1QDLB

The crystal structure of anthranilate synthase from sulfolobus solfataricus
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
195
structure length
195
Chain Sequence
b'MDLTLIIDNYDSFVYNIAQIVGELGSYPIVIRNDEISIKGIERIDPDRLIISPGPGTPEKREDIGVSLDVIKYLGKRTPILGVCLGHQAIGYAFGAKIRRARKVFHGKISNIILVNNSPLSLYYGIAKEFKATRYHSLVVDEVHRPLIVDAISAEDNEIMAIHHEEYPIYGVQFHPESVGTSLGYKILYNFLNRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ANTHRANILATE SYNTHASE (TRPE-SUBUNIT))
publication title The crystal structure of anthranilate synthase from Sulfolobus solfataricus: functional implications.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Lyase
total genus 54
structure length 195
sequence length 195
ec nomenclature ec 4.1.3.27: Anthranilate synthase.
pdb deposition date 1999-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00117 GATase Glutamine amidotransferase class-I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qdlB00
4Y1RB 1GGHA 3FSEA 1GGKA 2RK4A 2VDJA 3CZAA 4LRUA 3NOVA 3TTSA 4ENPA 4MGHA 4AUEA 4BTEA 5BV2P 1OX6A 2R1VB 1CS0B 3L3BA 4I4NA 4MNTA 3SOZA 2NV2B 3WFZA 4L8YA 3L7NA 2GK3A 2NV0A 3TTUA 1OI4A 4B7AA 3NORA 3PQ8A 4Y1RA 4LGYA 4AUMA 1ONSA 1SOAA 3F71A 1Q2UA 4BIMA 4P2GA 2R1TB 4I2NA 1C30B 4OJYA 4L8WB 4OFWA 3B36A 2ZUSA 3BWEA 4R7GA 3UK7A 1QVZA 3ZR4B 4GE3A 3PQ4A 4UCFA 3TTTA 3B3AA 4UZSA 5IP5A 3R75A 1I1QB 4JQSA 4OIFA 4PXYA 3PQ3A 2WJZB 3L18A 2VXOA 1OX5A 2AD5A 2YWCA 3CZ9A 2R1TA 4ZDKA 3NOQA 1P80A 3SF8B 5LIRA 4ENRA 4E5VA 3EWNA 1KXJA 2GHRA 4ZDIA 1R9GA 5JZMA 4E08A 1UCFA 4ENWA 4Y1GA 4UOQA 1CE8B 4N12A 4Y1FA 1GG9A 1JVNA 2ABWA 3SF8A 4D1YA 3NONA 2YWDA 3MIIA 1GGFA 2IUFA 1O1YA 4P35A 3VU3A 2A9VA 1KEEB 3UGJA 2YWJA 3ZJ4A 1OY1A 1PDVA 4S0ZA 2VKTA 3ER6A 3FIJA 1J42A 1A9XB 2ZUUA 3P9QA 3ZJ5A 5SYAA 1PDWA 2R1VA 4OGFA 1PE0A 4L95C 4ENQA 4AULA 2ISSD 3TTXA 4ADSG 3NVAA 4ENTA 3MGKA 3NOOA 1KWKA 4QYTA 4L8FA 2ZUTA 1IPHA 1G2IA 1T0BA 1T3TA 3TTVA 1P7ZA 3F5DA 2RK6A 4I46A 3GRAA 1I7SB 2FEXA 1IZYA 1SY7A 1VCNA 3M3PA 4OQ4A 2OR3A 4B31A 4ENSA 1GGEA 3P9SA 1VCOA 1BXRB 1K9VF 1U9CA 3CY6A 3EZGA 1Q7RA 3N7TA 4GE0A 3CNEA 4WXYB 1KA9H 1VHQA 3PQ6A 5K4AA 4ENUA 3OT1B 3CYFA 4L78A 3UOWA 2AB0A 4K2HA 3UJNA 4GUDA 3P9RA 1T36B 1GPWB 3TTYA 4Y0NA 3PQ2A 4N0MA 4B5KA 4ENVA 4ZDJA 4QYXA 1P81A 4ZGGA 1QVWA 1CF9A 4MTCA 4P34A 3L4EA 4Y1EA 5DFAA 4AUNA 1QF7A 2VRNA 4WINA 1L9XA 2XF2A 3D54D 1GGJA 1GPMA 2W7TA 1QDLB 3PQ5A 3R74A 3EJ6A 2D7JA 3EN0A 4B2YA 1P7YA 1JDBC 4P5PA 3EFEA 4UOZA 4RKYA 3R76A 1OX4B 2R1UA 1N57A 2ZUWA 4B40A 5SY9A 2YWBA 3P9PA 4P36A 1WL8A 3B38A 1S1MA 4XLLA 5E9AA 1PV2A 2LXNA 2ZUVA 3PQ7A 5SY6A 1P5FA 1OX4A 1QWSA 1I7QB 4BFLA 1FY2A 1IZZA 3BHNA 1KWGA 2VPIA 4RKWA 1C3OB 4HCJA 3TTWA 5JZOA 1VCMA 1FYEA 4AJ9A 4OGGA 4UNIA 2V4UA 3OT1A 3TQIA 1QVVA 3UMMA 2RK3A 4L7QA 3RHTA 5SY4A 2H2WA 3KKLA 1M6VB
chains in the Genus database with same CATH superfamily
5HG0A 4MWEA 2W70A 5GMOA 2RK4A 4ALKA 4ZI2A 1XAIA 2CNWA 2X2EA 2H4ZA 1I2AA 1YZUA 2GHIA 4HMOA 2DF8A 5BRAA 5JADA 1WV0A 1JBKA 1Y1SA 3CJRA 3PVZA 4LYFA 3TGPA 1FFXB 1OZAA 4TV8F 5CA0B 2ZRPA 2ES4A 4BNGA 4NBLA 2W2KB 5CM8B 1GZVA 3MT8A 3FFXA 3BWEA 3KVVA 3HB1A 1G42A 1TLLA 1VPLA 4F11A 1GARA 2C8JA 1MAUA 1SUBA 3OQJA 4YUVA 2PYIA 3GBSA 3KVOA 1UJ2A 2FR8C 4IMRA 3MSXA 3EDRA 3BIJA 1J90A 1SC6A 4FFNA 4JBGA 4O5OA 5MN5A 1NVEA 3TI7A 1V4BA 2FUG6 2IH5A 4E08A 3DAOA 3I01M 4DQDA 1OFGA 2FP4B 2H1CA 2RGXA 3NYQA 2QGFA 2PWZA 3LGXA 4EVIA 3H6KA 4D1YA 2CZGA 1VJ0A 5BV1A 3ZU3A 1Z5GA 1PX2A 5EJ5A 5TGZA 4KHPB 1I36A 1NAIA 4JJEA 3WLTA 2HCFA 4KFCA 1MAWA 2WRZA 1YRLA 5EJ9A 2XB4A 2AYZA 1OH5A 4QD3A 1H93A 2XMCA 1ABFA 1SRRA 2VPPA 2ACKA 4HUJA 2GCNA 2PJDA 5FHQA 4URHA 3TM4A 4NNJA 2BFBA 1Y8ZA 2WUEA 3HK2A 1XT6A 4PHFA 3MD9A 1T3TA 3O8CA 3VDMA 1YI8A 4ZZ1A 4B9EA 4CMEC 2G9RA 2P7IA 3TLJA 1TJYA 2JS7A 4HNQA 5DGXA 3RGGA 2H11A 4R2KA 1U02A 4BZZA 1CUHA 4B75A 1KDVA 3MWDA 4ZQGA 3U4DA 3X1XA 4LVOA 4C7KA 3OIDA 1YR3A 1OBFO 3GLGB 3CY6A 2FUCA 4BC1A 2PQMA 2WPDD 3W6ZA 3LA8A 1WZ2A 4G86A 3D3EA 1FVFA 1I1OA 2E0IA 3EVGA 3WXMA 2WJHA 1ZDMA 4JNCA 2XXAB 2XT0A 3AINA 1NVXQ 1A27A 4KWTA 3NTUA 3PXBA 3E22B 2H0AA 3MELA 5PNTA 3RT9A 2UZ3A 3CURA 3R5HA 5KNDA 5JHGB 4J0CA 3IXMA 4BLWA 4ZMRA 3JRWA 1WVMA 5C0OE 1CT9A 3LBIA 1NX9A 1GGJA 2OESA 4EVRA 1DRKA 3LL4A 2PR7A 5DYGA 1EQAA 3H5NA 4I2VA 3CNQS 4BV2A 3T38A 3QMVA 4C0XA 4Q1DA 5KQGA 1YZFA 3NJ8A 4J3NA 1D4AA 2FLVA 3R7LA 2G71A 2DCUA 3EDCA 3LWZA 4M8NE 3BD6A 3W79A 4YRIA 4HDSB 1E0DA 5I7EA 1PU2A 2AD1A 1ACJA 3JVDA 2WU4A 1PD1A 3NETA 4I9GA 5E6SA 3BF8A 3L8HA 4KPFC 1I2CA 1YZNA 1C1XA 1Z4LA 3LXMA 4P7GA 1JPNA 4YPFA 5DTJA 2VTBA 1T2CA 3AZOA 1RQLA 3ETCA 1F3OA 1XTPA 2QIOA 3K5HA 4W9RA 5ALQA 1QIGA 1E4EB 5BN5B 3RJ9A 1XA0A 2K2QB 1XYVA 1XPOA 2XMZA 4NOMA 2BGLA 3ZLJA 1NIJA 2PGLA 4PONA 1QVVA 4MEJA 1KO8A 4NQZA 3U7EB 5A4JA 2V1UA 3L0YA 4V1CB 2Z2IA 1NBMA 1VKOA 3QOWA 1GGKA 2RKWA 3DZIA 2AXNA 5D7NA 4Z1MA 3TLKA 1ENYA 4HGRA 3T9AA 3RSGA 3VR4A 4D26A 2WHRA 3AZPA 2R3SA 3I2IA 1JFFA 1SXGA 4GECA 4MVJG 5DYIA 1ZK4A 3RRJA 5HJ7A 5LNK6 1CUCA 4UQPA 3RUCA 1RJWA 5H59A 1L7BA 2GAFA 3VNQA 3G49A 1K08A 1QMGA 2QUZA 1H4TA 1CUGA 4GR4A 2C1XA 4HY3A 1GPNA 3AO0B 1GQFA 4Y2SA 4YEDA 5F7JA 3B36A 3O03A 3MB5A 1EPUA 2GF0A 3FDZA 2QQ0A 3GFFA 3WG9A 2FV8A 4ZWNA 1WZUA 5I9TA 2ZRDA 4PYKA 3I5AA 1Y5MA 2C2MA 3L06A 1XQYA 1FJXA 1N7GA 4KXNA 2JGRA 4AWXA 1R8JA 1XVUA 4CCWA 2WG1A 4ZCLA 1DHTA 2RG7A 2MINB 3EQ2A 3LQFA 2HMWA 4GPIB 4HWGA 3K71B 4FDVA 4LZLA 4URUR 5DHUA 1SXQA 3CG0A 3D3QA 3CTMA 3CZPA 2DM6A 3BL8A 2MSDB 1QRUA 2MTBA 4EATA 3K2IA 3NRBA 5G1PA 4NZ9A 3GZJA 4JSYA 3A1NA 1N1MA 3A9SA 1UK6A 3QPAA 4TMWA 1RLUA 1WB4A 3AKYA 5EINA 4CKBB 1CCWA 1GAJA 1E2GA 1KEVA 2F1OA 3QOFA 5AW3A 1NI4A 4WZAB 5LJLA 2JAPA 5EJAA 1SUIA 3ZBUA 3TLXA 3SR0A 4CGYA 4OI2A 1FOEB 3FFAA 4XTCS 1K5PA 4MUNA 2QLTA 3QPCA 5KYKA 3W2IA 4PRYA 2W4MA 4HQ6A 2QAGB 4E7OA 3THWA 3RWOA 1UAAA 1T8TA 1M8KA 4ZZ3A 1J8FA 4OMFG 1SD2A 2A5YB 4BNLA 1L1FA 1YFKA 4QUBA 1Q12A 1JJFA 4LCJA 1GG2A 2BSXA 1VKJA 3K8OE 2FMUA 1L3BA 4BKQA 1W29A 5IK2A 3K15A 1BXRB 3NQ41 4MEBA 3T7JA 1A7JA 2AFHB 1A1VA 3C87A 2JI7A 3DPSA 1JSZA 4E21A 4JI2B 4EEKA 3BORA 4L4ZA 5F9HA 1AKVA 5JHHB 1W2GA 4KN6A 4JJZA 4TWAA 4ENUA 4YT4A 1ECPA 1RKVA 1I3CA 1VM6A 4IVNA 3ZE6A 4BNNA 5E3HA 4IOMA 4HNAA 4HB3A 3GUVA 1U65A 1ZNQO 1USWA 4KIUA 1F8UA 2FCAA 1BHSA 3IIKA 3LMKA 1Y98A 4Q5IA 4Z9FA 1D07A 3UGTA 1PW7A 1Z8HA 4XCVA 1UC4B 3ADKA 3HGMA 4IWXA 4B4WA 1L4FA 5FRDA 3ZUPA 3G2QA 5AXAA 5AUQA 1CY4A 1NKVA 3NEJA 4J75A 3GMSA 4B6RA 1TW2A 3IIEA 1O0CA 4Q9HA 4TYNA 3V2UA 3G5UA 3WKEA 3ZW9A 1VKNA 4JJFA 2DT8A 1NVGA 4AB1A 1SBCA 4LSGA 3R3XA 4BMCA 4FSXA 3Q8MA 5SICE 3K96A 1FFWA 3W3AD 1NJGA 1Q91A 2Q62A 1HDYA 2PQ0A 3GNLA 2NVOA 4G0UA 2GN1A 1XRRA 4K6OA 1QZ3A 2XQKA 4KFRA 5AIBA 3Q8LA 4TYWA 2I55A 1NDQA 2VC2B 2OXCA 3T3PB 2QE7D 2GAAA 2H1WA 3TGLA 1SVUA 4QBGB 3GQVA 1CP3A 1QZTA 2C54A 4YCBA 3DPIA 3N0WA 2ZWPA 5EE3A 5LP6C 1TX4B 1YB1A 5AP9A 3VOSA 2LCFA 3UMMA 3FWYA 3KEOA 3U7RA 1PZNA 5AVWA 1EDZA 2ZJ6A 3N0RA 4RLHA 3ZK9A 2FEKA 5FPQA 4B4KA 3OQHA 3VR0A 2LD4A 1LFAA 4MGHA 2OILA 1XP8A 4BAGA 2ZIWB 4JB3A 3I8XA 3EH2A 4P3YA 2GN0A 4G5SA 5F21A 4IOKA 3DBRA 3KQQA 4AJIA 2J0SA 3WDMA 4QDTA 4GZ5A 1EI9A 2AFVA 2DH6A 4RPIA 5CFOA 1TJ3A 3R8FA 5EZQA 1YF3A 3IQWA 3I9NA 1BOOA 4NAHA 1WZIA 5AHRA 2RHWA 3IB6A 3L43A 3TM5A 2F3TA 2C84A 3U3MA 2W6NA 3IQFA 1BYUA 1PR2A 2DLNA 2X9QA 5EIWA 3TI9A 1I4OA 2H0QA 1ZVKA 4FBLA 4QBFA 3JQBC 4RPKA 2JEYA 4YO7A 4GZ6A 4JIMA 4UEWA 4AU1A 1NTRA 3BGVA 1WXWA 3W7VA 1W25A 2GHTA 1BMQA 2IOYA 4LDRA 4KQGA 3ZV6A 1TYBE 1NW8A 3D7NA 3R7FA 2JJ1D 3R3UA 1VMEA 1UFKA 2OPBA 3GA5A 5EA2A 3KPUA 5EKTA 2H2DA 4OQYA 2JD1A 4MB6A 2A1TS 3KSZO 2QX7A 2JEOA 1DG3A 1BIFA 1XK6A 3NAZA 2BSAA 1XLTC 4PSAA 1NFQA 3V1UA 2FF5A 4N54A 4UBIA 4L85A 3H9CA 2AX4A 2WM2A 3CW9A 3PRHA 4IKOA 4PINA 5A7GA 3ABOB 1PJZA 5TY0A 5KTSA 3Q5DA 3RYFB 1H6CA 2G7ZA 5IT5A 2C4NA 3KQPA 3R5XA 4Q1CA 4QQRA 4IQ4A 1ZQ1A 1X39A 1XVTA 3GF4A 4B7CA 3MMXA 4U3JB 5I7RA 2V7EA 3QVSA 2AXEA 1TU3A 2IEYA 1X1QA 3PFWO 1IPHA 1N75A 3QKUA 4S12A 2OXIA 4D3XA 4EVQA 1A9XA 3MCWA 3GRCA 1ZMBA 1U3VA 1O6CA 1JR3A 1KDRA 3CS3A 4XIGS 5EG5A 1RP7A 1JB9A 1WTAA 4Q37A 2HSZA 3TIXB 1I1HA 1THGA 3MMZA 1GOTA 2CUZA 2HNAA 1FDTA 3T7KA 4C1BA 4D3FA 3RE1A 1ZGJA 2I0FA 3VNRA 5HJ5A 2WVHA 2Q1UA 3L1KA 4MITA 1HEYA 1DJNA 2QZSA 2ZBEA 5FULA 1G8YA 3TJZA 5CG1A 3QVGB 1CR0A 1DDGA 3KWFA 2FLWA 3AWIA 5FTWA 4L5JA 1ZRSA 5K0JA 1A2OA 5JU6A 1WULS 2R8BA 3WSVA 1OLSA 3H3XA 5B2FA 4LJ8A 3R74A 3SZUA 3K9QO 4AXBA 2WQ7A 3SGLA 4C5AA 2AI1A 2FU5C 2IIVA 1T0UA 5HKAA 2W2LD 3FJOA 3WKCA 1H0KA 3HLYA 4RVUA 5AVYA 5JAHA 3LGAA 1LW6E 2X14A 4KFUA 3EZNA 3ROFA 3NTXA 3ZLUA 1WXHA 4LHYA 4BGEA 1XMQB 2WF5A 3UT5A 4CEJB 1TCAA 2O3QA 3GLTA 3GGSA 4RS3A 2HHHB 3EFOB 4H7PA 2BSQA 3O4VA 1TYZA 3KBOA 4DDTA 3ZIUA 2I9KA 3PDJA 4AURA 3KTDA 3WQRA 2F9MA 4MEAA 2O07A 1ZC3A 4QHTA 1C50A 2EP5A 4Z9YA 3ZY6A 2PUGA 3PUWA 4A2CA 3OIFA 3DFUA 2YASA 4MQ6A 4CV2A 1MB2A 1P0PA 1LDGA 1TM5E 2Y3IA 4I5IA 4MYUA 3KEFA 4BDTA 4N76A 4YB8A 3RI3A 3WISA 2JRCA 3DKVA 3OMWA 2J3EA 4Z9AA 5FV4A 4CLOA 2AN5A 2YWEA 4WGGA 1K5GA 5IW8A 2OV3A 4R1SA 3BE4A 2RI0A 1HYGA 5I5EA 1IBSA 2QAJA 4KTTE 1E9EA 2Q3JA 3HJBA 5DHQA 3X3HA 1M1UA 1IONA 2PT5A 4D9KA 1SD5A 4ETWA 1G2PA 1W73A 2B2CA 2QRLA 4LRQA 4TVBA 4X20B 1H9CA 3QYFA 2GNPA 1UDBA 1ZMRA 4MW1A 2FX3A 1M75A 2ECKA 1SOVA 1B6RA 2JASA 1FUYB 4FMCF 4MTLA 4P22A 1FSPA 2IH2A 3FFWA 4HZIA 1R18A 2J9RA 1H94A 3QUBA 3PWZA 3ZWYA 2E82A 2HJVA 3HSSA 121PA 2J3QA 2HXSA 4RGVA 4EJ2A 1S8OA 1US8A 2CK3D 5HP4A 2OCPA 1L7QA 4HX5A 1YBMA 4I8IA 3I4LA 2HQBA 4F71A 4QPDA 1C0EA 3OZXA 4CU2A 4CKCA 3EC1A 3OX2A 3GVHA 3ZI7A 3ZCXA 2V6BA 2P27A 4K6HA 3O8OB 2PU5A 1TM1E 3KD2A 3OTHA 4O4IF 5B53A 4X71A 1KEWA 1HKHA 2QJRA 2O2SA 3FBWA 4IQGA 1NZJA 4RAOA 4WVLA 4UTVA 2NIPA 3PNKA 1E4VA 4B44A 4ERXA 3Q3EA 4EWLA 4YIKA 3RRFA 3ROMA 4LRWA 3U7IA 4DMRA 2PTHA 3VPGA 3WI7A 2C07A 2DWPA 2NPFA 3THYA 4IG4A 2I78A 4B47A 1DNPA 3DSRA 3PR2B 2SICE 1LKZA 2JBHA 3GX1A 4MDEA 1ABBA 2I76A 1UWKA 2XKBA 1FXSA 3DKRA 4NMXB 4TKMA 1GTMA 3C74A 5JCJA 2VAWA 3AHFA 1ESMA 1Z16A 2QJTA 5EZYA 3V97A 4IAOA 3RJTA 1VZ2A 1Y3HA 4B45A 4Q3DA 2GBPA 3COZA 1GQYA 1M72A 4IM7A 1HT0A 2PZEA 1RDFA 4OGKA 1SHZA 2ONYA 4LV8B 2WHPB 3GQBA 1H8HD 1NLFA 1NM5A 2CVFA 2JIPA 1RMYA 3EXG1 4MUEA 4B76A 2AJ8A 1L7AA 2CHUA 2QXUA 2YVUA 3MTEA 4R81A 4AS3A 4C0KA 1SQ6A 3A2MA 3NHWA 3O21A 4M76B 4LTMA 5NLLA 5CJJA 4J3JA 4XWYA 4D3ZA 3VZSA 3VVBA 1SZPA 1D2GA 4QEDA 4C1NA 3X1YA 1OA0A 4XWKA 3LT1A 1O3YA 4JUIA 1WDKA 2PWYA 1SCIA 5DM60 4KAAA 2EJVA 4TV9B 5IC4A 3IQHX 4E30A 2LXNA 3K9WA 1JNYA 1ZI8A 2GO1A 2VG8A 1QX4A 1SZDA 4JT8A 1RBZA 4MCHA 4PPGA 3NHRA 1Z33A 2AXQA 5SY6A 1Z6ZA 3W04A 1FDRA 1QVAA 3TX6A 2CYAA 2C7PA 1O77A 3HCFA 5AW9A 2ACWA 4FYKA 1JHPA 5CVDA 3R9IA 3DOJA 4MR8B 3DAGA 4POAA 1U81A 3UB4A 1F14A 5DSTA 3FPBA 3H1EA 4N9QA 2BIFA 3ROZA 2IKQA 2YUTA 5GZ1A 1CS4C 1RJDA 2HBQA 2I2XB 3OFJA 3LU1A 4B7XA 1IHOA 5L51A 1JQ5A 1S9DA 5IVHA 1XQWA 4MVCA 1GKUB 2X1VA 2PX8A 1IWPB 3GBPA 4RF4A 5AT1A 3G2PA 1F48A 1W36B 3IERA 1UADA 2JD2A 4E22A 3KYJB 5JS7A 3ND8A 1OGIA 1DWUA 1EH5A 2PU7A 1A8UA 2CFCA 4P8RA 1DBIA 3KKNA 4K9PA 4BEWA 2WQ6A 1LLFA 3KXDA 3PZBA 1PFQA 2MYTA 4MV4A 5E4TA 2ID7A 5JW6A 1RXSA 1BE1A 3RTEA 2O8FA 4PSDA 3L41A 1G0NA 3MGGA 2IDZA 4OMCA 2GSWA 2AQ8A 2GFHA 4GL4A 4D43A 1FFGA 1F8GA 4ETMA 1QRDA 1XC7A 2E85A 3R20A 4ZPJA 4BS9A 2BGWA 2ACEA 2IF0A 2VVTA 2NACA 1VLQA 3IKJA 3GLSA 4TYMA 4EY8A 3WNBA 2C78A 1TVMA 2Q8PA 4YGYA 3JW8A 5JZMA 5EUQB 4UTPA 2CBZA 4U9UA 1DC3A 1MNAA 4MLDA 4O4JB 2NSJA 5EXDA 1QFSA 1RAFA 1VPVA 1Z6PA 1M34A 1U7OA 2Q5QA 5TDHA 3SM9A 3UEOA 4CL2A 1ZMOA 3C3MA 3QVLA 1NYQA 4J0HA 2MSWA 3LY5A 5AMXA 2YWHA 4O2AB 1PDVA 4HYYA 3PHHA 4M9UA 4JP5A 4FFDA 1SBYA 4BNDB 2G07A 1RKUA 2FUEA 1Y37A 1Z2CA 2PJZA 3G1WA 3VR5D 2OHJA 2OK7A 2R4TA 2ZUDA 1WRBA 2ZJ0A 3P9CA 4LSWA 5L3SB 1CQWA 1UKCA 4CYMA 4C5BA 1IZ9A 2DKOA 1P2UA 1PGJA 2G82A 1H2YA 2I87A 2HYIC 5EP1A 5AHWA 1N6IA 2MYPA 2CFRA 1KFJB 1RBMA 3CLTD 1ECGA 3U56A 4ZYZA 4UE3S 5EMHA 2EATA 3HHEA 1H23A 3FCXA 4BKMA 3T5TA 3VHLB 4KIFA 5DVZA 1ZC4A 2C5EA 3TOSA 5KVVA 4E5MA 5EQJB 1GCIA 2GDJA 3LY8A 5JD5A 2J30A 1Z56C 1EWQA 4MB0A 1G5IA 2UVPA 2LWIA 3AEKB 2IE0A 4NK5A 3VPXA 1XHLA 4M49A 2H2IA 3CVJA 4GLBA 3ZDFA 3ZTTA 4CDGA 1B41A 2RKOA 4IR7A 1DC7A 4KJXA 4QTZA 2RMKA 1DLIA 1D1PA 4ZEWA 3ASZA 1RC0A 2WC1A 1N9GB 2EFJA 2J5BA 1A9TA 2FRXA 3IEPA 1SAYA 2FPMA 3W1WA 1PK9A 3N5KA 1QK3A 5KTNA 3KQHA 2F4VB 1K0UA 2E6UX 3MZ0A 2Q99A 3O9MA 4P5PA 2WB2A 1RKXA 2EBHX 5G40A 4BB6A 1N3IA 4BV3A 3UW1A 4FYWA 2YDXA 1OX4B 4MIEA 5HZGA 4PCUA 4KVGA 1PWXA 1URPA 1CPYA 3K4QA 4WNAA 3L7YA 4AXXA 2ZBFA 5F9MA 3R0ZA 4URYR 3U1BA 2AZTA 1X94A 1PNQA 3EVBA 4CF7A 2WW8A 2AOUA 1SKMA 3LLUA 1G8AA 1U94A 3G5TA 3G8YA 4LSMA 1JJIA 4KQWA 4CM8B 3ACDA 2Y1GA 5AM3A 2F8SA 1AGRA 1W36D 1ICIA 2CFTA 1ZH2A 5F35A 3ZE9A 5FUVA 5JD4A 5JJKA 1E3DA 2GAJA 4DMUB 1SOMA 2G4VA 5FBRB 5CB4B 1WUKS 3CWZA 2IITA 2O2GA 2O8DB 1YQGA 2Y2VA 2W58A 5KHOC 1FP7A 2QZ4A 1Z75A 3DNFA 5DW3A 1N5OX 1GZ4A 3HV2A 3DB2A 4WDQA 621PA 1YJAA 1EXVA 3W77A 5ICCA 3CGGA 3TR0A 5LOVF 2BDUA 2C92A 5JD6A 3U5ZB 3OZEA 3BN3A 1GT6A 3P9XA 1DX4A 1OI4A 3UO8B 1X7YA 4IZIA 3VDQA 4US0R 2BM9A 1RWPA 3AF2A 3AM3A 2XZOA 1TPZA 3NHAA 2OFOA 4BTLA 1AF7A 1DAGA 2XUZA 4IIHA 4DQ0A 2BL4A 4RTJA 1YQUA 1MTZA 2VDMB 3IEVA 1NW7A 4ZVMA 1DG1G 3P4UA 3BERA 3IBFA 4O25A 3STUA 2JIOA 4B80A 4BPBA 4FCTA 1BA3A 1E2IA 1N7HA 2ORWA 3LW7A 4JWKA 1QGZA 4WOJA 2FW0A 1IZ7A 3NHZA 4RCVA 1ZK1A 4NFYA 1A8PA 4HL6A 2AW3A 3OJWA 2GPJA 2FPKA 3SS7X 3PXAA 1QM5A 3ZWNA 1QGYA 1O95C 3TD2A 5LUBA 1T13A 1C1DA 1HE4A 2HCJB 3CHYA 4WK6A 4BUJA 5KJFA 2UYHA 2AKEA 2W2VA 1YQXA 4IQFA 3RSHA 2B0CA 3A9CA 3SBXA 2VQSA 5FWYA 1JDJA 3HBFA 4DRZA 3N6XA 4UHCA 5IJAA 1BCSB 5ESWA 4CF4A 4TV8A 4EUEA 2B7CA 2ZUUA 4EP1A 3ZHCA 2A1UB 3RU7A 4JC0A 7ADHA 5GIPE 5IMBA 4W5QA 3T3HA 5IS2A 5KINB 4F3YA 3FLMA 4FQ5A 1XZBA 3FB1A 1SVSA 1XQVA 2EERA 4IHKA 4BNYA 3JY6A 3J81k 1OJLA 2BR3A 4C0AC 4KBYA 2G36A 5DK6A 2IZ7A 3FXAA 3PFCA 1B43A 1Y9JA 3IKLA 2JAQA 1O9HA 3AERB 3AF3A 1KZ7B 4NONA 4QQNA 3UJ9A 1DIAA 4EA7A 1YTUA 3Q40A 3WNZA 2JK0A 1I3OA 3A1CA 2IX3A 4NYJR 3H4VA 1CULC 4GU5A 5BQ3A 5EJ8A 1PR0A 2LV8A 1MH9A 1WPRA 3ACCA 3A4VA 2YFQA 3GFRA 3ZD8A 1KQGA 4GEKA 3ZE2B 2GBLC 3PNBA 5SZJA 4FKBA 3LV8A 1WXFA 2WHYA 1LQ2A 2VH5R 1CF9A 3QVKA 2FMHA 2H1SA 3LSTA 2J3IA 1GSAA 1JE1A 3MT7A 1U0SY 3ETHA 5ULLA 5LDHA 5KKCA 4UM8B 2WILA 3GPLA 2VTKA 5AJXA 2OBFA 3HZRA 4AJNA 1VOTA 2PT9A 3Q7IA 1SUWA 1F3LA 3S3TA 1NR5A 3R2JA 2JGDB 1F0NA 2A0WA 5DRYA 3H2GA 4B71A 4DCCA 4F4CA 1P6QA 4PLHA 4RVFA 3PNYA 2ZI9A 1PWEA 4HDNB 2A94A 3AB8A 4OF4A 3VNBA 5A3QA 5SZIA 1P2FA 4ODIA 3SMVA 5E7IA 4HXGA 4WK0B 2AN3A 1LNQA 3ZZUA 3SLKA 3T1YB 3PNOA 5HK8A 5CDHA 1TVCA 4MGIR 5A1TA 4LCEA 5HIJA 1ESEA 2QM0A 4TKVA 1OAKA 1C4KA 1UAYA 1Z74A 2YWFA 3OMLA 4WEOA 4EKDA 2UVDA 5E2BA 1JIKA 4PZZA 5JISA 1V9LA 3JWEA 3KC2A 2O5RA 3ONDA 1KOFA 4NU6A 4JLUA 1Y6JA 1Y4UA 3OM8A 3PXEA 4WL0A 1RI2A 3MERA 2J0EA 2WQZA 1E2JA 1XQXA 4CMHA 4F2WA 2G1PA 4NLLA 3ENVA 1RXVA 1EB8A 2YQ4A 3LCVB 3LIPA 4JI5B 4BGUA 5CITA 3DBLA 5JH7F 4GC5A 4DV1B 3I53A 2VJNA 5JAMA 2I7DA 3NHBA 6REQA 4J0JA 4P2GA 4ZREA 3SS9X 2WJWA 3WLHA 1BROA 2B6NA 1FNDA 3KOUA 1JH8A 3RVKA 5HZMA 2QUAA 3FZEA 1T26A 1MVOA 3K6JA 4N5DA 2JLRA 4MS4A 4IX1A 2WWRA 3FWHA 2C58A 4YJFB 1TTPB 1QO0A 2E7ZA 2QM8A 4X54A 4XSVA 3OX1A 3A3NA 3OVMA 1KOGA 4MQUA 1Z4PX 3MTJA 4UMEA 3CLRC 3LX6A 3PFGA 1NSYA 1UCFA 3EA0A 4UDOA 1S7CA 1M5RA 5TVGA 1NR7A 4WOBA 3ERCA 1T29A 5DWDA 4JLNA 1PFUA 3E9CA 4MXDA 3OQ1A 4RKEA 4MA5A 1XDSA 5DGDA 2A5JA 3ZNOA 1OXSC 3OCWA 3PICA 1A9SA 3PNQA 2HQ1A 3QPUA 2O4UX 1C5KA 4JC5A 4RANA 3RYHA 1JUDA 3W5AA 1N33B 1XZ8A 2D2FA 3QENA 2YV2A 2Z9CA 4JC8A 4RIIA 1V7ZA 1I3LA 1RSZA 3QNUA 2CLDX 5CVEA 1P62B 3RAFC 4KLRA 4O0LA 2QTRA 3PC3A 4JUDX 1J2TA 5J59A 3ZCPA 1ACLA 4GICA 3VO1A 1N77A 2OE2A 4YYEA 2J9FB 3JQAA 2J4FA 2HSDA 4QFBA 1NVVQ 2C4UA 3LECA 3OZ7A 4PVCA 1J9EA 4LWQA 1VL1A 4QSMA 3ZPXA 4F9GA 4ZMBA 2PGXA 3V8PA 1NOJA 4NY1A 2BFEA 4EMUA 1ZD1A 4UNNA 4ES6A 3VKGA 2A35A 2BTOA 1AQUA 4FNAA 3JQ9C 4PC1A 2Q49A 3TLAA 1G20E 3P2IA 1UJ6A 5FWAA 2WI8A 3H8SA 2OZPA 3RQSA 4W8HA 4IP0A 1XG5A 2FPGB 3H9QA 3IKMB 3MS2A 4B6OA 4LJ9A 1NJ5A 1W88B 2OV6A 4FINA 4UARA 5HE8A 1EFDN 4W6ZA 5JMOA 5LP1A 2AGVA 5EE1A 4ALNA 1WZEA 1XGKA 2XAAA 1QWOA 3L84A 3QITA 4M0MA 3ZNPA 1EDOA 4YV1A 4Z4CA 1YJ8A 2VYQA 4I36A 1WB9A 1CB7A 1T8UA 3QA3E 4P1ZA 3EFEA 3Q72A 3C24A 4II2A 5HKKD 1MZVA 4RFSB 1C3JA 4J9VA 3PRJA 1GNSA 4TTSA 3B1KA 1SWVA 3ODGA 1MRNA 4LMRA 2ODAA 3SDZA 4C06A 3NHYA 3WLRA 1H0HA 4RZ2A 4FNMA 5JLAA 3AHDA 1NX6A 2G1JA 1SPXA 3JATB 4TVKA 1Z0JA 4BNJA 4L6IA 2VSFA 2J67A 4C2UA 2LKDA 4WZBE 1I6KA 1GYRA 5F3WB 4R6WA 2VO1A 3EHEA 3Q3IA 4LOKA 4PZLA 3OLXA 1GVNB 5LKRA 1A82A 1K8ZB 2BGKA 4KDRA 3H5IA 4P4SB 4Q1BA 4QGBA 3AONB 2G7MC 2EYUA 3B9QA 3BQ9A 1RQXA 1XTRA 2BKEA 3OP4A 2GYWA 3G0BA 1UR5A 1G6HA 1IIBA 3A9VA 4OXXA 4GYKA 4K0KB 5AJHA 2QTZA 3FWZA 2CXXA 1ECBA 4LRUA 4Q05A 4ENPA 1DO8A 5CIYA 4K7JA 4RCYA 5I8WA 1Q44A 4ZTZB 3T5BA 2RAVA 1FNNA 2DOKA 1J1UA 4L6AA 3WIOA 1LI7A 1VL2A 2DCMA 2ADOA 3NORA 1OE0A 4BLOA 1GDDA 3N8HA 3P0IA 4C22A 5IJ9A 2O54A 2NAPA 3IRVA 3O5AA 2O0LA 2XA9A 2XIJA 1II8B 3QYPA 3NVDA 4MUAA 5TMBA 4W6QA 3CZRA 4RA6A 2JIRA 3K35A 1JN0A 5JI3E 3I42A 3KYDA 5T57A 1ZW6A 5IDWA 3CZ9A 4LHSA 1UPFA 3UAVA 3Q3GE 5AKGA 3HYLA 5H3CA 4LXGA 5F52A 3EYAA 4Q12A 4ZDIA 2ATVA 2NU6B 4XR9A 3DNMA 4LVNA 1BGVA 1NXOA 3H2HA 2BT4A 3JQ8B 2CBGA 3ZS8A 5BN3B 2GPTA 3X1WA 1VDZA 2B98A 1UWVA 4G2TA 1P7WA 2QT0A 2YV3A 3KYCA 4F97A 3VDRA 2RHGB 3SZLA 3WGKA 1QIEA 3R5TA 4L9RA 3CVXA 2GB4A 3HYTA 5J4KA 5IPFA 1W59A 2B8EA 1WY7A 2XTAA 4BL5A 2BOVA 3K5IA 3HJNA 2P2LA 2FQXA 3NANA 3NOOA 2E4UA 4MDYA 3TQTA 3WNVA 1FLNA 2DUMA 4P38A 2HV8A 3TO5A 1NU8A 1G1AA 2MSCB 2R85A 1N6HA 3KM0A 4UZFA 4ZCQA 5IM5A 3TXYA 4AROA 1ZAKA 4M0EA 4R9SA 5DBHX 2EBUA 3DAPA 3LUJA 3P9SA 3VTZA 2WUWE 4XRGA 1LSSA 4ZKDA 2NVWA 4MWZA 3D6AA 4J29A 4LTDA 1NF2A 4CUJA 3GH3A 1BJTA 2RH9B 2QJWA 3OTOB 1AC5A 2DHDA 2I6FA 5DOZA 2IYQA 4AY2A 4HX9A 4ECAA 1YCFA 1NRWA 2ETXA 3EXEB 4Q03A 5IJWA 3OG9A 5HMMA 3W1EA 2FLKA 2XJ4A 10MHA 4XUGB 4EHNA 5KTOA 2QS9A 4GI3A 3UC9A 3LUDA 3F90A 4QOEA 2IK8A 3SHQA 3K5PA 3IUEA 3BXGA 2BMVA 3D54D 4EYKA 1FFCA 1Q7GA 1MHPA 1OYYA 4M7RA 4OB6A 4ASUD 5B5SA 4QTYA 4YPVA 4HKTA 5L4LA 4PQRA 4GDMA 5LXTF 1LCIA 1I8TA 1CEXA 3L01A 1CZRA 1HDEA 1P3Y1 2AN4A 2NUAA 2P3OA 2IEIA 4NARA 4N7BA 2PGAA 2EF0A 2WYIA 3DA8A 2ZIXB 4KW7A 3A9TA 1DOAA 3V8MA 3Q0TA 3L6UA 5FQOA 5K03A 1YVPA 1I0IA 1ZJYA 5JS8A 1Z5VA 3MFQA 3AW9A 4HN9A 4MP3A 4B17A 2X0RA 4MW6A 5CNMA 2P0AA 1N32B 4MICA 2OB2A 1MJNA 2VHQA 3I2GA 3KQVA 4CMAA 4UMDA 3FHLA 1G3MA 1W4ZA 3ME5A 3RADC 2VWHA 3LHSA 1P74A 1X19A 2NXNA 3ELUA 3RAGA 1NJSA 1T4DA 3KJHA 4RFLA 1M9NA 1RMTA 1SOWA 3F2VA 2ZATA 3AEUA 3UENA 5DI3A 3WP1B 1U8AA 1G60A 1TL7C 2VP9A 4KGZA 1OX6A 4YS6A 1UJ4A 4DARA 3NDPA 1JS1X 1XZMA 2WT4A 3HR7A 1FFEA 4JLVA 2BEUA 5B4UA 4CM9A 3WYEA 3LT4A 2P1RA 2Y9MB 5J4LA 3CUKA 2FPPB 2Q50A 3I72A 2F00A 3PQ8A 3UMCA 5KYUB 3AGPA 3O9VA 2CJWB 3QRWA 4MYCA 3RBVA 1UC8A 1GHTA 3UWDA 4N9WA 3KSDO 1OHHA 2Q1XA 4LX8A 3V5NA 3WGUA 5EVCA 1D04A 2CHGA 4JJ4A 5FBQB 5ILQA 3T3EA 4EKEA 3AVYA 1GEEA 2Q5IA 1TQ8A 1CF4A 1B76A 5BR1A 1T4BA 3SJZA 1QU3A 1KJNA 3SHTA 1SIUA 4X65B 1R9MA 3NXKA 1EQ2A 4QOHA 1FYVA 2FZWA 4FHDA 1KZGB 2O2CA 1ZRMA 5F4BA 1KFBB 5CAEB 3U4GA 4TZ6A 3QVWA 2UYOA 2FX5A 4FKMA 3G7NA 4G5QA 5DX0A 5L4NA 4QDOA 4FS3A 1KNXA 2VPYA 2B9EA 5TPZD 3RPEA 4D9HA 1DO2A 1GTZA 3FPSA 4UAUA 3ZEAA 4B46A 5BR8B 3O8BA 2IEBA 1OXUA 3C6YA 3OTQA 1TECE 3DMFA 3GFSA 3K9HA 4FLMA 1EG2A 1ZONA 3HY4A 3IB3A 3PDIA 1XCJA 2DLDA 2HLDA 1DOZA 4COOA 1MO5A 4D9GA 4TMVA 1UOQA 3NVAA 4H7FA 3TLGA 1HR0B 3O8QA 2UUAB 3PFKA 2O7NA 3THXB 1YOVB 3TR5A 1L5MA 3D6NB 5JY1A 4IDPA 1XJ0A 2E48A 4WLFA 3EDQA 5YASA 1UPCA 3WLMA 1O96A 4WCDA 4JI3B 1VG1A 1XD2B 3FNIA 2O2ZA 1XCBA 3PJFA 3DTVA 1KZ6A 1PYOA 2A3RA 2DWCA 3R3ZA 4S0XA 3IPCA 5EFZA 2XWSA 4F4IA 1COWA 1RQ2A 1IG3A 3RS3A 4EQ6B 1Y4DE 2GN2A 4P08A 4FIDA 2EX0A 3PE3A 4I66A 4WKGA 2IKSA 1NLZA 3PGLA 4NH4A 4UDXX 1IZ8A 4C20A 4HNTA 5JXWA 3WIUA 2RGGA 2Q07A 1HDZA 2IGBA 3NBAA 4O4IA 5J1SB 1YS4A 4XSGA 2L0XA 3QU9A 4Y6PA 4RZUA 4X91A 5CEFA 2HF8A 2D7JA 3OQIA 1XU9A 4MI6A 5DULA 2IL1A 2ZB7A 4MRAA 3G2KA 4FLEA 1IUNA 2P2NA 2E5LB 1GLNA 4LDZA 3OQVA 2DPLA 1J06A 3DOFA 5IMSA 2OM6A 2RGWA 2X6RA 3M6VA 3KFXA 4R8LA 3TRFA 1ACMA 2ADMA 2OHOA 3J7TA 3O38A 3OOSA 4AS2A 2QTMA 1J4AA 1ATZA 5BQXA 1CRPA 2NO5A 3QHQA 1JXOA 4GWGA 4KLNA 1JYFA 5KTRA 2CFOA 4LJKA 5BQPA 1IOLA 3BQMB 2IWRA 2Y77A 1QIIA 5JNTA 5C8ZA 4Q3BA 1XFDA 2GCPA 3FF4A 4MRPA 5E1MA 1TCCA 1W34A 2JGIA 3GBVA 1WEKA 2X5XA 1BX0A 4U7WA 5FNVF 4IHJF 3AY0A 1C0IA 2NXCA 4FJ0A 2A5FA 4ZFNA 1QAMA 1YVUA 3KAJA 1I9CA 5HMLA 5IKOA 3A2NA 2RIPA 2YN0A 4HGZA 5HQTA 2HT1A 1L4KA 1PX0A 3G59A 4XCQA 1GL7A 4WKNA 1IMJA 2B1RA 1K92A 5ALLA 3OAAA 4U7JA 4KTVE 1FSFA 2CLEB 5D6OA 5F4ZA 5FPSA 4CG2A 4KWEA 2EX4A 1M6VA 2REXB 3PZRA 4CLRB 1EVQA 3CA8A 1R6BX 3F71A 4JFRA 3E7WA 1GPKA 1DV1A 3R6DA 4KQ6A 2OECA 1K66A 4QHYA 1JU4A 1O9GA 1M2VA 2C88A 2JBAB 2ZDQA 3WYDA 3IVXA 1T0JB 4H7HA 1VCIA 1WQ1R 4HJRA 4KGXA 2YIMA 5ALNA 4MRVA 3RVNA 1CY8A 3EZXA 3WX0A 4CF5A 2PSSA 3R3SA 4PHHA 4BU1A 3GLIB 3H2IA 5JQGF 4QUIA 5CT9A 3U6KA 3QNMA 3TQQA 1T5SA 2WTAA 2XUFA 4BLUA 5LP6B 3HTXA 1BH2A 2WM8A 3GDWA 3X43A 4A2QA 2JHFA 1QJ4A 1SGWA 2AKAB 3T7TA 2JFOA 1JVSA 4YECA 1EKXA 5CFZA 2JDIA 1TCVA 4XA8A 1YMVA 1L6RA 4ZPXA 3DVAB 5JBNA 4PNPA 1GA6A 2WAAA 2XD4A 1OLUA 2OO5A 3LUPA 2JFPA 4OHPA 5BVGB 3PJRA 1F5NA 2BMDA 2C2XA 2XDQB 3C7TA 3F7NA 3QELA 1B23P 5JY6A 4PC6A 2TMGA 3Q2OA 2C5SA 5JCPA 1TF2A 3PHGA 5ED0A 4QXPA 2NADA 1SULA 3E03A 3QU2A 4KXYA 4QEZA 1P9WA 1N3YA 1W4CA 3DLTA 2EZ8A 3O6VA 1L7RA 1XJWA 4LQLA 4H1HA 4PR0A 1OB2A 4CN8A 2GAOA 4HUQA 4I5EA 4AMBA 4FMBB 3DYBA 3TXXA 3V1MA 3VHXA 1HT2E 3QFHA 3SHFA 1G21A 2ZJFA 1R0XA 1UXJA 1X7ZB 4IINA 2WP8J 4EX7A 2IHVA 3P27A 1QHXA 3C6BA 3UMYA 4ARSA 3CNEA 3NEYA 3TFOA 2Q46A 1E0KA 4S1PA 2AMFA 1HSOA 4X61A 2SKDA 4DADA 4UEOA 4FS8A 4QA9A 4DUYB 1YCGA 2O0MA 2X15A 3R8XA 4DR3B 3ENWA 1PIWA 4RTMA 4MHTA 2WU1A 1PR9A 4I6EA 1XRQA 3ORRA 5HQ3B 2HSWA 3VFDA 4XQEA 3GFBA 4NZNA 3G89A 4G4GA 1TUBA 3R24A 4BX8A 2HX1A 3DLBA 5CH3A 4YMSA 5IRCD 1DG9A 4MQEA 5FI0B 1JEJA 3A14A 3WWDA 2WFLB 3HKCB 1YBAA 2Y76A 3FFBA 3QG5A 3K2BA 1P7CA 1UDRA 2ZZNA 3RJZA 2D3TA 3GHYA 4CKYA 1JLLB 1OD6A 1SK9A 1W8DA 2I6TA 2NXWA 2HMUA 1NQXA 1E9FA 3IV9A 3WMXA 1W5FA 1WCIA 2ZYUX 2P2ZA 1JXAA 4NABA 1YFZA 1RYNA 3QUCA 1NN0A 3IOMA 4M9XA 4BE4A 3UJBA 1JJBA 1RPAA 2HGZA 5BVHB 2AJTA 3B1VA 4UMFA 4EGJA 4H27A 2G6TA 2Y0DA 1TYCA 2C95A 4JY7A 5DNEA 2IV3A 2GT1A 4MHSA 1C81A 3HSKA 3V4FA 2LZ0A 3MGAA 2DFVA 4L50A 5GJVC 2V03A 2P3QA 1A7UA 3DCYA 4K9DA 1PL0A 3AUKA 1V5EA 5DXAA 4HHEA 1WBJB 3B13B 1LDYA 5D3ZA 3T4EA 3CE6A 1TYEB 4KIWA 4ZA2A 3REFA 4OJQA 4CUZA 2GOYA 2BFDA 3B8EA 1CIVA 1Y7LA 3GUHA 1XEAA 2FOIA 5C4IA 2QI9F 1OFTA 4UCWA 2B30A 4DFDA 1W75A 2EFCB 2AOWA 1PWZA 2CE7A 3NV9A 2PA3A 4G0QA 3U81A 4CRWB 1Z8DA 4QGAA 1CDDA 1FUUA 4DHWA 1DWPA 2ERXA 5EP3A 4MWCA 4K1XA 2VXOA 1HDCA 3TB6A 1Y7IA 1S1CA 4BKUA 3OQMA 1VL8A 3ER8A 4GRAA 4EPYA 3SX0A 1Z6AA 1BMDA 4TT3D 3KVNA 2H7VA 2YJZA 2SCUA 1XYYA 2D5BA 4IQ0A 2VI5A 1RYZA 1Z38A 2BGRA 4X1KB 1NM5C 2B6HA 4UVGA 1E9SA 1KFEB 2QD2A 1N2CA 1P1CA 3DUFB 1UBHS 4YY3B 2YWJA 3BGSA 5LOVA 3B85A 1TYDE 4AQYB 2QL7A 3OCYA 4X63A 4IF4A 5AK3A 3R9XA 3QLEA 4RAQA 4YRDA 4EYQA 1BDIA 3ICWA 5I01A 1WKVA 2BPOA 1XXHA 1RZUA 4MVJI 4RK1A 1TTTA 2QZZA 3K4HA 1G3QA 3V4PB 1XALA 4K9QA 2HRQA 3SE7A 4X1IB 3MLAA 5IVIA 3O4FA 2CSXA 2WTEA 2ZBRA 2PUAA 1E9BA 1F51E 1AT1A 1NBIA 1VE5A 2Q21A 4MMZB 3K0BA 5EXXA 2YCLA 3C6QA 1KGSA 1IXKA 3E9ZA 3CNNA 3W5VA 3SSOA 1E1MA 2FI1A 2WVAA 2A9RA 1ZHFA 1DCMA 3OFKA 4OHBA 3V8EA 4CW7A 4HXYA 3QLVA 5IXJA 5CM9C 2ZCVA 4RC9A 4WGFA 4BC0A 4BV8A 1Q74A 1UZAA 4LMBA 1U0RA 2O23A 2UKDA 3G0GA 4YI3A 5KDLA 5B58C 3RHFA 4MWDA 3U7QB 3L8DA 2PKWA 5GGYA 4MK4A 5KQPA 3AM4A 5KYYA 2WINI 3K20A 2BGNA 4EPVA 5MFZA 1J0DA 5KNBA 3T9FA 3SYMA 5TXGA 3RVQA 4ZIRB 4B5KA 5LU9A 4B3BA 1VYTA 5KWJA 2VPXA 4ZVOA 3H16A 1FRVA 3I6ZA 4P34A 2OXTA 2A9FA 1UZUA 3OPQA 1YULA 2Y4OA 1MJGM 3GP3A 4TQUS 4L8VA 5C5IA 3DWEX 4GVXA 3S1AA 1G5QA 2PO7A 1UEXC 1JKJA 3LIIA 1OH8A 1H4SA 4I3HA 1Y3FE 1XQ6A 1NW6A 2W2OA 2K87A 2WOJA 4HAYA 4E5KA 3G5AA 3QYJA 4MB2A 2HIGA 3M0EA 4EBFA 3ZQ4A 1FJHA 1YHZA 3GJQA 4WZ6A 5CBKA 3JYHA 8ADHA 2P0EA 5FWXB 1UJBA 3QSGA 3QHAA 2HSGA 3TX2A 5L4SA 4AWAA 4DMFA 2AC7A 1ISFA 4BFSA 2WWYA 4C2BA 3FVTA 5K3FB 5IJXA 2PRIA 2W6ID 5JZOA 5B6IA 5KNCD 1WUJS 1KS2A 3H5VA 3NKFA 1OPXA 3TQIA 2WFAA 4PFJA 2E37A 1UK7A 3QVVA 4INZA 4P31A 1ZM4A 5F64A 1P73A 521PA 3WYBA 1PRYA 3G23A 4DIMA 4YP0A 4HWSA 2VDUE 1JIIA 1RJ9A 2DFPA 2FFAA 4ZRMA 3RYTC 2IUTA 1U1DA 2HPZA 4I4NA 1XLVA 2PZ8A 1A7AA 5IWCA 3QSYA 1BKSB 4MRRA 2IIBA 1ZCFA 1DLJA 3AFGA 4QYSA 3KOYA 5ECYA 1H4QA 1FDOA 4JLJA 5MGNA 4OHFA 2AR0A 3NDJA 5AJZA 1G8GA 2BFFA 1W49A 5G3YA 3VOBA 4LCBA 3M6UA 1HORA 1ODKA 2R4QA 4H59A 4BTVA 2H1OA 3LP8A 4EF4A 1Y8RB 4BO4A 2VZ0A 2O20A 2XB9A 5K6AA 1QYRA 1XLUA 3ZX5A 3OY7A 2C94A 1Q0LA 4Y2HA 5AOBA 3NWOA 3CX7A 4RY9A 5J5CA 4KE7A 5LYJA 4BLVA 1QAQA 4QFCA 4X92A 5EKDA 4C29A 4NBUA 1XDUA 2VNHA 5H81A 3EUEA 4GWLA 3VKWA 3RO7A 1M2JA 1B93A 1GUFA 3HB7A 1GUDA 4HZUA 3GPCA 3KUKA 3ZJ4A 5JH7A 4HLCA 1GFSA 4RTOA 1U7WA 2V8OA 5IDXA 3JYOA 4XGKA 1TAHA 4GMGA 4B3JA 3PLAE 1AKTA 1ZUNB 2Z8ZA 4KIJA 2SKEA 1F2DA 1JQLB 3EXAA 4PZUA 4S1OA 2VDWA 3LE8A 6LDHA 2YXDA 7MDHA 4RVGA 4F45A 2XCQA 1SU8A 3EMBA 4FHFA 3PPYA 4PE5B 1JHZA 3IMFA 3ZYZA 3UFBA 4TMFA 1KJYA 3HJHA 4M0FA 1L5GB 4HLUA 4EZBA 3WAKA 1E1CB 5LMCA 4WPGA 2OCGA 2DBRA 5KKNB 2LIVA 3MJDA 2X1MA 5ALIA 3DMHA 3ZKAA 2JK1A 5B7QA 3E5NA 1V16B 1J00A 2VWPA 1S3GA 4B8ZA 4V3BA 2REOA 3ZHUA 4YCLA 4H6WA 4L75A 4XM0A 1E62A 3IVAA 1DZIA 1A71A 1D6NA 3BWYA 4K6FA 1PDOA 3TTYA 1FIUA 4KK3A 2BFCA 4A36A 1V0JA 2IPOA 1QHGA 2EEPA 2O1EA 1IPFA 1O0SA 1Z5UA 2JFZA 3A1TA 3IBCA 4PYLA 4R05A 5E6UA 2WA1A 4DIEA 1Q21A 4BO2A 4E14A 1LTQA 4IOJA 3DR3A 2J07A 4B2YA 1CY6A 3N2IA 3DHVA 3RAPR 3SG0A 3VHQA 4YMUA 3AF6A 1RS0A 1THTA 1Z7BA 1TVKB 3ZJUA 1MO4A 1E2BA 1ONBA 4H9GA 4UREA 5BSEA 5I8PA 4LXUA 1N5RA 4BRWA 3QTLA 1AGYA 3HKBB 5IAAA 1QONA 1P8JA 3PYMA 1B3RA 1NMQA 2WU0A 3L0ZA 2HU5A 4QC2A 4GI2A 1KI6B 3PCRB 4G85A 4Z7QB 1LC3A 2YHSA 2P9EA 1GRRA 2Q3BA 4FK8A 4DNXA 2PUEA 1XAJA 1GL6A 3MYYA 2BZ0A 3P5BA 2O2JA 2IZZA 2VRCA 2ZITA 3VSDA 3TF5A 1JA9A 3TMAA 4AJ9A 5MN6A 1R4MA 2JJQA 1F0YA 4BWFB 1LDBA 2NNWB 2O48X 2G5TA 4UBNA 3A3PA 1JIUA 4C7VA 1ZISA 2VHYA 5G2OA 3SWWA 1L2TA 1ZI9A 5IZCA 3GEMA 3MT9A 4TTQA 1Y9AA 2RCYA 4BLQA 2EQAA 3MPOA 2YIVX 2DSTA 2HKIA 3NALA 2YS6A 4E5NA 4NBKA 1QPBA 2QTHA 4FE3A 2GN4A 3PKIA 4LOJA 5ERXA 3RRMA 1NQOA 3LKVA 3ZOZA 2P8SA 4LI0A 1PKXA 1JPUA 1SM4A 2P30A 3GRVA 2VXBA 2QMYA 2HHAA 3INTA 1GZUA 3U9SA 1NTOA 2F17A 3NH9A 3SKVA 5EE5B 1CTQA 1JMKC 1GU0A 2HO4A 3LKDA 1Z35A 3NIFB 4HXFB 1VGQA 4RK5A 4UFOA 3N1UA 3QX9A 4IGKA 4O2BB 3PSHA 1GAEO 5LZ9A 1XTJA 4UMVA 3OE4A 3DBVO 1E60A 2TRSB 4IWYA 5FPHA 1HE8B 1CYEA 5KOHA 4O8ZA 5E95A 4FGJA 4HMQA 4KQKA 3WKDA 3IEKA 3ZXYA 3KB1A 3AFIA 5H9VA 3F6SA 3VH1A 4GM1A 2P9CA 3P1JA 4YQZA 2W43A 3HYNA 1EM8A 3IT0A 3W7BA 4ER0A 1VPEA 2XH8A 1ZR4A 3B5EA 3EBOA 3K1YA 3KKMA 5F2NA 4UU8A 1KMCA 3BX1A 3JQ7A 2WWWA 2ZYIA 4YJ2A 3L8CA 4PLWA 3PFFA 4PC3A 3JZIA 3RS9A 1FP4B 4I3GA 4TS1A 3L7LA 3OPXA 2YL2A 4EPWA 4P33A 1T5DX 4X44A 1R4AA 1ZD8A 4II3A 3CEJA 4BX0A 1H8EA 4EI9A 3A7EA 3GFGA 2Z95A 3PC7A 1TT7A 4L72A 3I64A 2EKPA 5E7JA 1CY7A 1VE9A 4MPTA 1YNOA 3Q88A 2X22A 5TS2A 5ITWA 4P4GA 1JPJA 1ZEMA 3K9LA 3EGOA 3NATA 2CXPA 3NR2A 4AJ2A 2O57A 3F96A 1PJQA 4F8EA 3A2LA 4YMVA 4RDHA 1J8MF 2PIDA 4RZSA 4IJWA 1QGUB 2Q3HA 1SCDA 4XFDA 1AXEA 2C2BA 2EGUA 2O14A 4FD2A 4ZEMA 4JJ8A 2ID4A 3GGDA 2EDAA 1H66A 3KAKA 1Z37A 4R9VA 3L7KA 4RKQA 3LTNC 2PFGA 3AESA 5F77A 2O2DA 3I1FA 3ORSA 4RW0A 2PMKA 4JYPA 5HUQA 3SVLA 5CCBA 2VHJA 2EHDA 3MGBA 5FYDA 1T1RA 4A0HA 1A4UA 1TEXA 1FBTA 5BXQC 4PW0A 5IT0A 1CVIA 2I3DA 2QTBA 1ZK2A 4HN4B 3CZQA 4X9XA 1JWAB 3HL0A 1QV9A 3GW8A 5JMTA 1OZ0A 3EH1A 4X1YA 1RAHA 2B8NA 2DUUA 1C7IA 2HNBA 1T1JA 3IDSA 3OEEA 3ON5A 3QVTA 4KXMA 1PNVA 5KKAA 4W9MC 1GNQA 4D0RA 2BMWA 1LLCA 2VAMA 2HH9A 4J49A 5ALEA 4KDCA 1F4VA 3BA6A 3QYAA 2M2IA 3KQTA 3WMRA 2X86A 3OJCA 1QR6A 2K7FA 4AMYA 4ZHQB 1E61A 4R3UC 5C7IO 1TF5A 1WAMA 2HD4A 2QRGA 4WH0A 4A2WA 1DELA 1MN6A 3G0CA 8ABPA 2C2KA 1LBHA 2J6HA 3FOCA 3SQWA 2CDCA 5LXTA 2I6XA 2HJSA 1PP4A 3C85A 5GJBA 1L5OA 4MJ7A 1W7AA 1H1TA 1A72A 1M2FA 1TM7E 1Z4NA 2QUJA 2Q3DA 1Z8NA 3SIRA 2PJRA 3DMPA 4BIMA 4L27A 2WD8A 1TA0A 4Q3AA 1ORHA 5LSAA 3LY9A 2QM7A 1RPZA 1QH8B 1WO8A 3ZH9B 4RHEA 4YO8A 1EM6A 2EKQA 4QGSA 2CCJA 3RBAA 5A0TA 1EVYA 2IF2A 4XDZA 4DOMA 4YGXB 1JG7A 1N5MA 3OM0A 2WUGA 5FBKA 4PSCA 4DNQA 3ITDA 4DLZA 5CDTA 3HU3A 1XSEA 1IB6A 1EUCA 2PKQO 4FHEA 1IC6A 2NVUA 3VMFA 4B8WA 3IAEA 1YL7A 2OT3B 4QJ5A 2FEMA 4JYCA 4ZVKA 3V6MA 3A31A 2J41A 1VFNA 2VJMA 3AF5A 2XY4A 3SIPA 2QDKA 2HWUA 4ZI7B 3IUQA 2D1TA 3ORFA 5K8UA 4A8PA 2YKGA 1R37A 2HQSA 2JGEA 2DH5A 4OQMA 1QHNA 4W8OA 1LY1A 1YRAA 2P5YA 4C87A 2C5BA 4DQVA 2OY0A 1H1DA 3DZFA 2OFWA 3LUCA 5M3BA 1SBZA 3PXGA 4F0JA 2BW0A 3HCPA 1MVNA 4ND8A 4XX1A 3VR1A 4EHJA 1IVNA 1X86B 2I4TA 2NU7A 3Q3JB 4C6TA 5LPNA 1Z39A 3M4JA 4MS3B 1C3EA 1MDFA 2B92A 3D2CA 1E3MA 1W4LA 4HDKB 3UZUA 3JAWA 1YL5A 1BE8A 2G83A 3UW3A 1RWOA 1O95D 4CLEA 4DLNA 5BUQA 4YP6A 1QIHA 1NQ5A 5HDBB 1EVKA 1VQ1A 3LA6A 3G3EA 4MRSA 3LQ4A 3QNWA 3SSAA 3NI2A 2PTGA 1OMOA 3Q6IA 3KZ1E 4YNBA 3HU1A 1XZHA 3FVRA 3I5XA 2RONA 5GIOE 4CEIA 4CIBA 2HJHA 1RWQA 2IC5A 2ZJ3A 3DFFA 3EXIB 1B8UA 1UJ5A 1GLGA 3HO6A 3LNTA 2RHMA 3S68A 3VU8A 1AHIA 4CKEA 3T5AA 3BFXA 3IPRA 1FC0A 4L4XA 2QXYA 2QHXA 3CGWA 4LFBB 5HUHA 3C6ZA 2CLSA 2HU7A 4YHBA 2I2BA 4XD7D 2AC4A 3FKJA 4C6SA 3K6SB 2O8VA 2PUFA 4A5SA 2OHXA 4KMMA 4KQJA 4XB1A 3WVNA 4A4DA 2NP6A 3AJ9A 2GPAA 2NSHA 3JZFA 4CKWB 2C2YA 3GJ3A 1DPFA 4B84A 1JEAA 3WICA 3PE6A 1ZK0A 3FRIA 4D25A 2F90A 2WBLC 4V24A 4YJGA 4C9BA 4R2XA 1UKZA 2VP6A 2BWJA 1UXKA 1X1SA 4EYOA 1ZCZA 3J7AC 2X0KA 5H16A 4OHRA 1WL8A 2Q4TA 4S1WA 5TSDA 3IPAA 1CQPA 2ZAGA 2C2ZA 4O3FA 2FPUA 1CRZA 2XBLA 3L79A 3WO1A 1MX9A 2XXJA 1N2SA 1P2TA 1I32A 4ZARA 4YHHB 3O7WA 5JIBA 3A1WA 1H22A 3BE8A 4NBVA 3SBDA 5BNIA 4RZXA 1FYEA 3JQPA 3BSWA 4HRVA 4WN9A 5JSFA 1CR2A 2G28A 4Y9RA 2I2CA 3COYA 4BBZA 3Q7QA 5H4HA 1Z6XA 1LRLA 2ZUEA 2C00A 2VZ8A 1WMBA 4KR7A 2CNKA 1X8LA 2J6BA 4PYQA 3ZHTA 1N2JA 4GM4A 3C45A 4BQSA 2OHFA 4YUWA 3K0HA 3V4LA 4JLPA 1RQNA 2VZLA 3JQEA 4PHTA 3TNDA 5AVSA 5K05A 5L8VA 1JFRA 1WMSA 4MJXA 3TLCA 4BVHA 4WY5A 1ID8A 3HG7A 5J4YA 1SOAA 3SY8A 1YIOA 4D4HA 1X0VA 3EUAA 2I1LA 3FOAA 4GPZA 2CV0A 2B69A 2PL3A 3CR8A 4HRXA 5DLEA 2FR1A 3AR5A 5C1OA 1NNLA 4R2LA 4GC9A 1PQUA 1Z0AA 2N1MA 1XCPA 3E82A 5AXDA 3CMMA 1EP2B 2B35A 4RVCA 1OWMA 3O75A 3QEOA 2OSBA 2P2SA 3HCEA 1KRXA 2W6JA 3OWHA 3R3HA 1W8IA 3N2GA 4IHJA 5FNVA 1AKNA 3QWHA 4R83A 3SZRA 2DR2A 1KF0A 4ZICA 4KQMA 1AZWA 5IAKA 2HCRA 1MV5A 1DAMA 5CFMA 4Y1FA 3Q7TA 5IEJA 4YR7A 4OREX 1U8UA 1LSJA 3FYCA 3QLUC 2X4DA 1GY8A 3FIUA 3REQB 4LDPA 2BFBB 3CRRA 1OCEA 4ZO4A 2GD6A 2X4LA 5K8CA 1UIRA 4GP9A 3GFVA 4S04A 3ZGVA 3K8ZA 3Q6NA 1SFRA 3CLRD 2CMKA 1EK5A 4UTOA 4X8OA 1G63A 4EUFA 4RVDA 3OZSA 3MBKA 2W42A 3CVOA 1K3UB 1KU6A 4KFSA 4OQNA 3THSA 4F3CA 4A3SA 5JQGA 3HH8A 2HJGA 4M7WA 5IKPA 4KNWA 2RHLA 2C20A 4IJKA 1WWKA 3FUWA 5HX7A 1NKSA 3RD5A 1PQYA 4QVGA 3WB2A 3MUEA 3DPUA 1U7TA 1Z2PX 4WY8A 4WZBA 2VR1A 1DBVO 3STHA 1Z6QA 4IVPA 4AKSA 2H06A 4UDYX 3VZPA 4PGAA 5I8ZA 3WY9A 5FORA 5GV7A 2O19A 1RD4A 4Q1VA 4ZT2A 2XB6A 3L1VA 3N2ZB 1X0XA 4DLSA 2ZKLA 1G19A 1KTIA 3TRHA 2X0EA 4XUEA 4PRLA 3M1LA 5MF6A 2XF2A 3COSA 2BKUA 1T2FA 4MUYA 1KO7A 3PQ5A 5JBQA 5J2UA 1KYWA 1W46A 2YVLA 3WGLA 3ZY5A 4DKJA 4HSEA 1YE3A 2W2QA 4P6VF 1D9XA 1T4CA 3WLKX 5E6SB 4IILA 1JDSA 3MBOA 1FTGA 1UKEA 2D7CA 1C1XB 1R00A 1ZGCA 3OM1A 1IWBB 3ORHA 3Q8WA 5JC1A 1T6XA 1C8VB 2GBGA 2HFKA 2L82A 4P7FA 4OHYA 3UV3A 3V2HA 5A3SA 2O2EA 4BEJA 4D4KA 4QOJA 4ARUA 1GP2A 4G41A 1FBNA 3KPWA 2H8GA 5J2TF 4Q9JA 1QWSA 1ARZA 4B7ZA 4P80A 5HBRA 3GJSA 1WMFA 2VF8A 1D2NA 4Q3EA 1KYVA 3GEIA 2VPIA 3ZN2A 721PA 2FEPA 2QSJA 2V55B 1FLVA 5AVJA 3USZA 2XLBA 3DEFA 2ZE8A 5HJ2A 2XRFA 1KHTA 3H1PA 1CUBA 5LYJB 1JFFB 1JMYA 2GBIA 2ZIEA 4H7EA 5BOVA 2I8CA 3H6HA 3SXPA 5LQSA 3VU1A 1YAHA 1W94A 1UMCA 1C3OA 5I4KA 4K9LA 2J48A 2Q5EA 4Q7MB 1AS3A 2RIRA 3VSAA 5C7OO 5BYBA 3WGZA 4OFZA 2XYHA 2OA0A 3U4HA 1C9NA 4UTNA 3K1JA 3FDZB 4F3NA 3OE7A 3E3AA 4WT7A 3BBLA 3KR1A 4BOYA 5ALRA 1AK2A 2O7RA 3DDZX 4AQDA 2G1KA 3BH6A 1N2EA 4BO7A 2EL7A 4F7DA 3ZV5A 2QRHA 4KAFA 5DNYB 2IHYA 3ICEA 2IUUA 4N3GA 1VP3A 4RACA 1YMQA 3FMVA 4XFKA 1SC1A 5FOVA 1CQIA 2GCIA 2C59A 3PQ3A 4P32A 1NQUA 2BKLA 3OJLA 4L5CA 1UWLA 5EC8A 5SV2A 1C30A 1JAXA 1P80A 2H5LA 3LKZA 4E5VA 3W78A 3PYXA 5FO1A 2P9TA 3AV0B 1KYQA 4KN5A 1WD5A 4YP9A 3SYKA 3ID6C 3IQDB 1NI4B 2Z6AA 4H31A 4BP9A 5CDFE 1WXQA 3LLVA 3QBDA 1Q1QA 1L4YA 1P61B 2GN6A 2IXTA 3L7IA 2H07A 2Q2QA 5AVVA 5H5JA 3E23A 3N0TA 2WD9A 2ZSIA 2W6OA 2B2NA 3N2LA 2XRZA 1JT2A 3LQQA 2JLAA 3E05A 4MWTA 2Q3EA 5F2OA 4U7FA 3DF9A 1U0FA 3IKTA 1L1RA 2BFMA 1SBHA 4TUYF 1G3UA 1VBNA 2X5NA 1K4YA 1ZL2A 4ZT3A 1WBDA 4BFYA 5I7VA 1QB7A 4KE9A 2DR3A 3FHJA 4Q82A 1AGXA 2P5UA 2J87A 2RI6A 3MGKA 4XGRA 2OUKA 1OC4A 2QORA 2R48A 2GZMA 4JXJA 1SKBA 5ITZA 2G63A 3SVZA 5KNDD 5GOTA 2XCUA 4B32A 1X1AA 2ZSJA 4LY9A 4WN3A 4A73A 3KZMA 5KX5B 5KNBH 1LTKA 1ZRHA 2O52A 4NE2A 3H9BA 4HNAB 1DDIA 3VC7A 2R4UA 2X77A 5FA6A 4PZ9A 4IDBA 4J8PA 2QW8A 2CL6X 3FR7A 1GADO 5HFAA 3DEZA 1HLFA 3CF4G 1V45E 9LDTA 3CLSC 5TNXA 4HRYA 1ZK3A 2IEDA 5ES3A 2PSFA 4W8GA 4YRNA 1H0RA 3IAHA 4JXZA 4DPMA 1S2DA 1U1IA 3DZJA 4IJMA 2PRYA 1FXWF 2OGWA 3KXPA 1L3CA 3HLTA 1L9XA 1CX9B 2Z58A 3PWTA 3KETA 4D8TA 2P3LA 3Q9UA 4B9AA 4IH9A 4ZYYA 4EDFA 1ISRA 1P7YA 2HUNA 2ZRMA 4IIUA 3UK0A 5BYKA 2RAPA 2JFBA 1RT9A 1PWYE 2VT6A 2XE4A 3FZGA 5FFNA 3ISTA 3WOVA 5EHZA 1S7GA 1E2PA 3OZDA 5TV2A 4BGVA 5IC6A 3TE6A 5FNZA 1CNMA 2PLFA 4BJ5A 4M2LA 3ZU5A 1CUXA 4BRUA 3B38A 4CG0A 2RB4A 4OX9B 3VR4D 4XI9A 1JU9A 1UP6A 4FMDF 4ZT6A 4B3SB 1RR6A 2O2YA 3HQ4O 3CSUA 3D6MA 4A6XA 4R1QA 1JAYA 5I4CA 1RZRD 3MA0A 3I9FA 4RDXA 2QMZA 4Q02A 1XTSA 1N1DA 3QKRA 2Z08A 3V33A 3RS7A 2DBVO 3JQQA 2DFTA 2RGCA 1MNQA 4UNIA 2ERCA 1Y3IA 3MW8A 1NF9A 1CR1A 1U99A 4LKRA 4M9RA 3V55A 4QEKA 1E2KA 4BVEA 2Q4BA 1Q0HA 2YN2A 3DBRB 2OO5C 2IZ5A 3R40A 4G1VA 4QOIA 1LBEA 1TA4A 1SIBE 3AGQA 1JHVA 2O5VA 4RGBA 4Q4CA 1V8ZA 5DN6A 2YHIA 4F96A 3X1JA 5HZHA 1PT5A 1Q11A 3SMQA 1NOIA 5IUJC 2D5IA 1YIDA 4EO7A 2E89A 2O1WA 2OGZA 1I10A 2J5RA 3AB3A 1RAEA 1XYGA 2VPZA 3DZBA 1SQ0A 4LDQA 4RMIA 2DYKA 3PXXA 4DYVA 2Y1LA 1XTQA 4H15A 1C41A 3LOPA 2WF8A 4RZIA 4ZVRA 1ORVA 4LPKA 4QFMA 2HSJA 4GPAA 3BJEA 3ILXA 4F9TA 2Q6LA 3L18A 3F6PA 3WL8A 2PX3A 1JJAA 5JLJA 1EG7A 3WLAA 4AJ1A 3GLGE 1OB5A 4YCSA 3TZHA 1QYWA 821PA 4XE5A 3ZHYA 5JWOA 1UXIA 1WHTA 2PX2A 2DFKB 1NE2A 1R0KA 1XTIA 5BW4A 2XX3A 4ZVLA 2FTKE 4EELA 3TJMA 4OQEA 4DCMA 2QTAA 1JDVA 1XP5A 3O91A 4TT8A 4PBSA 5A1JA 2GEVA 1YK0A 4GO1A 1TMYA 2XHEA 1A9XB 3NHPA 3ICOA 5BURA 1W0JD 1C4XA 1R0RE 4HFJA 3I9V6 1LZLA 2VAXA 2ZR0A 2XZPA 3A4NA 3ZKWA 4QJ4A 1R9JA 3AI7A 4CG1A 3UQYS 4D74A 2BM1A 4ZAVA 1QFYA 4KZPA 1CKEA 1KVRA 4M0DA 2HYDA 4D99A 4X95A 2YBEA 2L19A 3ABRB 1XF9A 5EGNA 2ZJAA 3SQDA 1A9RA 1GFIA 1NI5A 3UK6A 1DAKA 3V00A 1PR5A 2TMYA 1ISJA 2RGBA 4BMSA 4X62B 1GCGA 3KAPA 1NW4A 1L4BA 1Z29A 2VP3A 4AO8A 1XFAA 3J81A 3ETNA 2BAGA 3M6LA 2PM8A 4O6VA 3ZD6A 3EPHA 5IBCA 4NKRA 1GRCA 3I2YX 4HYTA 1OLSB 1USUA 2R6ZA 4Q18A 5EKXA 2FSHA 4DCPA 1GNTA 5CJPA 5EN4A 5ADHA 1E18A 4TM8A 4Y2YA 1XA3A 4LV5B 4HB0A 4CL0A 1NVKA 4QRDA 2H5IA 4H16A 4XJXA 3AVWA 2O6HA 1DKQA 2WMYA 2Z2ZA 3EB9A 3KJNA 2Z3VA 3PR3A 5D1NA 1LDEA 2BCGY 4YAJA 3ZWQA 1NT4A 1SBQA 3ZLVA 1E2NA 2WMNB 3HR4A 3UT5B 1H1LA 1PJBA 1QOQB 2QU8A 1R3DA 2ZXFA 3BXHA 3KT6A 3O2SB 3C1UA 3E9DA 2JFQA 2UUBB 3DZKA 4RETA 4MR9B 1BVUA 2WVGA 3SICE 2P11A 3TPCA 1BG6A 2CSUA 1VI2A 3PI7A 4IMIB 1R1DA 1W1WA 2JCVA 1M2WA 4DJDC 2YOHA 3TW8A 5E0OA 3O83A 4BFTA 3FPGA 3PUZA 1ZBDA 1ADFA 3NBQA 5IYZF 4IIYA 1E8NA 5F5XA 3LCMA 5A7FA 2OCAA 4F1JA 1ELOA 4N5MA 1YJBA 4CLOB 5K3OA 5BV8A 4UULA 2XOKD 5KC9A 1LRKA 3ADBA 3A25A 4D46A 4MIOA 1OU4A 1P77A 4MGKR 3E7DA 1G8PA 1AV7A 3U60B 3LQKA 1CUDA 2F1KA 3E61A 3PGMA 4B4VA 1WV1A 2V7WA 2DPMA 2FN9A 4WZAE 4A92A 1KSFX 4QOGA 1E7MA 3ZCVA 1WIWA 5E4YA 1X7XA 3TQSA 5EXPA 3AHCA 1L5HA 3W2TA 2XZTA 5IU6A 2V1XA 3A6DA 1J9ZA 3Q3VA 4R7GA 3QLVC 1KERA 1WU7A 2ARKA 3D2LA 4UTZA 3U3OA 2GILA 3PRYA 4LBYA 3E2IA 1LLDA 2XUHA 4LHVA 4LJ6A 4Z9BA 2A0KA 4ZCPA 1T0HB 3PA8A 3KJIA 1US8B 2HO5A 1DJOA 1JQBA 1R27A 2G1UA 2W0MA 3AL3A 1KAOA 3IQGX 4Z3DA 3ZIAA 3LUBA 4JBHA 2IDJA 3LWDA 5A6SA 4EJ6A 4CKCB 1D9ZA 1G5TA 1A96A 1P8AA 1ZIXA 2CLOB 2Z9BA 3GJ6A 1B6TA 4UCXA 5HCUA 2PYDA 1E3TA 3L8EA 4LQCA 2VYCA 1S8AA 3D3KA 5HKBA 2BMAA 1RTTA 2XCIA 3HGTA 2P9JA 5ALUA 1KSHA 4L51A 3LVRE 2CD7A 4W5HA 3D5TA 3GYBA 3QE9Y 4FR2A 4B4DA 3EW9A 4MVYA 2DT5A 1VBMA 1ZIDA 1IM8A 2BVNA 2DWUA 3HCNA 3DEKA 1L9KA 3HYCA 1EP9A 2YNMA 3THYB 2F62A 5DYWA 2BUCA 4RPHA 3TDMA 2ZG6A 3MC1A 5B1IA 1USKA 2GZSA 4UM9B 4FYIA 3E5HA 3A10A 4IV5A 1N34B 1UBRS 1NVVR 2A88A 1RQGA 4CF3A 2IBSA 2G9QA 5EZYB 3IHLA 4R5HA 4MYRA 4BVBA 3D2AA 4QBIA 3SXJA 4LNHA 1KAMA 1VKZA 3GQBB 4ND2A 1XZEA 3ICPA 3P19A 3KPYA 3R5JA 4G65A 4Y0VA 1EXWA 5CK4A 4ZO8A 4RSGA 4XGNA 4CFSA 1ZSNA 2VHUA 1LUAA 4KH1A 5EIBC 1Z4MA 5JSZB 4Q9DA 4RXMA 4K05A 4Z4EA 4U2EA 3KG2A 3EFHA 1K8RA 3ESRA 3ZLTA 2IY8A 3RC3A 4C0SA 2EXXA 4Q7QA 1PJLA 2FPSA 3PCXA 1W9MA 3Q7RA 4R51A 4QG3A 2FZVA 2KW5A 4DRYA 1GNVA 2MR5A 3OZBA 2Y1KA 5LNK1 2EQ5A 2FQQA 4BATA 5KHLB 1AB5A 2IYSA 1ESDA 1XRSB 3ZCUA 3NNNA 4ABTA 3QXHA 2AQIA 3THOA 5JNLA 1OXTA 3GDGA 4P0PB 3IURA 3RUFA 5K6AC 3IOCA 3KUUA 1AKWA 2PEYA 3V9AA 4TWRA 2YXNA 4N4AA 3SXUB 1I6LA 1HKUA 1I7QB 4HDOB 4P3NA 3ZZNA 5TE9A 5EEHA 5KOJA 1A88A 1RKBA 1NNSA 1GTJ1 5TPWA 4RD1A 3LYUA 4ZTBA 5KSYA 3GNTA 3ZWVA 1E59A 3ABZA 3H5OA 1NFRA 3M82A 5A3JA 3L4JA 2NM0A 3MK31 2AUMA 1KMMA 4LOAA 1CUFA 2X2OA 1MRSA 1O08A 2OV1A 5DW0A 1Y5NA 2VZEA 1XTVA 3JU3A 4LDAA 7ABPA 2O8FB 4KMOA 4DLXA 3MHPA 1DIBA 2YZGA 4PAWA 1C9JA 1YL6A 2JI8A 1EEHA 4W63A 4J0QA 2CUNA 1FA9A 1ONSA 4HLUC 3DC7A 4ALMA 4DBVO 4IVRA 2R00A 1K7EB 5GTDA 3OFNA 1QE5A 1ZH6A 5C1DA 2VOEA 3MJVA 1QVZA 3NWBA 1IN1A 5IEBA 1C1HA 1V35A 3W2HA 1LVHA 1CZLA 2RHCA 3RTDA 5FBHA 1M34B 3BTVA 4KDFA 1P4SA 3A8TA 3AP2A 1C9KA 2Q2VA 1RABA 3NTOA 4FYVA 3W5DA 4S24A 4K6CA 5K6RA 3E0QA 1PAUA 4QLOA 4L8GA 1C3LA 1SUPA 1Q6YA 4QXQA 1N7IA 1BMFA 4NQRA 4PYJA 2EWMA 3FBGA 5M5BA 1E20A 1UPTA 1V1RA 3HU2A 4UM9D 1X2BA 3KQUA 4WBSA 4BVJA 4LKOA 1JDPA 1WVGA 2YY6A 2JHPA 4DHEA 3ZXXA 3BZUA 3IE1A 3F8SA 2ZUTA 2JLXA 1XNJA 2PL9A 4NG4A 2GRUA 4YP1A 2VQ6A 5EFOA 3LHFA 1ID1A 2JVKA 2DJIA 2H16A 2C7VA 4CPDA 4QOSA 4YROA 1FU4A 5G0TA 5AW2A 1R2QA 3IMGA 1XU7A 3OLVA 2VH1A 3RF7A 4ENQA 3EEOA 3WB0A 4D9IA 3WMFA 1QFZA 3QKTA 3UF0A 4JKOA 4IIFA 3CSDA 2ZYSA 4IZ6A 4D0SA 1KMHA 4QQKA 3CO0S 3C5HA 4TL6A 5H8WA 4M1OA 4EIWA 4BQNA 5E7MA 3FTQA 1YZTA 3CLVA 4GR5A 4WEQA 5IZCC 1SCUB 3D3WA 4ENVA 1HURA 3BD9A 4RIGA 1O7JA 1YB6A 3JAKA 3UHAA 2OUIA 3U80A 1E5XA 4CV3A 3LYLA 1E64A 1G41A 3OFSA 2KBFA 4Q7KA 1OLXA 5DN9A 1IK4A 4HDQB 5HIKA 1C7EA 4LGVA 3SHWA 1XCMA 2HB6A 5KEIA 2CDAA 4WNAB 3OT5A 4NJOA 4WESA 3RBXA 3D6UA 1RYHA 1EWRA 3NUGA 4PZEA 5MHTA 2F8TA 1JHAA 3ZDBA 1ORDA 2AOUB 4EY6A 1D1SA 1LB1B 1JTVA 3HNPA 2FRDA 1K6MA 5JECA 1IE3A 2WF9A 2YJ5A 3B2QA 3BWXA 4IEIA 4QT4A 2XGJA 2BGGA 1C9EA 2AV6A 4ZHSA 3JRNA 3KQNA 4FP9A 2Q8NA 1B0AA 4NCXA 1MJHA 4YWJA 2VNIA 2I7TA 3AJAA 2WJ6A 1O5IA 1RCUA 3LAWA 1C7ZA 1QLJA 3PB3A 3K9BA 4MV9A 4ZMSA 4IJQA 3V1LA 4EYSA 4S05A 1P3JA 1P0MA 1OFHA 1XXLA 2JGMA 1N1GA 2WAYA 3PV0A 4BB0A 4BKOA 4WXEA 3U13A 3QI2A 3WL4A 1JHYA 5DNVA 2H4WA 3NTLA 5IKMA 2YN4A 3I45A 1T9BA 3TW0A 3DO5A 2APJA 4M8LA 3WRWA 3CZAA 3T4UA 3PJGA 1JTEA 2AK2A 3JVUA 4YA6A 2HA6A 3G6KA 4BO5A 3JD3A 1KYIA 1MVLA 1L1QA 3F46A 5DDIP 5JAOA 3PRKE 3O0TA 4KZKA 3TOZA 3BJMA 4ZJPA 3PEVA 4HNGA 4LFAB 2P9HA 4O08A 4DEVA 5CDGA 1X1CA 3U3JA 4LTNA 4Y6GB 1EIWA 3IT3A 2J7PA 5TLSA 1VSBA 2XVZA 4DUGA 1MPTA 2Q9BA 3L6DA 1I1QB 1QYXA 3QKRB 4OYLA 5EHXA 1C80A 3OO1A 1APBA 3UJ6A 2G8NA 1C1DB 3QW4B 5EJGA 2HBZA 1E3WB 3AIIA 4BO1A 4G5XA 3D5EA 1BHO1 3H5LA 5FWYB 5I4BA 2QB5A 1FLAA 4PSUA 1ODIA 1GZSA 4FJ1A 4Z4FA 2ATCA 3F78A 3I39X 1O2DA 2Y99A 3LBYA 3LT2A 3Q6MA 4PQYA 3NHUA 2HK8A 4Q9NA 1LNZA 2RGYA 3G1TA 1R6AA 4TV8B 3DEYX 5FTLA 1WJGA 4XDHA 5DX8A 4BU0A 9LDBA 4ND4A 2GJKA 4C4RA 2OHGA 1KK2A 1JIJA 3PKZA 4EENA 1A2QA 1QQTA 3RH0A 3OD5A 2YOFA 4KE8A 4QPPA 4HF7A 2KM1A 2X9NA 3DHWC 4DLAA 1PE0A 2XRMA 4LJRA 3MLBA 3BXOA 4RKFA 2ISSD 1CDEA 2OGSA 3RC2A 1Q17A 1NKTA 2CJPA 5LQMA 2NO0A 5TGTA 1N2ZA 4EW2A 1ULZA 5KJEA 4YT8A 2ZRBA 3IQIX 3DMDA 3CRVA 3DZGA 5A4IS 5EJ4A 2Q5LA 3IP8A 4E4RA 3S7ZA 2UUPA 3EEYA 3ZE0B 1FNMA 4Z4HA 6ADHA 1NC1A 3RNLA 3BB4A 3DM5A 3I0NA 2YQZA 3I6QA 5ABPA 1FB5A 4YWHA 1C3VA 1S8FA 3UCFA 4U8GA 4DLVA 2R6GA 5I9LA 4I9FA 2AYYA 4OBWA 4PC2A 5CNIA 3PDHA 4G84A 4RUKA 4NXMB 2ANBA 5ENDA 3DHEA 4BWGA 1TM2A 4NESA 1E7YA 5JNSA 4B3XA 3L4EA 2NUBA 4FBGA 3NG1A 2IOFA 2N75A 4FFMA 4MZDA 1XDBA 1A4XA 1N8KA 1ZN7A 3EVZA 1CY1A 4G0YA 4OIMA 4OYYA 1VXRA 1WY5A 1I01A 1PJRA 2YIJA 3BIFA 4NJEA 4S1VA 4AZVA 1E9VA 1SU4A 4XCXA 4TS4A 1NF3A 3BA1A 3UJAA 1LJUA 4Q4LA 4RSRA 1NLYA 2V7QA 3S55A 1NBEA 1PL8A 1MIOA 3R9KA 3L8ZA 1XMIA 2EW2A 3BS4A 4TKVB 4MPJA 3S44A 2ICAA 5K8LA 3D9QX 1PR4A 1DAEA 3VRHA 3U3XA 2C2OA 2PKYX 4GKAA 5DCYA 3WV5A 4NBTA 3WJ7A 4DWOA 4Z7NB 3DTYA 3M5CA 3PHCA 4I5GA 4TVOA 1CZHA 2Y0PA 1QSGA 4JZKA 8GPBA 3OMXA 4RWZA 5DNUA 3DWGA 2LCQA 2PX6A 3H2SA 2OWEA 3SQXA 3L4BA 1A8IA 4YFVA 2FZEA 4GZLA 5ARCA 5FXMA 3OF2A 4RMJA 5JPDA 1T9AA 4YX9A 2O7QA 3ESYA 3D8UA 1O8BA 1R50A 3C3EA 3KSRA 1CS0B 4PLZA 1ZHHA 1JEOA 4UATA 5JT1A 3GLUA 4L22A 4ER6A 1ZM2A 1VMIA 2WTUA 4MQFB 5P8WA 4MS4B 4R1UA 2GCOA 5CCEA 2FOLA 4JVLA 4UBOA 5L3VA 1A4RA 1N8SA 5J2TA 4DB2A 1HUQA 4BKPA 5CW1A 5I5GA 2P4QA 5K8VA 1IBMB 2D2VA 2BD0A 1ONOA 1YUMA 4HH0A 4JVSB 5CX1A 4FEEA 1BXGB 3MJRA 5B37A 2PGIA 3T0IA 3B1ZA 1AZSC 2HDWA 4L6CA 3VYWA 4DBLE 5TF4A 4MQLA 1R9GA 3ZG6A 5K1ZA 2H7XA 3RYHB 2REQA 4U7GA 4ZCMA 5K3CA 1L0BA 3EG5A 3EIFA 4GMHA 3ROQA 1ISMA 1DIOB 3NGLA 3T61A 3PQEA 1IDN1 4C7BA 2JVIA 2QRUA 3K2EA 3MWEB 4P9NA 1SUFA 3RIXA 4AZWA 5JXJA 2WSSA 3DQZA 3HE3A 5CLGA 1WETA 3THRA 3FCSB