NU6A 2XWBF 3EFHA 1JEYA 3EXFA 5EE0A 4CM9A 4EGQA 1FP2A 3OQJA 1K97A 2GPWA 4FYVA 5DIFA 4H7HA 3TPFA 3ZWKA 4B82A 1F20A 5KVQA 4S1WA 1BWSA 2NXWA 1NXQA 1F8XA 1POXA 1NXWA 3GQBA 3JASA 4OOEA 3ZWQA 2V7XA 3P5SA 3N8HA 1F1BA 5JDIA 2GN4A 2QIOA 3D6NB 3IHKA 3L0SA 2YJNA 4HDAA 4UTZA 5FO1A 1I33A 3HBLA 4GBGA 1BN7A 1NV8A 1W6RA 2ODAA 3UT5A 3PGJA 1KQFA 3D7NA 2P0YA 1M5TA 3IPCA 4BDSA 2BR5A 5CA1F 3GJQA 2ES4A 4XYBA 3A3OA 4X61A 5TV2A 4E2FA 2C7PA 2RHCA 1P3DA 3H4IA 3WDSA 5L95A 1KJNA 3FM9A 5EQTA 3U39A 1XIVA 3RS7A 1Y3IA 2A14A 2RGNC 2H57A 4RPIA 4EHFA 4HGPA 4LVUA 3PGLA 2I71A 3HKEB 4G07A 4OK3A 1J21A 5LQUA 2Z6VA 1DKPA 1T3TA 4WUTA 1OGJA 4UDNA 3C39A 4PLFA 3D2BA 4GT1A 2OBFA 2ZWMA 3DQZA 5KQMA 1ZC4A 4IIUA 1UEIA 2CCGA 4KBGA 1QF6A 2D3WA 2VUIB 4YJDA 4H4CA 3S1LA 3PV0A 1XJ0A 1JVSA 4E21A 1VPTA 5A7HA 5AHWA 2C2HA 4KWHA 3CPHA 1COWA 2C96A 5HSGA 5LQMA 3NIFB 1GT6A 3IPAA 4XDYA 4W5OA 1JR3A 3CO0S 1C14A 1GN9A 2I03A 4R2XA 4RXTA 4C0SA 2KM1A 1SHLA 3QW4B 1DKLA 1E3LA 1T15A 5FHRA 2NSDA 4YRBA 1C81A 3EWIA 3CH5A 1BSVA 4L95C 4XVQA 2XQKA 2O7SA 1SVOA 3PX3A 4MV1A 3FTFA 2ZR8A 3CLHA 4L4RA 4AG5A 4Y7CA 5J2UA 3D0RA 5CFZA 5D5PA 4O59O 1U9JA 1NGSA 1NI4A 1YZLA 1E9CA 1QTQA 3DC7A 1GZSA 4B4OA 1C7ZA 2XKKA 2OZKA 1E96A 1T9DA 4G37A 4H6PA 3MT8A 4HZUA 2F48A 4L8VA 3AY3A 3CZ4A 1GCAA 1RBYA 2A0FA 2JFVA 3NUQA 1ESDA 3BDVA 4WN9B 2JG3A 2H4ZA 1QUEA 2JHPA 3U7JA 1MA3A 1YCHA 1HEIA 1CY6A 1SB8A 2QQ0A 3HY6A 4YP5A 4S0XA 1ZK4A 3MOGA 2ZJFA 2W11A 4UHFA 4YP6A 4HWKA 1F8GA 2ZDHA 3BQMB 4DHWA 1KZ7B 1KGSA 2Q3EA 1AQYA 1YV9A 1OI4A 3CF6R 3M9LA 2WSSA 3ITKA 3DBRA 4HB2A 4YMVA 2H08A 3IXMA 1Y42X 2E1RA 1LRLA 4LWQA 1F3OA 2IEGA 3KQHA 2V8OA 3R09A 4DXAA 2VL7A 1UDCA 1X9IA 4RYLA 5D7NA 3H2HA 3HBNA 1H2FA 2EWVA 4JJEA 2BR3A 2NUAB 3HA3A 1VSUA 3GDFA 5CAEB 4D41A 4DIKA 4WVLA 3ID6C 4U2GA 2IY8A 4ZT6A 1YK0A 2IUTA 4E33A 1A9OA 2PKQO 1N3IA 3KHTA 1G8HA 5FV7A 2IYFA 1H23A 4BNKA 2Q9UA 4MW1A 1NMQA 1W2WB 1ZG3A 1O0BA 2C0QA 3FTEA 1DINA 4PHHA 4JWTA 4BNGA 3MN1A 2Q1UA 3M6UA 1B43A 4LSGA 1P4GA 3A9CA 4L1KA 3ISVA 4WCFB 1JB1A 5JSKA 1HYBA 3NQ41 5P8WA 4C7KA 3IVGA 4QVGA 5DNEA 3JQCA 2JGEA 3T7SA 5CEJA 1L8XA 3VU9A 1YMVA 3KL2A 1SG0A 3AXTA 1N9GB 1S2MA 2IYXA 4JJFA 2HC9A 2BE7A 2VRNA 3EXHB 3GCXA 3UANA 5IT0A 1OPXA 2O23A 3H7AA 2WKWA 4BU1A 1WPRA 3ANMA 3RS8A 4AJJA 3C6ZA 2QP9X 4LZAA 1PP4A 3MPUA 1F8YA 3O82A 5ICGA 1UQRA 3P4YA 5IJAA 1HFEL 1C9MA 4D8WA 4WIAA 2NTYC 1EX6A 2G9RA 2Y99A 3WTCA 5JSFA 1YOVA 1VMEA 4AUEA 3LYAA 4X60A 2I7XA 3I6YA 4HPWA 4QGHA 5AMXA 3WG9A 5KTOA 2GCGA 5AOBA 1K5GA 2R7AA 3BUSA 1UJCA 4I2NA 4I6EA 1O97D 5FWXA 3VM6A 1H5QA 3WNBA 3I58A 3KLMX 4XX1A 3LX8A 4XQ9A 1U8ZA 3EGIA 4QHTA 5BQ3A 5IJZA 1HLDA 4G89A 2CFCA 4F1JA 3GLHA 2IZZA 2IYSA 3U7QA 3H5NA 1MV8A 4M22A 2WKPA 3ICVA 2XVAA 3KUDA 4B2YA 5DO9A 2PTGA 2XSZA 4Z9AA 4FILA 4XVUA 4A36A 3DSRA 2AD5A 1NUQA 3H5LA 3PC2A 5JSUA 3P71T 1ZQ1A 2WPDA 4MYTA 4ZJZA 1TCCA 3A4LA 4TWZA 2R1VB 4HXFB 4KVFA 4J4HA 1DEHA 4RHFA 3O91A 1C3JA 4NZMA 5DRYA 4D4HA 4F12A 2DQYA 1UBLS 1V3QE 2GHRA 2JJ2D 3NWOA 4LJAA 5JY1A 1NT4A 2HM7A 2XJ9A 1OVGA 2L19A 3JQQA 4CIYA 3BMQA 1OYYA 3K72B 2YMPA 3O4RA 4D56A 5ES4B 2AOTA 4KYIB 4L4XA 4LDAA 5GQSA 4ZCSA 5AESA 4OVKA 1SXJC 1RKVA 3TQOA 3EOZA 3EYWA 1T25A 4EVIA 3DOUA 1ZEMA 3VOBA 5C35A 2IF0A 2H0RA 2KLBA 3LDGA 3HO1A 5LKAA 4BQSA 1PEKE 2WZCA 3PI7A 1T13A 1T2VA 1NW8A 4F7WA 1TTHA 4F8YA 4LPSA 3TAXA 1MV5A 3F5SA 5BYKA 3D3WB 3R1IA 4XPIA 4WBNA 5GJVC 5TF4A 3ENKA 1CZKA 1OZHA 1WQ3A 1P2VA 2MOKA 2Z98A 1R7RA 4MNTA 5A0VA 2MINA 5C9ZA 5JUWA 1MPXA 4M2LA 5F3DA 2GH1A 1UMBB 4TTTS 5BW4A 2BGNA 2J59A 1OBFO 1PNQA 2IZ6A 3LT1A 3PD7A 4FOOA 4PLHA 2Z08A 3GEHA 2AFIE 3ROMA 1NZJA 1OXVA 1L5GB 2P4HX 1Z4NA 1ZMTA 3CR8A 2RK6A 3M1LA 3VNVA 4RZ2A 2ATVA 3QUSA 3CMCO 3NM5A 4Y8VA 2Z2KA 3NBQA 4DR7B 5LSAA 3ZZTA 2IXBA 5HR5A 4NJMA 2W43A 4X84A 4CTJA 3I9JA 3KG2A 4YAOA 1AQJA 5BSVA 1ZA2A 1QXSA 1RR6A 3G9UA 2VNAA 2EG5A 4EGSA 4EYOA 1GFIA 3LUCA 3OJXA 4L5YA 2UXBB 4H6WA 2B1GA 2BKAA 1RMQA 2YJTD 4OOFA 5KQLA 5FWYA 1LQTA 4RFLA 1L5ZA 1I9CA 4F3KA 2YWXA 3GEMA 2FUG6 3RVMA 4YJGB 1B15A 1ORVA 3CUYA 3Q1LA 3VKWA 4DXDA 1LPNA 4RVCA 2AI2A 4D26A 1R4NB 4HH1A 1JTFA 1G1AA 4Z7QB 4RFSB 3EX7C 3EA4A 4ZEWA 4B74A 3OY7A 2FW6A 1K68A 1DAFA 1AN0A 2CXRA 3GGDA 4GVLA 3WWPA 1AB6A 1Z26A 4B8WA 3G2PA 4JEIA 2EF0A 4AZ0A 3KPWA 5J47A 1SIUA 1B93A 121PA 4Z2AA 1OA0A 1GQFA 3I5MA 4AURA 1SQ5A 3G5AA 2X23A 1MQAA 2IV7A 4BLSA 3EGXA 3TZHA 1DC7A 3H1AA 2P1DA 2ZJ1A 1IOZA 3IEPA 3PP8A 4NMWA 4TRMA 5H3LA 4BMDA 4CQLB 1CD5A 4LX0A 4DJTA 5IABA 1OPRA 1Y6GA 4PICA 1ETUA 3WV5A 4YQYA 3UGTA 2OECA 3GVIA 2XMDA 1TI7A 3KDPA 4II2A 4TL8A 3AEUB 2CB0A 3PT9A 3OUTA 4UM9D 3ZOZA 4MWSA 1QJ4A 5BWCA 1DUSA 2CUKA 2OT3B 4DQKA 5A5DA 5GZ3A 3H83A 2GM3A 1W19A 1R0RE 1YZTA 2ATEA 3FR8A 5JYDA 3G0HA 4AUNA 3ANTA 3DKKA 2G40A 3KZXA 4N47A 5DIZA 2I7CA 4PC1A 3THYB 4ZQFA 2PNFA 3RADC 2WJZB 5LQSA 2GBPA 1ZOLA 3O8OB 4LC0A 5L45A 4Q9KA 1NVKA 1IJEA 3CX3A 4JT9A 4L0CA 1VG0B 5IYZF 4P58A 3RU3A 1GAEO 4OQQA 5CYGA 4U6QA 1BE0A 2Y05A 1XVUA 2MIIA 2RC6A 5CK4A 4QTTB 4B6GA 3HADA 4PQRA 1DC5A 2NSYA 2G04A 4EATA 4ZYLA 2FRDA 3VR4D 3T5GA 3PCRB 1LDYA 2XTJA 2XAAA 1NASA 2Y0DA 2Y9MB 3F7MA 4M9RA 3SAJA 2IS6A 1NDQA 4L15A 1NWHA 1AXGA 3I9NA 4NK5A 2NU9B 2I4NA 1BKYA 2NAFA 4M0DA 3JXEA 5C32A 5JH7B 1GRNA 4ZAZA 4MB6A 4TS4A 2XR1A 1YBMA 2YIJA 2ACVA 2YNMA 3AF1A 4M0EA 4TLBA 3SBXA 5H4HA 2FR8A 4W5JA 3GPIA 3QHPA 5DM0A 5LC1A 1K0FA 1J8FA 2XYRA 4DARA 4X1KA 3ORFA 3TGLA 3V8MA 4AY6A 2R9VA 1AV6A 3KOXA 4IJ5A 1YIAA 2ABWA 2W8BB 4ZTZB 4PAQA 2G06A 3KR0A 4DIUA 2R5FA 1M6VB 1KVUA 1QAMA 3NJ4A 1CE8A 3SXJA 3MTQA 4RIGA 5LPNA 4KL8S 4J1NA 1NP3A 1UBTS 4Z4IA 3A6EA 3DKIA 1Y6JA 4M1SA 2LIVA 3BRWA 3QXSA 4RKYA 1FSFA 4OI1A 2PD3A 1Z8NA 1YQQA 3CKYA 1OZGA 1W5BA 4REMA 5J4KA 2CLHB 4AJ9A 3LQYA 2HXGA 3PNBA 5JNVA 2QAGC 3GK3A 2ZSDA 3KDSE 4P83A 4BFLA 3OD1A 4QPDA 4JP1A 4NMMA 1L5YA 2F00A 4WXHA 1FTNA 5DGIA 4FS3A 4DA6A 2DUUA 3IQEA 5JT1A 2O57A 1PGOA 1ZJJA 3AB8A 4Y9RA 1VKZA 1LZLA 3PYMA 3RYCA 3N2EA 2AEJA 4E88A 1VSTA 2DOKA 2YW2A 3EGWA 2P6OA 1G63A 4Z1MD 1UEJA 4D96A 2YQ5A 3PG5A 4ZI2A 3ELYA 4LE1A 1KSFX 3BIOA 4JQSA 4PQEA 5ABPA 5I3CA 2FK7A 5A5VA 1SVWA 4C43A 5ADUS 3FH0A 3T94A 3RSSA 3OTGA 4JLWA 4O4IF 4NABA 2AIRA 4BV9A 4E0BA 2YNMD 2YVAA 4P6VF 1U6KA 3AI2A 1FYWA 2WHYA 3CWQA 3DBIA 2WU1A 2B36A 4EEKA 4NBSA 4O4JA 5IKPA 5ARDA 3Q15C 2MJLA 1RLJA 3PQFA 4NS4A 4Q9AA 4NIMA 3V2IA 2XTAA 3EULA 2JBAB 1NF2A 2W71A 3CVYA 4TYWA 1L8OA 4LOLA 1Z6ZA 2ZUDA 4AKTA 3LFHA 1NV9A 3UJDA 3N6XA 3B5EA 3U62A 3MRSA 2Q5QA 4TGLA 3BAFA 4II3A 5KTRA 1BXRA 3ND8A 1GO2A 4RJIA 5GV7A 3DMHA 2B7CA 4ZGBA 3H19A 3NWPA 3U44A 1JWAB 1N4AA 2JAQA 1ACLA 4M76B 3TK1A 3MEQA 2BFCB 2KB0A 4CUKA 4BAGA 5B6JA 3R44A 3VPXA 1O87A 1PJCA 2GK4A 4I6GA 4GPZA 4TYMA 3SJ7A 3HGTA 2I33A 1NC3A 1Z5PA 4ZAGA 1A9XA 1W0KA 4XUGB 2DWUA 2XKAA 5KMGB 3PEVA 2BDEA 3FZQA 1WQ1R 4EW3A 3OCUA 4LJRA 1C8KA 2R5WA 2H4JA 2RMKA 4YRQA 3P9YA 2FWIA 4DDMA 2WJJA 4KWTA 5F1OA 2IH4A 1UP4A 1W4RA 2G1AA 2HA4A 4GEGA 2ZPUA 4Z1MA 2AG1A 3EGDB 2DM6A 3FROA 1GP2A 2FVYA 2ZBPA 3NBUA 1T2CA 4KIGA 3X1DA 1KGDA 4BFZA 3GGOA 2FGKA 3OQIB 4Q24A 3FW1A 5ESDA 4DCJA 4ZJUA 3KKKA 3U6KA 1P74A 3ZU2A 2IF2A 3TPCA 2IYNA 1DEKA 1DJOA 1BMQA 4H1UA 5F12A 2BT4A 3K8OE 2AOTB 4YH1A 4TXLA 5BO5A 1VG8A 1PGNA 4BV2A 4I8DA 5DYNA 3GMTA 3B1KA 5BN5B 2PT9A 3PYXA 4G36A 4ERNA 3HU5A 5HQ3A 2WHRA 1UP6A 4TLEA 4DMCA 1OV4A 2C5GA 4RKRA 3WJAA 5DF1A 3F67A 2M32A 1ORDA 3V4PB 2C5FA 2XY4A 4KKVA 1OC4A 3CVOA 4QBFA 3COPA 2J45A 2ZJ8A 3RKSA 2F8TA 1RKXA 2AK2A 3EQ7A 1DKMA 1S7GA 2KHZA 3NM4A 5CLFA 3QVOA 3VR6A 4TM8A 4B47A 5K6TA 1JDJA 3EARA 5GONA 4A0FA 2YWRA 1TK3A 2ZCVA 2G63A 3BB4A 4ER6A 2ZRBA 3AF3A 1H1LA 2J4DA 3D5EA 4J3NA 2EGHA 1LI4A 3NVKI 2PT7A 1LBQA 1L4HA 3FOCA 2FUCA 2BRUC 1PJ4A 1YIOA 2EFDB 3HPRA 4MV6A 1ORRA 4IKEA 5A3QA 1IUPA 1SEPA 3THXB 3ZD9A 4Y1FA 5JHGB 1NC1A 1QU3A 1E3IA 1IN7A 1GZ3A 5JTTA 3GJ6A 3JQBA 5A05A 1PX0A 4RACA 1GCUA 1WF6A 2W37A 1FS5A 1HMYA 3PWKA 1TK2A 3C1OA 5GGYA 2FPGA 4NKRA 1ZH0A 1RI3A 2YCLA 2QN8A 4RTRA 1DKNA 4J1QA 1SKMA 5AXDA 2CFRA 2IZ7A 1YL6A 3OFNA 4PHCA 4PRZA 1ZBQA 1QGUB 2P2LA 2XRZA 1PT6A 2GBIA 5MFZA 1YTLA 1GZHB 2Y1GA 4N5MA 2G77B 5CXXA 2Q5HA 1PZGA 1XD2A 1ACMA 4HX9A 1GY8A 3F78A 3JYNA 5DLPA 4ITUA 3MBOA 5C1BA 5ITSA 3ZD6A 3ZHVA 2CDRA 3IJRA 2VSYA 4LFAB 4N0DA 2C1ZA 3ZDFA 2JLZA 1Y6FA 1QQAA 2F1IA 1E5DA 3AZPA 4LZWA 4XVRA 4YCBA 1JEJA 3SSMA 2YRWA 3OLZA 3OZWA 2OSVA 1ZFNA 1W30A 2IELA 5EJGA 2PANA 1JVBA 3H5WA 4RD2A 1RHRA 3QVSA 5BR7A 5JLJA 1U5CA 4Q4CA 1YVRA 4B8YA 2JPDA 5JFGA 4HB4A 3P27A 4EJ2A 4Q4AB 3QBJA 4HBZA 1BRTA 1UAYA 5B64A 1Q1BA 4L5BA 4ZCIA 3UWKA 2UUPA 1AN9A 3CJQA 4G67A 5LMZA 2ZR9A 4QUKA 4TVBA 2ID9A 2Y1FA 5IBCA 3USES 1C3OA 4K81B 4L16A 4EVQA 3O4IA 1UFKA 3OURA 4BQFA 3SYLA 3T7EA 4R84A 4EPVA 1AZLA 2BJHA 2V5AA 4MP8A 3FTNA 3RNLA 2YTZA 3IMEA 3U3MA 1AUVA 5COQA 5I9TA 3STYA 2APJA 5JQWA 5HRUA 3O3MB 1WX1A 3AK4A 1PTJA 4UBMA 5T4EA 4DV1B 3KP1A 3A9VA 1RHQA 1L5QA 4JLKA 3UVEA 1QGOA 3ZGZA 4URYR 5DI3A 2W4QA 1N32B 5JD5A 3HYSA 1LDEA 2LDBA 2ZAYA 1DCTA 3RHFA 4R0NA 1GNRA 4RM2A 3VR4A 1WTCA 2BF7A 1I5EA 4OB6A 4UPVA 5B1YA 1ZJ5A 4FFWA 4LWPA 1ID8A 3M6FA 3HA7A 5B1IA 1QO0D 2NSJA 4IIJF 2OTCA 4PLWA 1R15A 4PGHA 2H4HA 4I6JA 1QC5A 5CTAA 3KVRA 1WSDA 1M33A 1OXMA 3T15A 5REQA 1U2DA 4MPTA 3FNFA 2DJIA 3KAQA 4EY3A 4K0KB 1CX9B 3FDJA 4DWJA 5IPFA 1OH7A 4R1TA 2O3RA 5J59A 5BMVB 3ZDQA 2IXEA 4PINA 1B23P 1Y3AA 2OZEA 1SU8A 1PCXA 2HWWA 2V55B 2GQ0A 1ENOA 1V9LA 3E15A 3E5NA 3FCOA 3I3SR 3HBMA 3I2IA 2FKNA 3Q5DA 4JBNA 2Q7OE 1P9NA 3IE2A 5EIAA 3K70B 3P8ZA 2VAVA 5KREA 5LQJA 5THXA 1M0EA 2BGKA 4ZVRA 4JITA 2WJYA 5BMVA 1TUBA 4RLQA 1MIOA 1VZ3A 1JA9A 3WYNA 3A6ZA 4C03A 2FUKA 2CNWD 2G8LA 2J5BA 2W6QA 4B6JA 2FSIA 5ISMA 1CP2A 1SQGA 1XDUA 3TZBA 3THYA 2FSSA 1B6RA 5BV8A 3ASZA 4K2HA 5FB3A 3TOCA 5IVHA 3IQHX 4XWAA 3UJCA 4H3SA 3BWCA 2F7SA 4UVEA 1XD9A 4OBXA 1PWEA 1AURA 2OYSA 3L7BA 4HWOA 4IF4A 4RTPA 3H8SA 4AUKA 3UG7A 4X94A 4EH1A 4GLFA 4R8SA 2WVJA 2R87A 3BHNA 3VHXB 1OLSA 3GP8A 3HKCB 3HGQA 1EU1A 1P18A 2KBEA 5F7OA 4MK4A 2FE4A 3DO6A 3O2JA 5ALIA 2JCXA 4TYQA 4Y0VA 1ZH2A 4A26A 2X42A 1U2EA 4LWZA 1QC5B 4UCWA 4UKDA 4QWWA 2K7FA 3CE9A 3KWJA 4JJ4A 4CT4B 4FDMA 4X1OA 4QDJA 2X4LA 2VYQA 3S68A 2II6A 3AIMA 3OJLA 4F5ZA 2FX2A 3Q5EA 1NW9B 2CFSA 1RBZA 2EKDA 2PXHA 1NYLA 4GWGA 1L9KA 4FI3C 5THKA 1EBBA 3WZLA 4OX9B 3K9NA 4XB1A 2QL6A 4L8WB 4LXTA 4ETNA 2C03A 3CF0A 5KHAA 1ECPA 1ZD4A 2VTDA 2Q2VA 5LQNA 3LL4A 4AZ0B 3ZX4A 1LC0A 2XDQA 5K0JA 3TLJA 4F4CA 2W0SA 3UJ7A 1AK2A 4X1IA 1DUIA 3X1XA 5TX7A 1IH8A 2WOJA 2F4VB 1Q0RA 3FZEA 4Z4QA 4A8JB 1P6UA 1VPVA 2WIDA 1CQIB 1PD1A 4U3JB 1QYDA 2XVMA 1ADFA 3HGMA 1GXSB 4TQ9A 3TUJC 1Z6TA 4ME6A 4EJMA 4FP9A 4ZO9A 1YTUA 1DC3A 1LDBA 3K0KA 5EQJB 1SH7A 2E55A 1O5OA 2YASA 1RWMA 3HWSA 3LSYA 4OHXA 3B1XA 5E38A 4DMMA 1D04A 3EMVA 3LVFO 3FRHA 4GXNA 4MUBA 5AHRA 4TROA 4MTLA 4CMIA 3ESBA 1CDOA 4ZAWA 4EB0A 2WA2A 1EVJA 3Q7QA 3DV0B 1N4DA 4NEQA 1YQ9A 2H51A 4N5NA 4OO3A 4RBNA 1L5KA 2QVZX 3V2HA 3WQSB 3MMNA 4CHTA 4DNPA 4ZHSA 1IN8A 4RQUA 1L7EA 5TEWA 1K4MA 4DUGD 2CDAA 3SYKA 1P2DA 2JFOA 4IH9A 5A4JA 2HQBA 1E7QA 4EP1A 2ZB4A 2XZOA 1RFLA 5EWJB 5JI2E 3GDHA 4BKUA 2GJKA 3E82A 4LISA 4X44A 3F3SA 1IE3A 4C4YA 3PTAA 3ZW7A 2W8BA 1J5EB 4QGFA 4D3SA 1YKGA 2BFMA 3R4CA 4NECA 4E2ZA 4R1OA 3V1UA 1FFEA 1MRSA 2D2XA 1PJZA 3GLUA 1NE7A 3ZKWA 1GKUB 3PPXA 4UOZA 3KUCA 1ULZA 1BH6A 1Z73A 1C1HA 2WDPA 4HB3A 4LTNA 2HREA 4U2CA 2J6IA 3MGAA 3EJWA 5EHIA 1P5HA 3BXPA 3HWWA 1NBMA 4RPHA 4HVCA 5K6RA 2A35A 1FFXB 2Y1KA 1FFWA 3HCCA 2NU9A 1G4HA 1KMQA 1WV1A 1MJGA 5TPZD 1SCNE 1U7XA 4LOHA 4MWTA 3RHSA 5GJBA 1LPSA 4D7AA 2FQXA 3F3YA 1KI9A 5D6NA 2C4UA 3WYCA 2YY5A 3DWFA 1GKLA 2QL9A 5HDQA 2PA3A 3IC5A 3KQTA 5HF9A 4HQ0A 5LB4A 5KYUA 3TO5A 1JU4A 1BX1A 4LYDA 3ZJ5A 1FS6A 5CBPB 2ZU0C 1MORA 1N7GA 3K30A 3RC3A 5C51B 2JLXA 1W48A 1UKVY 4KI0A 4G24A 4UVGA 2FPXA 4O4HF 2V4ZA 2BN4A 3DZ8A 1KRHA 3FCYA 2QVYX 4LZOA 4BQOA 4CU5A 2JD1A 3IR7A 4JLPA 4QC2A 2FQWA 5GZ6A 1V71A 1DTWB 3WYBA 2QX4A 2XUZA 2Q6TA 3B8EA 4HPJB 5F1YA 1JHAA 5BRAA 4AQ7A 3B20A 1VRVA 4KK3A 1UPUA 2Y76A 1TW2A 2QX6A 4IH1A 1ECFA 2WWHA 4UAUA 5BNZA 2IYLD 2TS1A 5F64A 2P9ZA 1JP7A 1GUFA 5H16A 4NYJR 5B4UA 5G0WA 1U2GA 3DT6A 4JI3B 4GR4A 4AXBA 1ZESA 4AKSA 4FDUA 2Z3VA 1V4BA 2JBHA 3OLQA 3P52A 2XT9A 2WP8J 4J8PA 5HX7A 1P1HA 2I65A 1VL2A 2MWMA 1EQUA 3EEBA 2FI1A 4COKA 2J3IA 1K5PA 2C8VA 4DVJA 1PRYA 3OIUA 1IG3A 2O3QA 1JH9A 5HGJA 3NG1A 3OAAD 1JUDA 1VIAA 1Y5LA 5C5DA 1I3LA 2G4LA 1M1YE 2ZI9A 1PR6A 1IK6A 1I2MA 2DP4E 3P20A 4RZUA 1LLFA 3RSOA 3QEOA 4UPDA 3E7WA 2XHEA 5ALDA 2BKUA 3ERCA 4Z3KA 1U0HC 4UULA 5CX1A 3PTZA 1B0AA 1NF9A 3Q7TA 3CNOA 2PEZA 1TX4B 1PN3A 4G01B 5DOZA 2VYNA 2VI5A 3CE6A 3DEIA 2LVBA 1T0IA 2DGDA 5K2OA 2IEBA 1U02A 2Q1SA 2ZIGA 1E2KA 4KLCA 1W4CA 4QXOA 4LXXA 4E2WA 2GERA 3WLPA 4UNIA 1H6BA 4J90A 1YRHA 4QHSA 3LUGA 5E6UB 3NYRA 3X3HA 1JAHA 4MDEA 5CLHA 2NUAA 3UJ8A 4X71A 5C0OE 3ZW9A 1N6IA 4DIEA 4EVSA 3UK0A 5HFAA 2XMGA 1QTIA 2C3YA 2QR3A 3C8ZA 1Y8QA 2DHRA 2BTOA 1JVNA 1YVEI 2OXEA 4JFAA 4W4TA 2UZ0A 1UOPA 1V1JA 3OM9A 4Z9YA 3DVQX 1Z3CA 5CVVA 3DULA 3WI7A 2G8NA 3V5NA 4AK9A 4BIMA 3PR2B 1UAAA 4LY3A 5F3WB 3L8GA 2GN1A 5AI4A 1EIZA 2VDQB 1BHQ1 4QSHA 3B1ZA 3GH3A 1II9A 2P77A 4ZGWA 1BMFA 4HQNA 3WIDA 3VO8A 2QMEA 4F38A 3J7AC 2ZTLA 4TX1A 2UYGA 3WXBA 4HV4A 1P1JA 1GGKA 2JI7A 4OGGA 1PNRA 2ZAMA 4RQTA 1TVKB 3W2GA 4JU9A 3NTUA 4MVJI 1OX4A 5AM0A 3QH4A 2OVBA 3TE6A 2AW5A 4U2DA 2W98A 3EC2A 4TMFA 1IIRA 2C9CA 2X7HA 3IV9A 1P77A 3OJEA 2H52A 5SY6A 3DNFA 3VHXA 3BTSA 3CVWA 3L7KA 3RTBA 4ZYXA 1SCUB 3DZFA 4W5NA 1PWXA 1T4GA 1UZLA 2VIIA 4KSBA 4QUEA 2WSSD 3ZV3A 4DM3A 5J4YA 2GETA 4KDFA 1H66A 1R37A 1NQAO 1JDBC 2JJQA 1D6SA 3LPDA 4A3SA 1PV4A 4OBBA 1QFYA 3ICWA 4IZHA 4KRGA 4GR9A 5EE3A 4BASA 4R40A 1ZGBA 4WXPA 5I9LA 5KYXB 2XBLA 1NJ8A 1UANA 4QECA 3G1TA 4ARUA 4MV5A 2B6HA 1KJZA 3D4OA 3FPFA 1TM5E 4JUIA 3ZV5A 1SBYA 4DWOA 5EHXA 2L69A 1D2NA 2DSTA 5HVNA 3I64A 3Q6NA 3U31A 4EEXA 4PYJA 4D0SA 2ID4A 2HRZA 3REOA 3MW8A 1I8TA 4TV8F 1T2NA 3GMIA 2QZZA 3R3WA 4MWZA 2J9RA 5FP0A 2YHUA 4DY6A 2YUTA 4DJDC 4WDRA 3TIIA 3J81A 3U60B 3T0FA 1I7SB 4TMTA 1KDRA 4OMCA 4RDCA 5IKOA 5DHSA 4BQNA 5JZOA 3V33A 2H7XA 2C2XA 4NATA 5FAXA 1ZGCA 5BXQC 2UVPA 4ECEA 2IW3A 5ICSA 4OI2A 2A1UA 1X87A 4Y9UA 3V4RA 4L6CA 2DBQA 3FPCA 3G23A 3KE8A 5FWAA 1AS0A 2I6FA 4K6KA 4N0PA 2OGUA 1HYEA 2AVNA 3D31A 5JAMA 1WUYA 4CLRB 1UJ4A 3YASA 4JUCA 5F7XA 3HJBA 1RKBA 2G71A 3X1MA 2VZ9A 2ZM5A 3HB9A 3WGQA 3X43A 4L4SA 4DAEA 1Q0SA 4M0KA 4F93B 4RHCA 1CUJA 3L7YA 4GRDA 1N8SA 1VIYA 1URPA 2DLNA 1M9NA 4BMNA 4PC3A 3OT5A 1SQFA 4RSMA 1A04A 4ROSA 2A9PA 1DFHA 1ZX1A 3D4LA 5LLDA 2QSYA 1TQDA 5ALWA 2P1ZA 2QORA 1NN3A 1ZNZA 3CISA 1C5KA 1NUSA 3DVAA 4NYMQ 4X90A 1MXHA 2IY9A 4IV0A 4ZOLF 5FA8A 3ZHCA 4MGIR 4AJKA 1IBCA 2H5IA 4MEJA 2PL3A 4D4KA 3ND6A 3GUYA 4ZYTA 1AHHA 1L5FA 3M3HA 3QE4A 2C0PA 2EW2A 2VLBA 1A8HA 4GI2A 1HFJA 5E0OA 2J85A 1KO8A 3AVXA 1XDZA 3QQPA 4XYLA 4IQGA 1TVCA 1WEKA 1Y89A 1G2IA 2GAJA 3JWPA 3PICA 4LNUA 4YR9A 1FPQA 1YONA 1L1QA 1FY2A 1N2JA 3VA7A 1DELA 4GE0A 2O48X 3VZSA 4P08A 1PS0A 1HE4A 4ARZB 1U7DA 4RZSA 4FM9A 4FCVA 2VSFA 2I1VB 5LQCA 5DNYB 1N34B 1JALA 2F59A 3FYSA 4W7SA 3DZDA 3F6SA 4ER7A 1UKCA 5JO0A 2BFNA 4C88A 4YCDA 4C9BA 4TKMA 5JSQA 3GI1A 2JIDA 1IAVA 2D1QA 3P9NA 1M8GA 4IQFA 3HU1A 5HF8A 1JEQB 3AZQA 3IQFA 3OLWA 4ES6A 3TVTA 3RE1A 1N8TA 4NAUA 4JY7A 1JFFA 1FFDA 1QHYA 3HP4A 3BOSA 2RBGA 4R69A 1XHFA 3VO9A 4BE9A 4CTOA 3U19A 3DEZA 2KW5A 3CX4A 5DP2A 1DHRA 1PFYA 2ORWA 2Z6AA 3JRNA 3T95A 5LWQA 1BH2A 2OQRA 2WAOA 4AC9A 3PNMA 4FKMA 3STXA 4K6OA 5F3RA 1IDOA 2GEKA 1GADO 4RA6B 3T34A 3VAAA 4CPDA 1NX9A 2R6DA 3QFSA 1YJAA 3G9ZA 2W2KA 1EUZA 2H3HA 7MDHA 1A5ZA 4PR3A 1CEYA 4EUKA 1KDVA 2Y0PA 1KEPA 4G86A 1TTQB 1LD3A 4Y98A 2PFKA 5DZSA 2PX3A 4XLTA 1KOLA 5C8VA 2GD2A 4IMRA 3UGKA 1M75A 2AG6A 3QLVC 4O08A 2SBTA 3RS4A 3TL3A 4OBWA 3L8MA 4N6NA 2IX3A 1N2SA 2DPLA 4E5VA 1NYQA 1Z2PX 1JEAA 4DYDA 1RQ7A 2H4YA 1GG8A 2ZRIA 3E27A 4M88A 3DTYA 5IFLA 5IK2D 3A4TA 5H59A 1ST2A 1OU4A 3HACA 1L7DA 2JHFA 1ZAKA 2GM9A 5CIWA 1E9VA 5B37A 3SE0A 3T7AA 4B4DA 4CL0A 2GZSA 2QR5A 2W90A 1SG6A 4GSYA 4GPBA 1FUEA 3EZFA 4RIEA 3V4LA 5EEHA 1M6YA 1CYDA 4OK6A 2CCKA 2Q4TA 3V8NA 1HLGA 1JSRA 3N9IA 3UUEA 1S3FA 3MMXA 3UUWA 1LNZA 3D1VA 4WOCA 5KNLA 2L0XA 3HRIA 4CRWB 2YXBA 4HDCA 4YBZA 2ZWAA 3VR5A 3SYNA 1PJSA 4LXHA 3MRTA 5FBVB 1ISRA 1E1YA 3D81A 2IE8A 5FUQA 2I0FA 5E4YA 2ZRAA 1B7GO 2PSEA 4KQHA 1L5WA 3WYFA 4LDZA 4E4RA 2LCIA 4UAGA 1DMSA 3E0XA 4Q19A 2DERA 3LVRE 2IOQA 2XQJA 3O9VA 4C6TA 5HUQA 4KDRA 1XSEA 3OMLA 4NR0A 4AZSA 1LV7A 4JYCA 4C3VA 3PUZA 3S1SA 4ZRDA 3LT4A 1IMJA 3MWDA 3R2JA 1YH3A 3LUBA 3MELA 4V1CB 2OAP1 1PNTA 3DQQA 2ZYUX 1E2LA 3L4BC 4M53A 5FA6A 4US1R 5E8RA 1PGJA 1NNI1 2IEIA 1EVZA 1G38A 2Z8ZA 1UCFA 2GDJA 2DHEA 5ARBA 4FJ1A 3MJDA 3RQSA 2I1QA 5K8JB 2CWDA 2R8ZA 1GSOA 1XQ9A 3D7KA 1RYMA 1E77A 2AYZA 3ECCA 4WLOA 1BS1A 2AKYA 3X0DA 1NI3A 3PRYA 1ZGGA 1IONA 2BBSA 2L82A 3EC1A 3K6JA 5LBUA 3KSBC 3N7UA 4YQZA 4D8YA 3ICEA 2VXYA 5JEEA 3TCXB 4IW3B 1VHLA 4EG5A 4HUJA 2P69A 3OECA 3OJFA 4RA6A 4QUIA 5T64A 4ZHQF 1GFSA 3ETCA 3M0EA 1C3XA 4AO8A 4RSGA 3SJZA 2BDTA 2RKBA 5BR8B 1IZ9A 3DE0X 3RANA 1MX3A 3BFXA 1F1JA 4GZ6A 2PG3A 4E5MA 4JI2B 4MVYA 4RLFA 5K3FA 1IUKA 1UKZA 1OX6A 2XF2A 3AC0A 1MJ5A 1UXHA 2YJ3A 3AHHA 1TZMA 1CV2A 1CWUA 1CFZA 1QSGA 2QD2A 2VDOB 1KFCB 3ROGA 4AYTA 1EP3B 4DYVA 4JQZA 4YRSA 5ED4A 4M0CA 3R0VA 3KETA 1CUSA 2JZCA 4HRYA 4QQNA 2XTNA 2GMWA 3SU8A 1DBRA 4KFSA 1GRCA 4MOWA 4B76A 2B99A 1RXCA 1SHZA 3VR1A 4X65B 1EFKA 2WW8A 4OREX 3S6JA 4BMVA 4NLLA 3R7DA 1D2CA 5CDTA 2VK8A 4YUAA 5KJCA 5D1HA 5TR9A 1RSZA 1ZNWA 4HAUA 5AVKA 1A7JA 1C2TA 1RCTE 3QPWA 3EYAA 3QU4A 1EZ4A 3V2UA 3ZLUA 1XA3A 3EUEA 5I7AA 4Z0NA 4KQEA 1GA6A 4JVOA 1BGXT 2C9YA 3L6UA 3WMWA 4URVR 1ZR4A 1WDKA 1RQGA 2SHKA 2WTUA 4G8DA 3JCZA 4C2BA 5J1SB 3FOZA 3TI9A 2HHHB 1T9BA 3S2UA 5K5EA 1PL0A 3B82A 3EVFA 1DO8A 4OJQA 5BN4B 3PGXA 4LZLA 2JJYA 5JCOC 4YCNA 1DG3A 2ERCA 4HGZA 1TQ2A 1EJ0A 1J2JA 1Z25A 2R7KA 4JBLA 3TEFA 2RGNA 3PCTA 3RJZA 1ISPA 5DNCA 3SQXA 4P3YA 2C3PA 4YRCA 3UC9A 4D25A 4HYEA 2COKA 4Q1EA 4CJXA 1BX0A 1FTGA 4HAXA 1SKAA 2PKWA 4N41A 4Q9LA 2EERA 1KI8A 4LOAA 4Y1EA 5E3IA 1VOTA 2UUAB 2CF6A 1D8AA 2LGJA 3ZQKA 3AF5A 3I30X 1QZUA 1XCOA 2CMFA 5DDIP 5DWDA 3RS3A 3SM3A 2O0JA 2QZSA 5K3OA 5E2BA 2GNOA 4MCHA 1SOVA 1ZBDA 1Q0TA 1K6MA 3LUDA 5IN4A 2H2GA 4RNCA 5LCXA 3K20A 1V9CA 1AQUA 3NZEA 3OZDA 2NVUB 3FWZA 1C9YA 4X91A 4CLOA 4OM7A 3U9TA 2GPNA 4HQ6A 4EJ6A 5A4MS 2EXXA 4NOLA 4NCHA 3KLOA 1M8PA 4LRTB 4L07A 3TJRA 5DBOA 2PRZA 2FWJA 1N1MA 4ZO4A 3IALA 4OXIA 4FZVA 3L92A 1KHTA 2CVFA 2JGDB 1Y4ZA 4R2LA 5DM70 1ZHOA 3QPBA 4KP7A 3GVXA 6YASA 1LX6A 2WYVA 3O4JA 3ZCSA 1J0BA 4L9AA 2MU1A 5I8PA 1JJFA 3X1WA 4BO8A 2HN9A 3N8IA 1YQGA 1GEGA 3L7LA 1VCHA 5LJIA 4KGXA 2F4NA 2YBEA 3TCKA 1GGFA 4B6PA 3U3RA 1YS4A 3DL4A 4LEIA 3O3OB 3BDAA 1E32A 1SQSA 3LF2A 1PAUA 4G8CA 3L0IB 2RGCA 1XALA 2V7BA 3FPBA 2PGDA 1M1ZA 3AJEA 1V3UA 3IEUA 3MAGA 3PA8A 4U8GA 5TNXA 3L4JA 2CXOA 1KI7A 1O7JA 4NYIR 4ZZ2A 5JYCA 1MO2A 1WCXA 5HKBA 2E48A 3ND9A 4G0VA 4RVGA 4ZU3A 1MEOA 1SPBS 2W2XA 3C41J 4A6PA 4B3MB 4Z4GA 3AI3A 2E5LB 2WAMA 3GPBA 3KTFA 3OIGA 1D4FA 1T9GS 4P93A 2JLAA 2QTTA 1UODA 1G3UA 2FB9A 3N74A 4MKGA 3UPUA 4KO1S 3G0DA 5ALSA 3ZCTA 5F4ZA 3UMVA 4E12A 3TVDA 3VZBA 5TPZA 1NAIA 1NA5A 2IHBA 1GNTA 3LBHA 1X1BA 4M1TA 3SC2B 3TMYA 4Z9XA 1EFAA 1C7JA 3DLHA 3ASUA 4NDNE 4RWEA 1JAIA 4HDOB 3PC8A 4ZT3A 4QPPA 2WWTA 3R77A 4FCCA 4N01A 4MKIA 4L0MA 1X14A 2UZIR 4AWBA 4XWKA 1EK5A 1UL1X 3JX9A 3BCHA 4F2GA 3O7WA 1SEVA 3O47A 3JQ9C 4MGHA 3W5JA 5I01A 1KK2A 4RU1A 2N75A 3ZCPA 2A9OA 2HUNA 3A2KA 1M1NB 3NHBA 5EWLB 1H4TA 1KEEB 1Q1EA 4LVOA 3ZY6A 3DUFB 2V59A 4L08A 1RMYA 4QBIA 5E4FA 2BFWA 4D79A 4G5SA 4M89A 1G21E 1OWOA 1AHNA 3DA8A 1NVBA 2OAEA 2QRGA 4V0LA 2FUNB 1TD9A 3KBBA 3R40A 2DX7A 2EZ4A 2VK1A 4PHFA 2P1RA 1XNHA 4PVDA 5TQJA 3T9DA 4FE4A 2F2TA 3WQHA 1F4PA 1CUBA 1THZA 2M6SA 1IG0A 3QLEA 1AQNA 1ISSA 1CQZA 2Z0MA 1NL3A 5HIIA 5C52B 1QO0A 3COZA 2M6RA 1T2EA 2B37A 4UQLA 1R0XA 3A0RB 2HA3A 4JI5B 3DEJA 4HP8A 1AY0A 4N65A 5CEFA 2P6MA 3H1PA 5ULLA 3IOBA 1H2EA 2WYOA 3VOTA 1C3LA 2H29A 3ZI7A 4G0OA 4Z9FA 4ALKA 4CKXA 2IDZA 1GSHA 4ZU6X 4DABA 1CZRA 1U3FA 2QPAA 1OLXA 4WCDA 3LUPA 3GGJA 1EG7A 1OU0A 2HK9A 1UM8A 3MNFA 4JSTA 1OGYA 3EOAI 1I80A 1X8JA 4MYUA 4MGEA 2HWXA 3DZBA 4NZZA 4Q93A 3S7ZA 3K3PA 3KR2A 4A8HA 3EE6A 2GM5A 1ZL0A 2WF7A 3R3HA 2YY7A 1E4VA 4CEJB 4IXDA 2CWWA 3N07A 2AG8A 5JXWA 1E64A 1Z06A 2V5VA 1GAWA 1QIMA 4HQFA 5IASA 1KWKA 1GITA 2QL5A 2V7PA 4DM7A 2OKCA 3ICOA 1N5KA 4N5HX 4XD7A 3JAKB 3QMPA 4MIOA 4RHXA 3IOCA 1K8ZB 1JNYA 1TD1A 1I4EB 3GRYA 3IMGA 1T1IA 1ZNQO 4CIVA 3KHKA 3MMSA 4ND3A 4OL0A 4ESHA 4CR8A 2PGJA 3MS4A 2P2DA 3RIEA 3EXG1 4RENA 5A06A 1HX7A 4UM9B 3BICA 2ILVA 4RE6A 4Z7JA 4UDYX 3ZHYA 4YMIA 5B7NA 2IV3A 2JAWA 2BFDA 5TQ0B 1H3FA 2Z4SA 4PW0A 4IX1A 2PU5A 2Y0BA 1V5IA 2BM8A 3IUBA 4NZNA 4Z2YA 4RXUA 1BMFD 1DUVG 1RYFA 2NU7A 3D2AA 1Z4KA 1IJKA 2JJ8A 3M6IA 4J7UA 1ANKA 3FHOA 3IT3A 1CSEE 2W70A 3S27A 4B3IA 1YKFA 1EJ2A 3HCOA 4DCTA 4EKDA 4PC7A 2FQ1A 2FFQA 3N59A 4QGAA 4MEBA 4YV0A 1T2AA 2C2BA 3QPVA 4TXHA 2FSHA 4KUEA 2XQGA 4FD3A 3FLEA 1PO7A 3L04A 2YOFA 1XZLA 2XW6A 3D3JA 4Z8YA 3K7EA 4XUEA 3ZZ0A 3Q5GA 4CIXA 3IUSA 4ZCTA 5FEMA 2IPLA 1CR0A 1ZCAA 3VPSA 3GZ4A 1Q20A 3NM6B 5EWLA 1J07A 1YI0A 3WXMA 3C3MA 4JELA 1SU4A 3TEMA 3NDPA 3FETA 4MV0A 3KYIB 1JT2A 1QIJA 1Y4SA 5FBLB 3T9BA 3VR6D 3ZWCA 2A4KA 3R6LA 5TY0A 2AJDA 4ZARA 4TL6A 1ADJA 1VE7A 3U4AA 4ZMBA 3QU5A 2OFOA 3CEAA 1JV2B 3CA8A 3ZWMA 2JIZD 5EP3A 4B7UA 3N8NA 4BVEA 2FN7A 1YI8A 2C4VA 2I99A 1L8QA 2VTVA 1E1LA 1LPMA 3LQFA 4BNLA 1Z2OX 2EJTA 1Q0QA 1D8TA 1P45A 4KPEC 4EX6A 1QB7A 5E1OA 2H17A 4KOAA 4LNAA 1U3WA 3NT2A 3II6X 2WJIA 7REQA 5JZMA 4YN3A 3MQFA 4ZC1A 4TLLB 3MT9A 4QG7A 5G1NA 3HHPA 3IMKA 4JC5A 2ZAGA 5IF3A 4NBUA 1EFCA 1ZM3A 3I32A 4OJTA 4ANFA 1I7DA 1VIVA 1K08A 2TMKA 3AQIA 5JARA 2E9SA 5U1PA 1R6TA 1YUNA 3CZMA 3EGXB 2RGEA 3EVTA 2AOUA 2J9XB 5A0FA 2M1XA 2IPAB 4M9SA 4OQNA 5H9WA 1UK6A 3EFOA 1X3LA 1QH0A 1OCEA 2PS1A 4OHBA 3KJEA 2FW0A 1J70A 4FFLA 4O2AF 4I81A 1K5DA 3DDZX 3VKVA 4ENUA 4L6AA 2G1JA 2O7VA 3AKCA 4C4OA 4K3UA 3DM9B 4GKAA 3TW8B 4ISBA 3GRKA 4CL2A 1V8BA 2YWGA 4JMPA 2Q2OA 4BGDA 5IS2A 2QTFA 4HLQB 1K2VN 4YJHA 2ZVJA 3M83A 4MW0A 1PWYE 1ZHHA 1S8FA 3SC3A 4AUMA 1V5WA 4CTMA 4J6FA 4Y30A 2Q1TA 3CZQA 4MH0R 4TKVA 2C9OA 1TZKA 1SUPA 2RFLA 1RRKA 2FPPA 2GKSA 3EA0A 3W4JA 1JTEA 3TBHA 4QTXA 1E6WA 3OFVA 3NOVA 2C3MA 3K1TA 3B6ZA 1DO2A 4ONEA 1YOBA 2UYQA 4MO9A 1KRXA 4NU0A 4GW3A 1QKIA 2NN3C 5CB6A 3W3ZB 1MGPA 3HP1A 1P17A 4TV9A 4H3VA 1Y82A 5FOVA 3OWOA 5HA5A 3F2IA 2HW8A 1PJ3A 2ONZA 5IC4A 4M1QA 3QYPA 2HHCA 3G8AA 3ESXA 4QSMA 4MR8B 1A2QA 1I30A 1UJMA 5I48A 3N6RA 1A72A 2X9VA 4LDNA 4C1NA 2ZBGA 1VL8A 2ASEA 2ZRGA 4FLEA 3QELA 1ODFA 3UTCA 5AW6A 5EHZA 4QOHA 3IAS1 4AMUA 3E3LA 1Z0FA 3PC8C 3DLTA 3LI2A 4D0GA 2W0MA 5I9MA 4JV5B 1BU8A 3HI4A 3PHJA 4J3JA 4V3CA 4F4UA 3TFQA 1QRDA 1BXZA 1XTIA 3CLKA 3EY9A 1S96A 1YZNA 1Z5OA 2A0KA 3AIKA 1CR4A 1AS3A 3M1IA 4JC4A 3SEFA 2CXXA 4Q37A 2DFKB 4V0SA 1TAHA 4ZCPA 3V32A 4IIGA 1BZYA 1JLKA 1HXHA 2GR9A 2IUUA 3QX7A 3L02A 1MABB 4EW6A 1A4RA 4TUYA 1T2UA 2X9QA 4QBTA 1TAGA 4XOIA 3A9WA 2J6HA 3SS8A 2RCYA 5TJ9A 1NPYA 3BEOA 1X19A 1IY8A 1KP3A 4IGIA 3VBCA 4IQ8A 1TL7C 4FEGA 4BU0A 1OF1A 4O2BB 1E0DA 1B1AA 3UAGA 1ZJWA 5DK4A 4JFRA 2IU6A 3CLRD 5E9AA 4HH0A 2C42A 4HLDA 1OB5A 1GAXA 1Z6PA 4OQZA 2GLTA 2HPVA 3HMKA 1NXPA 4IJUA 4V2UA 1U11A 2F17A 1GAJA 2A1IA 3LXMA 4HAYA 2DQSA 4IEIA 4H3KB 4PCUA 5ALOA 4QD3A 1XI2A 3F90A 5IF9A 5K20A 1IY1A 3GLSA 1B14A 4QIHA 5FV4A 4PIPA 3Q3HA 3HCRA 1TCUA 4RDHA 1L7NA 2LTAA 4EFLA 1PJ8A 3PHBE 4G4GA 4TVOA 4DR1B 4K9NA 2HHLA 2MMGA 1PKXA 2YWCA 4MXDA 1JG3A 4EJSC 2E4VA 2QN6A 3V9AA 3ANSA 3O2NA 1YDFA 4HWSA 2H06A 3RSHA 1JG4A 1LNSA 5E9WA 3WLNA 1RADA 4CF7A 2BJVA 5IANA 1YR1A 1M66A 1CS0A 5JZSA 4OSEA 4KGDA 3V34A 1CUFA 3T0GA 2BCGY 3IP7A 1SBTA 3PU6A 2PXCA 2I4IA 1DBPA 1J1UA 4E32A 1DAPA 4QLBA 4Y2RA 2W9XA 3EXEB 4MRAA 1Z7WA 5M5BA 3DL7A 4F2DA 3GJSA 2HNAA 5DE3A 3TKAA 3GVCA 5A5FA 4PN3A 1E9AA 1H2AS 3WKBA 1T3ZA 4IO0A 3O8QA 5AJYA 1N92A 3BWYA 3NASA 2ZOSA 4P7BA 1JXAA 1ZJ6A 1GNPA 4TMWA 1Z7EA 4XSVA 3FSJX 4X6UA 5SY4A 3ROKA 3T06B 4AWXA 3EXAA 1Z6YA 1N3BA 4QASA 2C9MA 2NW6A 1JE0A 3KKNA 4OLAA 3FOWA 3M2PA 5EUBA 5EAIA 4K9OA 1LRJA 2GXQA 4KB5A 4DT1A 4LCEA 2QRPA 2JA2A 4KN9S 4Y2VA 3O84A 5KQPA 1FL9A 1Z9BA 3NRJA 2JC3A 3C6MA 1TVKA 3DMTA 3QE2A 4IXMA 1P80A 1PL8A 5EESA 2PKCA 1AXEA 2C2GA 2GBCA 1YZGA 5B1SA 1U7HA 2FEOA 3A1DA 2QGNA 2Z5GA 5BVHA 2H7CA 4RV5A 2ZUSA 4NCBA 2G9VA 3O95A 3SJBA 3IUPA 3IBCA 1JQ3A 2IITA 1PD0A 2CBZA 3H1GA 3OC0A 4BZWA 1GFWA 3D6JA 4LVNA 5JJ5A 1FP1D 3DE7X 4AS2A 4F21A 3FMPB 2IE0A 2X40A 4F11A 4NARA 3QKIA 4B3CA 2VUHB 4UVIA 1PGPA 1U94A 2ZUCA 2NO0A 3OKCA 4OFZA 3FGZA 5AJWA 2YQZA 3BRQA 4KR6A 1J23A 2B8NA 2HA0A 2JIOA 1A7AA 2PZLA 1L5LA 5K09A 2WYWA 2X2OA 3CV3A 3RYHA 2QTMA 1YS9A 4UEOA 5KDLA 3W4KA 5IX8A 3IX7A 5CBKA 4V0QA 4KACA 1RRMA 4EGAA 4RHEA 1EVQA 3MYYA 1ORTA 3LOPA 5AKJA 1W94A 1XDWA 5KWVA 3BFJA 1OREA 4AW9A 1KWGA 3CVXA 1TUIA 1ZC3A 3I12A 4D43A 1S8NA 2PKRA 2PIDA 2F1HA 5FJJA 1JH8A 1EBUA 5L6LB 3H9JA 4BJ5A 3C3XA 3RRJA 4ENQA 1EVLA 3HZRA 4GSLA 1G21A 1T5BA 3NIGB 1G8KA 3N87A 2WOOA 4RELA 5DT2A 4MMYB 2HDHA 2JGNA 5CGQB 4J0JA 4LG1A 4PZLA 3I3OA 3LXUX 2C92A 1DQRA 2G72A 1PR5A 4BEBA 2VRWA 1L4EA 3LRTA 3O8BA 3V4FA 4DRXA 4YRFA 1MJNA 5A02A 2C4KA 1CT9A 2CHEA 4YQFA 1GFZA 4ZVOA 2IXTA 5EWMB 3P32A 1KU6A 3NHAA 4RLSA 3K31A 1YRWA 1R0ZA 2CYBA 3QPDA 4PYMA 4DG9A 4FB5A 3WWZA 4J0QA 1DC6A 2VDPB 4DLRA 4G23A 4RAOA 3DFIA 3SEQA 1TK9A 3FUWA 4MS3B 1JECA 3ILVA 5T3YA 3SFZA 1H6DA 3ANLA 4IL5A 3KKQA 1TCBA 4OLBA 1SD5A 3QF4A 5IAJA 2OV3A 1MG5A 1Y1TA 2D5IA 2P68A 1TGYA 1RWBA 2ILTA 1FJXA 3IE0A 1Z68A 3PHCA 2RHJA 4Z1OA 1RJDA 3FLAA 4URWR 3E8XA 2W6IA 4U2KA 4O02B 4XW2A 5EJFA 1DTWA 2ZWOA 3EZ6A 5C34B 1ZOIA 3UFBA 2UYCA 4A8JC 1JW9B 3DS8A 5LQRA 2OYRA 2QZ9A 4J0KA 3WQRA 4YDRA 3K4HA 4V0KA 3B5IA 3DCYA 1S5PA 4WLUA 3UOGA 3EXHA 3GLIA 5C2JB 1V41E 3AEUA 3ADCA 1E5XA 4GZ3A 4DG8A 5CA0F 2Q5EA 3M5CA 2R1UA 4JXKA 1QP7A 3L77A 2IWRA 1AUOA 2WUGA 5KYWA 3LKZA 2IQIA 1PT7A 1CY1A 1GXSA 1S3SA 1VE1A 2PZMA 2YDYA 3PHHA 4JP2A 4LSZA 4ROTA 1WQ4A 1YBFA 3I6BA 3D8HA 4K9QA 4P80A 4XM2A 5TJHA 4AY4A 3NVAA 4JOQA 2PWBA 4PSUA 5J5AA 1DWOA 3AUXA 1V45E 2GB4A 4RIHA 1REQA 2PU7A 3RSCA 4LDQA 3WA6A 1KO7A 2H5LA 3T0IA 4A27A 4KDEA 1HE1C 1XB2A 1M2JA 3SEAA 2QP3A 4NULA 5CVUA 4ZQBA 5AI0A 1ZSVA 1SELA 4G0ZA 3RU7A 1R6BX 4H77A 3KEGA 1VE3A 5C46F 2G0AA 3OG9A 3QVUA 4EHAA 4EFNA 1FRVA 4WXRA 1EWYA 1EUCA 4MVJH 1P1BA 5C1DA 3OZ7A 1QK4A 5DM4A 1G8JA 5LM3A 3AONB 4QPNA 2FETA 4FDAA 2PUDA 2PL9A 5BNTA 1X0XA 3S3TA 1S8AA 4B0PA 4BFSA 2P4SA 1H2XA 4XD7D 2BHRA 3OFJA 2G9NA 4S24A 3HJUA 1CNEA 3GG9A 1DWQA 1JQAA 1K7EB 2JFNA 2GXSA 4A82A 1IB6A 4MUJA 1WB6A 4BYMA 2PSJA 2X77A 3JQAD 1CY0A 4LTDA 2V7QA 4L5IA 4EG7A 5FL7D 1JHOA 2HCBA 1FLVA 1YB7A 2OP1A 2RHTA 3DAFA 4UXIA 5DYIA 4UJ3A 1X1SA 2PT5A 2DBZA 2HK7A 3BSYA 3WWOA 3THWB 1OTYA 1R0SA 2D74A 3ZCVA 1NJSA 2CV0A 1WXIA 3HXTA 3UK2A 2FZGA 1G17A 5HNKA 4ZANA 2YS7A 4K6CA 3VI4B 4R3WA 3VC7A 1A8UA 1R66A 2OG1A 3HSSA 1CZLA 5CFQA 2XBMA 4LSWA 2BEUA 3RARA 4JCOA 1CIVA 4A5OA 5HFJA 3CBGA 2MSCB 3LCCA 3W2FA 3NW9A 3ZY4A 5J2UF 2N1MA 1EGVB 1I3NA 5A3SA 3T3PB 3L3BA 2Q46A 4K6FA 5K0GA 1P5ZB 1IVSA 1WW8A 3KELA 3JS5A 4FHGA 3HM2A 4MARA 3KZ1E 3H18A 2JK0A 3RSFA 5LR6A 1G3MA 2HRRA 4G0XA 1OE0A 1E18A 2NVUA 5K3BA 5BWLA 4DV4B 3O3CA 1I4TD 2CJYA 2Y92A 2ZRMA 5AW7A 2VK4A 3N58A 4RCYA 5EUMA 3AVTA 3MWKA 2Z3WA 3ZWBA 1HE2A 3ESZA 1HBJA 1FMTA 3DOIA 4PFSA 1GCGA 1NVAA 2P65A 1POWA 1YMQA 4HL6A 3ZXSA 3GLTA 4JP8A 2RSLA 2ZW9A 3TJZA 1D4AA 1JFSA 2OCIA 1L0BA 3TTXA 5IT4A 3SMQA 1NVEA 3KK0A 1D0IA 2HQ1A 4MO2A 4HGYA 2FMFA 2V65A 1F0KA 2BYTA 2NTJA 4I3FA 4WA8A 3SIXA 5AJTA 1ZJ4A 1JXQA 1TYBE 1XZAA 3JZMA 1B8UA 1TKRA 1E4OA 3PPYA 1Z5ZA 2FCRA 4TVKA 4H9GA 3IBGA 1VQ1A 1FXUA 1OKKA 4HJRA 1ZUWA 2XZDA 2VDKB 3NIDB 3QVVA 4OH7A 4PZDA 4ZK2A 3D8TA 1T5LA 2YKGA 4OFBA 1W36C 4YAEA 4KPGA 4RKQA 2FMTA 3E2MA 3W2IA 1NBEA 4UXHA 5B7GA 3UH0A 3JQDA 3WB0A 4M46A 4A16A 1DXYA 3A1TA 1FTSA 2Q0HA 1JEYB 1TEVA 1S1MA 3BN3A 1FZTA 4YV7A 3GCGA 5ECYA 3EUWA 3D7LA 2Z5FA 2ST1A 3U81A 2PUFA 3JR3A 4FGZA 2UVDA 1JT9A 2VG8A 4CTNA 5K3CA 3VSEA 3IHTA 1M2FA 1HA3A 2NXEA 5B58C 2ODQA 3SKVA 4AF6A 2OL4A 1W5FA 1Y6QA 4ESOA 5E6UA 3OOEA 4WASA 4KFRA 3EGOA 3RKRA 2AOVA 3D3QA 1YB6A 3QKSA 4M0UA 4ZT4A 4HVLA 1RVDA 4ZVTA 3VVMA 3W1WA 1R0LA 2YJZA 3FGNA 5IEBA 4DJEC 1CUYA 2CNWA 2RD2A 5CJ2A 4J75A 5AT1A 5FXMA 2D1FA 1CJMA 3KJHA 3NNSA 4A6EA 4NQZA 5BWNA 1X8LA 1KZ9A 1JHPA 1F2UA 2Y6UA 1NBME 4PZZA 4LQ4A 1JYEA 2DC1A 1E5QA 1AU9A 2TECE 2XGOA 2KSQA 3GHYA 3O74A 4P3NA 4BCCA 1YFJA 1ZAYA 3GFSA 2GEVA 1M2OA 4IGEA 1QFJA 2R8BA 4UHJA 3PE4A 4EBBA 4E6PA 2DXIA 3EPPA 1NP6A 4XR9A 3PWZA 2Q3LA 3AR7A 4RTQA 4UQPA 1VHQA 2CLKB 1RPAA 4BQRA 5JAOA 3FNBA 4OA8A 1F3LA 1J97A 5G3YA 1ZCFA 4ARZA 1ABBA 3OZXA 1KEVA 2IKQA 2QX9A 5ALJA 4QA9A 1DC8A 3HDHA 5BQPA 1WUHS 4DREA 4F4DA 5I6DA 4C07A 5FF9A 1HFKA 2I1WA 2WUVA 4OBEA 4BNHA 2FEAA 3L40A 1F12A 4IDCA 2XT0A 4WUVA 5JPIA 3W2EA 4DNOA 4MLDA 2ZS7A 2XEDA 3NHJA 3PUYA 3RTEA 2B8TA 3BEDA 4YMSA 2WU3A 1OWLA 1ODJA 3QWIA 3MB8A 4CI0B 3FY4A 3I5XA 1A8SA 4FVTA 1I4DD 4FMBB 3FJ1A 2DTDA 1NYTA 2PXAA 4HYYA 3K32A 3MAAC 1YJBA 3VSCA 1YL7A 2FK8A 4FNOA 4N49A 3DTNA 2BHLA 3PNKA 1G66A 4Q9DA 1AOXA 1SU7A 3DOJA 1T91A 3BXEA 4JP3A 1JJ7A 3OPNA 4JYMA 5D5HA 3PXBA 4I1RA 3X1JA 4B4VA 3U0BA 5C5CA 3DLBA 1ZZGA 1EM8A 2HBYA 4OHKA 4LJ9A 2W83A 4XIGS 3BWVA 3L7CA 1U2DC 1CJVC 2FSFA 1E0KA 1E6EA 1XQXA 1Z16A 2G5TA 1TDJA 2QGFA 5EJIA 1IBKB 5KYNA 1VJ5A 2R1TB 4QXQA 1ZDMA 3SHWA 5JCZA 1H94A 2I22A 1V16B 1TM1E 3BMNA 1NYRA 4I4TB 5DPMA 4LJ6A 4BN0A 4NPCA 1LF5A 2PCJA 5CITA 2C7BA 3AR6A 2QT0A 3CKLA 3IDQA 4IF6A 4IJVA 1PFUA 3V48A 5ILOA 1Y63A 4YP1A 2HR1A 5CA0B 4GHWA 4Y1RB 5KSWB 3RG8A 4O2LA 3BE5A 4EJSA 2XUDA 4RZHA 1SOWA 1SC9A 2Y0CA 3FLBA 1NQTA 3QFRA 4MQ6A 1EAMA 1ZD2P 3RF6A 1L8LA 3V2GA 1FJGB 4GLOA 1GA4A 1KIFA 5KJFA 3PDJA 4HQOA 2J0UB 3WBJA 1Z4MA 1QK5A 3QLJA 3OCZA 1CRWG 3O9MA 3TB6A 2NG1A 2N9UA 1M2VB 3OZCA 3CXUA 3OWHA 4YWHA 2WHXA 1UBJS 4U63A 3NIWA 5IJ0A 1ZH4A 3AY6A 4TQGA 1D7OA 1C50A 1T5SA 1P7YA 1IZ0A 3V80A 2V5UA 2Q9AA 3FF1A 1EK6A 2DWCA 2VLIA 2Q2WA 2GEFA 2PO7A 4PLPA 3QG1A 2RI0A 1KC3A 2G9QA 4B6EA 3U61B 4JA0A 1E2UA 3L4SO 8MHTA 3UJ6A 4BNTA 1OH6A 2ZIEA 5H0IA 3EEYA 3JAMA 3ML1A 1K6JA 1U31A 4OHRA 3RASA 3CNEA 2VJLA 5C31A 1D6NA 1NNSA 3L41A 2EZ8A 2V7TA 4H0CA 3IE1A 1OX5A 1WZEA 3NVDA 2XMRA 3RIXA 5EJ6A 4YHHB 2Z2YA 1ADBA 4FC6A 3FPHA 5CA1B 1FFSA 2FSGA 4OKSA 4D9FA 4Q1DA 4NH0A 1E2BA 1BOFA 1D6MA 4GOJA 1RT9A 4KWIA 5P21A 4KR9A 4DMGA 1EMDA 1Y7TA 1O6BA 1ZH6A 4EO4A 3X1KA 1NP7A 5AUOB 2WDZA 3NOXA 4HRXA 4J1TC 4PYQA 1MRNA 4DCUA 3IULA 1SBIA 2NU6A 1NU8A 4G2TA 1FNCA 4QPJC 3ZY3A 3H42B 5KTNA 2OV4A 4IIBA 5K0NA 5A7FA 1RRFA 1KPIA 1WKBA 2LUOA 2Z30A 4J9UE 3I4CA 3HDYA 1YU6A 3SLKA 2OC9A 2YVKA 3EEFA 1QBGA 3QGMA 5T4HA 3W6NA 3QLUC 4BX9A 5AW3A 4HBGA 5JWOA 2C88A 2IYWA 2O8CA 3BE8A 3CQ9A 4HWPA 3S29A 1UZAA 4NDZA 2GO1A 1J99A 4X63A 5BR1A 1XTPA 2H92A 2I91A 3N86A 5HZKA 1Z6XA 4V0MA 5DHTA 3E5MA 2CNKA 3GFFA 2NPFA 5MGNA 2NP7A 2JHAA 4KNVA 1ARZA 4UZSA 5CDUA 2OBNA 2BP7B 2Q99A 2XDYA 3T3DA 3KFVA 4LBZA 4XAQA 3WHPA 4X1KB 4OHYA 5G4KB 1KI6B 4RH3A 8ATCA 1IQ0A 1Q21A 3S5JA 1PW5A 1YZKA 2AZDA 3A10A 3SK0A 3TFWA 3ER9A 1QIHA 3SPXA 2BUBA 4MSUA 3QKWA 3EQ9A 4RX1A 1Y9JA 4JLDA 1YA6A 1KY2A 1JBKA 2GTHA 2VQSA 4E3ZA 2A84A 1BEUB 2JVIA 2LBPA 3FTCA 5BMOA 4LECA 4ZZ1A 1L5NA 4FUTA 3SGLA 3ZIDA 4OIMA 4GYJA 3WLIA 4YI3A 2HXSA 3HCAA 4RL4A 4D9HA 4D3XA 1ACJA 3FG9A 2W2MA 4KFUA 4ZDWA 3M9XA 1LTQA 2BBWA 2JAOA 2QMHA 4LNUB 4U02A 2NU6B 3OETA 1GPMA 3QE3A 1XPRA 4P2BA 2WYHA 3JWGA 3GPDG 3TXXA 2G3YA 3GLIE 1PZHA 2X22A 1B8NA 1DDIA 1QG0A 1LUAA 1CFJA 1UBNA 1W88B 3DJYA 1G3IA 3C3CA 3D7RA 1LY1A 1UBRS 2ALJA 2G7ZA 3L7OA 3B2QA 4FYJA 1N0VC 4CLEA 1HSZA 1V43A 3PEUA 3UOAB 4C30A 3H2IA 3ED5A 4JKOA 1EQAA 2CZCA 3LZCA 4LQLA 4RIIA 2OHGA 1PWHA 4RHUA 5KHLB 2E0IA 2JGRA 1M6VA 2MMCA 3GFGA 4L6IA 2VHXA 5DH9A 5BN5A 1GLVA 1QHGA 3BJZA 3WRYC 1NOKA 1CJBA 2DBYA 1MAHA 3QVWA 4YXWA 3OPVA 4XXHA 3RW9A 2Z9DA 4JOCA 4S2UA 3G2OA 2G88A 1YHZA 3F1KA 2BBTA 3N05A 3DP9A 1FBNA 2IYRA 1CXZA 2CZGA 5TPWA 3DO8A 5T7BA 4BV8A 4CLRA 2HGZA 3CUTA 4XJVA 4TUYB 4WINA 4CQJA 4DIBA 4A03A 2AEFA 5BPHA 2F8SA 1LLUA 3K92A 4EFDA 1ECCA 3LQRA 3H9GA 2LZ0A 3CXRA 3R20A 4OL9A 4BNUA 3GLKA 4NEHB 3K9FC 3ZDCA 4M1YA 4MJ7A 4PR0A 4BNZA 1QP4A 3AM1A 4DR3B 3HCWA 4WADA 3MSXA 721PA 2VOEA 3L1KA 2J1LA 4UDOA 4LF9B 3LT5A 3KPUA 4JEUA 1Z4PX 3BWDD 4WY2A 1QO9A 4YLGA 4PY2A 1SB9A 4OHMA 3EIFA 3H16A 2IYZA 4LY6A 2ONCA 1PFQA 2H8GA 3AFGA 3VDMA 5ALKA 4G8BA 3ZX5A 4WD3A 1AKTA 2ZBDA 4GR5A 2ZE8A 2GKGA 4WFKA 3SOPA 3HEBA 3RDPA 2XD9A 1E2FA 1PJQA 3OCJA 4PGGA 5BV0A 2GGSA 3TNFA 4J29A 2PH1A 1L7QA 3FF4A 4WSOA 1B6SA 4F0JA 2Q5CA 3ENNA 5KWJA 1TT7A 4ZVPA 5EE9A 1Y7PA 1YAHA 4KHZA 4U7HA 5SYNA 3ZXXA 5REQB 3PJGA 3O2SB 2G36A 2RJNA 3HJCA 3STTA 1N75A 1E94E 1PTJC 1OFTA 2Y1DA 3JQ7A 4GMFA 2Y1XA 1RDFA 3O0DA 5EP2A 5GOZA 5L4LA 2VJYA 4WZAB 4AQDA 2EWWA 1LKZA 2FPMA 2Z2XA 4N8SA 5DX8A 1V26A 4NHOA 5HMLA 1ES9A 2H31A 4UZEA 4U2BA 3D59A 1F9AA 1QYWA 2OXRA 2ZR0A 1M2WA 1Q1QA 2QMOA 2OGWA 4TT3A 5HBGA 4LFBB 1Z39A 1A50B 2A1TS 2QZJA 1OXXK 3E3NA 3UHJA 2B9VA 3LW7A 3TBKA 1KDYA 2XB2A 4JHXA 5CLJA 4UDXX 3BIWA 4MR9B 1E6LA 2QD4A 3G0BA 1W5EA 4GL2A 4NBTA 4W6QA 2R96A 3KAKA 1H69A 4BKQA 3D0KA 2G82A 1F5NA 1ODSA 2NZ8A 3QWAA 3E22A 4K28A 1CY4A 1U7OA 4KQ6A 4J07A 3MJFA 3PFWO 8GPBA 2P9HA 3WLJA 3OCYA 4P4UA 4H7DA 4WLEA 1OY1A 1P9WA 1IUNA 1T2DA 4M8KA 1H2RS 3TZLA 1SC4A 1PEYA 1Z37A 2FRDC 3IT0A 4DSNA 1Q6ZA 2XB8A 2PZFA 3INYA 2EZ9A 1W49A 2FG7C 2VAWA 3DHEA 4PLZA 1Z8FA 2WRZA 1KVSA 2QUBA 1T0JB 4IEEA 4TWIA 5IAKA 3ZHBA 4E5NA 1MX1A 1IDN1 2L42A 2QLLA 2D7DA 1U9IA 1RIFA 3O3NB 4LI3X 3UZUA 3QUCA 4RY2A 3SSAA 1JPNA 1W9MA 1L9XA 2J30A 4PHTA 3ZBTA 4POOA 4KYUA 3HLTA 4NCKA 1XL1A 2GD6A 4OB7A 3U4MA 1N5RA 3EQ6A 5FTKA 1DS6A 1VA5A 1K75A 3CRNA 1DWUA 2V8BA 3IJ5A 2R6AA 1FXSA 2CXSA 1M0SA 3AQ4A 3I6MA 3M1AA 1RXYA 4R05A 3KJXA 1Z6QA 3ESCA 3MTJA 3AEXA 2P78A 4IXTA 1EFVA 2P3LA 3DDUA 2HX1A 3F1LA 4MS1B 2V6MA 3CX8A 1Q22A 2P9CA 2V4MA 5LKRA 4B6SA 4UZFA 2ETXA 1G8MA 2WNIA 4LMRA 4I1IA 4QLAA 2PMKA 4UHDA 3ZD8A 3O26A 2PAFA 1R8YA 2YV2A 4EZEA 5B2EA 4GIBA 3T9CA 3NT4A 3FE2A 4HSEA 4JXZA 1P81A 4ID3A 4NU6A 3DC2A 1G7TA 1HEYA 2VJNA 1XFDA 4P3PA 3F5MA 3W0LB 1AKRA 3M70A 3KQSA 3QRWA 2X76A 3HZOA 1NW3A 4RGVA 3A4IA 3B6IA 5JD3A 3TNJA 4K1XA 4JB0A 4WA7A 5EWMA 1NSFA 3GLHE 3WKCA 2R8EA 3GEGA 4GX1A 4UCFA 4E70A 5B5SA 1U6IA 1TQ8A 2FW9A 2QLBA 3HB5X 1SY7A 3PS9A 5EOVA 3IEXA 3KB2A 2EHJA 5IAAA 1DPFA 2X0KA 5L3SB 2RHWA 3LQKA 3CH7A 2A94A 1U1CA 4Z4CA 3MVEA 2ZYHA 3T4UA 3L1IA 2I29A 2ZIZA 4B48A 3G5UA 4DA7A 2BFDB 3AR5A 2PZ8A 3L43A 4E6EA 2ZB3A 1ML3A 3Q3IA 4MR8A 5FLYA 4YS6A 1KSGA 2W2PA 3QX8A 2XUKA 4B2IA 4L57A 3ZQUA 1O8BA 4NJEA 3RB8A 3JVVA 1HDXA 4H4EA 2DRIA 2K2WA 3W77A 1ESCA 4NOMA 4TS9A 1E9FA 2V7VA 5CD1A 3GV0A 3Q8MA 4L50A 1J20A 3KSAC 1QFXA 4DKJA 2RBKA 3K4QA 3QKRB 4AZVA 4M4SA 1HDEA 1A76A 1P1RA 1XCBA 3ZZMA 1YS1X 1KMIY 1W36B 3HUUA 5EXTA 4YVFA 3SQNA 1AA6A 4E22A 4LY0A 3O4FA 5CDFA 3KRTA 2RI6A 1SCJA 1ZIPA 3CPSA 1F51E 1NFQA 1RKUA 2E87A 4GG1A 2NACA 3C5HA 3P0HA 5FDFA 2Q1WA 2ZM6B 1CVLA 5IJ9B 1W1WA 2QG4A 1P7PA 4HGRA 4HWTA 2ACEA 3NJRA 5KVAA 1YAJA 3B7GA 2IWHA 5FPPA 2CMDA 2WF6A 3GDWA 4S1OA 1D03A 5G40A 4ZDKA 2FMXA 1NF3A 2ZAOA 4HEQA 4NJOA 4UW9A 4DVGA 3NR2A 3OMXA 1TB4A 2AUMA 3WA7A 4IH4A 2LCQA 4K6GA 3DMPA 3JQFC 1GR1A 1YCGA 5CURA 1Q3HA 1GG2A 2DZDA 3WISA 3UHOA 3ZZ1A 5BVGA 2EKQA 3AW8A 3COVA 2AFVA 3Q7EA 1TU3A 2LDXA 4I5DA 3R74A 2DBVO 3R3SA 2QD5A 4EUSA 3LWZA 4DR4B 1E1KA 3G9XA 3NBYC 3I72A 4WXYB 3PZRA 3OZEA 2Z57A 4YJ3B 5TE9A 3R3XA 5T8KA 1N57A 2C4NA 1JDTA 2FZKA 2H0QA 1P39A 3FBGA 2OCGA 4GECA 2GEDA 1BCSA 4L9RA 2W2TA 4M9XA 1NG1A 1XCPA 2XWPA 4CBVA 5KOHA 5LQDA 1LSJA 3BK2A 3T5DA 4GKJB 4Y1GA 3A11A 1MB4A 5AXAA 3SLGA 1GA1A 1SVLA 4XDHA 5AXBA 2RBEA 5A4FS 3FDIA 2WIBA 1M2KA 1N0HA 1CVIA 2WWIA 1VGQA 3DE4X 3L6OO 2OYCA 5K45A 3RSLA 4BUZA 4U7DA 3A9UA 5FBQB 5HMMA 3A4MA 3O4HA 4G26A 4NYJQ 5DGDA 5FKJA 3UT6A 3QE9Y 2W58A 4HDMB 2WSYB 4Y2HA 3DLIA 3LBYA 3TDMA 2GDZA 4FYKA 1A8PA 1GUZA 5AKIA 3QITA 2FWMX 3O8LA 5A4AA 4DLVA 4RMJA 2UVQA 1IXYA 2CT8A 3TX6A 4Q3EA 1GL6A 4M83A 1AQ6A 5JMPA 4XWGA 1BXKA 2VQ3A 3TSCA 3SX2A 3UAOA 3DCIA 1DV1A 5NULA 4B8ZA 4JBYA 1O4VA 3F6PA 3HL0A 1B16A 1KKMA 1Q91A 1LEHA 4D5EA 4AECA 3RC2A 1NN0A 4NCXA 1LK0A 3BXOA 3IDFA 2QX8A 4LDPA 4NOJA 4PRLA 5ALNA 3LLCA 3HHEA 4RF3A 1YD7A 2JW5A 4L5JA 3BMOB 3GAFA 3ZEAA 3R6GA 4EPTA 2BEVB 2XD4A 5AXCA 2ZDQA 4Y2PA 3RVQA 1HPLA 2E4YA 5DX0A 4LRUA 2Z9CA 3WSVA 2ZBRA 5I9IA 3OIWA 1S6YA 2JCGA 3LM8A 3SFTA 3B9BA 4UVHA 5DLEA 5EERA 4MW4A 1S2NA 5AKEA 5LBTA 1P75A 3RUHA 3NTVA 2YMLA 2VTKA 5J4LA 4BV3A 3PR3A 4IDEA 3ZTTA 5LXTB 2ZXUA 1VYTA 3I0MA 4F6CA 4HXEB 4B3BA 2XNHA 4WGGA 1G7RA 1Y3CE 3NC0C 1UMDA 3RRFA 2R25B 3EF0A 3BM5A 1L7BA 3LP6A 4AJEA 2EJCA 3G2LA 5ENVA 2QAJA 1E7YA 1M83A 1LWOA 4QUDA 4MAAA 3B38A 3OE7D 4PX3A 3EBPA 4UAVA 3DEKA 4R81A 4B79A 1VBKA 1C7FA 2XCLA 3AIOA 3JR7A 4OJMX 3KQUA 4Q9JA 2VC2B 2G07A 3UK6A 2ZCJA 1JHRA 4FEAA 4FSHA 3GARA 2JZNA 3KX2A 1H85A 1I5OA 3PI6A 4CT0A 4ZRNA 1LVUA 2A9JA 3GGCA 2XKJE 5K8CA 4X20B 2E5WA 2Z4TA 1AKWA 4A1FA