1QDLB

The crystal structure of anthranilate synthase from sulfolobus solfataricus
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
195
structure length
195
Chain Sequence
MDLTLIIDNYDSFVYNIAQIVGELGSYPIVIRNDEISIKGIERIDPDRLIISPGPGTPEKREDIGVSLDVIKYLGKRTPILGVCLGHQAIGYAFGAKIRRARKVFHGKISNIILVNNSPLSLYYGIAKEFKATRYHSLVVDEVHRPLIVDAISAEDNEIMAIHHEEYPIYGVQFHPESVGTSLGYKILYNFLNRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of anthranilate synthase from Sulfolobus solfataricus: functional implications.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Lyase
molecule keywords PROTEIN (ANTHRANILATE SYNTHASE (TRPE-SUBUNIT))
total genus 54
structure length 195
sequence length 195
ec nomenclature ec 4.1.3.27: Anthranilate synthase.
pdb deposition date 1999-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00117 GATase Glutamine amidotransferase class-I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qdlB00
4P2GA 4HCJA 5JZOA 4UOZA 1QWSA 1GGFA 2H2WA 4P34A 4E5VA 3L18A 4AULA 4P36A 1VCNA 2YWCA 4I4NA 1T3TA 4ENRA 2R1TB 5DFAA 5SYAA 2D7JA 5K4AA 3SOZA 3TTXA 1J42A 1KWKA 1GPMA 4N12A 4XLLA 4ENPA 2AB0A 2AD5A 3EZGA 4MNTA 4GE3A 2R1UA 4UOQA 3R76A 3TTWA 3PQ8A 2NV0A 2GHRA 2RK6A 1A9XB 5E9AA 4S0ZA 3TTYA 4B2YA 4ZDJA 1I7SB 3D54D 1CF9A 1I1QB 3SF8A 3P9SA 1IZZA 4MGHA 1GGKA 1IZYA 3NOOA 3OT1A 4BIMA 3NOVA 2ZUSA 4Y1GA 2YWDA 1P80A 1GGJA 4LRUA 4L7QA 1C30B 3WFZA 4Y1RA 3B36A 3ER6A 4L8FA 1CS0B 1PDVA 1CE8B 1BXRB 4I46A 1KXJA 2ZUWA 3NONA 4D1YA 4L8WB 1Q2UA 1K9VF 2R1TA 4OFWA 3TTUA 3SF8B 1KEEB 3F5DA 2VKTA 1IPHA 2ZUUA 1QF7A 1R9GA 4L8YA 3UOWA 1P81A 1OX6A 4OIFA 3ZJ4A 3L3BA 4OQ4A 4MTCA 4UCFA 3R74A 3NVAA 4ZGGA 3NOQA 3GRAA 1UCFA 4I2NA 1QVWA 2GK3A 3PQ3A 3UK7A 3FIJA 4OJYA 4B40A 3TQIA 3RHTA 2VRNA 2ZUTA 1VCMA 2XF2A 4AJ9A 2IUFA 4ADSG 3UJNA 1FYEA 1SOAA 4R7GA 4E08A 4JQSA 4B5KA 1S1MA 3BHNA 2V4UA 4UZSA 3NORA 4AUMA 4ENUA 3B3AA 2OR3A 2R1VB 3EWNA 4PXYA 2A9VA 2NV2B 4AUEA 2FEXA 3CNEA 4RKWA 2WJZB 4ZDKA 5LIRA 1KWGA 3KKLA 1WL8A 4OGGA 1OX4A 4RKYA 4ENSA 3UMMA 4K2HA 2RK3A 1PE0A 4GUDA 1GGEA 1QVZA 1PDWA 4ENWA 1C3OB 1QDLB 5SY6A 3FSEA 4BFLA 3N7TA 4Y1EA 3UGJA 3PQ2A 4WINA 2VXOA 1G2IA 2ISSD 4GE0A 3EJ6A 3ZR4B 1QVVA 2VPIA 3P9QA 1FY2A 3F71A 3P9RA 4Y0NA 3EN0A 3TTVA 1SY7A 2R1VA 4Y1FA 2LXNA 4WXYB 4P5PA 4ENVA 3VU3A 4AUNA 1VCOA 4L78A 1JDBC 1T36B 2YWJA 5SY9A 4ZDIA 3PQ4A 3R75A 4N0MA 4L95C 4QYXA 4ENQA 2W7TA 1GPWB 1P7ZA 3BWEA 1PV2A 4OGFA 1I7QB 1P7YA 4LGYA 2RK4A 1M6VB 4B31A 1O1YA 3CYFA 3L7NA 4UNIA 3MIIA 4QYTA 3MGKA 1ONSA 2ABWA 3TTTA 5JZMA 3PQ6A 1JVNA 4BTEA 3TTSA 5IP5A 3PQ7A 1GG9A 5BV2P 3PQ5A 2VDJA 1OX5A 3CZ9A 3L4EA 5SY4A 1N57A 1Q7RA 3CY6A 3ZJ5A 4B7AA 1OI4A 4ENTA 2ZUVA 3CZAA 3EFEA 1GGHA 3B38A 3M3PA 3P9PA 1P5FA 2YWBA 1L9XA 1U9CA 1KA9H 1VHQA 3OT1B 1T0BA 1OX4B 4P35A 1OY1A 4Y1RB
chains in the Genus database with same CATH superfamily
3GN1A 3ORHA 2FW0A 4AIRA 1CX9B 3EZXA 5L6LB 1OE0A 4CLOA 3AVUA 1N2IA 1WBDA 2AG0A 3NUZA 2PMFA 1BS1A 2G1UA 4ZV4A 4CN8A 1UIRA 2FMXA 2JDIA 2I2BA 2A5JA 2AEJA 2PT9A 4TROA 5T4BA 4CI9A 4Z7QB 5FWNA 2H7CA 4K1LA 4EH1A 4F3YA 3CEPB 3H5RA 2ZWPA 4MNTA 4KXWA 3ZV4A 4QXMA 4RXUA 1ULTA 4G0WA 5DSZA 1EUZA 3UCXA 3WE7A 5F3DA 4ZO7A 3SC3A 1QMPA 3T94A 3NYQA 1ESZA 2O06A 2QTCA 3EQ9A 2FFJA 4PYMA 2PDAA 2BBWA 2XRZA 1JWLA 2A0XA 1ISGA 4JJEA 3OHPA 4II2A 1O8CA 3CLRC 3O73A 3TIFA 4JLWA 1RWBA 4NMMA 5EMKA 4ZGBA 1RYMA 5B3AA 1Z9BA 2J3DA 1NATA 1W36D 2DBZA 2PT7A 2QLFA 1XV5A 1P31A 1HT3A 4WCFB 1LJ8A 2H16A 3QUSA 4IXDA 3MXOA 1AGXA 4FBMA 4IOKA 3AZQA 4XX0A 1XNQB 3GJ5A 4JP1A 2PWZA 2F9MA 1RKXA 1UXIA 4R1PA 3IOCA 5A0FA 1V7PC 3LMKA 1NV9A 3OUTA 3WYNA 1YF3A 3TW4A 4KACA 3NOQA 1OYOA 1QLJA 2PLWA 4H6XA 4ZT7A 3DWGA 2MWMA 3TLAA 3O82A 5IYZA 2HT6A 1YBFA 3EZYA 1V5FA 4U8GA 3KSRA 1DZ3A 4PG6A 2ZSKA 1ZW1A 4G8DA 1CRQA 5F2KA 4Q00A 2PRYA 4Q1VA 2G04A 4D3XA 4IXWA 4PSCA 3TB4A 3I01M 4P22A 1SUEA 3AB8A 3NHBA 4IDAA 4MARA 2I2XB 5DZSA 1BYIA 1VKOA 3AEXA 1A9SA 4Q1AA 4BQEA 4UCXA 3K0SA 4CTNA 2ILVA 4L0CA 5F9HA 5CB6A 4RPCA 5AP9A 4QEZA 4PG4A 4QBKA 4GUAA 5K8UA 2OE2A 3E81A 3PSAA 3U4QA 1HT1E 2PG3A 2Z1NA 1EUCA 1K8RA 3QKUA 4QQKA 2YV2A 4QBIA 2ACWA 3NJRA 4WLFA 5GJWC 1DNPA 2VHUA 4GW3A 3S2YA 1KP3A 4I4TB 1KRWA 2YZ2A 3NNNA 1RM3A 2XUQA 3QYAA 1ZNQO 2VEDA 2QEQA 2ZR0A 1G98A 3BYZA 3SIXA 2YV5A 5BW5A 4DM3A 4RPGA 4WGGA 3RVNA 2SBTA 3FROA 1AXEA 2PSHA 1IJKA 4GHWA 4YCCA 2G80A 2QL5A 3MGGA 4LMPA 4NEHB 4ZD6A 4CL3A 3GJ3A 1U8ZA 1SIBE 5TPZD 3EB9A 1K92A 2VR1A 4FFNA 2ORIA 2I7VA 2DPLA 2X4LA 2M6KA 3HA3A 4YAUA 1QJ4A 4WZAA 2CLFB 5HFJA 4A0GA 4G0VA 3AI1A 4EJSC 2EFCB 1SUPA 2HGSA 2ZBGA 3LYUA 5H4HA 4HJRA 1SHUX 1UL1X 2JFHA 4LTDA 1CVIA 1Z73A 3BH0A 4P6VF 5WRFA 4DLTA 4ZEVA 1DBWA 5JY6A 4KLZA 3QLJA 3LA8A 2P4EA 1BQ3A 1MO4A 3WKEA 1UC9A 1MX3A 5AVTA 3K9FC 2D8MA 1ZHOA 5K3BA 5CFPA 4QLOA 2QX9A 5HQ3A 3JQEA 2O5RA 2XOKA 2FLWA 4M9CA 5ER9A 3S2GA 2GVZC 4BJ1A 3CR3C 2O6LA 3THXB 2D7JA 1DRVA 1WKVA 3IQWA 1KPHA 2AIRA 2IHBA 3QPUA 5D3QA 3I32A 5CA1F 3UJCA 1WKCA 4MDEA 3AHCA 3EVEA 3NBQA 1Y5RA 4X1YB 2OAP1 1BMTA 1PP4A 3ZYCA 4B73A 1EVJA 3CIOA 3BH6A 4E5UA 3D3KA 1I0IA 5FLXA 3SQWA 1IY1A 1NRJB 2XIQA 3HZOA 5BPFA 2PTGA 3FWZA 2AMVA 3SBXA 1A88A 3CWQA 3RRBA 2VTEA 2WUWE 3D9QX 4P93A 5DGDA 2X5XA 5I4IA 3UAOA 2GESA 1UBLS 2GA9A 3NIDB 1CQIB 2Z04A 3UFBA 1SWVA 4BBPA 2DFKB 2X15A 5CYGA 4OO3A 5KYNA 1R9NA 3MA0A 5G41A 3U4MA 5AQEA 1M5TA 4G86A 4HAZA 1Z8DA 2BEVB 4WOCA 5L3SA 1BDHA 4YV7A 2GZRA 4B6QA 1VLHA 2VQDA 3O8QB 5KWJA 1Z0UA 3EIHA 2ZRHA 3UTCA 3TIIA 1GPYA 2J0UB 1GO2A 3R74A 4YMUA 3NEAA 5F2NA 3DB1A 3ABSB 2H06A 4BO0A 4EHKA 3UVEA 4IZIA 4X90A 2I4TA 1PYGA 4MR8B 2FQYA 2ZI3A 2EX1A 4HBZA 4AMVA 1JDNA 3ERCA 3QYJA 1PJ3A 3TW6A 5IJAA 2EGGA 1UJ5A 4ZDKA 2YXNA 1GNLA 5EY5B 4BRUA 2JVIA 5CDFA 1H22A 4UJ3A 1NFFA 3QW4B 2WHQA 3FHCB 3I12A 1A8UA 2W83A 3JCZA 1EE9A 1ZRMA 5CLLA 3E3NA 4BFUA 3E27A 4RKEA 4YMTA 4YHHB 1FC0A 2Q1XA 3JVIA 4JB3A 2C9DA 3SZRA 1DFHA 1P61B 1PDOA 4Q3BA 4Y1FA 4L5IA 4ZCIA 5IBPA 1MB3A 1JXMA 1VSBA 2B1RA 1OAAA 2B83A 3EXIB 3NG1A 4DQXA 1Y48E 3M7IA 2FZKA 3VH2A 2IC5A 1D4AA 1FEZA 2O52A 2RGYA 4YUYA 1N7JA 3DZCA 1JEQA 2PIAA 3BWEA 1P1IA 1VFNA 1GPDG 3MGCA 3S5JA 4XM2A 3W6UA 4F7WA 4F71A 2CV2A 3DYIA 1Q57A 2ZBEA 5M3BA 2HD4A 2GT1A 3LUKA 4EBBA 3NGXA 1JAHA 1Q6YA 5B55A 4P0QB 1NF2A 3GP3A 1N6IA 2FJ0A 4DHWA 2DM6A 2D2XA 2NU6A 4MP8A 5FUBA 4QVIA 1PRYA 1Y1KE 2KLHA 2PX3A 4HRXA 1S8OA 5DIFA 3G0HA 2OA0A 3GGGA 1X7XB 4YJHA 3L82B 1O6ZA 3BMOB 1JR3A 5CDGA 5IUJC 2NUTA 3SM3A 4W5NA 2HYIC 1WHTB 2HJHA 4CCAA 5K09A 1X38A 2REQB 1Y4UA 3KTFA 1U98A 3TRKA 5KYYA 1E96A 2QL7A 3MLBA 3SHWA 2PYIA 4DF3A 2OC9A 1G9SA 3DMTC 1XL1A 2BFDA 4MQBA 5BN3A 3RQIA 4HQFA 1AVTA 1XKTA 1I4WA 1XRQA 1PZNA 1E6WA 3UHJA 3LPLA 5DT9A 3W5JA 3M1IA 3IT2A 4KQ9A 5IHPA 2YZ7A 2HEIA 5CH5A 4C0XA 3GGJA 5J63A 4PF1A 3R5JA 2GILA 3MTAA 4JVOA 4C29A 2NMVA 4MIOA 5A4MS 2R6CA 3AESA 3DEAA 3TLZA 2A7XA 3N70A 5AW1A 5IVPA 2O7SA 2HADA 1IWOA 1SXJC 1E66A 3LBIA 3LPNA 4MIKA 5IBQA 4YR9A 2AR0A 3RYFB 2FG5A 3VHXB 4BO8A 1IEXA 2VH1A 2YC2C 5AXDA 2I2CA 3ICPA 1XZIA 2QRKA 2VQFB 3RAEC 2HPAA 3HYLA 1EP3B 1NVBA 1TYEB 2FP3A 2HCFA 3HFSA 4N6GA 4NS4A 5ALHA 1EX9A 1VKZA 4EZBA 1H94A 2OV4A 2N9UA 4S1OA 1E18A 1NJ6A 3S1SA 3ZE9A 2OCKA 4TVBA 1GYQA 1TUGA 2F2TA 4Y6LA 4CCYB 4KODA 3O7WA 4YO7A 2I8LA 2JH8A 4K9NA 2XOXA 1PWHA 1TF7A 4H18A 2F1HA 3GRAA 5IDVA 1E9RA 1KMCA 1DHTA 2JRLA 3RSQA 1ISHA 4CT5A 2SKDA 4HMPA 4DCUA 1ORDA 1FMLA 2FSUA 5EHGA 3AR6A 4EJMA 3CV3A 5M2QA 2JGAA 1L7AA 4EJSB 1NN3A 2AZTA 3QU2A 4HH4A 4KXMA 3QPBA 4J0DA 1SK9A 2HU5A 4ZXPA 1FTWA 2V55B 3IPRA 1WZIA 1JECA 2J48A 4L8LA 4MIEA 4OGLA 1LVUA 4QJBA 4WFQA 3RJZA 1FYFA 1O58A 3IMFA 4E1AA 3B1WA 4LBWA 3QLVC 1T0IA 1XXLA 1CJKC 2XNSA 4B82A 4ZKEA 3OQIB 4OHCA 4D25A 1R0YA 1BDJA 1QDLB 2G77B 3TO5A 2YKGA 4XCQA 3OLWA 3R09A 4G5FA 4D9KA 4E09A 2XCIA 1O03A 1M1YA 3PFWO 4FYWA 2AI3A 4MW1A 2CLEB 4DKJA 3A6KA 4OK5A 1AZTA 3FOWA 5L40A 4N0QA 2X22A 2O2CA 3NVMB 4JQOA 1ZD5A 5CCDA 3ZV7A 5C4MA 3A3YA 3TVYA 3RO7A 2XR1A 1PUJA 2QLMA 1AHIA 4DSUA 3U7QA 5EP4A 2QN2A 3DFIA 4BRZA 3K0HA 5LC1A 3TLJA 4ENQA 1T34A 1K27A 4M9RA 4HV4A 2ZSHA 3KR9A 1IEWA 4OQZA 4IO1A 6ABPA 5BQPA 3DQQA 2R62A 1OH8A 1TD9A 3N2YA 1FS4A 3VOSA 3QQ5A 1JP7A 3V00A 2I6UA 4JLAA 3V4OA 4O08A 1IZ0A 2FOLA 2IBTA 1ZOLA 3WISA 1QQAA 4L0DA 4NAUA 4LRYA 3FR7A 1NXTA 5BN4A 5HCUA 5C7IO 4BZXA 1E9AA 2H1OA 3K70B 1H1TA 3B5EA 3CSSA 3AR2A 1E6MA 3F78A 1EB9A 2EATA 1I80A 2Q50A 3ABIA 2C5SA 4S1PA 2QZ9A 2B99A 1O9BA 2JC3A 1H5NA 3ZK8A 3HEMA 2A1IA 1M1NB 2YJNA 3R3JA 5T67A 3W2GA 4P4GA 5ALOA 4M1KA 4DIDA 4YRBA 3S7TA 5D1NA 3JASB 2QVYX 2WTNA 4IP0A 1SXJA 4LSMA 3I0NA 4F9GA 3TTWA 2R5NA 4QRIA 3OJEA 1BRMA 1F8XA 2EXXA 3BF8A 3DTTA 5ESXA 1JEJA 3SE0A 4EMBA 4H7IA 1EIWA 2W2XA 2BM0A 1TM1E 2ZU6A 4GVXA 4G01B 5CJ2A 1KIAA 2XD9A 1XG5A 2F1JA 2VAXA 2Q99A 4AJIA 1MNQA 3RSLA 4NPCA 5TV2A 1XYVA 2W6JD 4YJ2A 4G4IA 2QN3A 3LCJA 3OVMA 5G1PA 1KJ8A 5JSHA 1L4YA 4L7QA 4WNAA 3FFXA 1IDN1 3ZPXA 3K4HA 4MGZR 1E64A 5AIAA 1MDFA 3SC2B 1NQ5A 3D7KA 3WHLA 2AKEA 1E61A 4ALKA 4BGEA 2WHYA 3R0JA 1IHUA 1PDVA 3A10A 4I1VA 1DXQA 4XH9B 4XIJA 1XDGA 2J5XA 3PFCA 2W2LA 5K05A 1NQOA 2V6JA 1FXWF 2WMYA 2X4IA 3AP2A 4I9GA 1VSTA 4QUGA 5FNZA 3LWBA 4Y2JA 4MQEB 1HZZA 1NP7A 4KPUB 4DZRA 3OSZA 5JFOA 4MVWA 2WAXA 1U2GA 2WPDD 4JOSA 4LOHA 4D43A 1GN9A 1FP4B 3VR4A 3IP5A 4XGIA 3VKUA 3G2QA 3KLPX 5DOVA 4CLEA 4PSVA 1C8LA 3VU9B 4JUAA 3RFXA 4YLEA 4A9AA 3LYLA 3WC4A 4UTOA 5FDFA 4L4SA 1W76A 1QANA 5FV7A 2P7IA 2EWVA 4JQSA 1X7ZA 5EG5A 2V4UA 1XEWY 1UFRA 4PLCA 4C7VA 3IIIA 3F7OA 4IF4A 4YXWD 2FPGB 2ZCVA 1R88A 2B61A 4RJIA 4DC9A 1DJNA 4IHJA 4KMSA 3FNHA 2CL6X 4UUBA 4WK2B 1ZK2A 4ZCPA 3KKLA 3V1NA 3VFDA 1NW5A 2VYNA 3MPOA 1ESMA 3OETA 3PKIA 2BF7A 4EUKA 3PC3A 3OQ6A 2QJWA 4PIVA 1TM7E 3AHHA 4EPRA 3BWBA 1SN7A 3RSSA 5IF3A 1DO2A 1F5NA 1UC4B 3MQFA 3F73A 4UULA 4MWTA 1AQ6A 3GJRA 2CVFA 4IBOA 1QV6A 2SKCA 2RI0A 1J5EB 2DFLA 2Y0PA 3G2NA 4N7MA 4CTKA 1Q7BA 5TY0A 3MTDA 3ROZA 1QRDA 1II8A 3G1UA 5BSHA 1PTJC 1RJEA 2CDBA 3AEKA 2CFIA 3EIXA 3WL5A 2NTNA 4L07A 5DHAA 3R75A 2X7JA 3RFUA 4YJ2B 1VGRA 2GPWA 1OXSC 4IVNA 2O8BB 1PSWA 3N7AA 3GAMA 3TOVA 2BE7A 2JLBA 2Q4DA 3DR5A 1JSCA 1D1QA 2YV4A 3IKVA 1F0PA 1M8PA 3D6UA 4DIKA 2W2PA 4Z0TA 2J1LA 2ID7A 1AB5A 3N76A 1Q7EA 5CPBA 4YALA 3IOYA 1NU6A 4LVOA 4Q1DA 2GPBA 2PYDA 2XYHA 4TX1A 4ALJA 2QAIA 2QP3A 2Z6VA 2F1OA 2W8BA 1DE0A 1NM5A 2WU4A 4IQ4A 4YECA 1PQPA 3UWPA 2AMFA 2JCYA 2D5IA 4GZLA 4TS3A 3PYMA 1A5ZA 3WK5A 3ZZUA 4CR6A 2QSUA 4JGGA 4WCDA 4FLEA 2HZBA 4D9NA 2IBSA 1E5DA 1ORVA 1VE5A 2KB0A 4OA5A 1OF1A 1W96A 3BFKA 3HDVA 3IVCA 3LBHA 4RCZA 5BMVF 3SHQA 3QVXA 3K5IA 2AI1A 1GAWA 1HRKA 1JPJA 3PWSA 2ZJ7A 3A3KA 3SOZA 3W9UA 5JCXA 2GN8A 2VA9A 3U44A 1B6TA 1B23P 2Z98A 2CMHA 1A9TA 1ZJ5A 1Z5PA 2QTGA 1HDGO 4OEHA 3LGAA 5JWHA 3R7AA 1OIWA 1O94C 3PX2A 3R5FA 1E98A 1FFCA 4MKXA 4QYIA 1EMDA 2A0WA 2P3QA 3Q5EA 4I5IA 2GPYA 2GWHA 4TM7A 4EYSA 2Z5LA 1NFQA 1ZG3A 1ZD2P 3OJCA 4LK2A 3FDFA 3JQAD 2R25B 3STUA 2ZT6A 3OE7D 2WNHA 3ZWMA 3PVCA 2BTEA 4OQDA 1PL7A 4BIIA 1UFOA 3BD7A 2JK1A 4L5BA 2BFOA 1E2IA 1TJYA 1YKGA 2FR0A 3QZUA 4OXNA 1SPXA 1UKAA 3JQ8B 3UWKA 3GA5A 4JIGA 4ND3A 5LJIA 4OXYA 4M9UA 1U2GC 3QOFA 4EMSA 2CUZA 1ZM9A 2C20A 3EK2A 1HQKA 2Z2XA 4YMVA 4XYBA 3W8DA 4QXQA 1D9XA 4O2BA 2WIAA 3WRVA 2GHTA 3JZFA 4R8VA 1M2HA 3I5YA 1JIUA 1U31A 4BVHA 1E2DA 1OFIA 1RMQA 3HCWA 1A97A 2CLDX 2XUZA 3UATA 2FSIA 2PWAA 4FCWA 3ILHA 2EKQA 2ZBVA 1JLMA 2Z83A 2XQFA 1HSOA 3H87A 2YYZA 1JV2B 1LTQA 3GNLA 4QL3A 3IV9A 3BTVA 1L8QA 4Y2HA 1RQXA 1P4JA 1XI2A 2O2SA 3TNYA 2O8CB 1P62B 2OWEA 2A5GA 4RZ2A 4JT4A 2MYTA 1HNWB 3ZC3A 4HEJA 1C5KA 4W1SA 5T6MA 1LK5A 1A3CA 2RGNA 2X23A 1BVYF 1VMIA 1IIRA 1DUVG 1NX6A 2OTCA 1FZTA 3U3MA 4C22A 2ZWOA 3IOEA 1V8PA 4ARBA 1EGHA 1JU9A 5I9SA 1PL6A 3FZGA 1ZM4A 2BPOA 3PWTA 1UMBB 3OE1A 3G79A 3U9LA 1I7NA 1SKBA 2ILTA 2X1MA 5LQAA 4LXYA 3REGA 4D8YA 4OP1A 5I7UA 3PQCA 3I9MA 4IYJA 1ETHA 4CZ2A 1U3GA 4O3FA 4XJTA 1HYEA 2P3LA 3TAXA 2BR5A 2ODTX 4C4YA 3N0WA 3E3AA 2GEUA 3RS2A 1FFWA 3VC7A 4BDTA 4KHZA 4LV8B 4FP9A 3ST7A 2DG2A 1NSYA 4LJ4A 2GXAA 3A4YA 3GDWA 4L4RA 2AR9A 1RRPA 5DNUA 3EIUA 4UTNA 2JVKA 1SU4A 2TECE 3UUFA 4AAYA 1W59A 2FDCA 2OG2A 4D4LA 3NMUF 4XARA 1SXIA 3OOYA 4GOMD 2H18A 5GJBA 2HWUA 4KQFA 1NBOA 2ZBDA 4IOMA 3CZ5A 4IDOA 1VE6A 3D3WB 3KJFA 3FYHA 4JJ8A 3KPWA 4MUIA 4B32A 2GN1A 2ZYVX 1H65A 2R6FA 1PS0A 3RB8A 3KYCA 3R6DA 5A3VA 4AURA 2PR7A 1PJCA 3VPCA 5IT9A 1Z5UA 3K3PA 2UVDA 1IHXA 1RMTA 2J4CA 1SKYE 4NY1A 3RVRA 3RYIA 3UZUA 5FQNA 4AX4A 3AHDA 2G5TA 4JI8B 1UBTS 1N3YA 3NATA 3A6HA 3VGJA 4YRFA 1W30A 1ZJYA 3PF9A 1T29A 1EVKA 5EN4A 1A1SA 2QTMA 1LSJA 1T3TA 1UJ2A 5KCMA 1N0WA 3AF1A 4QYSA 3INNA 1F2DA 1WG8A 2VSXA 3PNLA 1WHSB 5KTOA 3BAZA 1Y6JA 3KB8A 3KDPA 4Q3NA 3DSRA 4RESA 4F5EA 5L3QB 3R0XA 1WMBA 1Y34E 3C5CA 1Z0ZA 4P92A 1EYZA 2DHRA 3OEWA 4P54A 3EGDA 1BS2A 1ODLA 2E4XA 3DNMA 3EA4A 4PAOA 3I4FA 1D7OA 2CD9A 2ZUDA 3MB8A 1Z0AA 3WBJA 1HV8A 3BPSA 3H4VA 5HJ2A 4EO7A 3NP7A 1OFGA 3LF2A 3OO0A 4RD3A 4TS1A 4YN3A 2TYSB 3DMDA 4C2UA 3T5PA 1DC7A 1KI6A 1J4AA 3SQMA 3SZLA 2GF2A 1H2BA 1FTGA 4MDYA 4Q7MB 1DG3A 2WSBA 2XGOA 4MUAA 5TF0A 1CEEA 4EG1A 1MJGM 2QRMA 2F3QA 1XDUA 2HRZA 2QYTA 3ETEA 3MXTA 1R4AA 4LHEA 4WTOA 4Y98A 5JMWA 5LB2A 3PX7A 3PQEA 3L8HA 3SEAA 1YZYA 4LDNA 1M2JA 5DLDA 1EDBA 1MBZA 2JFVA 2Q41A 5CGZA 3I2GA 3G9TA 2CW5A 3WL7A 3I5UA 2DFVA 5BVGA 1QFZA 4DQUA 4I66A 1Z6AA 2MYNA 1T4DA 2XCOA 3NVAA 4OHWA 4UE3S 4CM4B 4LV5B 4RL4A 3QELB 3LHKA 4BU1A 3TE6A 2JLRA 4KZPA 4RTJA 2X6RA 4L27A 4UM9D 2PZBA 1QX4A 3NZEA 1EFVA 1EUDB 4H7PA 3H7AA 3EGWA 2EFYA 1RTKA 2V1UA 2C5HA 2P9TA 2EDCA 4HGRA 4R3NA 3TCNA 3TOCA 3ZHBA 4Z7OB 5ITSA 3BCUA 2PBRA 4MW6A 3Q7TA 1AT1A 5A5GA 3C6ZA 1ZNXA 4G4JA 2AN1A 3MJCA 2H4JA 1PE0A 1LNZA 5KQMA 1K0FA 1JAYA 3QF4A 3EZ2A 4HS9A 4D0NA 1I8TA 1WX1A 3RTCA 1MB2A 1KI2A 2B25A 4RHUA 2WFAA 2ATIA 3ZD9A 1ND6A 3PNOA 5AKGA 3EJ6A 5ICFA 1HE8B 2PPVA 4P4LA 2C5EA 3GD7A 1YR2A 1REQB 5HUHA 4V0LA 1FQOA 2XYPA 3FFTA 5LBTA 3GDHA 2JKYA 3W9YA 1LWOA 1XGKA 4W1QA 3NV9A 4LNUA 4YRGA 1RHMA 2JEZA 3O47A 3HL0A 5JADA 5EQDA 3WGIA 2Q2OA 3CH6A 1H5UA 1RT9A 1ISJA 4WKPA 3HXTA 1JEEA 3KHUA 3UPDA 1CD5A 4MVJA 5LP6B 1ICEA 1H9BA 1SZJG 4D80A 1UBGA 4MYRA 1WMAA 3LY7A 4MI6A 4WKCA 3HGMA 4NV1A 4LFCB 3TD9A 2XIJA 5LXTB 4LDQA 1M2VB 4V1CA 2YJ5A 2IOHA 1GFSA 2CNNA 4DWWA 1FW6A 4RQTA 2AE2A 2B8NA 2P6OA 2WBLC 4Q93A 1G8PA 3KVNA 2CFSA 1D2HA 1J2JA 3O2JA 1XTIA 1ODJA 2R6HA 5BR1A 3TR5A 4AICA 1DIOB 1NXPA 1PK9A 1SVOA 2I3AA 1INLA 1ZGCA 4TL6A 4M8LA 4OGWA 4LV6A 2FZGA 5DK6A 3NAGA 3ZI0A 3VV3A 4ATNA 4KQEA 1L1FA 2HIHA 2Q9BA 1WF3A 3HKBB 4JNKA 1MH9A 1XRLA 4ASUD 5K03A 3CSUA 4C3VA 1FSZA 1E9SA 4XPZA 3QUAA 4EITA 3IAUA 2PIDA 4ZT4A 1V96A 1OB5A 4IDFA 2ZTHA 1JS1X 5J2UA 3RAGA 3AU9A 3D8SA 2OM2A 4C7KA 1QS0B 1N3BA 1FFDA 2Q0XA 3FZQA 3OO1A 3SHOA 3THYA 4XM1A 2YWXA 3QHPA 2VIIA 1U0TA 4KWIA 2Q2WA 1SB8A 1S1CA 1EGVB 4YWJA 3GVXA 1GRQA 1Q1NA 1JKMA 1R5NA 2OZLA 1L5RA 1NT4A 1TE2A 1FP4A 2OXRA 3MTQA 4URHA 4Y7CA 4Z49A 4IIJA 1SHLA 1WMDA 2C96A 3L6OO 2IHNA 1G18A 2QMOA 3LCRA 4CQMB 2PRJA 2BEKA 2Z2JA 4Z51A 5CD9A 3ZZMA 2AZXA 4EI2A 3H9JA 1V3VA 3ZXXA 4NMWA 2RGRA 1UDBA 1UZAA 3PTAA 2YWFA 1YOBA 3PYLA 5CRIA 3DD5A 3WRWA 4E3WA 1P19A 4FW9A 1SB9A 4CMJA 3H4IA 2I6SA 1IEQA 3HB4X 5HM6A 3SQXA 3TKLA 4Q4DA 3RG2A 5JAOA 1E5TA 2C8VA 1E6CA 3SLRA 1NC3A 1HG1A 1KDPA 3EG9A 4YR7A 4DV4B 1SZPA 3N7UA 4L22A 2ZKIA 4MQ6A 4OLFA 4JGBA 4TMYA 5ESDA 2Y1WA 2G88A 1U3WA 2REBA 3KLBA 3ZHTA 4CEHB 4W8OA 4DUYB 2HRBA 4AS1A 2BZGA 2JBAB 1P0MA 1V8DA 2AKAB 1MOQA 3EA5A 3C98A 3KKNA 3PEFA 4AN0A 5A1JA 2NSJA 2HTEA 2ZYWX 3U4IA 1NI4A 3ZDZB 2OZEA 3GGPA 9MHTA 3Q0EA 1FNBA 1TF2A 3JS5A 3NVDA 3RUHA 3WKBA 1K68A 1Z5ZA 4KK4A 2HTFA 2RCYA 4CIXA 3PI7A 1YFJA 3ZD7A 4ABTA 2XTMA 3AERB 1C0EA 1R0XA 4B4VA 1D0SA 4R81A 3TVDA 4DA7A 4UUMA 3CG4A 4MICA 1EZ1A 1G5TA 3RR2A 1PT5A 1OC4A 2PGNA 2X9NA 4KSYA 3OPYB 3IODA 3ZNQA 2DCUA 4K3VA 4CIVA 2R1VA 4JC8A 1Z3IX 2CV1A 2FWRA 5JVDB 2EGUA 5IC4A 4RZQA 4ARZB 1GNTA 2P6NA 1D4OA 4IIJF 3KB1A 3GLIE 2EIHA 1LI7A 4M1TA 4CE6A 4YPOA 1WD5A 3KKZA 3L2OB 4G5RA 4E13A 1Y37A 4B0PA 4D4MA 2GRAA 1CZUA 2RJNA 2HHAA 1E6LA 2FU5C 3BC1A 4JN6B 4NK4A 3VZBA 2F9FA 5EIEA 1TT5A 5T5QA 4DCVA 3FTDA 4OI2A 1E2GA 3T4EA 1P0QA 2AVNA 3C6BA 3ORYA 4I4CA 5EIBD 3F6BX 1WLSA 4F3KA 5BPHA 5HQTA 1I1OA 3O9ZA 5FD8A 2ZRPA 5FBKA 4L28A 2LVBA 3MERA 3GGDA 2IOFA 1LRJA 4FINA 2OT3B 3NRJA 4NV3A 3V1TC 3OMXA 1XO1A 2BM8A 2ISCA 3DKRA 2AFIA 5TPWB 3HI6A 1YZKA 2MTBA 2IH2A 1NV8A 3DNPA 2CKDA 3D81A 5LDGA 2JEOA 5I5EA 1XQ9A 1NN1A 1U3VA 1SQ0A 1XTSA 4IJKA 4IXTA 4YEDA 2C3UA 4KFSA 1C4KA 4F3NA 4JYCA 3FRIA 4X1IB 4UHJA 3LUAA 4G1CA 4L75A 4OQMA 3ZW7A 4B6JA 2X1LA 5CT5A 1C7FA 3IQXA 2Y4NA 3SF8A 1Y4DE 5KWVA 3NEYA 4DJ5X 2R11A 3OTOB 2D1FA 4NK5A 4IWXA 2V7XA 4LF8B 6Q21A 5DMHA 4PPNA 1H0RA 3V1UA 4A36A 4OFZA 2EL7A 2Y6VA 3LCUA 5BUQA 3DUFA 4IRUB 4XVRA 3EH1A 4WFKA 4DB4A 4HO1X 1R12A 4P33A 4JBIA 3WK8A 4NHOA 3HI4A 3I9JA 2YY5A 3BH7A 2DWOA 2TS1A 4M89A 2NVUA 1SRRA 1HLPA 2LR0A 1JKJB 1Y82A 3EZNA 4QDJA 4P84A 3DZ8A 4B1FA 3ZHVA 1EP1B 1KQGA 3PXEA 1IAQA 3BN3A 2OZVA 3AR4A 3D8UA 4QPDA 4DANA 4B8ZA 2O4CA 2GEDA 3VPFA 1MO6A 3E8SA 3IR5A 3ZJ4A 2LV8A 3FNFA 1A72A 1JLHA 3VR5A 3IO3A 2GKGA 3EEQA 2RBKA 4W8GA 3HWX1 3ANNA 4I9NA 3T3EA 3VO2A 3T1NA 2YHSA 5I9TA 3RUIA 5EQTA 2CCKA 3DKIA 1JJAA 3K1JA 4RJJA 3T61A 3BB4A 4CLXA 3FX2A 3C6QA 2JLAA 3TH5A 4DILA 2FG6C 4MA4A 1Z6YA 4G5OA 2PZKA 2P4QA 1NWHA 2FPIB 2HA5A 2JGLA 4Y2YA 3J81A 3K6JA 2QK4A 1DBVO 4M1EA 3B9PA 1VJ5A 1QGUB 3CMMA 4PR0A 4EHAA 4CFYA 2FUCA 1D09A 1NM5C 3KTDA 3CF6R 1EG7A 4GP7A 2XB8A 3NP9A 3GJQA 1B7GO 1J8DA 2EW8A 2XXAA 2O5EA 2ZDGA 5LP1A 5K3AA 4LOLA 5JAUA 2FFBA 4UD2A 1QFJA 1PQYA 1RXWA 1MCZA 1ONOA 3I9LA 1A7KA 1ARZA 1JDSA 4HH0A 4KYIB 4TS9A 3ULKA 2BHSA 3ZKWA 4M38A 4F97A 3DAPA 1ZY2A 2EDAA 3R7WA 3GLGE 4H1WA 5KTSA 1T2FA 1XZDA 2CD7A 2QRLA 1MMFB 1R0BA 3NEJA 3WGYA 1H1LA 1Y8CA 3WO1A 3O0DA 2FKNA 5IHXA 3O8NA 3RRMA 5JSZA 1CERA 1UOEA 4OY3A 4UAVA 2J9FB 4NONA 4UDYX 1O94A 5E7MA 1VHTA 1DVRA 1FSPA 3IAXA 5BV2P 4JI4B 1VBFA 3UHAA 3GF4A 5KYXA 1WNTA 5SY4A 2C83A 4MYTA 2BEUB 2IXAA 1TQ6A 3QX9A 2E21A 4BE7B 1JB9A 4GC5A 4UBJA 3NBXX 3TRFA 3KJHA 1Q0RA 4MYDA 1IDOA 2NX2A 5K8CA 2QNRA 1GSIA 3C4QA 1JIVA 1WQ3A 3EHEA 1WZEA 2E82A 3GLVA 3EDOA 4RU1A 1JYFA 4UOZA 3GU3A 3CINA 3N2ZB 4KYTA 2OOKA 3L7BA 3FSGD 3EVFA 1JEAA 3D2AA 1NBHA 4BMDA 4EA9A 1DWOA 1YV9A 2Z8YA 3NHYA 3JW8A 4HNHA 3I76A 4YRSA 2X2OA 3WS7A 5JD4A 3QPDA 4QDTA 1OH5A 4IDDA 1MEOA 1VJDA 1WVMA 4XVCA 1U4SA 1JA1A 3VXKA 3OZTA 4ZVVA 5AUNB 5LYJF 5MGNA 2EHJA 4O2AA 2E6UX 5IC6A 4CLDA 4CRWB 1PK7A 2PJUA 2RK6A 2DBYA 2X0IA 4FGKA 3SS7X 4X7PA 4CU5A 3ZW9A 3CJQA 1QVRA 1XQVA 4OVKA 3UT6A 3TPCA 3Q3CA 1QO0A 1T3GA 4FZRA 4QRHA 4IQFA 4CUJA 4E21A 1YRYE 2X2FA 1U6IA 3H5VA 3P96A 2B30A 4N8EA 4R9NA 4ZU1X 5LQKA 1JG3A 1XNHA 3K0EA 4ZCLA 3C97A 3VR4D 4BVJA 3W3ZB 1QOQB 2H4XA 1AKQA 1AN9A 5LJLA 2YZMA 3HVUA 1OU4A 4IIJB 3TNDA 1A5BB 2SNIE 2XWQA 3R5XA 3P9CA 3NC0C 3AYZB 4G89A 4K8RB 5DNDA 3L8EA 3IL2A 2OGUA 4LJSA 3G1TA 4FFMA 2JHPA 2VUHB 3F5FA 5E2BA 5GIOE 4YBRA 2WF6A 1K5HA 2IPLA 2NO6A 4B79A 4OX9Y 2W6ZA 4YTEA 1HSZA 1PLJA 3PD1A 4ITVA 5CHYA 3FVQA 1RJ9A 2CZCA 1SEPA 3L0YA 3TJMA 3WLAA 4P80A 1RYEA 3UWSA 1JZQA 2JJMA 4NESA 4TL8A 4TTRA 3IPXA 4H3HB 3G2IA 3VBEA 1L5LA 4Z54A 3LP5A 2B1IA 3LT2A 4XW2A 1RYDA 3AFIA 1Z82A 1NF9A 4LX0A 9ABPA 1CJMA 1FSGA 4M98A 4MQ5A 4A5OA 5K4HA 1SFRA 3ZCPA 1AHHA 3AJRA 5EGNA 2IYLD 1J2YA 4OQFA 5K7SA 3NTOA 3GPDG 5BNTA 2P75A 3QPWA 2IHTA 1XPUA 5T6BA 5JRJA 2FKAA 3D7RA 4C0BA 5BW4A 3BRWD 3GWGA 5KTRA 5AI0A 3C8MA 3QE0A 4XB2A 2VH2A 2G09A 2CLOB 4ISCA 1P44A 2PFKA 3B13B 3DO8A 1XWFA 5GOTA 5B1YA 2R4TA 4IMJB 3D4OA 2C04A 3I45A 5CA0B 3OFVA 1HDRA 3MS2A 3PEYA 3F71A 3FSRA 1VI2A 1ZGBA 2C4HA 3WJ1A 5D6OA 3JD0A 1MQ8B 2AXNA 4J43A 4PINA 2Z2IA 1EHYA 4QM6A 3DZDA 1KDOA 4L78A 1JDBC 4TWZA 3KQLA 4ETIA 5IDYA 5C4GB 3VSCA 1N3LA 3FY4A 4J7AA 4UTVA 2ZVJA 2IE8A 2PXCA 1FNNA 2V5VA 2XEDA 3A9TA 3GEMA 3KCNA 3WGQA 4UHHA 5FQOA 3W7VA 5AOBA 2IDZA 2G4LA 4IDGA 1XTTA 5LP6C 3PQ6A 4HQ0A 5CT9A 1VZ3A 3MMNA 4H1TA 4A10A 2FUG6 1OTYA 4JQCA 5BSFA 4H15A 3Q3IA 1QPGA 2QVBA 3H2YA 3WB0A 1DV2A 1FYWA 3RH0A 3SYMA 4YRMA 4Z4EA 5EWMB 1QZTA 3SFTA 2YWBA 3JQFC 1L7XA 2ODBA 1WVGA 4J6FA 5HDBB 1BW9A 3RD5A 4YCNA 1Q3KA 3HKDB 2VXBA 4FEEA 1PO7A 2IT1A 2KHZA 2IPNA 3N05A 5IH3A 4EQ6B 5JHHB 2NWQA 1B1CA 1T36A 4MV1A 2VH5R 5KJ1A 1NW3A 1TKAA 3EISA 3N5CA 5CB8A 2C7GA 3FLBA 3RNOA 4JI0B 2XB9A 4OYHA 5EPUA 3S29A 4MAMA 4A2QA 2Q8QA 3Q2IA 4Q3DA 3CH5A 1EPUA 1PT7A 2B1GA 1J42A 4BNDB 5EZQA 1YJ8A 1DFGA 1NQTA 2NUPB 3OT5A 3OZIA 2JH9A 3M6IA 1X7WA 1WV0A 1IQRA 1MIOB 3ZS8A 2QPAA 4URZR 2H4FA 1Z5WA 5H3HA 3FDZA 4IRMA 4MS4B 4GR5A 2GNAA 4FBLA 4P4UA 3YASA 1ZZEA 2PJZA 3A6GA 4AY6A 3X1DA 1KJ9A 2Q6TA 4ONEA 5FA6A 2WAAA 3GUZA 4O3MA 1M73E 4KQIA 1V5GA 3PDJA 1UP4A 1GGJA 3DVQX 3RPEA 3GCXA 3HJRA 1PFYA 2P91A 4PGHA 2B6NA 4TKLA 4B8WA 2R4QA 3VR6A 2VHWA 1DKQA 3KUCA 5K0NA 4CGYA 5FH9A 2VLIA 3OLXA 1BE8A 4KR0A 4Y2VA 2JANA 4QGBA 1L1RA 2A2ZA 2CNDA 3E22A 4Q02A 4JBNA 2OCBA 3IE0A 2QZJA 3U1VA 1SAYA 3TMAA 1W1WA 2P62A 3R24A 3LZCA 4L5AA 4WLUA 1N2CE 5B1HA 4H4EA 1P1CA 5ECDA 4OQ4A 2QYOA 4BJ3A 2Q1WA 1XMQB 1EVYA 4LUCA 4EFMA 1SVIA 4NU8X 4Y67A 1FP6A 2ZTVA 1M2GA 3EZFA 3RC1A 4NXNB 3I6BA 3DW1X 4OCZA 1CUXA 3ZU4A 1BNCA 3KTAA 3RYCB 1JR4A 3HVKA 1HOXA 1DTWA 1U8XX 1ODKA 1TT7A 2GNPA 2XT0A 3A1EA 3CPJB 4U3JA 3ZY4A 4C89A 4E5NA 3BULA 2DFNA 1PEAA 5HX7A 2QAGA 4BUJA 4TV9A 2VJMA 1U7DA 1JG4A 4EFDA 5JARA 2ECOA 3K8OE 3PF8A 2Q5IA 4PV7A 1C3OB 3CF4A 4NJMA 3L7JA 4WLNA 3ZDFA 3W3AA 2GAFA 1E9EA 3GCGA 4ID9A 1GKIA 1HORA 4Q48A 1ISIA 1R2QA 2HQOA 2RHDA 4YFYA 5T3UA 1C9KA 1SC3A 4HI0E 4OMCA 3V1YA 1E3DA 2D2VA 1KC3A 1O0SA 4B35A 1OFTA 1GG5A 3EN0A 4WOBA 3S68A 3HUFA 4LG1A 4RM2A 1MUUA 3T38A 2VHTA 2I1QA 3L41A 2NU6B 4XGKA 3A4MA 4MKZA 3T7EA 3TD2A 3F3YA 3NCHA 4KYVA 3D6MA 4GWGA 4MEAA 3L6DA 5EINA 3MJTA 1NVFA 1Z7GA 3B6MA 5FFFA 3NTUA 3KSMA 4BVKA 2FGKA 1E2HA 4AJOA 1BCSA 3NC1C 1ZINA 3DE6X 3LBNA 3ILYA 1YU6A 4P7BA 1DIBA 4MUBA 4JL5A 4M1SA 4WSOA 3ODGA 5IJZA 1B15A 3AF2A 4NKRA 5KKNB 1KVTA 3A3OA 2O48X 4IO0A 1UZNA 1XQ6A 1Z12A 2C2HA 1QRSA 1KE1A 4HEA1 4JB8A 2ZUEA 3I8SA 4QM7A 3NTXA 3VYWA 4RUKA 3U3JA 4MYHA 4BE4A 1QIFA 1RLOA 2YYYA 2C3OA 2Q4EA 3PSHA 3VNQA 1GUZA 1IK4A 3L1VA 2AG1A 4M8IA 2OORA 3RVBA 5LSAA 1P2BA 3CE9A 4MRVA 1ULUA 4RZXA 3VZSA 2DQKA 1BC5A 1UMKA 2VT6A 1EB8A 3GWZA 1QGDA 4HDSB 3TQQA 2N1BA 2FPUA 3TLMA 4NDNE 3WA6A 2QSYA 5B3LA 4AS2A 4BNXA 3IMCA 1OT5A 1CF2O 2YWRA 2V0NA 4MR8A 5DGXA 5HK9A 3WQRA 2IWHA 4HTFB 1JDZA 2GARA 2PGOA 3BZWA 4HDQB 5JWOA 5B2ZA 1ZH4A 1T8RA 4H0NA 1EK2A 2JAWA 2OWDA 2QOEA 3C3AA 5C46F 1ZICA 5FL7D 4ECAA 2JFPA 4I36A 1V9CA 4FBGA 4P4NA 5DM0A 1O3YA 2A0KA 5F5NA 3CEHA 2H29A 2DLDA 3B2EA 4K86A 4EKYA 1E0KA 1UDRA 1VB3A 2OHFA 2YVQA 3RLIA 2ZDHA 3PUHA 3QTTA 3TIXB 1NKTA 2GHQA 1QKKA 3ABRB 3EH2A 1N7GA 5TX7A 5ISMA 1E60A 2EZ4A 1HTWA 4DM7A 1S4QA 2B0JA 1HR0B 1AUPA 4UFOA 1F7UA 4CR7A 4FMDF 3K0CA 3IUNA 1ESCA 2CUTA 4JHXA 3FCAA 1MRNA 4DXHA 4H6PA 2UZ4A 3F9RA 3FUTA 1AA9A 3SSAA 3STTA 3OIDA 4DWJA 1LJUA 1G3RA 1RU3A 2ERCA 1G19A 4IVPA 3DE5X 2HQRA 3HS3A 3MMPA 3QVGA 1FNMA 1DBQA 2PX0A 3TYXA 1TD1A 3UAGA 3DWIA 3EDCA 2DWPA 1XCGB 4EPVA 4WBNA 2CF6A 1QVWA 5AO9A 3R8XA 3QKIA 4B6FA 1LF5A 2Q8PA 3QFTA 2ZJ6A 4HPJB 4MKGA 4XEHA 3LQRA 2MU1A 2V6MA 1A1VA 3PI6A 5EIBC 2COEA 1E3LA 1F3OA 2VBIA 3MLEA 4KOEC 1ZD3A 3RTEA 1IULA 2BEWB 3LCMA 5EZYF 4OMFG 3GYBA 4JV5B 3PWKA 1V1MB 2XE8A 5AVOA 1YL5A 3M5CA 4PXYA 5I8ZA 5LLSA 4L3OA 1C3EA 2B7LA 2W6NA 3CNEA 4ZAGA 3RC2A 3RRZA 4F5DA 1U0BB 4FOPA 2QRZA 2RIRA 2R6ZA 2DTEA 1JKFA 1PFUA 1K6IA 5IVDA 3UWOA 2OUKA 3NGMA 1GD1O 3WIVA 5BQFA 1P9NA 5DHRA 2C95A 5K2OA 3MAJA 5ICEA 1VKNA 4PLYA 2CXXA 1V39A 5AJHA 1WUTA 4E5MA 1TJ5A 4QFMA 1DT5A 4M0UA 4NG4A 4WEOA 2A8YA 5BUSA 3I2FA 3ECAA 3V48A 1RQ7A 1SOVA 3PV0A 4JT8A 1UBSB 2CMFA 4DLAA 3W7BA 1YWGO 5JDCC 3BFJA 3RJ9A 3UO8B 4AI6A 2JJ2A 1BU8A 2NUBA 1XN1A 1MIHA 2BJWA 3VU9A 2FPPB 4GBJA 4RZSA 3RRXA 2YOFA 1W0KA 4LGYA 2Q2QA 1I4EB 2XYRA 3SNKA 1XROA 1T25A 1E1QD 2M6RA 3N8KA 4AG6A 2FV8A 4KNVA 1LC3A 1O95C 1MF7A 1T8SA 4KRYA 2JVJA 4D9EA 3IP7A 3ICWA 4MMZB 4N5HX 3EMKA 2HY7A 4HB2A 1RIFA 4NZNA 1JHMA 4MUXA 4MH0R 2P2DA 3SJAA 4OMDA 3L6RA 4A7PA 3TSYA 1TQ4A 1QZUA 3D8RA 3W6NA 1GNRA 1NRWA 1RLMA 3PHJA 4WNAB 4AXBA 2AJTA 1NQXA 4KZKA 2DMRA 3G85A 2XUIA 4HS4A 2GJSA 4KV7A 2YH2A 4BX9A 3C7TA 5FL3A 1ZWKA 3GBPA 5I9NA 2OBMA 5AKHA 2JIZA 1B8VA 1FLAA 3K1TA 5IBCA 2IXBA 2QNBA 1H2FA 4S1NA 3TEJA 1SHZA 1CDDA 1X3LA 3RF7A 2JFOA 4UUQA 4MGIR 1NLZA 3EIEA 4CTMA 2EGHA 4PYJA 4RD6A 2PJRA 4WN3A 2IP4A 4HEA6 2BT4A 1U1EA 3C14C 3GOHA 4OQLA 4X3PA 2X58A 2ZAIA 4HYYA 4M9ZA 3DWEX 5C1OA 2WZQA 1RYZA 1IZ7A 4YV2A 1Z15A 3WXMA 4XWOA 1IY2A 3I5XA 1Y7LA 2ZJBA 5IS2A 1RADA 5JCJD 1Z8FA 3A6FA 2R6R1 4QTZA 3RU2A 2BISA 3KHSA 5LZ8A 2AOVA 2AI2A 1BVHA 1HEYA 1DC3A 2CYBA 2WIBA 5C34B 2BEWA 1P1KA 2ONCA 1WZCA 1IJBA 4XM0A 1AE1A 1ZR4A 1A98A 4PZEA 3EQ6A 2WU1A 1DLJA 3NDRA 5D7BA 2F8MA 2CHUA 2ZVQX 4AL4A 1T43A 3DCJA 3HHPA 1YAJA 4AY4A 3URKA 5BNWA 2D5AA 2I65A 3MBIA 3TE7A 2O1XA 1NJGA 2VSQA 3KAKA 4GXQA 2PT5A 1DC4A 3IQFA 1QPBA 4PZAA 1M7BA 2FXVA 3WRXA 3FWPA 3ZKAA 3N87A 1OWMA 2MINB 3NX4A 2OQIA 4GQAA 3PNYA 3HV2A 3JWHA 4N0DA 5FHRA 4XJSA 4D9HA 1AQJA 2FDXA 5H80A 2WJWA 3QEMB 4TXNA 2ODNA 1R4MA 3MWLA 1TGYA 4IMPA 4GH5A 4E08A 2GZMA 4KDCA 2DH6A 5EWLB 5ADHA 1ZH6A 4TMTA 1DQPA 3QVUA 4PYRA 5JY1A 1FDSA 3SDBA 1EAYA 2P6MA 1HH4A 1LSOA 2ZIZA 2C92A 4QJIA 3JPYA 2BFBA 1X8JA 4DA8A 4KMOA 4H17A 1JMKC 1JH8A 3PE4A 2JLZA 1LPAB 2QTFA 1BJKA 2X0FA 5KYGA 4RMHA 4GLBA 4C21A 3IELA 2AOTB 3OZXA 1BKSB 3HO1A 4ZMSA 4UPEA 2Q1YA 1PD0A 3PUIA 3E9EA 1XQYA 2X0NA 3PKJA 3M2PA 4GYYA 4QOIA 4RXMA 2ZJ3A 5TQ0B 3AVXA 3SHTA 2Q3EA 3EUFA 2FZ4A 3IRUA 5AT1A 4D02A 1M67A 1CY6A 1FFXB 2X6TA 4EGQA 1RZRD 3ZHCA 1J2EA 3RM3A 1SVSA 2AEMA 3ISJA 3L1JA 4K28A 2VG8A 3VPAA 4DLLA 2CXPA 2P2GA 3ICOA 4JC4A 4MHOA 1GVHA 4WESA 4F4FA 2DQZA 2GZ2A 4HX2A 4DLYA 1QE5A 3TIVA 4NBSA 2JBHA 4RULA 2P27A 1VKHA 4CIDA 4QOEA 1F6WA 4RK0A 1G55A 1MEJA 5TGDA 3W8RA 2VI5A 3S2UA 2QL6A 4B33A 4NI5A 1EDEA 3DZHA 5L3ZA 4BQFA 5EMHA 4RCVA 3UJDA 2YDYA 5CK4A 4IEFB 4DFDA 5BV7A 2W70A 1DKUA 3IEXA 2NOAA 5HA5A 2D00A 3O8RA 1R6VA 1KA9H 5B12A 3MD9A 2CB0A 4L74A 2VDOB 5FEMA 2J31A 3DE2X 2Z2YA 3HL4A 3I0MA 1YCFA 1FFGA 1Y6ZA 2V6GA 3ICEA 4EB6B 2X42A 4N6OA 4G0QA 4MW5A 5LP6F 2B4AA 2OYCA 1HE5A 4WN9A 4E12A 4FT2A 3P0IA 4C4ZA 4CETA 1GPJA 2RHJA 5I48A 2ZRQA 3DYBA 4ZRNA 4IXMA 4D99A 3K15A 3I53A 1AX9A 4HQOA 4LA4A 5AJYA 1RHRA 3KAQA 4INPA 2PUBA 3B6KA 4P7GA 4X97A 1UJ4A 2BN4A 4ER5A 1H2WA 3OLVA 5MF6A 2X1VA 5GM2A 3S2ZA 3GFRA 3BDIA 1Y5NA 1J8QA 5CGQB 1XJWA 2PWBA 1UJNA 4UAJA 2QLTA 5LYJA 3W1VA 1VIAA 3WK7A 1SXGA 3VNAA 1E9FA 4JLBA 4D3YA 3TL2A 3RYCA 1GG2A 2O5VA 1COZA 2PBZA 5H02A 1NBIA 1G5PA 3IJPA 4I1YA 1MJFA 4OJNA 2PAFA 1BWSA 1QHHB 3OEEA 1S01A 3HH8A 1Z83A 1T0PA 3WNZA 4J94A 4Q9KA 3OF2A 5A4KA 5B4UA 3LI2A 1YQXA 4YDRA 5B6JA 2F6RA 5KNDH 4R9UC 5A3QA 2ZRLA 3FPFA 2DU8A 2ZSUA 1GPUA 4JELA 4G2NA 1CE8A 5LA6F 4KITB 1BZYA 3GRPA 1UCFA 3B48A 5FBLB 1ADYA 1NR1A 1JXQA 2XZPA 3L84A 3MTBA 5HIIA 1I5OA 4BFYA 4PBRA 2EKLA 4CQNA 2LKCA 3QWHA 4E11A 4CG1A 1N78A 2XT9A 2XITA 1YO6A 2GK4A 3DS8A 2BDUA 4ZQBA 1Z62A 2BUCA 3RVPA 2NUTB 1M5UA 3PGA1 2DF8A 2ZBUA 3RC3A 1OTHA 3F2IA 5C1IA 2Z5GA 3AL0C 3QXSA 1RYYA 4ES6A 3GHYA 2DFTA 3HLKA 3GT0A 4HH3C 3IXMA 5JPIA 2JAPA 3LCVB 3FNRA 1M54A 2XTZA 1RE1A 3M8KA 5IJ9A 5B2EA 3ORFA 1L1EA 3PQ2A 4QVKA 3DVRX 1AKRA 2ZJZA 3ETNA 4IHKA 3ZE2B 1PR0A 2O0LA 2Q49A 3MTJA 3CLSD 1EWRA 2RAFA 3E4DA 5EKUA 3ADOA 2BGKA 1WUKS 3DA8A 5BV8A 3F74A 4NF2A 5KNCH 1IU9A 1R8YA 3KZOA 4NBRA 2YY7A 1JLKA 1A5SB 1ENZA 1HTBA 5TRTA 3OU7A 4JUIA 3ZHZA 1O95D 13PKA 4QYXA 3D7LA 2F90A 3KT8A 4OLHA 3OPXA 1PJZA 3NANA 3S7ZA 2QD4A 1F2TA 4UVGA 5C8XA 3G6KA 2ZYIA 2HSEA 5KYTA 4KFRA 5A0VA 1CUDA 3K1ZA 3EX7C 1GRCA 4YRRA 5EWMA 4BTEA 1OWOA 1XB2A 2NZVG 4ZOLF 2EARA 3LC2O 2Z6UA 4OP3A 3WNBA 1TCUA 1IXRC 1PS8A 1U3CA 2J6CA 3AB3A 4N0EA 4QU8A 1ZJ4A 1RXYA 2PZLA 3VI3B 1XRJA 4RNCA 2HI0A 5DWVA 1GGVA 4IMRA 3V1MA 2B4QA 1M2NA 2QAGB 3ECCA 2I7TA 3TSCA 4DWVA 1OKKD 3B8HA 4RFSB 6REQB 2QBYA 5IZ4A 1ZESA 1V9LA 4YJFB 4ZEXA 1I1HA 1XKLA 2ZYDA 3IKLA 3A6EA 5HGJA 3WL6A 3CQ9A 4LK3A 2WJPA 3LRPA 1EH5A 2J3EA 3V33A 5G4KA 1JGTA 4JLOA 4B3SB 2VPTA 1V5WA 4L1KA 1CR4A 2NU8B 4OUDA 2XMQA 2I34A 3ZWDA 1N2OA 3IKTA 1T5TA 2PMWB 2H4YA 1II8B 2UDPA 4Q0MA 1DQNA 1PFGA 3L8YA 5I47A 3IR6A 2BFFB 4KIJA 4HN4B 3RE1A 1UXOA 5HFAA 1KMIY 1C3VA 3H5IA 1W85B 2OCIA 3AUUA 1E2EA 2MDTA 2WF5A 3KALA 4ZJPA 1Z4JA 1XE3A 3CO5A 3JQPA 2E4AA 4ZZ1A 1XVAA 2QMUA 2AWOA 3GBSA 4QTYA 1L8LA 3IALA 4K6GA 2NQ8A 2ACEA 4D8XA 3AVPA 2ZXEA 1D2CA 3FHLA 3Q2KA 4RS4A 4A0SA 1Y5MA 3AFMA 4EQ6A 3ZDAA 4BRSA 4JBYA 3OJ0A 3O1HB 5EFZA 2VATA 5A2QA 2O8EA 4A27A 3EPHA 4AZ3B 3V7NA 1D8AA 1A9PA 2AN3A 4KDFA 4EY4A 3PEUA 2ZBFA 1L3BA 1Q1AA 1CDOA 1XRRA 1XHFA 1SCNE 3HG7A 4I46A 4RCYA 4DG9A 4EY3A 1JR3E 3HVRA 1N6LA 1U7HA 1J8YF 3WJ2A 2EQAA 3QEOA 3NBZC 4BNFA 3WLJA 4HUJA 4J4TA 4EPWA 2XHEA 1P81A 1RAHA 3M9LA 1BMFD 1QV9A 3L1IA 3M4JA 2R4UA 3ZY2A 1REQA 1BX1A 4C7OA 5E8RA 1W52X 4MVJE 1FX0A 3ZGLA 1KYIA 4AMYA 3BCSA 4CF4A 5CBPA 4RJLA 4P58A 3IR7A 4J07A 3OH8A 1GFWA 4U9UA 4Q7LA 4C43A 3H1GA 1YS6A 4JJ7A 3UHOA 4D3FA 2NW6A 3O8DA 4N3NA 4UPVA 4RE6A 1PR3A 1SOUA 4QD3A 2M98A 3E9NA 5CFZA 2ZAGA 2GN9A 1ZW6A 1UOPA 3DLCA 3ND8A 4IUDS 5EZ6B 4CF6A 3O8CA 1KS2A 5BURA 5KYKA 1YDHA 2HA3A 2C31A 2YASA 3CZPA 2VP6A 5A05A 4RIFA 1IONA 4FDUA 3PEVA 4TWJA 3HU3A 1CK4A 4PTLA 1H1LB 1H2AS 4XQ9A 4FJ1A 1ZNYA 3P7MA 1U7TA 1IBCA 2V6FA 3S1AA 3T9DA 4CVNA 5JXHA 1GCGA 3QVOA 1DWUA 4GLJA 3H18A 1NXVA 3M9WA 2X1HA 3H9QA 4D4GA 5ICSA 2M9MA 4ERXA 5AKYA 3WRYC 4OQXA 1PJSA 5DI9A 2F00A 2R1ZA 1YU9A 4CMIA 4BC1A 3QEJA 4XOUA 4O2BF 1SK8A 2Z3VA 1G4UR 3B3JA 4R7ZA 4YT8A 2FNAA 1K8ZB 2RG1A 5BQ5A 3UG6A 1P60A 4XZ3A 5FTJA 4CMEA 1XNRB 4G36A 2ZDQA 2GSWA 3A0UA 3L46A 1ZAYA 3OWXA 1MC8A 1EUCB 3L6EA 1YRQA 4F2PA 2QZZA 4XB6B 2Z57A 2VDJA 4ROSA 4QE3A 4JBLA 3E9ZA 3IUEA 4XQGA 1W5FA 3M3PA 1GPLA 2B3TA 2JJ1A 3UXYA 1M5RA 2YY6A 5HIKA 4XJVA 1T0BA 3KZNA 4E1VA 4AQ7A 1R50A 4PRKA 3Q2OA 4TYWA 5HK8A 4OHMA 4FMDB 4NZZA 1NVDA 1QYDA 5T4HA 5KBYA 3WGKA 5H1YA 4F92B 1Z37A 1JPNA 4DGQA 2BGIA 3DJFA 3L93A 5D00A 1ZK1A 2HDNB 4DPMA 4CM9D 4LJYA 1Z4OA 1ZD4A 2AW5A 3CRVA 3QE3A 2XCQA 3P2EA 3ZZ0A 1P74A 1QHHA 3R44A 4FEYA 3JZMA 5ALQA 3O92A 1O96B 2ZWMA 2C2MA 1BJRE 2I6QA 3K9CA 2XXAB 2EZ8A 4C78A 4ZJYA 1X0XA 3HBAA 8ATCA 3VR6D 1ACLA 2DYKA 4M55A 4C76A 3NTVA 5JNVA 5CJJA 4RMIA 1CF9A 1KY4A 3AUTA 2CXQA 5DLEA 3UGTA 1PGJA 3P2YA 4I8XA 3OZAA 1MQ9A 2ZT7A 1E77A 2WSIA 2YDXA 4D4JA 3V9AA 1DT3A 2FSSA 2JI6A 3UK1A 3DT8A 5A1TA 4IV5A 5DCWA 2NT3A 5BYJA 3UMYA 7ADHA 3D3WA 2ODEA 5FA8A 3N6XA 2OZKA 3OX1A 5J4LA 3F6EX 3TBHA 4DR1B 1XK7A 1B8OA 1LF0A 1DQZA 4P4TA 1HE1C 4PO3X 4R16A 3UNXA 4EK9A 4F04A 4D98A 4BNMA 1FTSA 1M34A 3F5QA 2VEOA 3A7EA 2FWNA 3RHFA 4D9JA 2HLDA 2I99A 1UODA 2I78A 2NXNA 2NUPA 2JFFA 2V6BA 3HCCA 3HMQA 3KJQA 3OM1A 4ZI7A 4I55F 3K71B 2AKYA 3RF6A 4TSKA 2XUOA 1GL9B 4OK3A 4ILKA 2E0IA 1DZIA 1ZX1A 4MYUA 1PFVA 3I2JA 4EUFA 1UMCB 3GLRA 4UDXX 3CNHA 3P71T 3OCVA 4WNYA 2R2GA 3WLKX 4LFAB 2GVDC 4X92A 4EKDA 3UAWA 2I91A 3KRTA 2ZQ5A 3DUFB 8LDHA 4C2TA 1KK2A 3R7DA 5L53A 2WJZB 5AYVA 3A8TA 3IQHX 4TSFD 3F67A 1NTRA 1S8NA 4L7VA 5DBFA 2XE7A 4TQGA 4YUWA 5I8WA 4UCQA 2IS6A 3ETHA 3JARA 4RA9B 3SN6A 5I9IA 5A03A 2VJCA 5CBKA 5IDQA 2A33A 1DAPA 1FVHA 2VAWA 3LFUA 4M1ZA 4BWFB 3KJXA 1J39A 5AOAA 5EJ9A 3FCEA 1TOAA 1VPDA 2LPMA 4U7HA 4XFKA 2YN0A 1RRMA 2IY8A 4F38A 1X2EA 2G1AA 2FEPA 1A2KC 4MW0A 4NENB 3WGTA 1UPTA 4AIIA 4CM7A 1D7AA 2JLVA 1SG9A 4E6PA 3QWAA 4M2LA 1X1CA 3U37A 1U5BA 5I9MA 5C7YA 2LNDA 5CCEA 4M0EA 1QTNA 4I1RA 4RVDA 5E6UB 3QHQA 4TUYA 2F9LA 5FPTA 1MX5A 3Q87B 5SZJA 1EBFA 1C1DA 3NKVA 3PEEA 1T1IA 2APJA 4MVCA 3AP3A 3EUWA 1ZD8A 2ZYHA 2CLIB 3TXAA 1DRWA 1FVXA 1Z36A 3ZTYA 2O1WA 4JFRA 5JHGB 2PSDA 2AYYA 4RKFA 4TGLA 5EWLA 2H0AA 2CNWD 1IZ9A 4ESEA 1OLXB 2VRBA 2HR1A 3H2HA 5F1KA 1WSDA 3UFXB 3AG5A 1O6FA 2X8AA 4IM7A 2XV1A 2A58A 3A6PC 2H07A 2W71A 5DYNA 4ZAZA 2XGJA 2YXLA 4PEVA 4P2GA 2PCLA 1X7HA 2RMKA 3GMIA 3R2JA 4MVJP 5CLQA 3U81A 2LWIA 4DJDC 5ALRA 5FL7A 4CG0A 2A5FA 1NF3A 3FRHA 2QP9X 4RQBA 3KUXA 1MG0A 2O8BA 4ZVNA 1ZSYA 3ZU6A 5KQPA 2GVNA 3AG6A 2Q0SA 3UWDA 1EEXB 3AFOA 4EG7A 5DSXA 4V39A 4EJ6A 3KO8A 4ZI7B 2FUNB 4GNRA 4R1LA 1Q91A 2NU7A 4FZ5A 2F8SA 3K1YA 4TZ6A 3X2SA 4AMBA 3AIOA 2J3QA 1DS6A 3E1SA 1HDCA 5IULC 2JS7A 2WTAA 1KF0A 2ZREA 1XA0A 4L8GA 3QBDA 4LAFA 8GPBA 2YMQA 2AFHE 1GTSA 2ZM6B 3SHVA 2IV3A 1RSZA 4NXMB 1QXSA 5J2TB 1D6NA 3HYRA 3Q9NA 1PL0A 1L6IA 1L7EA 5AI9A 5CDFE 3ZD6A 3COSA 5J2TA 3Q8KA 2XNKA 2Q4RA 3QWFA 4F3TA 1CR1A 4ZALA 3CNOA 3FRJA 3PC4A 3O91A 5CW1A 1SELA 2QJOA 5HXAA 1YD7A 3GFBA 3OP4A 4LI0A 5JQGB 1V11A 2WRZA 2AC2A 3QBJA 1SJ9A 5EZSA 2CN1A 1PR2A 1H1DA 4GX5A 4OFWA 3HXOA 3EQ8A 2FW8A 2I3ZA 2PS9A 2H5LA 4RHFA 4DJJA 1KZ4A 2RGAA 3PBKA 3UN1A 3D3NA 3FB1A 4LGCA 5JS8A 3S8EA 1O96A 1NHWA 5DO9A 5EWJB 1JTVA 4KLNA 1JYSA 5I7HA 1I94B 3TQTA 1QF9A 1BFKA 3O3OB 4PWZA 1RLTA 4RDCA 1W5EA 3WLHA 1M2WA 3VVLA 5LUAA 5JCPA 3T5AA 2KWIA 3RHTA 4WECA 1J0DA 1SOAA 2K2QB 2ZZKA 1A96A 2ECQA 2IHVA 2WP0A 3LY9A 3QVKA 1Y3BE 4N5IX 1BEZA 1ZLXA 3H86A 1IEVA 2R1VB 2VUIB 4HRVA 1Y4AE 1AD2A 1PJTA 3LUFA 1NUSA 5JSYA 4GYKA 2BI8A 3N2GA 5BO5A 4A8JA 5KQLA 4UUPA 1WF6A 5YASA 3JVUA 4YRPA 1TPYA 3QPVA 5CT6A 4DPLA 3Q3VA 2FPSA 3IUBA 3N07A 4QUKA 3IP9A 3K09A 1N4DA 5EJMA 2WF9A 4OHKA 3Q10A 1T5LA 1KQNA 2PVCA 3Q98A 2HRCA 3UKJA 1JB1A 5JNRA 1BJTA 4BUZA 2C57A 4IV8A 1PVVA 4H27A 2VHQA 1XD9A 1NP6A 4LDZA 2HSGA 1WPGA 3BORA 2P4UA 3VSEA 2MMCA 3HNOA 5JC1A 3W4KA 1VIVA 3B1KA 4ZVTA 2DHCA 4U7GA 3F3MA 2OBBA 5HE9A 4BN0A 1LUAA 1L7DA 4RDXA 4IPTA 2GM9A 4OXKA 3T5CA 3K70C 5C35A 2PGDA 4BFSA 3VVCA 2JLCA 3KZXA 3T3OA 4B09A 1ORWA 2V3WA 1AHPA 3UXHA 3L49A 4RFVA 1D03A 4MWEA 2X40A 3BQ9A 2MHCA 1Q44A 1AG9A 3H2JA 3JU3A 3L0ZA 4XIIA 4CNBA 4K3UA 5HOQA 5LKAA 4M86A 3PX3A 3F8WA 1OYYA 4O4JA 4Q4LA 5TEWA 4WBNF 5JI2E 1E3EA 3LUHA 4HDCA 4FR5A 2AT1A 5KCZA 1FFEA 2OV8A 1ND5A 1AKWA 3OT1B 2WJGA 3QA3E 4XEUA 5DCLA 3D0RA 3E9RA 4R31A 1YQQA 2XYVA 4PZ9A 5K0EA 1OLOA 3RVDA 1S3FA 221PA 2JLQA 3R0QA 4N5NA 4DQDA 4YRLA 1NIPA 3FPBA 4E5VA 4HWOA 1KBZA 4JJKA 5JNLA 2YWCA 3QY0A 3KEMA 2WSMA 3CUKA 1P0CA 1ZHHA 5D5HA 4YXFA 2QQFA 3ILXA 1G8AA 1KO7A 1R6TA 2DUMA 4EYKA 4B3GA 2GPAA 3JQGB 5GVRA 2QKYA 1VIMA 5ECYA 1RZ3A 4CIAA 4GPIB 4KTVE 4RAOA 3JTEA 3TTYA 4BN4A 3O74A 4C0HA 2VT3A 1I1QB 1VHJA 2CBXA 3IHTA 5K9ZA 2M6SA 4TT3D 2J09A 4KPEC 1XF9A 2JATA 4PVCA 2OO5A 3EVAA 3TI7A 1IOWA 5BWMA 2BDTA 2ZUSA 4UXJA 4Y1GA 5IZCC 4DTIA 4YCLA 1DAGA 3I6MA 1DELA 4B0OA 3WJ7A 2F4NA 2GJAA 4JVMA 5K0JA 2B1QA 2BZ1A 3AF6A 2I03A 5C80A 5CBPB 2GBCA 4L8FA 1NZFA 4ZCQA 2OXIA 3QBEA 4WN9B 3LKBA 1WTAA 2VRCA 1V9SA 3P20A 3H11A 5HDQA 3T3DA 5IABA 1FXUA 5CP8A 4ALMA 4JC5A 1MAUA 4G0OA 1MNAA 2MOKA 2Q4TA 4Q3LA 2E3JA 2X3UA 3DM5A 4E14A 3F5DA 4G1VA 4GEKA 2YJ3A 3HU1A 1EHCA 3TZEA 4FYIA 4X00A 1RC1A 3R41A 1Y7HA 3T9CA 1R0KA 5ERXA 3HU5A 2GCPA 3OM0A 5J4HA 2P1RA 4IXNA 4NYIQ 3ZX4A 3MG9A 4XKJA 3MFYA 5AW6A 3Q1LA 3ZV6A 1NUHA 4GZ6A 1LLQA 3LLSA 2W8ZA 1KU6A 2PYZA 2CL7X 2O8EB 5H7XA 10MHA 4WJLA 4KE8A 4O4IF 2BHTA 5FJJA 4E6EA 4EX6A 2CDAA 4BNZA 3JPWA 4M6WB 5FPQA 1SEVA 5BYKA 2FN8A 1D3AA 1CB0A 2DR3A 2X9LA 1M8KA 3O9MA 4PVDA 3SNHA 4C7MA 3HUTA 1BXKA 4AP9A 4KR6A 1UBRS 4LZJA 5LIPA 5DX0A 2E4YA 1YULA 3ELUA 1V5EA 3KE8A 5CK5A 2CMDA 2COUA 5EJAA 3V3TA 3DCYA 3R3ZA 4PTZA 3OQJA 3PFIA 3EW7A 1WXHA 4QHTA 1CR6A 1YB5A 3PCXA 1HQDA 3NWEA 1GNQA 1JPVA 2RH9B 3BWMA 3THWA 5JAQA 1EG2A 3E7FA 3PNBA 2WNSA 1A8QA 4O2AB 4NNPA 1GRVA 1I9GA 1TJPB 3SYKA 3QBTA 4A6EA 4I3GA 1N2ZA 1V4NA 2UZ1A 1OFUA 3I37X 3O2QB 2ZIAA 3HDYA 5FV4A 2C2BA 5KOJA 4ZI3A 4W5QA 1V2GA 4K81B 2JFXA 3B82A 2DKOA 3A9SA 3MGKA 2CSXA 3P0FA 2PX6A 4BEBA 1KAQA 4MJ7A 3V2GA 1DC8A 4S0XA 4QG3A 2NXEA 3QKSA 3JYHA 1NXQA 3HA5A 4UBNA 5FUYA 3RJMA 1LPOA 2HJRA 4LCJA 2PJDA 3QX3A 4I5EA 1IN5A 4NFYA 2DR0A 2QTVB 3ZCRA 5HCNA 3WL8A 2G5CA 3WBKA 4EW6A 1J9EA 2FF5A 4ML3A 1HDEA 4DIEA 3FI0A 2QRHA 3L9WA 1GL7A 1B2LA 5AXBA 4M49A 2RHRA 1MT3A 1MAAA 2NAFA 3KPUA 1ODSA 2VJNA 3WYBA 5SZHB 5J5CA 4DV6B 4BNDA 4KQHA 3DFZA 2W2OA 1S8FA 4CM5A 5EIHA 4GL2A 1RXVA 1HLFA 4V0RA 3RC7A 3ZZ1A 4RO0A 1JHXA 1USKA 1XJ5A 4XIGS 5KVSA 3ETGA 1IVNA 1T9HA 2EZTA 2ZULA 5LXTF 4PLFA 1QH8B 1WB5A 1B8PA 1XWWA 1OFUX 2DJ5A 2GHRA 3EZ9A 4OSEA 3PTZA 1I7SB 4O4LB 1ZXBA 5A4IS 2HJWA 1IY0A 3PDIB 4FIZA 3SXUB 1WJGA 3CUVA 3QMVA 5DB4A 3WOVA 4Y2SA 5B7GA 1P7VA 3OLQA 4R2JA 4JSTA 4C4SA 3KJNA 4MS4A 2JIOA 3U62A 3PRJA 4IFBA 3X1ZA 4L3WA 2H1LA 3G2LA 1TO1E 4LI3X 1JU4A 3RS4A 2PV7A 3OD1A 3LP6A 4F2WA 4V38A 4HSGA 2ZE6A 1L4GA 3GNSA 3MMZA 4GMDA 4N82A 3HJUA 4HT3B 1DQRA 1RI2A 1XMJA 1QS0A 2MSKA 3CB2A 4XLTA 3IP3A 1M7HA 4P1ZA 4BLPA 4EY8A 4DB2A 4W4TA 2ADOA 1CIJA 1WEHA 2VC2B 1R0CA 3O8BA 1IBKB 2Y68A 4OHOA 3OUZA 1WTCA 3OZWA 2GJKA 2E1RA 3HA2A 1ADGA 4KUHA 1KY2A 2HIGA 3C3KA 4TTAA 1MABA 1I36A 2YWEA 1SCKA 4YHBA 4LEIA 1FYDA 3I9V1 3WGJA 5JV5A 1WXWA 2B4KA 2JF0A 3BHNA 5G0VA 5GONA 3ZLJA 1DEOA 3A6DA 4COKA 3DLAA 1W85A 2YC4C 1K1EA 4HNQA 2ZQZA 3V8VA 4V1CI 2PZJA 2HQBA 2HQSA 1SCQA 1RABA 5JVDF 1XN4A 2BR4A 2O2HA 4LJ8A 1G41A 4V24A 3TEMA 4YY3B 3CRW1 5D5PA 3G8AA 5JBIA 4ZZ3A 4BFLA 4EG8A 1CUHA 1YC2A 3FBTA 1JBKA 4FSDA 4HP8A 4YAIA 3KJIA 4DV7B 3COJA 1ADCA 4TPKA 2A6PA 2QMHA 5KHAA 3VKVA 2C9CA 1UDAA 2QR2A 1BFDA 1U9ZA 4B34A 2P11A 4JAVC 4L9SA 1VMKA 3E05A 1QG2A 3AY3A 2PRIA 4MCJA 3V6MA 1X7WB 1RAIA 2R7AA 4KIGA 5A4FS 3KVYA 4MRAA 4HRYA 2EP7A 5H3LA 1P9WA 1SKYB 4JKYA 5C5DA 3OQOA 4IAOA 2R84A 2IQIA 4YCBA 1P7ZA 1ILWA 3HO6A 3K7EA 4C0AC 1AUXA 5KSYA 3IESA 1J0CA 3MRVA 3AU8A 1QK3A 2IP1A 1ONSA 4HQLA 4NEQA 1RJGA 3C0KA 4R69A 2BKUA 2OHJA 2DERA 3TTSA 6CHYA 3W5DA 1JFSA 3IC5A 4YUXA 5KSWB 4ARIA 3L4EA 2WC1A 2CC2A 5FUXA 5DNVA 4IOLA 2Y0DA 1P8JA 2NTJA 1XZHA 2Z5FA 5AXAA 3K32A 4JLMA 1A76A 4AJ1A 2QPTA 1NMXA 1LY1A 4QU5A 3VOBA 5LL6P 1Q20A 1X6VA 4RM3A 1C7IA 1EFPA 5KO2A 2YX1A 1K9SA 1ZNWA 3DC7A 4UOEA 4B81A 2X5KO 3F8TA 1Q0LA 3QYPA 3O3NB 1PW7A 2BBOA 1RHUA 4ND4A 4NU5A 4O1HA 4I4NA 4QT0A 2HUNA 4ARVA 5BN1A 2SCUB 2J33A 2VK8A 2WPDA 4M46A 3H11B 2AA3A 5C2JB 2AXQA 2FRDC 2Z4SA 5J1TB 2V96A 1NJ5A 2FPXA 3RODA 4PX5A 3LX5A 2D2FA 2FHSA 3VPDA 1KPGA 2XVAA 4PQFA 3BM5A 4EPXA 3NLLA 5AJVB 4XVUA 5CG1A 3TAUA 2RGGA 4WGFA 3CZQA 2H3EA 3VAAA 3VOTA 1YA6A 4EQZA 3HB9A 2XMGA 4D82A 3OQPA 4OOEA 1XTPA 5IK2D 4CHTA 4MJLA 2C4MA 1E3QA 2CWWA 2YTZA 3A32A 3BK7A 3JAKA 4O2AF 1H2RS 3FYDA 3I4CA 2GMWA 1HT2E 3K53A 4Q01A 4LY6A 4Y1RA 2RI1A 5EHQA 1GTG1 3RT1A 5LZ7A 2WY2D 1SCIA 4ILEA 1XEWX 1FDOA 2JEYA 2WIKA 3I04A 3SZOA 5C81A 2DZDA 4RSMA 5AR1A 1LVHA 4JENA 3JR7A 4DS3A 1SQ6A 4UU8A 3QUCA 2VJBA 3VDNB 5IJXA 4X3OA 5DXFA 4RD0A 3VR4H 1KL7A 1SXHA 2BEJA 1E6EA 2F3SA 3PPXA 1SXJB 5GJVC 1EZZA 4V0ME 3FUWA 2RFLA 3STXA 3EGVA 5BV1A 2VDPB 2NQ2C 3ISVA 5IAAA 2CNOA 2IJGX 2JGJA 6PFKA 5ITVA 1MQSA 4PWYA 1Q3TA 1YZUA 3DCIA 1B0PA 1L5GB 2B8JA 1QFXA 4IWYA 4UXHA 4F4DA 4TMWA 3CCBA 3V9PA 1RMYA 3G88A 2XF2A 5BWLA 2ECPA 2JA2A 4BFTA 2P6RA 1JIKA 5B53A 3FI9A 2FCRA 3AQ4A 1VIYA 1W5AA 4HWGA 4EBFA 1BD3A 4L3VA 4FQ8A 2Y1DA 3LQ2A 4PQEA 2GBLC 4J3FA 2HPZA 4QUIA 2PSFA 4PC6A 1H3NA 2FUEA 2NO0A 3A9VA 5ENZA 4AMUA 4C7OB 1KH3A 1S6YA 4I81A 1G4AE 4X8MA 4EF5A 1N0HA 4RWZA 4RTLA 3TFWA 3RGWS 2JFZA 1S9DA 5JS2A 4E2ZA 1AXGA 2FRVA 3FMFA 4RH1A 5ITZA 1UJ6A 1JHQA 1X14A 2IF2A 1KJQA 3KXKA 3WRYA 2HN9A 1KFKB 2NACA 5AVJA 5K3OA 4I5DA 1UBMS 4YQZA 4KLAA 2ONZA 4DBZA 5JO0A 1TNDA 2FPPA 2WM9B 3B3FA 3E7XA 3OZGA 2HO5A 3DUWA 4BLRA 4YRZA 5FTLA 4AWXA 1T10A 1XC7A 1P33A 4GPBA 1QCZA 2JIMA 5E7IA 3HY4A 3KEGA 3QI7A 3R20A 4KI0A 5C8YF 2OV2A 1O4VA 3K8YA 1QR2A 2FZ5A 1UPBA 2BHNA 3D3QA 1Y1LA 2J59A 5GP1A 1C8VB 4Q15A 1QHNA 2GD6A 2Y27A 1RQRA 2VF2A 4DDVA 1IXSB 3KYCB 3D4PA 4B6OA 3OE7A 1GCOA 3V1LA 2NPOA 1TZCA 5HP4A 2AXEA 4H35A 4P3PA 1ULBA 1TVEA 3TQOA 2XT6A 2IZ6A 1TAHA 2XRMA 1EA7A 2WDZA 1FUEA 5ES3A 1US8B 2AVDA 5EVCA 3H16A 3FF4A 3G9QA 4UHFA 1KHHA 1YL7A 1V1RA 4UBOA 3SC2A 5CCBA 3JQ6A 1K5GA 3L18A 4DDTA 2FVYA 2Q3MA 5LXTA 3CONA 5AVKA 3ZI4A 5IMSA 4WBNB 3TL6A 1XZAA 1NVUQ 4DLSA 3D4LA 2JI9A 2V9PA 4AKSA 1OB2A 5JXGA 4HGNA 1WXIA 1RFLA 2R87A 1HYHA 4BGIA 5C8VA 4J2OA 3PENA 1SD5A 3ZXIA 3EUEA 2XAUA 3IT0A 5DXAA 3WSTA 3GEPA 4TRJA 2FZEA 4YQFA 3DKVA 4MQEA 4WQMA 1OI7A 2H9IA 5JR3A 3PWZA 1N33B 4A1OA 2W93A 2OCLA 1X7GA 1S4MA 4FHEA 1XQWA 1TEVA 1SUBA 3I5MA 1R4MB 1QGYA 3DF9A 2B8EA 1DTEA 1NR7A 5D3MB 3UMBA 2PFGA 2PRZA 1L9KA 3STWA 2GAAA 1Z7BA 4URWR 3HEBA 2QTAA 3ROMA 4NBKA 1T9ZA 4IIVA 4MUFA 2O7QA 1GQSA 1ZXLA 3OCJA 4NL4H 4PYLA 4QTUB 3HFGA 1K63A 3IDAA 4LJ5A 3E3OA 3OPYI 4MMYB 3RSZA 3VU0A 1FMFA 3AF5A 4HDKA 1KO1A 1T2EA 1X7YA 4BNKA 1E3JA 1GDTA 2Z5VA 4EB3A 3NT5A 4J0IA 5BN3B 1Y9JA 2HA4A 5EIFA 3WLPA 1W2HA 1O08A 3TZHA 2HK9A 1JXOA 4PPFA 4YIKA 3UTDA 4TVKA 4WXMA 1NBAA 2O3QA 2HUPA 2H1HA 2ZR8A 3D6TB 2A86A 1OBOA 1TC2A 1V8OA 1T0UA 3O90A 4GOXA 2F8LA 3B6JA 4Y7DA 3TM4A 4PG8A 3EIQA 5CIYA 3QKSB 1H0KA 4TM8A 4LGVA 1FNDA 3IHLA 4HB0A 4BS9A 4F3RA 5KTYA 3B3AA 3MC1A 5ANRB 3EGOA 1QAOA 1EM8A 2ENUA 5H68A 4DBLC 1NKVA 4ZYYA 2WJIA 3UA3A 4FILA 4Q39A 3N9IA 4QG7A 1KWGA 2DPMA 4FZVA 5KOJB 1XAHA 2R6JA 2ECKA 1F7VA 1R4NB 4G0ZA 1X7DA 2CXUA 3IVRA 4Y0AA 2GN2A 4FOOA 1GGEA 5CLGA 5DRTA 3L4SO 2EWWA 2AC4A 4GI2A 4JYPA 8ABPA 1LB1B 4LC9A 1PQ4A 1FW8A 3KAJA 4TV8F 5COAA 3VGPA 1P3JA 5CB0A 2V45A 4WKOA 2QGNA 4NCBA 1M76A 5KOYA 3D7MA 3S70A 4G63A 2IUSA 1G20E 2J7PA 3NH6A 3OIYA 2CDNA 4ZU3A 3VU1A 1CIPA 5DYIA 2VP3A 5HKLA 4RKRA 4KNYA 3C3JA 2WABA 4UBKA 4PFJA 2R48A 1CT9A 2FG7C 1CS4C 1LI5A 4YJ2F 4Z1MA 4DR6B 2YRWA 1JIXA 3K2EA 3OMWA 3LGXA 1GPWB 4DE5A 1W93A 2JGRA 4OV6B 1QHFA 1E5QA 3VPHA 3TSOA 3VMFA 4KPGA 2VWGA 3K16A 3BMOA 4TTVA 4A03A 2FRXA 3HCFA 3KQVA 3MINA 3D4BA 3OJOA 3AXTA 4PAGA 1MJHA 4UTXA 2VOEA 1C3OA 3ITDA 3TVTA 1GU7A 5DHQA 4FDVA 2W0SA 2J45A 2YFQA 3SLKA 5CFOA 4MB0A 1P1JA 1LDEA 4D0GA 1QTRA 1IAVA 3D6FA 4CR8A 3LHDA 1H2ZA 1BH6A 4E88A 3DXYA 3K05A 2WVAA 4V0MA 1O54A 1V2HE 1GU1A 1CUFA 2DSTA 3MJRA 5DKFA 3KE9A 2IPOA 4RC9A 1F8GA 2P5UA 1ZJ6A 5EVJA 2MSEB 2J3MA 5LQSA 1I33A 5BSGA 1SC1A 1Q7GA 3H9EO 4WNIA 2WMDA 4EGFA 2FGJA 5B1EA 2FWAA 3SKXA 1N2EA 1KKUA 1VLVA 1OH6A 1E0SA 1CEQA 3P9ZA 2DBVO 4IUCS 3ZLBA 4MPTA 2RH4A 3JZIA 2IH4A