1QE1B

Crystal structure of 3tc-resistant m184i mutant of hiv-1 reverse transcriptase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
427
structure length
415
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYIDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lamivudine (3TC) resistance in HIV-1 reverse transcriptase involves steric hindrance with beta-branched amino acids.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase
molecule keywords REVERSE TRANSCRIPTASE, SUBUNIT P66
total genus 88
structure length 415
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1qe1B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1qe1B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1qe1B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1qe1B03
1S1XA 5DG7A 5KT4A 3GYNA 1EETB 4KHMA 3TQ1A 2W8KA 3MECB 4Q44A 3E51A 1KHWA 2BQRA 1HYSA 1C0UB 2VG7A 4IG0B 5HROA 3LP0B 3DOLA 2HNDA 1ZTWA 1XR5A 2AGQA 2J6UA 4TXSA 3KLIB 3TAMA 2D3ZA 3UPFA 2BE2A 5KFLA 2IC3B 2IMWP 3KLHB 4K50A 3E01A 4TN2A 3SFGA 5KG6A 1BQMB 4H4MA 4RW7A 5KG2A 4I2QA 4MFBB 2RDJA 4IR1A 1S0NA 3T19A 4ICLB 3NMAA 5J2PA 4EO8A 3IG1B 4NZ0A 5KFKA 1LW2B 2I5JA 3JYTA 4RZRA 4KB7A 5I3UB 5KG4A 4PWDB 5J2MB 1SUQB 4URQU 4U6PA 3DRRB 4O44A 2ASJA 4ECTA 5DGAA 1S6PB 4NLOA 4IDKB 3H5SA 1RT7B 4DEZA 3MR6A 3RB4A 1RT5A 3H40A 4ED7A 2FJVA 1RA7A 2QV6A 2R2TA 1CSJA 2WCXA 4TY8A 3KK3B 4PUOA 3OLAA 3EPGA 3BSNA 2BRKA 4Q0BB 1HPZA 2J6SA 3BGRB 2R8KA 3KLGB 1JLGA 3C6TB 2V9WA 3CJ2A 2VG5B 3BSOA 1JKHB 2FVQA 2UUWA 1HYSB 3BREA 5EDWA 3BJYA 4DL2A 4JV2A 3KHGA 3MEDA 4RW6B 1MMLA 3CIZA 1S1WA 1TVRA 3KK1A 4Y3CA 4EO6A 3IS9A 2UVUA 5KFGA 5F8JA 4O3NA 1JLFA 3KJVA 2HMIB 2UUTA 4FBTA 1TV6B 3HVAA 2JEFA 5C5JA 3MFIA 5DLFA 4Y2AA 3N6MA 3DRSA 3KHHA 1TL3A 4LSNA 3CDUA 1IKXB 3PJWA 4TYBA 1TKXB 3NBPB 1S1TB 2BANB 3DI6B 2B6AB 1EETA 3QGHA 5KFTA 2XCAA 2YKNA 1SUQA 2JC1A 4YMEA 4R5PA 5J2QA 5KFXA 4WXWA 4TLRA 3KLIA 3TAMB 2E9ZA 3DLGB 3DM2A 3QIPB 4B3OA 2BR0A 4KO0B 5HBMB 3OSPA 4J9RA 1LWFB 4KV8B 5L1LA 1QUVA 2E9RX 2FJXA 1HPZB 3GIKA 2D7SA 1C1BA 4K4UA 1HQUB 3DOKB 1S1VB 2W9BA 3I0SB 5CYMB 2FVPA 1C2PA 1XR7A 2I1RA 4MKAA 3BR9A 1S0MA 1UWBB 4O4GB 5KG3A 1S48A 1N6QB 3H5YA 4O3OA 3ISNC 3MECA 1HQEA 5T14A 4IG0A 3QGIA 4ED6A 4NCGA 2RF2A 2CJQA 4O3RA 3V6JA 4F4WA 2UVVA 4RNHA 4WYWA 4NLRA 1DTQA 5HP1B 1HARA 3N6NA 4WFZA 3KMSA 4NLDA 2AWZA 4ZP8A 1S6QA 3D28A 4QW8A 3M9NB 4WFYA 5KFHA 3QYYA 4ZVFA 5KFIA 4NLSA 3PR5B 3I5BA 3H4BA 1BQNB 4IFYB 3GV8B 4B3OB 1S1WB 2YNHA 1W25A 4HYKA 1JIHA 1EP4B 2C2EA 1RTJB 3RBEA 3CJ4A 5KFCA 4H4OA 2YNIA 5DQIA 1RT4A 1HQUA 3DOKA 5C25A 4TQSA 3RB0A 5C42B 5DQGA 4YR0A 4RW4B 4I2QB 3NBPA 5F8HA 2ASLA 3PW7A 2JLEA 2XGQA 1HMVB 2RDIA 4ZPCA 3GIIA 5KFRA 1RT2A 5J2NB 3MEDB 1IM4A 3SI8A 2OPPA 2AGPA 2HAIA 5KFBA 1KLMB 4QW9A 5KG7A 4RW9B 1FK9A 3CJ5A 1TL1B 3MEGB 4QPXA 3V6DA 5J1EB 2ZE2A 4GC6A 1JLQB 1FKPB 2XI3A 5KFMA 3DRSB 3C6UB 3E01B 1RT3B 5L1KA 2BQUA 3OL9A 4Q43A 4H54A 4O3SA 4RW7B 1DLOB 2ZD1A 3MR3A 3M8QA 3T5LA 1C1CA 1IKVA 4KAIA 4IFYA 1RAJA 1LW2A 2HNZA 1U09A 4MK7A 3MR2A 4IQXA 4NRTA 2IAJB 3JSMA 2YNIB 4H4OB 3QGGA 2V4RA 2UVRA 1RT4B 4O3QA 5L1JA 4NLQA 3CDWA 3ICLA 4O44B 1RT1B 2ZKUA 4ED8A 4NLGA 4MK9A 4MIAA 4WXOA 2IJNA 4LQ9A 4KKOB 3CDEA 3CJ0A 2WRMA 3D5MA 4J9PA 2RKIB 4RNNA 5D3GA 5KG0A 4ID5A 3KLEB 2YKMA 1NNDA 1OS5A 5KG5A 2OPRB 4Q8FA 1RTDB 3T5KA 2DPIA 3DRPA 2O5DA 2YNHB 1N5YB 5KFZA 2HWIA 3HKWA 4NLVA 1TKZA 1RTJA 3FQKA 3BQ1A 1S9GA 1REVA 4PWDA 4X2BA 3PVXA 1I6JA 4ECQA 4PQUB 5HROB 2W9AA 1QE1B 2BRLA 4NLWA 3GV5B 2R8GA 3I0RB 1GX5A 2W9CA 1FKOA 1SV5A 4IH6A 3Q8RB 1DLOA 1DTTA 1IKWB 4J9LA 4EYHB 3VQSA 5DLGA 2D3UA 5KT6A 5C24B 3GV7B 3IRXA 3NGDA 4WE1A 1TL3B 4EBCA 3KMQA 2AGOA 2BANA 3QO9A 4GC7A 2YNGA 3H5UA 2YKNB 4ECXA 3KHRA 1J5OA 2AX0A 4RW9A 4URGA 4OL8A 5J2MA 4RW6A 1N56A 1JLAB 3DM2B 3QIPA 1FKPA 3FSIA 3RB3A 3MR5A 3OLBA 3PW5A 4M95A 5D3GB 2R8JA 3HVTB 4KFBA 1HMVA 4TQRA 4F4XA 2OPRA 5KFVA 2JEGA 4PUOB 3OL6A 1IKVB 4YQWA 4H4MB 3DRPB 3BGRA 2WONA 1IKXA 2IM3A 3MTKA 3GQCA 4EEYA 3LAKA 2F8EX 4IKAA 3M9OB 3PW4A 1R0AA 5FDLB 3UQSA 5HLFA 2GC8A 4R5PB 5KFQA 1RYSA 3KOAA 4WYLA 1HNVB 4TYAA 3HVWA 4DL4A 5EWGA 3PJXA 4F4YA 3LP1B 4XPEA 4MK8A 1T03B 3DLKB 1MU2B 4ZVGA 4R8UA 3NAHA 3KK3A 3GIMA 4KBIA 3OL8A 2XC9A 1J5OB 4ED0A 3KLFA 1RT2B 2R2SA 5J2NA 5KT3A 4RW8A 4I7FA 1TKTA 1YVFA 4Y2CA 2OH2A 3NL0A 3TVKA 1JX4A 2BQ3A 2B5JA 2J6TA 4O3PA 5DG9A 1HNIA 5KFJA 4JUZA 1TL1A 3MEGA 3FDSA 3RAXA 4NLYA 4IOBA 4QWDA 1N4LA 4K4XA 2ATLA 5K14B 4ECSA 2HNYA 2WK4A 1S9EA 4G1QB 2AU0A 4K4WA 5F8NA 3QO9B 4RNMA 4IRDA 2YNGB 1LWEB 5HLFB 3G6YA 4HKQA 1JLBA 2R8HA 1LW0A 1N6QA 1RT6B 3DMJB 3MEEB 5KFWA 4ZMMA 3M8PB 1BQNA 4QWAA 2C28A 5DQHA 1EP4A 1FK9B 3PZPA 2RF2B 3DLGA 5KG1A 1S9FA 1IKWA 5F8GA 4KO0A 3DYAA 5HBMA 1IKYB 4ZHRA 3IRXB 3ITHB 2QE5A 3I5CA 4ZP9A 5F8IA 2W7PA 2FLLA 1S1XB 2FVRA 4ZPBA 5DGBA 1T3NA 2OPSA 1S97A 1TKTB 1RA6A 4MIBA 4M94A 1S6QB 1UWBA 4O4GA 3NKYA 1TKZB 3UDLA 4ECZA 4DG1A 2WB4A 4Y34A 3PW0A 2ILYA 5KFFA 4K4ZA 2C22A 3V81A 3NAIA 5KFAA 2W9CB 4J9KA 1T03A 1S0OA 1DTTB 4FBUA 2ZE2B 4QWCA 4KKOA 5KT7A 5KFSA 1LWCB 2RKIA 1VRTA 1RTHB 4ZVHA 3PHEA 1K1SA 2R8IA 2WOMB 3KLEA 4I7FB 1R0AB 1RTIB 3MEEA 3M8QB 3CVKA 4J9NA 1C1CB 2YNFB 3QZ7A 4ECUA 2V4QA 3LANA 3V4IA 2FJWA 1T94A 1VRUA 2HNYB 5KFOA 3RBDA 3T1AA 3FRZA 5EWFA 3I5AA 5EWEA 4J9QA 3V6DB 3HVTA 4KFBB 3OHAA 4G1QA 1TP7A 2IM1A 2JC0A 3IGVA 2IBKA 4ED1A 4IG3B 1RT3A 4NLPA 4LSLA 3IGNA 1JLEA 1LW0B 2WHOA 3RB6A 5F9LA 4ECWA 1QAJA 3LP2B 3QIDA 4YR2A 5CYQA 3Q8SB 1HNVA 2JEJA 4WZMA 4IFVB 4ECYA 1S10A 2XCPA 3KLHA 1JLAA 1RT1A 4I2PB 2XI2A 2HWHA 3LALA 3KK2B 5J1EA 1MU2A 1RDRA 3H98A 2FLPA 1Z4UA 2VA2A 1JLGB 5J2PB 2VG6B 1ZETA 1RTIA 3CWJA 5KT5A 4RU9A 4DG1B 2ZD1B 3ISND 4F50A 3G86A 2WTFA 2VA3A 1N5YA 2HNDB 3BQ0A 3SFUA 4IDKA 2FVSA 1T05A 3HHKA 2BE2B 3EPIA 3FQLA 1TQLA 4RUAA 1IKYA 3Q8QB 1JLCB 4DL3A 4ZHRB 5EUHA 4U7CA 3LP1A 4KSEB 3FFIA 5F8LA 1FKOB 1SV5B 3IN5A 1N48A 4URSA 1HQEB 3H5XA 1GX6A 3GILA 4J9OA 2OPQA 2CKWA 5I42B 4QWBA 2EC0A 2YKMB 1NHUA 5L9XA 3OHBA 4FS1A 4ED2A 3T5JA 4J9MA 3RAQA 2C2DA 2AQ4A 3BSAA 2XWYA 4G3IA 2GIQA 4DL6A 3LP0A 1REVB 1DTQB 2FVCA 1S1UB 2DPJA 2C2RA 3DDKA 2UVWA 4Q45A 4JV1A 4TY9A 1QE1A 3UR0A 5F9NA 4WZQA 3KNAA 1TKXA 2OPSB 4EBEA 2B6AA 2ASDA 1QAIA 4EBDA 4K4VA 2VG5A 4ICLA 1KHVA 5KFNA 3OSNA 1WNEA 1C0TB 2R2RA 1LWEA 4YR3A 4R0EA 3KLFB 2D41A 5JUMA 4KHRA 4RW8B 4IRKA 3V4IB 1RT6A 3DMJA 3LAMA 3DLEA 5FDLA 2GIRA 3IS9B 4I2PA 4RUCA 3QLHA 1JLFB 3KJVB 2HMIA 4ECVA 1SH0A 1TV6A 3H4DA 3KK2A 1C1BB 4MH8A 4JV0A 3FFIB 3KHLA 3OL7A 3GIJA 1S1VA 2W9BB 4NLXA 3V6KA 2VG6A 1JXLA 4DL5A 3KLVA 4LSNB 4YP3A 3BSCA 4XO0A 5KT2A 5I42A 1S9EB 3DI6A 4NRUA 3PW2A 3Q8PB 4FS2A 2IA6A 1SH2A 3C6TA 3IG1A 3MF5A 4Q8EA 2WONB 1KLMA 1JLBB 2I5JB 5CYQB 3JYTB 4WFXA 3MFHA 3M9MB 4IFVA 4EYIB 2W8LA 3G6VA 1VRUB 2B5JB 3DRRA 1HNIB 1LWFA 4KV8A 1TVRB 4IH5A 5C42A 3BQ2A 3C6UA 4RW4A 1RT7A 1D0EA 1SH3A 3CO9A 4F4ZA 2IJFA 3QZ8A 5K14A 2IC3A 5KFEA 2W7OA 4ZPAA 4TY8B 4LQ3A 4IG3A 5KFUA 4ZP6A 4LSLB 4Q0BA 3ITHA 4K4TA 1JLEB 4MFBA 3DLKA 4R8UB 4ZP7A 2V0NA 1S1TA 2WOMA 2IAJA 2OPPB 4XPCA 3JSMB 3LP2A 4NCGB 2B43A 1JKHA 4ZPDA 4QWEA 3T5HA 2ALZA 2FLNA 4O4RA 4K4YA 5I3UA 3V6HA 3QLHB 2IM2A 4IR9A 5C25B 5KFDA 1C0UA 2VG7B 1JLQA 1K1QA 1S49A 3DOLB 4NLTA 4NLUA 3KK1B 2AX1A 5KFYA 4J9SA 1RT5B 3V81B 2JEIA 4DL7A 4ECRA 1S4FA 3H59A 3N6LA 4RNFA 2OPQB 1BQMA 2ILZA 1LWCA 1RTHA 3EZUA 4NYZA 3G6XA 5L1IA 2E9TA 3KLGA 1D1UA 1S9GB 1NHVA 4RNOA 3DLEB 2XGPA 4PQUA 2YNFA 5J2QB 1T05B 2R2UA 3CJ3A 4MKBA 5KFPA 4ED3A 4K4SA 4ZVEA 5DG8A 2IM0A 1S1UA 3M8PA 3I0RA 1XR6A 5JXSA 1RYRA 3H2LA 1JLCA 4IH7A 1S6PA 3PR4A 4IRCA 5C24A 4WE1B 4ID5B 5HP1A 4KE5A 3DYAB 1RTDA 1ZTTA 5F8MA 3I0SA 5CYMA 1C0TA 2HNZB 1VRTB
chains in the Genus database with same CATH superfamily
1XTZA 2ABYA 4W90B 2DIUA 4ILRA 3GB0A 2GQQA 5K8NA 1HHSA 4P74A 2MQQA 2OP5A 2LQBA 3ONQA 1C0UB 5HROA 1ZTWA 1VMBA 3DOLA 1UPMB 3B6BA 4WKRA 2HFNA 1P6TA 2F4VF 1KS2A 3OD2A 5IV4A 4I6WA 1L3TA 2IMWP 2I2YA 3SFGA 4NI2B 4H4MA 2VBYA 2AJ2A 4LRCA 4RW7A 4RPFA 3EZ5A 4MFBB 2RAQA 4CO2A 1IBKF 3ZZTA 5M2UA 1UKUA 4EO8A 3C19A 5I3QA 4JI6J 3O5TB 1HWJA 1RXOB 1UJ5A 4HHJA 2IYGA 5CXTA 4PWDB 2E29A 3EXYA 4DV3J 1P27B 4FP9A 4FVCA 4U6PA 2W2QP 2HW3A 1ZZFA 2YX4A 4NLOA 3H5SA 4CT9A 7FDRA 3RB4A 4A8KA 3DU6A 4ED7A 3D1QA 1KVJA 1VBYA 5T41A 2R2TA 3AXKA 1DY3A 1U0SA 3KK3B 1BUXA 2UV8A 3IAS9 3IXQA 3O1LA 1VHIA 3HT3A 4DPYA 5D15A 2VFTA 3KLGB 1DHMA 1B99A 2A2DA 3CJ2A 4LF4J 3GSIA 2V67A 4DR6J 3BJYA 4DX7A 4IQMA 5D4NA 4CO1A 1I94J 1OQ3A 2MQMA 1CJTB 1N32F 3MEDA 3P49B 4RW6B 5DDRC 2XMAA 2VC0A 1TVRA 2A6MA 2VBXA 3Q83A 2BJ1A 4Y3CA 4EO6A 5KFGA 2HMIB 1RADB 4FBTA 3BBFA 1NB7A 3T1HJ 4HVZA 1HNXJ 3MI7X 3N6MA 3KHHA 1TL3A 4LSNA 1HWUA 3MUTP 4LVOP 3G4SS 1S1TB 2HZCA 2B6AB 5KFTA 3OR2A 2CAJA 4LF6F 4NCAA 3S01A 3HFVA 4YMEA 4R5PA 4YHHJ 4WXWA 3VVUA 3L3CA 3D1OA 2MLZA 4TLRA 3VVTA 4F02A 1OYEA 3LO3A 2E9ZA 1EQ0A 3DLGB 1CJKA 4KRWA 4DU7A 4B3OA 2BR0A 1AFIA 3KYLA 2F7VA 4KO0B 1Q5VA 2GVDB 2MLXA 2COLA 1LWFB 3JXOA 5E2QA 5L46A 4J9RA 2FJXA 2FD2A 2E9RX 2D7SA 2EVZA 3DRYA 1C1BA 4K4UA 4CCHA 1S1VB 2LQ8A 2P9EA 4NL5A 2W9BA 2Y1LB 5CYMB 3AD7C 2HHHJ 1UWBB 2QSWA 5DS7A 1JB0C 1S48A 3HSJA 3KWMA 4EGLA 1X4EA 1T0TV 5IS2A 4MKYA 1BHNA 4DSFA 3EUNA 1R0BG 4NCGA 4NEYA 1SQFA 2UUBF 3QT8A 4IOCQ 2DCUB 3UFCX 3K8VA 1YITS 2HVDA 2CJQA 2HS0A 3P45B 2NCKL 3RRHA 3SXLA 3JTPA 3AQPA 3IBWA 1KP6A 1E6VB 1HBOA 2FJEB 1FRJA 3N6NA 4K0KJ 4IYQA 4NLDA 3J81U 4ZP8A 1VRQC 3I87A 1IBLJ 3M9NB 2EXUA 2BVZA 2OELA 2CPDA 3BKUA 3QT5A 3L7PA 4NA3A 5KFHA 1QDUB 3UDEA 1Y5NB 4GO7X 3RR8A 2IRUA 2XY7A 5J1NA 3GV8B 2MKHA 4HYKA 2UXCF 4DR7J 2DKOB 2VJUA 4ANEA 4DUZF 1CS4A 2CWXA 4USKA 1SJFA 3RBEA 4OMFG 5KFCA 1XN9A 2ZH4A 2KTQA 2LU2A 3DOKA 3P6YC 4TQSA 2Y9HA 1RACB 4YB6A 4ZVSB 4RW4B 4I2QB 2OKQA 4FYWB 4B3RF 4JYAF 3NBPA 1Q4RA 1GMVA 3BPSP 3FNNA 4M5GA 1YJUA 4I67A 5CA5A 1XNRJ 4PZVA 1VLYA 2YX1A 3TA0A 5JJBA 3GIIA 3K17A 2OPPA 2AGPA 1NPKA 2HAIA 3MAAB 2QA4G 2A6OA 1YDLA 3M8WA 4OYIA 1QVGR 3BEGB 4RW9B 1WUUA 1FA0A 1TL1B 2BM0A 3CJ5A 3HSZA 3P3DA 3VAFA 2UXBF 4LF6J 2HHTA 2F8HA 3TA2A 5J1EB 4YY3J 2ZE2A 4ETZA 2DGXA 2IMOA 2XI3A 1KD1T 1VK3A 3C6UB 2O3DA 3FBEA 4LRBA 4P10A 5HMXA 2BQUA 2HAFA 2XO7A 3GLJA 3TP2A 4RW7B 1FFGB 2GJFA 2VU5A 1WKJA 4U95A 3M8QA 2GGPB 3IWNC 1C1CA 1IKVA 1UETA 3G87A 1HNZJ 2GO8A 4YN3B 3T1YF 2HNZA 2EFNA 2QLFB 1NPRA 3K5LA 3MR2A 4FF2A 3JSMA 2FY8A 2YNIB 3QGGA 3QNWB 2UVRA 1RT4B 4O3QA 4NLGA 2DGSA 4O44B 2ZKUA 2F9DA 4ES1A 5CCLA 6AT1B 2CQHA 5EHHA 3CW2C 4WTOB 2UXDF 4MIAA 2ZUGA 2IJNA 1IQZA 4LQ9A 4YEAA 2V8DA 5AE3A 3CDEA 1TUGB 2WSFC 2WRMA 1WHXA 5ETKA 5HI7A 4WP8A 3CCZA 4J9PA 3CCLS 3EICA 3R7NB 5KG0A 3VCDA 4RNNA 1NNDA 4Q8FA 1YK9A 3NRBA 3MCSA 2BZ2A 2KO1A 2EI5A 2YNHB 3PDNA 2FLOA 4GKJF 4MYTA 3TYTA 1CS4B 3T6BA 3PVXA 2G0IA 2BV3A 2CPEA 2WB1D 3JQMA 2W9AA 5H9EJ 4OFZA 2BDPA 2BRLA 4NLWA 2LDIA 4OQJA 1GX5A 4LBPA 3GV7B 2W9CA 1DLOA 3OJSA 4RU2A 1VK8A 2CNLB 1YLXA 2D3UA 3MTJA 2J5AA 3GJTB 5BXIA 5KT6A 5IFMA 1Y3KA 3F0NA 3DNCA 5ETVA 3NGDA 2DISA 2DNMA 1ELOA 2QA2A 1UEVA 5CD4A 5SZTA 4EBCA 1TK5A 3HHDA 3UO0A 2DRBA 2RD5C 2F4VJ 1P9YA 3VAJA 5CABA 4ZPTR 2AX0A 3MDFA 4RW9A 5KOWA 1RKJA 3AQOA 1JLAB 1NB2A 3FSIA 3P8BB 5LSOA 3PW5A 1E6YA 5E5NA 1AZSA 2J76E 3N9UC 2CXEA 1Z2LA 2OPRA 2QMXA 3OFFA 4NX9A 3WC0A 4TQRA 1XNQJ 1HW8A 1IKVB 3NY0A 3RW6A 2E66A 3UCZP 1URNA 3BGRA 2WVBA 2LQ5A 1O0PA 2IM3A 2YWWA 3S7RA 3GQCA 3LAKA 4IKAA 3MM9B 5HMWA 2AZ3A 3BR8A 4BWMA 5HLFA 3FSXA 3WBZA 4JV5F 4FKXA 4ZJOA 3L7UA 4ZS6A 1OY6A 1SKRA 2LDYA 4DL4A 1S59A 3M2VB 4MJKA 2VPZB 4HL9A 1VFJA 4DZDA 4MK8A 2DGWA 1T03B 2QX0A 3DLKB 4ZVGA 3C14B 1ZPVA 2HQDA 2PA3A 3AOCA 3QBCA 1S76D 3PRDA 2PO4A 4OYBA 1MLAA 3R97A 4ED0A 3M1VA 1U1NA 2RMLA 4Q7AA 1N88A 5FLXU 1YHQS 2CPIA 2OI2A 2DITA 3GR1A 4ERDA 4IQXA 2XYPB 1C4CA 3MEGA 3ZO7A 2UXBJ 3LGMA 2Q43A 2QJ3A 4QWDA 3CCTA 1KFSA 3TOQA 1YQHA 5K14B 3G8QA 5LOQA 2AGOA 4C8ZA 1SJ3P 2RB7A 1XEZA 3D68A 1NCLA 1M5PC 2WK4A 3CGIA 1AYEA 4NYOA 4EZ6A 4X62F 3QJLA 3NG8A 3ZTPA 4K4WA 1U2FA 1I5OB 4U8VA 3M32B 3A8KA 3MR7A 5B0CA 5B0AA 2DGUA 1S72S 2R8HA 3I31A 3OXLA 2QMUB 2AV5A 3CJSA 1GK8A 5A8WA 1RI7A 1RE1B 4LBIA 2GMJA 4LFAJ 1I94F 1U8SA 3AJ1A 2R7TA 1WEYA 3J80Y 2C28A 2XMJA 1M5OC 4JI5J 2UXDJ 4B3TJ 1E6YB 4M5KA 5ADZA 3AA9A 2QZ8A 1PJ5A 4YDXA 3R7BB 2R3VA 4CO3A 4XIUA 1S77D 3IRXB 3A12A 3OFHA 4J9VA 4ZP9A 2OTJS 3M2RB 2FVRA 4ZPBA 5DGBA 2VQEF 2OPSA 3CE8A 1FX4A 5FD1A 1RA6A 2FB0A 5E7OB 3EVOA 3IM8A 5ETNA 2KXHA 4CH7A 3MPWA 3UDLA 3BO4A 2D3OR 2WB4A 2YQ3A 5D4OA 3KG4A 4DFJA 2O66A 3S6EA 2K8GA 5E0OA 1VR6A 1GNKA 1RGVA 2P6SA 2VC1A 3D6MB 4G1PA 4QR0A 3FCHA 5GAGU 1HHTP 5ETSA 3L4BC 3NAIA 1NBEB 3TAPA 2FGCA 1TKDA 1DTTB 2DCLA 2ZE2B 4Q2LA 1WG1A 4C8MA 4QWCA 2BOPA 3D4JA 4ILMA 3GPAA 4ED5A 2RKIA 4P6QA 4QIFA 1FT8A 2HHHF 3AB4B 4ENOA 4CTAB 4WKYA 3AT1B 4X4OA 2QLJB 3I32A 4FNHA 1C1CB 2F8MA 1H2VZ 1URRA 1ZA1B 4OYAA 2XY5A 3O6QA 2R7RA 2UUBJ 3LANA 3CEDA 3IP0A 2PSZA 4DPTA 2SXLA 2FHJD 2P6TA 4DX6A 1AW0A 3T1AA 2ZOGA 1QVFR 3FEYB 1HR0F 1RHQB 5HK4A 1JWWA 3OHAA 1TP7A 1FTCA 1ZPWX 2AKWB 2IM1A 5GAGI 1IR2A 2LFVA 3J80U 2DB1A 3D2WA 1RT3A 4LSLA 3GE9A 1PGZA 1O6XA 3CJKB 2OGUA 1EKSA 3QATA 2WHOA 4NA2A 2LXUA 3OVSA 1GMWA 2XMUA 2YWGA 1UWAA 2LQJA 2JEJA 4WZMA 3C16A 3RUBL 5H9FJ 2KM8B 4ECYA 2DYAA 2HIQA 2JFKA 3T1YJ 1Y4ZB 1QM9A 3MWBA 4QZVB 3B4DA 2H54B 1HNZF 3ZTOA 1JQGA 4BBYA 1Y00A 3LW5C 3KK2B 1D8YA 2IBOA 4DV5F 1WSRA 1Z4UA 4LF1A 4RWXA 1ZETA 1VQKS 3D9BA 1U1LA 4FF1A 4PAAA 2ZDPA 4C6AA 2ZUAA 1FKAF 2V94A 2FJDB 3VAIA 1LNQA 3R8YA 2W4CA 4DN0A 1YRXA 3W9HA 5GAEI 4DWIA 1MMDA 2ERRA 1KRPA 1T05A 1LXJA 3HHKA 4KT0C 4JI7F 3HZGA 1TQLA 3OVBA 1IKYA 1NK5A 4CNZA 2G0CA 4ELTA 2UU9J 2DEJA 2A2CA 2XNRA 1AZSB 1FKOB 1B0VA 3W2VA 1H7XA 1NSQA 2CQGA 4I6AA 3MUVP 1N48A 1Q53A 1SC1B 1YTYA 2OPQA 3LQVA 1BMQB 4QWBA 1UVMA 2YKMB 2OMLA 2ACYA 3RAQA 2KFZA 3PYFA 3L95X 3T5JA 3MM7B 2LP4A 4IO9Q 3PO5A 1HI0P 5IC6B 2BKNA 2GVDA 4N56A 2ZZNA 2ZH7A 4B9LA 1CJUA 2HRUA 1REVB 3WX4A 2X1AA 3B54A 2FVCA 4DN9A 1X4GA 4A8FA 1SL1A 3DLBA 2RU3A 4JV1A 4NOHA 3KDOA 4K5SA 3BS9A 4NA1A 4TY9A 3T6JA 5F9NA 1XQIA 2PA8D 3MM5A 4ER8A 2NR0A 2VQFF 4LT6A 2ASDA 2IVFB 5ETLA 3R7SB 1NU4A 2BJ8A 1QAIA 5LM7E 2CQ3A 2VG5A 2KJVA 5LMNJ 4F3OA 5KFNA 2CDRB 1PYOB 1C0TB 2R2RA 3F41A 4EI2A 4BS2A 2ZBPA 2PN6A 2R7QA 2ZHOA 3HDSA 4KHRA 1JK9B 3W9IA 4IRKA 2GIRA 3DLEA 2OEMA 5E3RA 1WJ9A 2V4JA 3IS9B 1XNQF 1VQPS 3QLHA 1JLFB 1LKZA 2M70A 5SUHA 4OI4A 3QZ8A 1IBLF 3BBCA 3MCMA 2DD8S 3GIJA 2CQIA 1HKAA 1X9MA 5FIIA 3V6KA 2VG6A 1KVIA 1EQMA 4DQPA 2CPFA 2QIFA 3QQCD 3CMAS 4BHQA 3MHYA 4XO0A 4HHHA 2VFVA 2EPIA 4F2RA 4C8LA 4KPYA 5IXUA 4FS2A 2DRAA 8ATCB 1RBOB 2W2NP 1NK4A 2WONB 1S6OA 2UZAA 1JLBB 4WFXA 1M5KC 4M1KA 4OJ1A 1FF2A 2W8LA 3JB9k 4ILLA 1VRUB 4IUFA 5IM0B 2Y0BB 2V2VA 4KTQA 1HNIB 4JI4J 1TVRB 2XMKA 4O0IA 2KN4A 3NOCA 1CQNA 1SH3A 3CO9A 2G2YA 1UA1A 3J7AN 3RZAA 5L9NA 1GH8A 2M88A 4ZP6A 1VQYA 1HD0A 2EFQA 3WC2A 4CLYA 2RQKA 4R8UB 5HSPA 4ZVPB 4ZP7A 1D8ZA 2QL7B 2Q6CA 4XPCA 2OPPB 3JSMB 2B43A 3ETOA 1W2BR 1BWVA 4ZPDA 1X0PA 4JI8F 4ZLLA 1YRTA 3MCOA 3W63A 4A8YA 1VQ7S 1FHTA 2XS7A 3CT9A 5IV3A 2VG7B 4UY8T 3DOLB 1R43A 2J0XA 1V5VA 2AX1A 3L7OA 4LJMA 4J9SA 2VPXB 2KVIA 5A76A 2RH3A 5BR8F 1SB6A 2ZBRA 5J1PA 5DM6Q 1TMJA 3G6ES 4P75A 2CJYB 2NYHA 4JP8A 1YKWA 1DBDA 1KNZA 3MOJB 2AJ0A 2ILZA 4CLSA 3A3OB 1OWXA 1SC3B 4Y00A 3MMCB 4NYZA 3AFGA 2AEFA 4WK3A 3HPOA 1YJNS 4DR4J 1ZAWA 3GFXA 2XGPA 3EGNA 5E33A 5J2QB 2J0WA 2R2UA 2MSSA 3AH6A 4MKBA 5KFPA 4HDGA 3WX8A 1U1OA 2JFDA 5F41A 1D09B 1RYRA 3H2LA 2HHVA 3AB2B 4USJC 1SJQA 5IZHA 5C24A 1BD6A 2YKAA 1JXEA 4JBCA 3S1TA 2KKHA 1HBOB 2XWXA 4KE5A 3TX8A 4E2FB 2FC8A 2UU9F 4RUCA 3CF5Q 1C0TA 2VZ9A 3PM9A 1S1XA 2HK2A 3IR6B 5KT4A 5DG7A 2W2MP 1EETB 3TQ1A 3MECB 2YY3A 1KHWA 4HT5A 1U26A 4B9VA 4IG0B 1MN9A 5KTQA 1GXTA 4CLFA 1B3TA 4NXMJ 3W62A 1U1QA 3UPFA 1FDBA 2KT3A 1TK0A 4NEZA 1BE4A 3GG1A 1ACMB 2CQ2A 4TN2A 1UEUA 4ZN1A 3LWLA 3BGOP 4TU8A 2BW2A 1H2TZ 4I2QA 5KG2A 4D3GA 2P9GA 2RDJA 4IR1A 1IJEB 1YJVA 1S0NA 3QRRA 1IQTA 3KJFB 2PEBA 3R6LB 2PC6A 4NZ0A 5KFKA 1LV5A 4L72B 4M5IA 3HD1A 4WP3A 4RZRA 5I3UB 4DS5A 2M52A 1IBMF 3P5TL 2V63A 3DRRB 3GCWP 2ASJA 4DR2F 4ECTA 1LOUA 1S6PB 2L9NA 4IDKB 3ILOA 1NAQA 1FRMA 1RT5A 3TJ9A 4N41A 3HSGA 4J37A 2FJVA 3CXCR 2Y1IA 2K1RA 5LXYA 2XS5A 1XK8A 4FYXB 4PUOA 3EPGA 4XAKA 3A3NB 3HI9A 4Q5VA 3BGRB 3GFYA 1RAAB 3TX0A 1A6LA 1Y9OA 1NXIA 2BACA 1XJWB 3MM9A 4PXEA 1JJ2R 2V9WA 4QR2A 2VG5B 2FVQA 1EJ7L 1HYSB 2I0XA 4DL2A 4CNYA 1KN6A 1BY9A 2GAHC 2MHNA 2BX6A 3KHGA 4JV2A 1NEEA 2DNOA 3C46A 3PKMA 1EHWA 1MMLA 2CJXB 1U1MA 1APSA 4X4QA 1PKUA 3IS9A 5D8HB 4O3NA 3TRGA 1JLFA 1CJUB 2UUTA 2L41A 2BM1A 5AJ3J 1KQSR 5DLFA 1VQ8S 5AJ3F 3H8YA 4Y2AA 3TJ8A 2MZ1A 3DRSA 3CB4A 3PKYA 1NJZA 3CDUA 3ENVA 1GQEA 3PJWA 4PG5A 3P5BP 1TKXB 5D4LA 4ZVTB 2BANB 4OJGA 3UNYA 1KSPA 2DNQA 4L6V3 3Q89A 1O51A 1W7WA 4ANDA 4Y6IA 2L9WA 4U8YA 4ZCMA 5GAEU 3TAMB 2H4WB 2NZCA 3OV7A 1RHKB 5K8OA 3K59A 5K5MA 1FD8A 2IRXA 3ZZOA 4NE9C 2ADBA 2ROPA 1UEKA 3BYRA 3GIKA 1CVJA 2OSRA 5T7LA 5BYSA 3CNQP 1YJWS 4UZCA 1RU2A 2OEJA 2XSJA 1SVDA 3I0SB 1AROP 1C2PA 1N34J 4NXMF 4DLGA 4MKAA 4U7UK 4WTYA 4ZIWA 2AP6A 2YVSA 4KGZB 2Q79A 2DNYA 4O3OA 3MECA 3UN5A 1HQEA 3H5YA 5T14A 2ZJQQ 3W65A 4IG0A 1FI4A 1F3VA 1RCXB 3QGIA 1A9NB 5K9FA 2XO6A 5AT1B 2MKIA 4F2SA 2RF2A 4O3RA 3M4XA 2BA9A 2GZOA 5E41A 2MQPA 2M8DB 4ZN3A 1GEHA 1RAOA 2UVVA 4FKYA 3MMBB 4WYWA 3MD3A 1HR0J 4C8OA 2EG1A 2B51A 3X3UA 4LRAA 1NRKA 2BJ7A 5ETQA 1HLWA 2GW8A 2Z56B 3POTB 4K0KF 3N0VA 2VOPA 2YWFA 4CLZA 3VV2B 2Y1JA 2UUCF 4W4MA 4F26A 5LT5A 2DNZA 4LF7F 4ZVFA 5KFIA 2DH9A 1RB0A 2YTCA 5B09A 4LF7J 4CM2A 1BQNB 2RUSA 5MAOA 2OTLS 3HKZD 1S1WB 3AJ2A 3MZIA 4QBUA 3I9ZA 2NREA 4NYPA 2C2EA 3PTWA 1RTJB 2QTWA 4A8QA 3CJ4A 2YNIA 4CM0A 3DCAA 4L3NA 3Q0AA 2F1FA 1HQUA 1PO6A 3U7JA 1K8AT 1IWAA 2HFZA 4OX6A 5IT9U 4X65J 4FXWA 5F8HA 3PW7A 2JLEA 1ZA2B 3ENAA 1F60B 3CJ8A 1NDCA 4ZPCA 2GV1A 1KOOA 5IQ6A 2BE9B 1WF2A 2DNPA 3ZZPA 3ZZUA 3FZ2A 3R5JB 3KTQA 4DUYJ 1FXLA 1F0XA 3PRVA 3M1VB 4Y28C 2J8SA 4M5DB 4ZITA 5KFBA 1X7VA 1KLMB 2JJ4D 2RT3A 3PYDA 4GVBB 4QW9A 1VLOA 3R1HA 2FLNA 1X5OA 2RNEA 3GYXB 1VGYA 2MDAA 2Z2YB 4KH0B 2IHR1 4WWSA 3UDCA 1JLQB 1FKPB 1U6ZA 3W60A 3NNAA 3R2DJ 3DRSB 2HVHA 3H5XA 1RT3B 5DZ7A 1N0UA 2E5LF 3CCVS 4RWWA 4UT4A 2E5LJ 1DLOB 2ZD1A 1UZHA 3MR3A 1PC5A 1AT1B 4KAIA 4IFYA 1F9HA 1N5QA 1RAJA 4P71A 1QSLA 4V19X 1DARA 3MMAB 3IR7B 2LLZA 4MK7A 4USVA 2BKOA 2E7WA 4LRDA 1NK7A 4CDIA 2A18A 4U9RA 1I3OB 1S57A 3ET6A 4WXOA 4R0JA 1VJWA 2MYFA 2GMLA 3KUEA 2MXYA 2KXNB 3FZBA 1Q95G 2DR6A 4S0MA 3TA1A 3W7BA 5D3GA 5CZVA 2I9SA 4ID5A 1P9QC 2W01A 4LFBF 1N33J 1OS5A 3R9LA 5KG5A 2VKZG 1RSCA 4WU3A 3AD8C 1RWKB 3QT7A 3T5KA 4K2XA 2XLKA 1UMJA 2V2KA 1U02A 4PQAA 4C3KA 2AD9A 2HWIA 2B8PA 3M7VA 4NLVA 5B0DA 1TKZA 2KYXA 1Y5IB 1IXKA 1F5BA 1MROB 1WD6A 1U0HA 4PQUB 3KUGA 3R27A 5F3ZA 5HROB 4OI3A 3VQTA 3G96A 4OYPA 2R7SA 3RRKA 1EARA 2VODA 3GV5B 3NWGA 3CJQA 2PE8A 1FKOA 4EYHB 1VOMA 3C15A 4JV5J 1LK7A 4I6YA 1X9WA 2QLBB 5JVHQ 5HVGA 1KFDA 1DRZA 1TL7A 1ZS6A 4HACB 3KMQA 5IQQA 4C97A 2E1AA 2Y8WA 2YNGA 2FZCB 2VHGA 4AQYJ 2RS2A 3DLHA 1VCTA 4KGMA 3EWGA 2GX8A 3MM8A 5J2MA 1R8PA 2JWNA 1FESA 1FKPA 4DX8H 3MR5A 5BYQA 3PEJA 4KH1B 2AYBA 1I51B 2MKYA 2PEHA 1H6KX 3K5OA 1YBAA 5T7LB 4KFBA 1CEZA 2DGTA 3HHLB 4CLLA 4F4XA 5KFVA 1NSAA 3NOGA 3QRPA 5EGYA 2HHSA 4YQWA 3VAMA 1WC0A 1U1PA 2YPYA 4PYAA 2WONA 4YY3F 4DFKA 4ED4A 3M9OB 2UUCJ 2BOAA 1UW9A 5IWAJ 4P73A 3D67A 1S6UA 1UA0A 2GC8A 1JMTA 3A8EA 3M2UB 2NSCA 3G71S 2V9KA 4EZ9A 3KOAA 1OMSA 1HNVB 1YZ7A 3ET6B 3D3CJ 4C7QA 3ILLA 2DR9A 4OLOA 3UD5A 4QIEA 1UVNA 4X66J 2RDDA 4QPTA 3LP1B 3CDAA 3FSYA 4F4YA 2XS2A 2WZ1A 1M5HA 3G9CA 4R8UA 4JYAJ 3GIMA 3TI0A 4MKVA 4X64J 4L3KA 3OL8A 1IUJA 2XC9A 1SKWA 3MMJA 3D1HA 2A3JA 3SMZA 4ZCIA 3M8RA 2OH2A 4RW8A 3GR0A 1TKTA 2FHKA 4PXDA 1WHVA 4W92B 1NHKL 2IYIA 2BQ3A 3NL0A 1HA1A 5DG9A 1HNIA 5KFJA 4JUZA 3GFZA 3FDSA 2HK3A 5ETOA 3OJUA 4JI1J 1N33F 2XZTB 2APOA 4CI0B 5AXLA 2XY6A 2WSEC 2J9EA 3BV8A 4RL1A 2JRSA 3DDIA 4CH1A 1NJXA 2HNYA 3AXMA 2RS8A 3A8JA 3SV4A 1S9EA 4UUWA 4P52A 4RX6A 5HAOA 3W64A 2FC9A 5F0WA 1MG7A 2KHDA 1A0OB 2OIHA 1LWEB 5HLFB 4OZ2A 3G6YA 3CC4S 2VASA 1CQMA 1N6QA 1ZM2A 2FGOA 4DV2J 1U45A 1R8AA 2X7IA 3VZHA 4KJIA 1EKRA 1HW9A 4ZMMA 3CMQA 1T95A 3R5GA 3R6GB 3O2IA 4P2XA 3TJAA 3DU5A 3GONA 1X4FA 1FK9B 1YRUA 3SQGA 3PZPA 3M6VA 1XC9A 3NS7B 1F5AA 2VIHA 2RJZA 3HHLA 5HBMA 3FBCA 2B3TB 3IC1A 1U49A 4OHYA 1GT8A 2MQLA 4OI6A 3ITHB 1H7WA 4KYZA 4QIGA 4B9SA 2EEYA 3J7Z5 2RSQA 4DV7J 1WC6A 2KHCA 4RJVA 3FVYA 1IVZA 4ED3A 1UWBA 1PAUB 2DHGA 2K2PA 1Y0HA 3NKYA 1NKBA 3FKBA 4ECZA 4DG1A 1HQ2A 4RKUC 2EK1A 2KDOA 3W5XA 2ZHAA 3PW0A 1KR4A 3ETMA 4J90A 2UP1A 1RZMA 2G0JA 2Y1RI 2FHMA 1B0TA 5CAAA 2V69A 3SBMA 2AJ1A 3V81A 1UZDA 2FJAB 3FK4A 3GFHA 5KFAA 4E98A 2W9CB 2C3PA 4J9KA 1OJ4A 3GYGA 2MB0B 5ITHA 1WDDA 3PYGA 2HLUA 1YJ9S 4DUZJ 1QD1A 1PILA 3NCPA 5GADI 3LWMA 4ZVHA 3THPA 3U02A 4ZLPA 2R7VA 4GMKA 4N8NA 1FFWB 4I7FB 1R0AB 3TARA 4LF9J 2V34A 4EUVA 2QRRA 3CVKA 3KG0A 2I8EA 3CSKA 4PG4A 3QZ7A 1TUVA 4J9NA 3DGVA 3MMAA 1EB0A 3CJRA 3W8PA 3UCUP 2XB2D 2V4QA 1HL6A 3JS9A 1KDNA 3V4IA 2VQFJ 5KFOA 1VRUA 2HNYB 2ZBIA 9ATCB 4DR3F 3RBDA 1MWYA 1WC5A 3PNIA 3R1LA 3DOMA 3V6DB 3D3BJ 3HVTA 4PWUA 5GADU 3H25A 2EFPA 2ZWOA 2E44A 4A8WA 2JC0A 2HG4A 2IBKA 2EKYA 4DQQA 4C11B 4IG3B 3M6WA 1FE4A 2HBYB 3AODA 1T9YA 1JLEA 1V6HA 2HVEA 3ZNUA 1T9WA 2QEXS 3HHNB 3BGUA 4AXIA 3RB6A 1BQXA 5F9LA 1NPPA 2DXDA 1QAJA 3HP6A 4M8LA 4KIAA 3H90A 3PXGa 1RAGB 2UXCJ 5CYQA 2PFFB 1SJRA 2DH7A 1SC4B 1FRHA 1X5PA 2XCPA 1RWUA 4PXCA 3KLHA 4DSEA 2VUGA 1L3UA 1RT1A 4MTPA 5D0HA 3J7ZT 2PGCA 3K58A 4FDFA 4BC9A 1CC7A 3LALA 2W25A 5J1EA 4FVMA 7AT1B 5ETPA 1ZAXA 9RUBA 5J2PB 1HWKA 3W2WB 5RUBA 2QSFA 2G2OA 2BBEA 3MM5B 3H2VE 2BJ9A 2MLYA 4DG1B 1OSDA 2XZWA 3ISND 2P2CB 1R6VA 3G86A 2BKPA 1KTQA 3K5MA 3TR5A 1N5YA 3PX4A 3NGKA 2XMTA 4USHA 4ZVOB 3SFUA 2FVSA 2H3EB 3NS6A 4PWWA 4B9NA 4QYRA 4TKTA 4P2MA 3U1LA 2ROEA 5LSRA 3Q8QB 4ZHRB 1RK8A 3SSSA 5LMUJ 1U7LA 4LF5F 2DJWA 2X51A 3IN5A 1N34F 4HH1A 2HSEB 1O5JA 1HQEB 5AE1A 3GILA 4ZLNA 2CKWA 4NZ7A 3ULHA 2KI2A 3GCXP 4FS1A 2Y8YA 3LA0A 3M6XA 1NK9A 2OD6A 3BSAA 2A10A 3RTVA 3D6HB 2XWYA 3OTCA 4G3IA 5I4MA 1VHFA 4P7TA 4QYZK 1K0VA 4YUDA 2J7KA 4AXJA 1H2UX 1RP5A 2G13A 4X4PA 3PO4A 1SCJB 2RVJA 5D78A 4AQYF 1KEKA 4WBFA 5KOXA 2DXFA 2UVWA 3MPDA 3UR0A 3OXGA 4WZQA 4AYBD 2OPSB 1DQ9A 2B6AA 2PIIA 1T7PA 2WSCC 2D69A 3HMJG 2LECA 4C8KA 4K4VA 4ICLA 4OIXA 1U1KA 1WNEA 2V5HG 2DO0A 4EK2A 4CT8A 3M8SA 1IBMJ 3W5YA 4CO4A 2ROGA 3V4IB 1RTZA 1EX8A 1FWLA 4KGXB 1AUSL 2CZVC 4WIQA 2O01C 4M5MA 3MMBA 4I2PA 1HWLA 3OFGA 2HMIA 1GMWD 4N7TA 1OPZA 3UI3A 2AJ4A 1TV6A 3MCNA 4JV0A 1C1BB 4MH8A 3D6FB 4B02A 3KHLA 1SL2A 3VF0B 1JXLA 4IOAQ 3W2WA 4DR7F 4ELVA 5A8RA 1SQGA 4LSNB 1WOOA 4DMZA 4YP3A 3BSCA 5I42A 2W4DA 1S9EB 3FCWA 3GMGA 5B7WA 4QU7A 4OZ0A 4NRUA 3BH6B 4DCOB 1NM2A 3Q8PB 2NYIA 2YWEA 3MF5A 4DV0F 1FJCA 2C3UA 4C3LA 4Q8EA 3JAMU 1T8EA 3C3LA 3SIPB 3M9MB 5CYQB 1KWMA 2VDHA 2DGVA 2HQFA 1TELA 1OIAA 4KPCA 2B5JB 1PYSB 2LCWA 4KV8A 3BKFA 5C42A 5CD4H 1UP1A 4DSLA 1BC6A 4F4ZA 1UW4A 2NS1B 3QAUA 4ZPAA 4HTIA 1MWZA 4LSLB 3AJDA 1XMBA 3ITHA 1FE0A 3NCRA 4PYDA 2FHJA 4L76A 3SCLE 3WQPA 3DLKA 4K4TA 4JI7J 1VQSA 4PR6A 1TFWA 2M8HA 1FJ7A 2WOMA 2ZNZA 3PFOA 2IAJA 2B4PA 4QWEA 4OYZA 1NK0A 4O4RA 3V2UC 3V6HA 3QLHB 2WVDA 4X4RA 2DHAA 2V6AA 1DQ8A 5M2PA 2ZJPQ 1X5TA 5C25B 1H0HB 1I1GA 1K1QA 2JOQA 1S49A 3I56S 3KK1B 3MEKA 1OY8A 3NWRA 2FUG9 3V81B 1D9AA 4BLGA 1Y10A 3HULA 4ECRA 2RE1A 3CC2S 1S4FA 3H59A 4OV1A 4RNFA 1CJVA 1NZ8A 1RISA 3NNCA 2HHQA 1RWPB 4OX8A 2FTRA 2HHWA 4JI4F 2J9DA 2B9YA 5L1IA 1HIYA 2CPHA 5IT0A 2E9TA 3EGZA 1S9GB 1NHVA 1X4BA 3UD3P 1VQ6S 3GJSB 4QOTA 2FDNA 3DLJA 4PQUA 1N8RT 3UN3A 2LVWA 4A8SA 3T1HF 3VWSA 1HNXF 1VYAA 1FWKA 1V3RA 4ZCLA 2XNQA 2PT0A 1FDNA 1LWXA 5DG8A 3TUPA 2DY1A 1S0VA 4PG6A 1Q86T 1S6PA 1MN7A 4P9SA 3PR4A 4FXDA 1FRIA 3HF5A 3J81Y 4C9DA 4ID5B 4DV4J 1Q8KA 5HP1A 4M5LA 1ZTTA 5F8MA 2MQNA 4ED1A 2N4CA 2WBMA 2HNZB 1VRTB 4KGKA 5GAHU 2XYGB 3GYNA 2NPIA 3CCES 3CPWR 2ZKTA 2W8KA 3D6TB 4Q44A 3E51A 4P7VA 2BQRA 1U0HB 2CNKB 1HYSA 2VG7A 3DKDA 4OX7A 2AGQA 2HNDA 3LPEA 1FRXA 2YH1A 3HHLD 4BC7A 1Q1KA 1WSVA 3KLIB 2G1HA 2HZAA 2J7UA 2D3ZA 4FZVA 3W1YC 1X0FA 2BE2A 1YBTA 2IC3B 3QFHA 1QLNA 4ZOSA 3KLHB 4K50A 3E01A 3RRGA 1FO1A 2H5IB 3LGNA 5DRKA 3EGWB 3EGVA 5KG6A 1U48A 1YJ7A 5ETMA 1Y11A 1RHMB 4UUXA 4V1Ak 5B08A 1UVJA 3NMAA 5J2PA 4JI6F 3K8WA 5H9FK 2I5JA 3JYTA 3O3LA 4OHVA 4PCQA 2KFYA 2XMMA 1VQNS 1SI9A 4EFAC 5J2MB 1SUQB 4URQU 2R7WA 2K3IA 3QJPA 5HN0A 4O44A 2DT9A 3NLCA 3QAEA 1XIQA 5DGAA 1PG5B 1X31C 4DEZA 5D4PA 1V9OA 1XWLA 3H40A 4Y2MA 4ECVA 1XMQF 1KONA 1RA7A 2QV6A 1CPZA 3FJ2A 3OLAA 4O0NA 4YB5A 3JTNA 2RRAA 2BRKA 4Q0BB 1HHQA 4ES2A 1HI1A 2J0QD 3IAM9 2HQ3A 1E6VA 5FLXY 2J6SA 1H72C 2FIUA 3UNGC 1U24A 2DNGA 2Y0SD 1KLNA 5L8RC 3BSOA 1PBUA 4CP5A 5BR8J 4FYYB 4QJVA 4B9TA 2HPUA 3CUNA 1DURA 2VKRA 2EBEA 3CIZA 1O8BA 2HKEA 1FJEB 3KK1A 2HHPA 2UVUA 2B4OA 2C1EB 2QG9B 3KJNB 4OZ5A 2X1GA 4MT1A 3NGSA 1TV6B 1PIEA 2OUGA 3VGVA 2POKA 2G2ZA 3MFIA 3CD6S 3KDNA 5HL7Q 1IKXB 3HJVA 3TZYA 2QO3A 2HQIA 4HH0A 3NBPB 1Y7PA 2DO4A 4K59A 4LR7A 2XCAA 2YKNA 1WC4A 2JC1A 3T41A 2MKKA 5KFXA 3FEZA 1TZ0A 1SKUB 1KBRA 4C2MA 2L48A 4X62J 2LEBA 4JI3J 3KLIA 2FPHX 2N3LA 2VBZA 1VJQA 3FRYA 4OJHA 1VC0A 3DM2A 3QIPB 2IA0A 4DPUA 3OR1B 2IVMA 5HBMB 4LIWA 4F3MA 3OSPA 2X1FA 4KV8B 2AF6A 5L1LA 1QUVA 1HPZB 3ZNJ1 3GSDA 1HQUB 3WIUA 4P72A 2MTLA 4XTTA 5CZXA 1L5UA 1XR7A 1KQFB 3I4PA 1GFWB 2V50A 3BR9A 5KG3A 1Q81T 4WP9A 2Z0GA 4NPOA 2HIYA 1N6QB 5G0RA 4CQ1A 5C2CA 1WHWA 3OQ2A 1VIOA 1VQ4S 4LFCJ 1HBUB 1X8DA 1B70B 4DR4F 3R5DA 3FUYA 2KB2A 2WAQD 1U6FA 1FNOA 2OFHX 4M5DA 4CLUA 2AEJA 3V6JA 4F4WA 4YB1P 2HLTA 2F40A 3FBBA 1Q78A 4RNHA 2CPJA 2DXEA 3DC2A 5U47A 5LL6d 1DTQA 2XG8A 4A8OA 1REGX 3R3TA 1FFSB 3CDBA 4UOHA 4WFZA 2BABA 3L9ZA 8RUCA 4C8NA 2B7CB 4LF8J 5HO4A 2HBZB 1CJVB 1S6QA 1X4DA 1IWGA 3D28A 3E3XA 4QW8A 3EX7B 4WFYA 1CJTA 3QYYA 1OPIA 3H4BA 4FPRA 4UQTA 4IFYB 1N5TA 3MGJA 3QJJA 2YNHA 1R0CB 3ZXWA 2HFUA 1JIHA 2DIVA 2GIFA 1NKEA 4Q2MA 2VOOA 1M0SA 2CJBA 1Z1ZA 2LXIA 4KQZA 1LK5A 1H98A 5DQIA 3BN7A 5C25A 2X1BA 3RB0A 1FDDA 5DQGA 3EDRB 2V68A 4RUHA 4I64A 2NPFA 1KQKA 2YKQA 5LXRA 3F56A 3ADAC 3AOAA 1HMVB 2G1DA 2RDIA 3W8GA 1NKCA 4WCEQ 3LOUA 4W98A 3NCQA 4KHPJ 3V4MA 2LQ9A 1VQ5S 3MEDB 1YG0A 1IM4A 3SI8A 1FRKA 4OX9F 1VQMS 1YJTA 1L3KA 1WI8A 4DV3F 2IFXA 1FEHA 2CDQA 2RUGA 3JQKA 3VZIA 4X4VA 3V6DA 1NDLA 4F4AA 1X5SA 3P96A 1FD2A 4DFMA 1AUDA 1AXQA 1FWPA 2C2KB 2Z30B 3SSQA 4DBQA 4DF8A 2F9JA 2GJIA 4AE5A 3E01B 3ELHA 2Z8QA 3NS5A 4CYUA 2H51B 3OL9A 1WI6A 4H54A 4O3SA 3SDEA 1S4EA 1W2IA 1T02A 3T5LA 3SQOP 1NDKA 4U7UD 2VFUA 4LFAF 1U09A 1Z2ZA 4ZPVR 4NASA 5EX0A 4Y0FA 2OJ3A 4H4OB 3B4MA 2V4RA 1TMMA 2F63A 4WU2A 5L1JA 4ED8A 1RT1B 2HHUA 3GJRB 5H1SV 4DR1F 2YKOA 2KT5A 4DR1J 4YDDB 1N5SA 1NZAA 4E8UA 3CJ0A 3D5MA 3CCMS 2RKIB 4ZLJA 4NI2A 4J91A 3R5CA 1VC6A 2KYZA 3KLEB 1F9EB 1U47A 5H9EK 1X9SA 5HQ8A 2DPIA 3M32A 4HDHA 2O5DA 5KFZA 4C0HA 1N5YB 5ETRA 3HKWA 4JI2F 1AB8A 4DQIA 2CPYA 2MY7A 4F25A 4PWDA 4WFNQ 4X4NA 1TTHB 2KG0A 2ZJRQ 2G4BA 3Q86A 4ZJQA 5C2GA 2QA1A 1QE1B 2PI5A 3OTOJ 3I0RB 4IH6A 4DX5A 1U2RA 1X4AA 4OHWA 3GP9A 5C24B 3KKFA 2MZSA 3IRXA 3HXMA 2JLGA 1TL3B 3IRWP 2B56A 3BO3A 2YKPA 5DDPC 1S5ZA 1Q82T 3IWLA 3RR7A 5GMKa 3H5UA 3M30B 2CADA 2YKNB 2Z4PA 2MJNA 3HZEA 5LJ5Y 3TUZC 1PYTA 4ECXA 1CC8A 5A8WB 4JI0J 2C2MB 4C3MA 2HGLA 1YJRA 2HURA 3K5PA 4QU6A 2NZ4A 4RW6A 2D1CA 1QTMA 4D3HA 3DM2B 3QIPA 2W2OP 1HFEL 3CIMA 4G1IA 3RB3A 1L3VA 2AEMA 3U1NA 5D3GB 4FYDA 3O8WA 2R8JA 3HVTB 1HMVA 4DV4F 4PUOB 1D3WA 2MZRA 3EMTA 4E0DA 1UTAA 3DRPB 1WOSA 2F4FA 2ZH5A 1IKXA 2KZMA 4EEYA 2F8EX 2IIHA 4ETXA 2C3OA 2ZBQA 2EWHA 2VPYB 2QA4S 5FDLB 1WTFA 4R5PB 4XDCA 5KFQA 3HSDA 5CCMA 1RYSA 5HJYA 1FNXH 4WYLA 2IJRA 2DNHA 3HVWA 4NXNJ 3TW0A 3PG9A 1YIJS 2CJ9A 1QY7A 2V8HA 3VGUA 1W26A 5MLCV 4JI0F 1NJWA 1MU2B 5AXNA 3DGPB 1RWVB 1V5IB 4LF2A 1D9DA 4CIOA 2CQCA 2DH8A 5EN1A 1J5OB 1U8WA 3HX9A 1RT2B 5J2NA 5KT3A 2GFFA 2NXEA 3QWUA 4PPDA 4JOUA 1GTEA 3TVKA 1JX4A 1X4HA 2B5JA 2K06A 4BDPA 2JVOA 3IFEA 2AYEA 3RAXA 2NXJA 4K7QA 4NLYA 4K4XA 4WPAA 4RBUA 1RLDA 2OFGX 4QCLA 1RBAA 3FBFA 1MWQA 1YSJA 2BW7A 3RYLA 2VL1A 3IBCB 4G1QB 2AU0A 5B0FA 3E2EA 5F8NA 3QSYB 3PACA 4RNMA 2DTJA 3M30A 1T3OA 4B3SF 2AHOB 4DQRA 4HKQA 1JLBA 4WF9Q 1LW0A 4CO5A 5GMEA 3MEEB 5KFWA 3L09A 1F2GA 2G9OA 2V4JB 3M8PB 4QWAA 2GA7A 4K8RA 4DSIA 1Q8LA 4TNOA 4N47A 4X64F 5DQHA 4QR1A 4K2JA 1B4SA 2QL9B 1C4AA 3AA8A 2RF2B 2HEKA 2B9WA 1S9FA 4CLKA 2ZOFA 5F8GA 5A0YA 1IKYB 2RQMA 2XMVA 2HGMA 3DOMB 2QE5A 3POTA 2XSJB 1TKTB 2IVYA 3FCVA 4X4SA 1GMUA 2GGPA 4Z7YA 4O4GA 1PCAA 2F3JA 1WG4A 3PYEA 1TKZB 2R7OA 3TVYA 2K7JA 1U1RA 1B64A 6FD1A 2EG2A 1WTBA 1HBMB 2ILYA 3KFWX 3FEXB 1JJ4A 2D74B 4K4ZA 2CZ9A 4U67Q 1WELA 1VIXA 5AXMA 3G8TA 1T03A 2Z2MA 1IJFB 5A6PA 4GRSA 1S12A 3DN9A 4USIA 3TEHB 5D6GA 5F3TA 5KFSA 5KT7A 1LWCB 1HD1A 6FDRA 1VRTA 1N52B 3PHEA 1K1SA 2R8IA 1VBXA 3KLEA 2NXUA 4HI2A 5DJBA 3SDEB 2VV5A 2CZ4A 3M8QB 2QLWA 4X66F 5D0GA 4WIIA 2XLJA 2YNFB 3MOZA 4LR9A 4LF9F 1DFDA 1RAEB 4ECUA 3MM7A 4HTJA 2R7XA 1RAIB 2FJWA 1T94A 3I55S 3HK2A 2OSQA 3D7SB 3FRZA 1UAWA 3ENWA 4HEA9 4DR3J 3I5AA 4DUYF 2HZVA 5EWEA 1RUSA 2GS8A 4KFBB 3TANA 4G1QA 1B0PA 1PJ6A 4X4TA 3IGVA 3N28A 1S7IA 2GHPA 2ZHBA 1Q7YT 2ZOMA 2W2PP 4I56A 4MIWA 4NLPA 2GVZB 3ZTQA 3QGPA 3IGNA 2DR5A 1LW0B 5DDOC 4YFUA 1U2CA 1M1HA 3A8IA 4ECWA 2HBQB 3CC7S 2QT7A 2ZH8A 4N77A 4YR2A 4F04B 1G3OA 1HNVA 1SIZA 3Q8SB 4IFVB 3GTYX 4G6VB 1N36J 1TL5A 1D9FA 1VBKA 1CBKA 1B7YB 2Q3PA 1S79A 2WVFA 2XMWA 2MGZA 1BXNA 1QAYA 1JLAA 1CULB 4RUBA 1EAYC 2N7YA 4DLEA 3Q2TC 2FZKB 2HWHA 1Q8BA 2YXLA 3BGFA 2FLPA 2DGOA 2E7XA 4WK1A 4AFFA 2VG6B 1RTIA 3CWJA 1K44A 5E3PA 1UFWA 2XBPA 5KT5A 2ZD1B 1WF1A 3SCJE 4F50A 4A8XA 2MKSA 2XTJP 3PV8A 4N76A 1UVIA 3IMQJ 4ZVRB 3BQ0A 4IDKA 4OX9J 4UF4A 2QYGA 4UQGA 1IBCB 5LMNF 1GXUA 3D0IE 2CNOB 3AOBA 3FQLA 5I3PA 5IM0A 4RUAA 1ULRA 1JLCB 2XULA 1ZM9A 5EUHA 4U7CA 4DL3A 1P1LA 5HQMA 3FFIA 5F8LA 1SV5B 3AY0A 4DV1J 5A8RB 2GJ2A 3OT9A 4M63A 2KG1A 1GX6A 2AJFE 1HBUA 2BJDA 3H42A 2VICA 1SL0A 5I42B 4ELUA 2EC0A 2ZZMA 5L9XA 2MSTA 3OHBA 4GO5X 1R89A 1RKIA 3MMCA 4ED2A 4HR2A 3TEGA 2AQ4A 2AJQA 2OAUA 3N4WA 4C98A 3D0HE 2YQ0A 2YQ1A 2GIQA 4M5JA 4UOGA 3CCRS 4DL6A 4OHXA 3QRQA 3PIOQ 1DTQB 2OEKA 1CG2A 1S1UB 2YWKA 4ANCA 2DPJA 2C2RA 2NXNA 5A2QU 1ITPA 4Q45A 2JX2A 2DY9A 3TUJC 3KNAA 1TKXA 2O1PA 5G0RB 4EBEA 1TL4A 3FC9A 4NZ6A 3M8ZA 2B4UA 3IWXA 4IO1A 1F9FA 1KHVA 2OO4A 3UE2A 4RLEA 4ZK7M 2J8AA 4F7VA 4R0EA 2D41A 1R7IA 3MM6A 4PG7A 5DZ6A 3GIRA 4CLTA 5IT4A 4YB7A 3UWTA 5JUMA 3OUYB 3MUMP 3CCQS 2HYIB 2I38A 2HFOA 2KFNA 3KJVB 3M05A 1OYDA 2AMCB 3KK2A 4OZJA 1N56A 4N5SA 3OL7A 4NLXA 1G4CA 3NGUA 1RWNB 3EYZA 1BWEA 3THVA 1JJCB 2HVIA 4ZDNA 5KT2A 3DI6A 2Q6BA 1FJGJ 1SH2A 1HBNB 5DO2A 4ZIVA 3IG1A 1ZOTA 1WEZA 3Q24A 2H65B 2W24A 1YWXA 1XERA 4EYIB 2Z57B 4IFVA 1LXNA 3UCGA 2V8GA 3BF4A 3O44A 3NXZA 2RIJA 2R7UA 3DRRA 3NGTA 2XM3A 4A47A 1JNZB 2HRTA 2QMWA 3QFWA 2B0GA 1NLKL 3C6UA 4RW4A 1RT7A 1D0EA 1ZM4A 2YH0A 3JTOA 3OTEA 2OHDA 4CYUB 4Z7CA 4LQ3A 2W7OA 4IG3A 3T9ZA 5KFUA 5DETA 2D9PA 1RCOB 1QSYA 1JLEB 2MQOA 1OSCA 1G7CB 1H73A 1S1TA 1RQ0A 1T9XA 1WOPA 2CPZA 2M7SA 2QYCA 2XHCA 2E5HA 3E8OA 3LP2A 3OXFA 1SIWB 1JKHA 4PPZA 3THTA 2RHQB 5IWAF 2L08A 1UVKA 4IR9A 5I3UA 4JI3F 2IM2A 2RRNA 2RILA 2VF3A 3EVMA 3UD4P 1TAQA 1WHYA 4USUA 3CJTA 2GCFA 3CD0A 3TZZA 1C0UA 1Q5YA 3MPUB 3PRBA 3PW2A 4NLTA 1NK6A 2X3GA 2LMIA 2ZM6J 1FCAA 1RT5B 4UOFA 2MMYA 1IBKJ 4DL7A 1F3FA 2AYMA 2KRRA 2Z2ZA 3DDNA 4R25A 4DV2F 3N6LA 2OPQB 3JSBA 1GTHA 1LWCA 2H48B 3G6XA 3EZUA 3F44A 2ZBCA 3MM6B 5HANA 1D1UA 2AZ1A 2ZH6A 1M5SA 4RNOA 3DLEB 2B8QA 4KY3A 2YNFA 2B4VA 3J81j 2GQCA 2EKNA 2FJBB 4OV6A 5A8KB 5ETTA 1GAOA 2WBRA 2IM0A 1S1UA 2C2NA 2MQ8A 3I0RA 1XR6A 2L3MA 2JHEA 1RBLA 2ATCB 2H1YA 5F0UA 4N8OA 5D0EA 4Z37A 4FF3A 4IRCA 2HBRB 1Q7LB 5A6WA 2ZVIA 3IA0A 3QMQA 4Y2IA 1IM6A 2PMHA 1WEXA 2VFSA 3FMWA 2QC3A 3DYAB 2OLWA 3NNHA 2CJAA 3I0SA 5HVFA 3IBFB 3N5FA 2D9OA 2R42A 2IDEA 1PJ7A 4NWBA 2ADCA 4OZLA 4KHMA 4M5NA 2MZJA 5CHCB 1QJHA 1JJHA 1R31A 4F3QA 1XBWA 1WC1A 1XR5A 2EFOA 3LP0B 2J6UA 4TXSA 2GHWA 3M6UA 2LEPA 3TAMA 4C48A 2L9DA 4B3TF 1OQ6A 5KFLA 4J9UE 2NSBA 2MKJA 8AT1B 1BQMB 1K73T 3X1LB 5A2QY 3T19A 4ICLB 3PFEA 5D0RA 3W2VB 4ALZA 3IG1B 1V3SA 1LW2B 2ZFHA 2JLFA 4XK8C 3NGRA 4KB7A 3GWCA 5KG4A 1SJ4P 1H38A 4KR0B 4UTGA 3PY8A 1FERA 1Q79A 4DR2J 2A0FB 4DS4A 4DF4A 2Q1LA 4LF8F 4UZBA 2IRYA 1RT7B 4LIRA 3MR6A 3G8SA 2M4MA 3I82A 1U25A 4CRJA 4YHHF 2WCXA 1CSJA 1R6YA 1K47A 3BSNA 1HPZA 1X60A 3KJQB 2R8KA 3RJMB 1ZH5A 4DOZA 1JLGA 4ZVQB 3C6TB 4FNIA 4HHUA 1JKHB 2KL8A 2UUWA 3BREA 5EDWA 5C7PA 4K4SA 1CLFA 2WVCA 3I9V9 3VAGA 4MMOA 2GMHA 2J0SD 1TUWA 1S1WA 3ZC4A 3ZZYA 3C66A 2ZH9A 3TAQA 5F8JA 2HVZA 4GKKJ 3KJVA 2KXFA 4TU9A 3HVAA 4TY8A 2JEFA 5C5JA 1G2EA 3DGPA 4F0MA 3CCWA 2HQGA 1WC3A 1FNMA 1J27A 1LQ9A 2CRLA 2OD4A 4AT1B 4TYBA 3ZZRA 3CCJS 3DI6B 3LPYA 1EETA 3Q8VA 3QGHA 3QWPA 3J7YU 1VC5A 4C8YA 4RR5A 4LFBJ 1SUQA 1DJ0A 3A4TA 5J2QA 2BJEA 1KKHA 2ZEJA 4MAKA 2V8PA 2DEIA 4ES3A 3Q23A 4I1TA 3OUYA 1DAXA 1L3SA 2NQPA 4AL6A 1A7GE 3S8SA 1DQAA 2HWTA 4B3MJ 4K5RA 3BN4A 4RBVA 2MKCA 3I4HX 4PXBA 3DOKB 1UPPA 2FVPA 2CG4A 3IR5B 5DM7Q 1LFWA 2I1RA 1S0MA 2VA2A 4O4GB 3K7RA 3FMBA 3F73A 1RWMB 3KUHA 4DZ6A 3ISNC 3HM9A 1VBZA 3K5NA 2ZH2A 4ZVUB 3A3PB 1P8GA 4ED6A 2BXJA 4V19J 3HJFA 2VQEJ 1T9VA 2AW0A 1MSWD 1B7FA 4JB8B 1H74A 3CULA 4C4WA 2ALZA 3BPDA 5HQLA 1H3DA 4FF4A 4OI1A 3W5ZA 1VQOS 4TVAB 4NLRA 7FD1A 1UVLA 4AL5A 5HP1B 2DNRA 1HWIA 1HARA 2ZNYA 3DHWC 3KMSA 3HHLC 2AWZA 3BDPA 3Q2SC 3ILIA 3Q8YA 3ZZ0A 1IR0A 2HS4A 2VPWB 3VAKA 4BWJA 2JNJA 2B7BB 2C2ZB 3UVJB 1J5EJ 4NLSA 3PR5B 3I5BA 5E3QA 2P5VA 4ZA1A 3SCIE 2R9LA 3BDEA 4B3OB 1W25A 2M9KA 3SV3A 3OR1A 4DCPB 2XQCA 1EP4B 3UDVA 4O23A 3ZZZA 1R8CA 2CQBA 2H9ZA 2QL5B 2XZDB 1ICEB 2LXFA 3AD9C 4H4OA 1MROA 1RT4A 4HI1A 4LFCF 5C42B 1R8HA 3WHIA 4YR0A 3T3FA 4OI0A 1F6TA 2W1BA 1MNEA 2RQ4A 3NEKA 4NMXA 4WFBQ 3Q22A 2ASLA 4B3RJ 2XGQA 4DI6A 3C14A 2JDJA 4MYUA 2FLLA 1AFJA 3EE3A 3J7A1 1U6BA 5HMZA 3RBZA 5KFRA 2VJVA 4AL7A 1K0TA 1RT2A 5J2NB 1VS3A 2MPUA 5HMYA 3N01A 3WDOA 3W9JA 3LTOA 2CQ4A 2E7VA 3M2UA 1FK9A 3MD1A 3MEGB 1SPBP 4Z2XA 4QPXA 5KG7A 1SBRA 2E1CA 2YWHA 2JL9A 1RHRB 2RRBA 4GC6A 5KFMA 5LMUF 4DR5F 3VALA 1YI2S 4ZCKA 5L1KA 4X84A 4ZPWR 4Q43A 2W4PA 4QIWD 4LF4F 4DR6F 1Y3JA 2YX7A 5GAHI 4B9MA 4NXNF 1RWOB 4I68A 4CH0S 2WVEA 4I0WA 1LW2A 3OTOF 5BJRA 4Y2KA 2DHSA 2Z58B 5CQGA 5HVHA 2I6WA 2M5YA 3B78A 2IAJB 4NRTA 5IT9Y 2J9CA 3HFKA 1ZM3A 4EU0A 4NLQA 3CDWA 3ICLA 4F36A 2FYXA 4MK9A 1VISA 3RAMA 5K8PA 2X3DA 4KKOB 3LGHA 4L73A 4LSZB 3TQEA 1NK8A 2HS3A 1YBUA 1FXRA 2K7KA 2LA6A 1PAEX 2N4DA 5E3CA 2HQCA 2MJUA 3W61A 4F4KA 2YKMA 3M2RA 2OPRB 3QSIA 4CLWA 1RTDB 2B9XA 5LJ3Y 5THWA 3DRPA 3DXSX 4FYVB 4H4KC 3H0PA 2LEAA 2FY1A 2XYHB 1RTJA 1SC6A 3BM7A 1S9GA 3FQKA 1REVA 3BQ1A 1TR0A 1XMOJ 4DL0C 3W3SA 1I6JA 3WIVA 4X2BA 4ECQA 1R3NA 2QGFB 4OYWA 1HBMA 1HI8A 3BO2A 4B3SJ 1J5EF 2R8GA 2H5JB 2KRBA 2Z2LA 2GO9A 1SV5A 3Q8RB 2DR7A 3B82A 1DTTA 1IKWB 3CD7A 3RGIA 4CO0A 3VQSA 4B17A 5DLGA 4J9LA 3PX6A 3IO1A 1UFKA 3ZTRA 4WE1A 3D0GE 2E5IA 2CQPA 3N79A 2ZWPA 1RU1A 2EFVA 4CTAA 2BANA 1NDPA 3H2UB 3QO9A 4USTA 4DV6J 2EFGA 1TU0B 3G2XA 4GC7A 1DZ5A 2DR8A 2K3KA 2DVIA 3KHRA 2CIMA 1J5OA 1HNWF 1FRLA 3N5BA 4URGA 1FVSA 3HCXA 4OL8A 1AA1B 3OBIA 4FXVA 4USMA 4LR8A 3WZ0A 4OZ3A 5AE2A 5B0BA 2B9EA 3OLBA 4M95A 3SQGB 3DRXA 4JI2J 2NUUG 4UW2A 2JEGA 2QN6B 3OL6A 2GQ2A 2H4YB 4JI1F 4WJBA 1PSDA 4DPWA 4H4MB 5E3AA 5CH7B 3EDQB 1M1KT 2BMBA 4P2FA 3MXHP 3KG1A 2VDIA 3MTKA 4A4JA 2EBGA 3CJKA 3PW4A 2KJWA 2P8IA 4X4UA 1R0AA 3D54A 4JI8J 4B9UA 1Y5LB 5BYRA 3UQSA 1VI7A 3KXDA 1ZBTA 1J2VA 3JQJA 1F1BB 3I6PA 4LVNP 2AIRB 4USWA 3CMES 2MZQA 4TYAA 3C16B 4ATNA 4DUTA 4DV0J 4A8MP 2C42A 3TWZA 5EWGA 1RHJB 2DBBA 3PJXA 3BZQA 2CQDA 1R27B 2ACMA 2U1AA 3MURP 4XPEA 1PC4A 4H4KA 2QFIA 3NAHA 3KK3A 3K57A 3CCUS 1HBNA 1VDHA 4OZ1A 2DHXA 2J9DE 4UOCA 4KBIA 4C11A 2ZZTA 3J7YI 4DSKA 3PHTA 3KLFA 4YS2A 2R2SA 3V5RA 3CCSS 1VQLS 4I7FA 4Y2CA 1YVFA 2XLIA 4GKKF 3MAAA 3K89A 1WACA 2J6TA 1YGYA 4O3PA 3CTRA 1QSSA 2P9CA 3FGVA 1TL1A 3TVZA 1F5CA 4IOBA 1F2HA 3R2CJ 1N4LA 2CPXA 1FX2A 2ATLA 4ECSA 4LREA 4F8RA 3C2PA 2HGNA 4GKJJ 4OLPA 2CNNB 2IY5B 2IPOB 3RG6A 2JZ5A 1TL7B 1N54B 2H5EA 5B0EA 3DHXA 3QO9B 2JH3A 4IRDA 2YNGB 2FQQB 3SZ2A 3PIPQ 2UUAF 1LFPA 1FVQA 1WKKA 2V2ZA 2ZC3A 4OHZA 1ZYQA 3I96A 1TK8A 4NCBA 1RT6B 3DMJB 4DFPA 4C0BA 1K9MT 2CJKA 4JI5F 1BQNA 3PX0A 1GXLA 3VAHA 2Q66A 4PKDB 1EP4A 2MEWA 1QTNB 2Y3YA 3QPIA 3RW7A 3JAMY 5KG1A 3DLGA 1CJKB 1NH7A 2BE7D 3MPVA 3UR3C 4F0KA 1R8BA 1IKWA 4KO0A 3DYAA 2AT1B 3TO8A 4TU7A 3UW1A 4ZHRA 1T9TA 5LSLA 3I5CA 4UY85 2U2FA 1RAHB 5F8IA 1S1XB 2YPZA 2RQCA 2W7PA 1T3NA 1S97A 4GVLA 3RBXA 2WW8A 2FZGB 4MIBA 2MZTA 4M94A 1BLUA 1S6QB 2M2BA 3BKTA 2VB6A 1NMEB 2O67A 4DQSA 2LA4A 3OPKA 4Y34A 4DJBA 2XEXA 1P1TA 3MPYA 2N3OA 5KFFA 2C22A 3DXBA 1S0OA 3GG0A 4WFAQ 5JMNA 2MGZB 4FBUA 1IR1A 1G6BA 1CULA 4KKOA 3G82A 2CVIA 2EC2A 2C3YA 4LUBA 5GVQA 2ZH3A 1OO0B 2GAGC 1RTHB 2XSFA 3MAHA 5HJXA 2FHOB 2WOMB 2HRYA 3KNGA 4B08A 2N82B 1Q16B 1RTIB 3MEEA 1QUPA 2E1PA 1VQ9S 1FJGF 2E1MC 1N32J 2DNNA 3SSRA 4X65F 3K0JA 1UL3A 3H20A 4DPOA 2BYCA 2F5GA 4RBTA 4EMDA 2HFVA 3UN2A 4KHPF 4ZJLA 5EWFA 3ILJA 4M5HA 2DRDA 4J9QA 1NSPA 2GHVC 1Q0NA 3AHPA 3A1YG 2E5JA 3VHQA 3BYPA 2PFDA 5FJ4A 2XHWA 2RHSB 4G65A 3TNVA 3SEOA 4DDFA 4FN5A 2EK6A 1XMQJ 1WF0A 5DDQC 4CZCA 1WG5A 1JNRB 1FDAA 2RU9A 2V8VA 4HACA 4P2SA 3GZ7A 2HHXA 3LP2B 3QIDA 3JSRA 4F67A 2CQ1A 4I4BA 1JXVA 1FEEA 4DV1F 3DLLQ 3R5AA 3ZTSA 1EIYB 3M8YA 1S10A 2BUNA 3M2VA 2UUAJ 2NXCA 3IM9A 1NJYA 2XI2A 4I2PB 4CWBA 2CUYA 1RLCL 3OTBA 1RDRA 3CO0P 1MU2A 3BBBA 3H98A 2KT2A 4DPXA 3MAQA 4RO0A 3OW2R 1JLGB 4DV5J 1SQEA 4Y65A 1NSKL 2KH9A 1RJJA 4BCAA 1KVKA 1N36F 1G1XA 1YX2A 1NH8A 1QAXA 2VFRA 4RU9A 2ALYB 1UFLA 4DCJB 3LUYA 4ITSA 3OVAA 2WTFA 1ZZNA 2A1BA 1Q8IA 4QYZJ 5L38A 1U4BA 2VA3A 2HNDB 2PMZD 3ISZA 2DGQA 2VBWA 2PDAA 3HT0A 5IC4B 1S7HA 1PBAA 3MM8B 2BE2B 4EWTA 3EPIA 1SJ1A 1WKLA 5K8MA 1RHUB 2OMOA 3P4UB 3EXCX 3BB5A 4OJ3A 3LP1A 4KSEB 4CLPA 2ZDOA 4URSA 4I69A 4DHVA 4J9OA 2C2OB 3ENQA 4L74A 1NHUA 4U96A 2C2DA 4J9MA 1NO8A 3VR1A 2GNKA 4OZNA 2VH7A 1KC8T 4DXLA 4YOEA 2J7WA 2CFXA 4A48A 3LP0A 2D3O1 2CWKA 3T9NA 3EVWA 3U1MA 2KZZA 1HNWJ 1FTRA 2V2QA 3DDKA 3HHEA 3OFEA 3PJ9A 1QE1A 4LRFA 5CYJA 3PCOB 4ID8A 2R4FA 4OI2A 3HD2A 3GU0A 3UVJA 4DV7F 5HATA 1MMNA 4EBDA 2N7CA 4AUKA 3OSNA 3BGLA 4HLBA 1WDTA 2KVQE 4KGVB 3W66A 4PG8A 1LWEA 5K20B 4YR3A 2CG8A 4LBHA 3KLFB 2CA9A 2UV8G 3R5BA 4RW8B 2YBVA 1RT6A 3DMJA 3LAMA 5FDLA 4F0HA 1OY9A 1NJIT 1NUEA 3HO1A 2CYYA 1S99A 1M90T 2MY8A 2M0GB 1SH0A 2ASYA 2E5GA 3H4DA 3EZOA 1RABB 5M2RA 5KAKA 3FFIB 1WWHA 2CVEA 1S1VA 1WORA 2WW4A 2K1RB 5EX3A 2W9BB 4DR5J 4DL5A 1KQGB 3PEHA 3KLVA 1SXLA 2LYVA 2DK2A 3VTIA 4LMZA 5JVGQ 1TFYA 1KOHA 5L39A 4C0OC 2IA6A 3A13A 3C6TA 2QFJA 1MW7A 2PI4A 2JVRA 1N5VA 2E1RA 1KLMA 3CD5A 2I5JB 3JYTB 3MFHA 2VONA 1EZZB 3NMRA 1UJ4A 3G6VA 2ZH1A 3D66A 2C3MA 1M1GA 1LWFA 2PD1A 4IH5A 2KM8C 3BQ2A 1SKSA 2AYGA 1XNRF 2DHHA 4QQBA 2NUHA 1LEOA 2IJFA 5B0GA 5K14A 2IC3A 1YZ6A 2DNLA 4XDDA 4TY8B 5KFEA 3DFEA 3RU0A 3G82B 3HVRA 1TAUA 2GVZA 5AXKA 4Q0BA 1RWWB 4KC5A 2DNKA 5IOLA 3HLUA 4MFBA 2LU1A 3JSYA 3TZXA 4DSJA 4PEOA 2V0NA 3Q8UA 4L75A 4NCGB 1FXDA 4GVBA 1RAFB 2VD3A 3T5HA 1ZAVA 4J7CA 4A46A 4K4YA 1UJ6A 5D77A 4DU8A 3TZWA 2IDLA 4J5OA 2KU7A 2QLXA 5KFDA 3US5A 1V3ZA 2LKZA 1JLQA 4NLUA 5KFYA 1M5VC 3HFZB 1ROFA 1RWXB 3U27A 3SYZA 4B3MF 2ZVSA 4OYOA 1KTVA 2ZITA 2HFSA 2ZM6F 2JEIA 3TUIC 3K2YA 4AD6A 5A0YB 1T11A 2NLWA 5A8KA 1X4CA 1BQMA 5GMDA 2JSXA 1RTHA 3VGTA 3EJMA 5G4DA 4DV6F 3KLGA 3AAWB 3VGSA 3OR2B 3LF0A 1T9UA 2M3DA 3SCKE 3OTDA 1T05B 4OYXA 3CJ3A 3EM1A 4QIVA 4TLQA 3ZFVA 1UCNA 2EW9A 2ZC4A 4PABA 1BGXT 2BEFA 2F65A 4HT7A 4ZVEA 2MHEA 4ZKAA 3M8PA 5JXSA 4PRFA 1JLCA 4IH7A 1IN0A 3C15B 3H7HB 1N0VC 3NP5A 4OYMA 2BJ3A 3QT6A 4FPIA 4WE1B 4LF5J 2CQ0A 3LH2S 3GJQB 3C8YA 1XMOF 1RTDA 3B8HA 4NMLA 2W7AA 5CYMA 3BH7B 2PMWA
chains in the Genus database with same CATH topology
1XTZA 2ABYA 4W90B 2DIUA 4ILRA 3GB0A 2GQQA 5K8NA 1HHSA 2MQQA 2OP5A 2LQBA 3ONQA 1C0UB 5HROA 1ZTWA 1VMBA 3DOLA 4WKRA 2HFNA 1P6TA 2F4VF 1KS2A 4I6WA 1L3TA 2IMWP 2I2YA 3SFGA 4H4MA 2VBYA 3EZ5A 4RW7A 1IBKF 4MFBB 4CO2A 3ZZTA 5M2UA 1UKUA 4EO8A 5I3QA 3O5TB 1HWJA 1UJ5A 4HHJA 2IYGA 4PWDB 2E29A 3EXYA 1P27B 4FP9A 4FVCA 4U6PA 2HW3A 1ZZFA 2YX4A 4NLOA 3H5SA 4CT9A 7FDRA 3RB4A 4A8KA 3DU6A 4ED7A 3D1QA 1KVJA 1VBYA 5T41A 2R2TA 3O1LA 3IXQA 3IAS9 3KK3B 2UV8A 4TY8A 3HT3A 3CF5Q 2ERRA 1TKDA 2VFTA 3KLGB 1DHMA 2A2DA 3CJ2A 3BJYA 4IQMA 5D4NA 4CO1A 1OQ3A 2MQMA 1N32F 3MEDA 3P49B 4RW6B 5DDRC 2VC0A 1TVRA 2VBXA 4Y3CA 4EO6A 5KFGA 2HMIB 4FBTA 1NB7A 4HVZA 3MI7X 3N6MA 3KHHA 1TL3A 4LSNA 1HWUA 3MUTP 4LVOP 3G4SS 1S1TB 2HZCA 2B6AB 5KFTA 3OR2A 4LF6F 3S01A 4YMEA 4R5PA 4WXWA 3L3CA 3D1OA 4TLRA 4F02A 3LO3A 2E9ZA 3DLGB 4KRWA 2BR0A 4B3OA 1AFIA 3KYLA 2F7VA 4KO0B 5E2QA 2COLA 1LWFB 4J9RA 2E9RX 2FJXA 2FD2A 2D7SA 2EVZA 3DRYA 1C1BA 4K4UA 4CCHA 1S1VB 2P9EA 4NL5A 2W9BA 5CYMB 1UWBB 2QSWA 5DS7A 1JB0C 1S48A 3KWMA 4EGLA 1X4EA 5IS2A 4MKYA 4DSFA 3EUNA 4NCGA 2UUBF 4IOCQ 2DCUB 3UFCX 3K8VA 1YITS 2CJQA 2HS0A 3RRHA 3SXLA 3JTPA 3AQPA 3IBWA 1E6VB 1HBOA 2FJEB 1FRJA 3N6NA 4IYQA 4NLDA 4ZP8A 3I87A 3M9NB 2BVZA 2CPDA 3L7PA 4NA3A 5KFHA 1Y5NB 4GO7X 3RR8A 2IRUA 2XY7A 5J1NA 3GV8B 2MKHA 4HYKA 2UXCF 4DUZF 1SJFA 2KTQA 3RBEA 4OMFG 5KFCA 1XN9A 2ZH4A 2LU2A 3DOKA 3P6YC 4TQSA 4YB6A 4RW4B 4I2QB 2OKQA 4JYAF 4B3RF 3NBPA 1Q4RA 3FNNA 1YJUA 4I67A 5CA5A 3TA0A 1VLYA 2YX1A 3GIIA 5JJBA 2OPPA 2AGPA 2HAIA 2QA4G 1QVGR 3BEGB 4RW9B 3CJ5A 1FA0A 1TL1B 2BM0A 3P3DA 3VAFA 2UXBF 2HHTA 2F8HA 3TA2A 5J1EB 2ZE2A 4ETZA 2DGXA 2IMOA 2XI3A 1KD1T 1VK3A 3C6UB 2O3DA 5HMXA 2BQUA 2XO7A 3TP2A 4RW7B 3M8QA 2GGPB 3IWNC 1C1CA 1IKVA 1UETA 2GO8A 3T1YF 2HNZA 2EFNA 3K5LA 3MR2A 4FF2A 3JSMA 3QGGA 2YNIB 2UVRA 1RT4B 4O3QA 4NLGA 2DGSA 4O44B 2ZKUA 2F9DA 4ES1A 5CCLA 2CQHA 5EHHA 2UXDF