1QE6A

Interleukin-8 with an added disulfide between residues 5 and 33 (l5c/h33c)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
68
structure length
68
Chain Sequence
CRCQCIKTYSKPFHPKFIKELRVIESGPCCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERLEUKIN-8 VARIANT
publication title Receptor-binding conformation of the "ELR" motif of IL-8: X-ray structure of the L5C/H33C variant at 2.35 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 15
structure length 68
sequence length 68
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1qe6A00
1X3PA 1DOLA 1PFNA 4HCSA 3D6WA 2FJ2A 2H1EA 1QG7A 1IL8A 1JICA 1RHPA 2B2TC 2EPBA 4IURA 5T1GA 1HFNA 2CVRA 2RSNA 2X6LA 5CBEE 3H91A 3GV3A 5E4WC 5CBAE 1B53A 5COYA 4IUPA 5CORA 4NW2A 4MN3A 3GV6A 5JJZA 1A15A 1PFBA 1B4OA 1LV9A 1QNKA 2EOTA 1F2LA 1QE6A 4DN4M 2IL8A 1G2TA 1U4RA 2EE1A 2HDMA 1VMPA 2RA4A 3N52A 2JYOA 4XDXA 1E0BA 4CJ1B 2L11A 2MJ8A 5E4XA 1KNAA 1G2SA 3FPUB 2B2WA 4RA8A 4U68A 1B2TA 1CA5A 4IUUA 1B3AA 2NZ1D 2BDNA 5EKIA 1BF4A 1DZ1A 4ZKBB 4HAEA 1TVXA 3DM1A 1ESRA 4MHEA 5D65A 2NYZD 2DY8A 3MTSA 1WD1A 1J9OA 3I91A 1PDQA 2L9HA 1MGSA 2B2VC 5EPKA 4HEDA 3G7LA 1RTNA 2SDFA 2K1BA 5EPLA 1BO0A 1DOKA 4CJ0B 1EIGA 3QO2A 1NR4A 2K01A 1B50A 4X3KA 2MPMA 1IKLA 1AP0A 2XIWA 2VXWA 1F9QA 1F9SA 2MP1A 1ML0D 2L12A 2N55A 2K05A 1PLFA 1ILQA 1PFMA 1WD0A 3R93A 1EIHA 1DOMA 1JE4A 3KUPA 4X3SA 2K03A 1F9PA 1XYIA 1MI2A 3F2UA 1SDFA 3DEPA 3TZDA 2KECA 4HSVA 3FDTA 1WTWA 1X3QA 4XT1B 3HP3A 3P7JA 4XT3B 1HUMA 1EL0A 1WTXA 2RSOA 3I8ZA 4QUFA 4IUQA 1XX8A 1MSHA 3SVMA 1M8AA 2M2LA 1KNEA 2B2WC 1CA6A 1O80A 5T1IA 1WTOA 2B2YA 2DY7A 1U4LA 4ZKCB 5DNFA 4X3TA 1HUNA 2MGSA 5EQ0A 1RJTA 2B2UA 4RWSC 1BNZA 1G6ZA 2KVMA 2X6GA 1F9RA 1IKMA 3I3CA 2Q8TA 1WVLA 4UAIA 4ZAIA 1BBXC 1AZQA 1DONA 3MWYW 1WTPA 1NR2A 2JP1A 2L1BA 1MSGA 2B2TA 3IL8A 4OIJA 1C8CA 3DEOA 1G91A 1RODA 2X69A 3LWEA 2HCCA 2R3ZA 4OIKA 2KOLA 2D9UA 2J7ZA 1HFGA 3UI2A 1WTRA 1HRJA 5CMDA 1U4PA 1HHVA 1EQTA 2L4NA 2KEEA 1NCVA 4IUVA 1NAPA 2Q8RE 4O42A 2K28A 4R8IA 1ILPA 3Q6SA 5AFWA 4ZK9B 2K04A 1J8IA 2HUGA 3IFDA 1ZXTA 2FINB 5EJWA 1CM9A 2N88A 1RTOA 4IUTA 1GUWA 1X32A 3ONAB 4RAUC 1VMCA 2FFKB 2KUMA 1O7ZA 4R9WA 2RVLA 2FHTA 5D14A 2HCIA 1S4ZA 2B2VA 4CJ2C 1AZPA 1SAPA 4X3UA 5EPJA 1SSOA 1ICWA 2B2YC 2FMMA 2HDLA 3I90A 1EOTA 1O7YA 1U4MA 3KBXA 2KEDA 4LMQD 4QUCA 3TN2A 4ZLTF 1WTVA 1WTQA 2NWGA 2B2UC 1HA6A 1Q3LA
chains in the Genus database with same CATH superfamily
5IYBG 1EQRA 3PSIA 4GLAC 3J7A5 1C48A 2P5ZX 4N8X1 4KHPQ 5CBEE 1N36Q 1W6JA 4IOAA 4OWTB 2B63G 1HTPA 3GV6A 4BY7H 1PFBA 3U4ZA 3T13A 4BXXH 1VQ5A 1QNKA 1QUQB 4JBJA 4Y52H 1DM0B 1SNPA 3QB3A 3DHQA 1FJGQ 5JJKA 2NZ1D 1DZ1A 3F8TA 4DAVA 3OMCA 4KHPL 2IX1A 1I4HA 4MTKA 1N36L 3CC7A 1PTOC 2IHEA 5ELDA 3G7LA 2A6HD 1W2BA 4I65A 1NR4A 1SNOA 4P75A 5ELEA 2L15A 3S16H 4UDUC 4NDXA 1ENFA 3R2TA 1FJGL 2WB1B 1I4PA 3S14H 3SK4A 3K58A 5EAYA 4LFAQ 2F4VQ 3BYTB 3HOUG 1NMGA 1OXSC 3C3LA 1X54A 2JA5B 2EXZA 3T1YQ 3DM3A 4L5QA 4QIWE 3MEHA 2NVYB 4C3HH 2WIIB 3CPWA 3PUVA 4LF6Q 1SN8A 5IP9G 2ICIA 5EQ0A 1RJTA 3J81c 4LFAL 1BCPD 2B2UA 2A68D 2F4VL 4DK1A 5IP7G 4ZUIA 1MSGA 5I6WA 2X69A 4OIKA 3W1BA 1K83B 5I2YA 1EQTA 4HSPA 5CV7A 2KEEA 4LK1C 3NHHA 4LF6L 2JA7G 4BY1H 4KY7A 1YZ6A 1EU4A 2MO0A 5JEAJ 5AFWA 4A3MG 3IFDA 4IO9A 1VQ6A 4X6AH 3Q8DA 1B70B 3LNNA 2F0TA 3GTQH 2NB0A 4BBSH 1VQNA 1CSQA 5IWAQ 1Y8PB 4NXMQ 3T4AC 3K59A 2JN4A 2KEDA 4KY6A 4RH6A 4GOPA 4ZLTF 1XWEA 2RBMA 2LS01 4HCSA 3URYA 5CV5A 3GTMB 2FJ2A 2WINB 4J8QA 2WV6D 1HNWQ 2PZWA 4V0BA 3C46A 3TSSA 2KCMA 5IWAL 4NXML 3J7AF 2A74C 1KRSA 5IGDA 3L9AX 4CKEA 3ERSX 1QE6A 4H44C 3HKSA 3TREA 1EZ6A 1GOZA 2OTLA 3KDFB 3MXNA 1EUJA 3GTKB 4IUUA 2F0MA 2BDNA 1HNWL 1LTLA 4JG2A 1KLUD 3FHWA 1X65A 3VR6A 3DWQA 1PMRA 3ND9A 3J81L 1YNXA 3ND8A 3AYHB 2E8GA 4RKBA 3M4QA 1DOKA 3S2DB 4N9TA 3KDFA 3QOJA 1IKLA 3VYUA 2E5LQ 1L0YB 1B8AA 4DNRB 2KECA 3HKZE 2EYMA 4A3DG 4OX9Q 1OO9B 3HG9A 3ULJA 1IBMQ 1HZCA 4DUZQ 2NVXB 1PH5A 3EROA 1M8AA 2JA6H 2KCCA 3HOZH 2B2YA 4ZKCB 1TWGH 2E5LL 3MXGA 2G5DA 2PI2E 1SMYD 4JOIA 4LUZA 1VQCA 4KJNA 4QMGA 5JPMC 5FLMG 4A3FB 2E76C 2F0WA 3GTLH 1VQ4A 5BR8Q 3QWNA 5GQOA 1OXVA 5G3LF 4DV1Q 4OX9L 1TWGB 4KTAA 1IBML 1LT6D 1LUZA 4OL7A 3KF8B 4DUZL 2Q2HA 4OEMB 4ME3A 3BJUA 2F52A 1Y1WG 3H0GG 2RHSB 2EYOA 4R8NA 1SNCA 4NMZA 2AMCB 5C3WA 1CZGA 4FNFA 4X65Q 5BR8L 1Y1VH 4GZYC 3S1QH 4DV1L 4RAUC 1PH3A 4C56C 2F0EA 3MC0B 2A1AA 1SAPA 2LSSA 1QILA 4GLXA 4LMQD 3S1QB 3DWPA 3CC2A 2B8GA 2AQ1B 3PCOB 2F0FA 4X65L 2I07B 4IPHA 3J7YW 2B2TC 3I4MG 2CVRA 3NQTA 4F87A 3CRLC 2NVQB 5A2QE 4DAYB 4MN3A 1I4XA 5JJLA 3E3XA 2R7FA 2Z4HA 3A56A 5FO8B 4XDXA 2PPBC 2LFNA 4RA8A 1CKOA 4POFA 1CK1A 3HOXH 1VQDA 3G4SA 2K5NA 4YY3Q 1BF4A 5NUCA 1GD7A 2I5HA 4DR1Q 4DV0Q 1V1QA 2Z4IA 4DGZA 5EPLA 4C3JG 2EYPA 4TKOB 2BE5D 4OONA 1XMOQ 4A3JG 1TT2A 2CQOA 1XYIA 4YY3L 3FPPA 1MI2A 1XPRA 4EVOA 1VQOA 2PYKA 4POGA 3RZOH 3PQIA 4RMFA 4DR1L 4DV0L 1UUPA 3CCLA 1VQ8A 3VA5A 4WFN3 4A3GB 3J80i 3S1MH 4C1NK 4Z9CB 4APVA 1MSHA 3VR3A 2Q2UA 3GP7A 5H1SE 1XMOL 1D2BA 2A69D 1AW7A 4KD4A 5DNFA 5EBDA 2WP8J 4NKLA 1EQVA 1CQVA 1SYEA 3HKZG 1D5ZC 1L0XB 1PH8A 1DONA 4K5XA 4YWLA 4QF4A 4KHZA 1G91A 3JAME 3CD6A 1VQBA 3R8BA 4A3IH 5I2XA 1EYGA 1Q1EA 5C3XA 3OHXC 1ICFB 2UUAQ 2OWOA 1AE3A 4KI0A 1DGSA 1IHZA 2PNRC 3P75A 2ES2A 4ZK9B 2CFMA 1J8IA 3X3MA 4HTHA 1JCKB 1MIUA 3VR2A 2RCNA 4HMIA 2I5LX 3PV0A 4JI1Q 5KEEA 1IBLQ 1I6HB 4JI0Q 1G6PA 4C1NI 2QCPX 3NBHB 2UXDQ 3GTJB 1VQKA 1ICWA 2HDLA 3OIQA 2PZUA 4LUOA 2UUAL 4LF8Q 1LTID 5CV9A 1GKHA 2ALYB 2F0KA 2E2IH 5JJIA 5M3FB 1TR5A 2ZJQA 3L7ZC 4JI1L 5C4XH 1B53A 3VR4A 1IBLL 2Q2TA 1WYDA 4JI0L 1CUKA 2UXDL 2EVBA 1D5MC 2A6HC 3TP6A 2E2IB 2PNHA 4ODGA 3EFXD 1JWUD 4A3EH 2C35B 2PW5A 3RR5A 5C4XB 4LF8L 2E75C 1GUOA 4DV4Q 3A7LA 5F2DA 1NNXA 2VS1A 3PIOA 1PTOF 3T51B 1TQOA 1GHKA 5EPKA 4CDDC 1JOKA 1I4RA 3PUYA 4A3KG 4HJ5A 2IJ0A 1S5CD 3KLSX 1F9SA 2KCNA 1TY0A 2BOSA 2LKVA 4KV6A 4DV4L 4A93G 1WCMB 1MJEA 1KDCA 3TZUA 1BCPC 2A68C 3MVVA 3R3OA 2MQHA 2EXDA 5DEHA 3D4WA 5BN4A 3E0EA 3K80C 1HA5A 3CQZH 3RN2A 3OW2A 1DCZA 2V1CC 1KDBA 5CV6A 1L2FA 2LMCB 2MO1A 3AU7A 5EKKA 1EWIA 4LF7Q 2B3GA 4R1JA 3CKIB 3H3VH 1GUTA 3FRPB 4ID6A 3GTOB 4M1UB 1LTBD 1XNRQ 1QVCA 3I3CA 1AZQA 2IX3A 3HEJA 1E1TA 4OIJA 4G4KA 5ELBA 4C3IH 5IE8A 2R7ZB 4BBRG 1W3SA 1XXGA 4LF7L 1Q7YC 4OHJA 2OT2A 4AIMA 3D6CA 1JB7A 4R8IA 2K28A 1I6VC 2KQ3A 2J0TD 4C3IB 1FL0A 1STEA 1ZYRD 2FINB 2ID0A 2NZOA 3NUCA 4IUTA 3GO5A 4JW0A 3W5OA 4DR5Q 2XTIA 5IT9E 1K3RA 1EY6A 4IPCA 2XRQD 5FO7B 5D14A 3IFTA 4KY5A 4CGYB 1OTCA 2SNMA 4QUCA 2EY1A 4IJHA 2QGQA 2XGTA 3I4NB 1B9NA 1H95A 5E3FA 4DR5L 3HOWB 1STAA 2MHVA 4Y7NH 2KHIA 2RSNA 2NN6H 2ZXRA 4BY7G 4BXXG 5M5WH 1B4OA 1E2VA 4R4IA 3I4OA 2ZJPA 2EE1A 4CJ1B 3Q22A 1B2TA 3MXPA 4DK0A 3H94A 3CF5A 1SMXA 3EN2A 2Z6KC 4X64Q 1PRTD 3S17B 1CQFA 1QVFA 1RTNA 1B7YB 3ICEA 1W6KA 3J81i 2R92H 1F77A 2EDGA 3AMUA 1FGBD 1WFQA 4H7BA 4ZQ3A 1SYFA 3E9HA 2RQXA 4RHRA 5FKAC 4B3TQ 4IFDJ 3S15B 3AQQA 4ZYSA 1SMYC 1K9MC 3NE5B 1D8LA 4X64L 2KBNA 5E1FA 3SEBA 1TU2B 1A0IA 4C3HG 2NN6I 1PH1A 2PI2A 2Z1CA 5C44H 4JI2Q 4G7ZC 4A3CG 1BBUA 2HQEA 4B3TL 2NVTB 1EFID 4O1NA 5M5XH 1PHJA 5C44B 4A3LH 3AFQA 5HGTA 4N9PA 2JQOA 3CCEA 1RODA 2JA8B 1EQQA 4UP9A 1RKNA 3UI2A 5IGGA 1R4PB 4UP8A 1Q46A 4IZ8A 4JI2L 4BY1G 1K8GA 3NTKA 1PV4A 4UP7A 1RDPD 3MFGA 5I6YA 2HQLA 4R4CA 4XIGS 4FF4A 5M3MB 4CHTB 2OF1A 4BBSG 1AH9A 4AH6A 1TWCH 3W2DA 3M3YH 4DV5Q 2YYZA 2ENBA 1NUCA 2D62A 1S5ED 1VQIA 1L0WA 1WTVA 3OWFA 1NBWA 3A7AB 3JAMc 3MEFA 1J6QA 1V1PB 1LABA 3F2DA 3MZ5A 5A2QL 3F1ZA 3SK5A 1GUSA 1L1OC 4AYBB 4IN3A 4DV5L 3DMUA 4KKSA 2Q8IB 3WOFA 5JJZA 4JCVE 1PYSB 1PVOA 2F0SA 1K0RA 1G2TA 1A3VA 1B9MA 3D0FA 3TEHB 2R93B 1E2WA 2E2DC 2BE5C 3FPUB 2FXQA 4R4OA 3NPPA 3HOVG 1YBYA 1J9OA 3I56A 2GN5A 3KLRA 1EY5A 1JT8A 1DJRD 2K01A 4PMBA 2OQKA 4YCVA 1V43A 4ILWA 1BKBA 2O2LD 2L12A 2A69C 1KAWA 3B6YA 1SE4A 1ILQA 1CKMA 2RDHA 2I5MX 2B8FA 1I3QB 4PZ8A 5FLXE 2UUBQ 2WAQE 1HUMA 1PFSA 1WTXA 4KHVA 1JC7A 5IIFA 2AQ3B 5KGUA 2JA6G 1JORA 3HOZG 1STHA 2PW7A 1TWAB 2OCEA 2AUJD 1ET9A 3OPOA 1CKNA 1HUNA 2MGSA 2NZHA 1ENAA 1QVGA 4H0LC 4ZCKA 2IX0A 4HJAA 2F0IA 2Q8TA 2UUBL 4JPBW 2VW9A 2JA5H 3PUWA 2K75A 2B2TA 2NVYH 3LWEA 2KJXA 2KOLA 3A8IE 1I4GA 4DV6Q 1S40A 2QA4A 3GTGB 1KL9A 1NCVA 3KOJA 1QJOA 1Y1VG 5JAVA 1GJXA 2KUMA 1N33Q 2EY5A 1K83H 3S9WA 4H13C 2O5JC 1EOVA 2PO4A 4FF2A 1XNQQ 4CJ2C 5GADC 4DV6L 1U4MA 3T1YL 2WFWA 3TN2A 3K6OA 4DXGA 5I4DA 1SEBD 3AEVA 2K5QA 4V190 1KLGD 4K5VA 2H1EA 2VUMB 1VF7A 4QL5A 1QG7A 3RD4A 5ELOA 3TS2A 1EY7A 4X62Q 2ZJRA 2EJGC 1N33L 4GOPB 1JOQA 1Q8IA 5COYA 3W1GA 1XNQL 1R4QB 1VS0A 5IT9c 2ZTEA 1O7LA 1R9TB 3GTMH 2KHJA 2VY3A 3HOXG 1E3PA 4C2MH 1XPOA 4YCUA 1VQ7A 3OW7A 3PO3B 1YHBA 1UWVA 1QWYA 4X62L 1TS5A 3ITPA 3PO2G 4TVAB 1SXTA 1TWHH 4C2MB 1X3GA 3CCQA 1I50H 4FF3A 1K73C 4XXEA 5FK9C 3Q0AA 3MXNB 1E1OA 3GDEA 1XJVA 3QO2A 3HGBA 2ZT9C 1QNUA 4A3BH 1Z9FA 2Y0SE 5I9OA 1PA6A 1E22A 1TWHB 1JB3A 3I73A 4IPGA 1I50B 2ZM6Q 2UU9Q 3GTKH 2LXKA 4DR7Q 3J7AV 4X3SA 1BCPF 1HPCA 2K03A 4DV3Q 2G9HD 3RNUA 5AJ3Q 3TZDA 4A3BB 4QCLA 4J15A 3FKIB 4G7HC 3S2DH 1EEID 3RZDH 2BA1A 2PQEA 2UU9L 4CDCC 2ZM6L 4YWKA 4DR7L 3QOLA 3KYHC 3RZDB 1LM0A 4DV3L 2CKZB 3NP8A 1Y69U 5AJ3L 1ZYRC 4MNOA 2WAQG 3KFUA 4EQNA 3M7NA 3S1NH 4RKLA 3U9OA 1C8CA 4RFBA 2NVXH 4A3IG 5C3EB 2JEBI 1OXXK 3GQBA 3K7AB 3UDXA 3T1HQ 4XQJA 3U4VA 2YTXA 5CMDA 1YJ9A 4IPDA 4A3FH 3S1NB 3I55A 5IT9L 2G9DA 3ZJYC 5C0XG 3T56B 5J1ZA 2XVSA 3AFPA 1FGUA 3BZKA 1K3BC 1X32A 3ONAB 4B9XA 5ELNA 1VQMA 2B63H 1HZ9A 3ZYYX 1DD2A 2R61A 2EY2A 5GAGC 1SYBA 3T1HL 1TIID 1EY0A 5IYCH 1C4QA 3M4OB 1EOTA 2F0HA 2B63B 2JEAI 1VCIA 3SGIA 1LTAD 3M85A 2F0VA 1HTLD 4XYOA 4QJFA 2EPBA 1YJNA 5CV8A 4ULLA 1K8MA 1PRTC 4K6LA 4LNQA 2CCZA 4DNTB 4A3EG 4HIMA 2YTYA 1E0BA 1XTCD 2MJ8A 4DUYQ 5E4XA 2NTTA 1GVPA 1YITA 3S2HH 3U50C 4TRDA 2K32A 3HOYG 2KCTA 2A19A 3RUZA 2NVQH 1DXMA 1STGA 3MTSA 3K5MA 1E7ZA 3J80E 1XPUA 4L5SA 5FOBB 3HOUB 3S2HB 4LWCA 2VQEQ 1Z7TA 2Z8LA 3BYYB 5IP9H 3NSWA 2BH2A 4DUYL 1SYDA 3ER0A 1LLRD 3TP5A 5JEAH 1T9HA 1Y14B 1SE3A 3CAMA 2DNEA 3CPFA 4HSVA 2DJFC 5IGFA 4LF5Q 5FJ8G 1EYDA 4HIDA 4L5RC 2VQEL 1A2UA 4IUQA 4KKTA 2NBFA 2Y0SG 4IOCA 3VA7A 1O80A 5T1IA 2K5DA 2BH8A 1CSPA 3HRZC 2JA7B 1BNZA 1G6ZA 2KVMA 3I7FA 2E74C 1NE3A 1TS4A 4A3MB 4LF5L 1TS2A 4A3GH 4JBMA 5TSSA 3TRZA 3DEOA 1GO3E 1QCBD 4DK3C 1D6EC 1YNND 4MZ9A 5FLXc 2E2HB 4AYBE 3JC66 1NAPA 2AUKA 4PZ7A 3DXJC 3N6RA 1HR0W 3CHBD 2K04A 4O2DA 1TS3A 2VQFQ 3QIAA 1VMCA 4R9WA 1Q12A 1N8RC 1FNUA 1STBA 1SBBB 1IXRA 2O4XA 2Z6KA 4QB4A 3WOEA 4AQYQ 1H9MA 4X3UA 1ZEQX 1PH2A 4JK1C 2EYJA 5M9OA 1HA6A 2E2JB 2VB3X 1A8VA 3K8AA 1IL8A 2QW7A 1PXUA 1B1ZA 2NN6G 2VQFL 1I6HH 4CDEC 4J6HA 5GAHC 3GTJH 1PZID 5CORA 4AQYL 4JI7Q 1JQYD 2N8NA 3H09A 1UE6A 5KYIA 4UY8C 1K8AC 1JJCB 1JR0D 1WOCA 2MFIA 2QKIC 4EQOA 1SNQA 5M3FH 1EIYB 5DM63 4MHEA 5IGCA 1H9RA 4NB3A 2DY8A 3I91A 1D1IA 4JI6Q 1YEZA 2B2VC 4JI7L 2R92G 2LXJA 4A3DB 1BO0A 5A35A 4GLVB 4DNIA 2WB1E 3BZDB 1F9QA 3CCUA 3UE0A 1WTHA 2KENA 5ISRA 2VL6A 5FLXL 2UXCQ 1DOMA 3C1FA 4YIJA 5K36G 3CU7A 1SDFA 2GVAA 1LT5D 1FR3A 1X3QA 1I94Q 4JI6L 1WI5A 3P7JA 5C4ZA 1JWMD 4BWGB 2JK8A 4OWWB 1CFMA 1TWFB 3OIPA 3H0GH 1UAPA 4QIWB 3QG1A 3P20A 2M2LA 1L1OB 2B2WC 2Z6BA 5HY6A 1WCMH 4CKCA 2UXCL 3K5OA 1LT3D 1Y1WB 2DUDA 1F9RA 3H0GB 4A3LG 4XYQA 2A5HA 1I94L 4BS9A 1L1OA 1LACA 3H15A 1BXTA 1SFOB 5J39A 3K7UC 3LWUA 3M4YA 1BR9A 4FXDA 1EWCA 1RCVD 3NXWA 2D0PA 5EGTA 4K5WA 3GTOH 2F3VA 4FP5D 5IGBA 3I2ZA 2CQAA 1GUWA 1Y8NB 1GUGA 1BBWA 1SR3A 3BS1A 1FYCA 1IBKQ 2R7ZH 4WJ4A 4Q0FA 3BG3A 3I4MB 4KN4C 1S4ZA 1V9PA 2PQAA 4K2KA 1SSOA 1VQFA 1CHQD 4EQPA 1UEBA 4X66Q 2K6AA 1WJJA 1PFNA 4PNYA 2K5VA 1PTOB 3C2PA 3CMEA 1RHPA 3BU2A 2X6LA 4IALA 1IBKL 2VNUD 3FEWX 3PUZA 1H9JA 2K14A 2EYFA 2R6GA 1NTGA 5LL6X 5M5YH 1YHAA 4A76A 3I4NH 2L11A 4C3JB 4X66L 2B39A 3HOWH 2EYLA 4ZKBB 4HAEA 1TVXA 2K4KA 5M5YB 4A3JB 3G6EA 1MGSA 2IY5B 2VB2X 1F2YA 3KF6A 3U9SA 3H3VI 2RDFA 1PZKD 2EQSA 2K1BA 3TQYA 3RLOA 2NTSA 2MPMA 4DFAA 3J81j 1FVIA 1S5FD 4GN3B 4P73A 3VYSA 1ML0D 3WWVA 2N55A 4R4TA 5C4HA 2YU9B 4DV7Q 3K5NA 1EWHA 1FNVA 3S17H 4G57A 3FDTA 4U673 2EJMA 2R7DA 3S24A 3HKZB 4BA1I 2BA0A 2WB1G 1C0AA 3A74A 3J80c 2ZXPA 4B9WA 2DY7A 3S15H 1OXTA 3ULPA 1CTMA 2OQ0A 5EBCA 4DV7L 1E24A 4EGVA 3IKJA 2JA5G 1UE5A 3H6MA 4JBKA 2QF7A 1N34Q 4DR2Q 2SNSA 4JYAQ 3GD7A 4OELB 2NVTH 3RMHA 3E0JA 2SEBD 2TMPA 1MBYA 3UDGA 2HUGA 5ELCA 1CM9A 2IT1A 2NUCA 4DR3Q 1X55A 4RG1A 5CC4A 3PIO3 1O7ZA 4RHSA 4NXNQ 1N34L 2JA8H 4FF1A 2L5TA 4DR2L 3KK7A 4PZ6A 4JYAL 4K14A 1O7YA 4RCOA 1EY9A 2JXMB 4K0KQ 1G291 3DWAA 2Z9HA 5JVG3 3X3NA 5M3MH 1A3TA 4DR3L 1JE5A 3E9IA 5GAEC 4IURA 3PF4A 2C5CA 4KKUA 3OWEB 4NXNL 1PRTF 3TMEA 5CBAE 1BUVT 5C5MA 5C4JB 4GKJQ 1MKHA 2K5HA 4IUPA 2JE6I 1Q1BA 3A8JE 4DN4M 4M8AA 1EFWA 1T5XD 4ALPA 4A3KB 5FO9B 4K0KL 3M9BA 1YHQA 5CR3A 5EKIA 4A93B 1WD1A 4RCNA 1VQHA 4GKJL 3SXHA 4HIKA 3UDIA 1X9NA 3CRKC 1LTTD 2R93H 4OGQC 2ZTCA 1X56A 2GVBA 2K33A 1EY4A 2RKSA 1PLFA 1P16A 1PFMA 1F9PA 2F0QA 3BVZA 2L0CA 1IW7D 5DAUA 1S5BD 4L8JA 5ELFA 1HH2P 4XT1B 1EL0A 4GNXC 1ESFA 3Q24A 1HJPA 1SYGA 4ZRZA 2PZTA 1D5XC 4O0AA 4QUFA 1YNNC 3EVQA 3M7GA 1VQAA 4BBRB 1UE1A 1Q90A 1I3QH 3O13A 5JVH3 1C7YA 4RWSC 3TS0A 1H9SA 2ATWA 5D3IB 1I5FA 1KABA 1HNXQ 4N8FA 5CYUA 3E6ZX 1D1KA 2JP1A 3IL8A 1SROA 3EQLC 5IYDH 5BN5A 1CKNB 2A6ED 2XWJB 2J7ZA 4F8MA 3PIPA 3D31A 1TWAH 2F3IA 1KTKA 4H02A 1VQPA 1RIPA 3R2IA 3SE0A 4A3FG 4HMJA 1ILPA 1QOHA 2XNAC 3LGJA 1OXUA 3OOCA 3TDQA 1HNXL 1TXYA 2FFKB 1ENCA 3S1RH 4JI4Q 2AKWB 3CCJA 4BA2I 2D5DA 2WKCA 1G8ZD 5IYCG 3JAML 4FVMA 3H3VC 3GTGH 3I4LA 2M9VA 3I90A 1UEAB 4BY7B 2YV5A 2AQ2B 3S1RB 2F0JA 4CDFC 1XTDA 2ASBA 4IFDH 2F0OA 5E7NA 1QUQA 4YCWA 3CW2C 1LYLA 4OO1H 4MTNA 4K2LA 1CI3M 4JI4L 3BZCA 1EU3A 5E4WC 3I70A 1NSNS 5CGKA 2CH4W 1X3EA 3PUXA 1F2ZA 1Z6HA 3NQIA 2IL8A 1VF5C 2MNAA 3F2BA 3CCRA 1YVCA 4U68A 4LF9Q 1BDOA 2VUMH 3NENA 4MIUA 3BDCA 3VYRA 4HIOA 1CA5A 3S16B 1B3AA 3MAQA 2AWNA 2EJFC 3S14B 3D8GA 2NYZD 1PDQA 1HNZQ 4LW1A 1IZ6A 1HZAA 2D0OA 2CHBD 1J5EQ 4A3CH 5I9PA 1R9TH 4P2CB 2V4DA 1AP0A 2XIWA 4C3HB 1SLJA 4S3SA 4DKAC 4OWXB 4K6DA 4LF9L 5JEAG 4L6TB 2EZVA 3PO3H 1C9OA 2CW0D 3T53B 2H4OA 2DJGC 2WACA 1SE8A 4IFDI 3HFZB 2EYHA 2MUYA 4XT3B 1HNZL 4OO1I 1JWSD 2XN9C 4ZUJA 1S5DD 2RSOA 2I46A 1J5EL 3G71A 5KNDA 4KJOA 3NWTA 4KK7A 1EIFA 1CA6A 3OMGA 3NWSA 2WKDA 3NEMA 4JVZA 3CXCA 4BY1B 1ZKOA 2DNCA 1Y8OB 4A75A 1MD2D 3RN5A 4ZAIA 3FKIH 1VDZA 4A3GG 1NR2A 1A62A 3I72A 1RL2A 1E2ZA 3GTQB 4BBSB 2D9UA 1I4QA 5C6AA 5K5PA 2EY6A 3HS0C 2A8VA 5KIXA 1U4PA 2CH4A 3KBGA 4DF7A 1U0LA 3BVGA 5EJWA 3CCVA 1RTOA 5LL6S 1EEFD 4DAPA 5G3LD 5C3EH 2QEJC 3K7AH 2IWHA 5DM73 2HCIA 1YJWA 2B2VA 5KNCA 1U9RA 1M90C 1VQLA 2FMMA 1RF2D 2K52A 4TQUS 2UXBQ 1AEXA 2QDBA 4E6IA 1GXDC 1X3PA 3HOVH 2F3WA 3D6WA 2DGYA 5IYBH 3CMAA 2HIVA 3MA2B 2TSSA 1GHJA 1ASYA 3KJOA 2BDOA 3LX0A 5LMUQ 2Z0SA 1YIJA 3HOVB 3PIP3 4NW2A 4B08A 2O5IC 3M4OH 1ET6A 1HQMC 1HZBA 3G6JB 1PH6A 1U4RA 1PYBA 1VMPA 2RA4A 2JYOA 2UXBL 1VQJA 5LHY1 1BCPB 2B2WA 2PMZB 5M3FG 5C0XJ 5GROA 5J22A 3U58A 2XSCA 1D7QA 4EX5A 4KD3A 5LMUL 1SE2A 2L9HA 2KHSA 1M1KC 1AE2A 1STYA 2SDFA 2HD3A 5C4XG 4IQZA 1B50A 3L3OC 4X3KA 1O7IA 2RF4A 3A0JA 3NBIA 1YI2A 3L2PA 2JA6B 3D4RA 3WDNA 1WD0A 1GM5A 3HOZB 1JE4A 1YNJD 3KUPA 4JI8Q 1Q82C 4FO2A 1NJIC 2VZAA 1PH9A 4GKKQ 4FXKC 3K0YA 5D3DA 2SOBA 3HOUH 3GTLB 4KLKA 2K50A 2CWPA 2IW3A 2F1MA 4WORA 1QB5D 3BDLA 3I8ZA 4FDBA 4Q5VA 4HJ7A 1K8OA 2ZTDA 1WCMG 4B3SQ 2F0GA 3NTHA 2D2CC 4JI8L 3KF8A 4JI5Q 3P1HA 2F0UA 4GKKL 4YWMA 4UAIA 5JPNC 5IODA 1Y1VB 5IP7H 2HCCA 2R3ZA 5HGQA 1HFGA 3DLLA 3STBD 1N32Q 4B3SL 2JA7H 1IYJB 1PYWD 3VR5A 1HXYD 4JI5L 1LTRD 4XQQA 4HR7B 1ZXTA 2N88A 1K0SA 4A3MH 4IUNA 4FXGC 1Q8KA 2R7ZG 3K5LA 2XWBB 4L5TA 1XMQQ 2E2HH 2F0NA 2EIFA 1AZPA 4C3IG 1N32L 3OSOA 2F0PA 2NWGA 2B2UC 3J7ZC 4DAYA 1DOLA 3C1EA 1VQEA 3PGZA 3PO2H 3HOXB 2BCOA 2N49A 4DAMA 4NP5A 3TP8A 5KRUA 1EY8A 4QQBX 1RD9D 1XMQL 3PO2B 3VDYA 5C5LA 3MHBA 1F2LA 3V2TA 3I4NG 2E2JH 2A73B 5L37A 3SK8A 3HOWG 1KC8C 3T16A 4RGOS 5IOCA 1STNA 2OTJA 1KDAA 4L63B 3V05A 1IW7C 1DYQA 1B3QA 2J4XA 1XNRL 3RZOB 1UE7A 3KLSA 4LAAA 4GOPC 3IRBA 1VQ9A 3SK6A 1EZ8A 3S1MB 2MP1A 4JI3Q 1FNWA 1CT1D 2F4IA 2F0LA 1GUNA 1KIXA 1EIHA 3EIVA 3A55A 1PTOD 1WTWA 4DK6C 3W3AA 4A3DH 3K57A 1TKWB 1EYAA 1IYUA 2WAQB 1PH7A 2AWOA 1HR0Q 2A6EC 1XX8A 1II3A 3G48A 4A3IB 1LTGD 4JI3L 5C0XH 1U4LA 3MXUA 4P71A 3CCMA 2ICEC 2JSOA 3EJIA 4F7XA 5FLMH 3CC4A 4DA2A 3MWYW 2HIXA 2H5XA 2L1BA 1TY2A 1TWFH 1SYCA 4GS3A 4B3MQ 1HR0L 5J3BA 4FYDA 4GN5A 2RCFA 4I7ZC 2RDGA 1Y1WH 5C44G 1H9KA 3NBHA 4B3RQ 1U5KA 1A3UA 2I0QA 5LMNW 3A54A 1QZHA 2LY7A 2JA8G 3EA6A 3EBEA 2OEOA 4DR4Q 1SFOH 4B3ML 3BDOA 1V8QA 4JBWA 3M4PA 3KLWA 2B2YC 3JAMi 1PZJD 3KBXA 4JOIC 5CV4A 1ASZA 2ZXOA 1WTQA 4WRDA 4GNXB 3HOYH 4A3EB 2PCFB 4B3RL 1VQGA 5M3MG 5C0XI 1KRTA 1M4VA 3QR8A 4J1MA 4RGMA 2PQAB 1BOSA 3A5ZB 5T1GA 1HFNA 3I4MH 3H91A 3GV3A 3Q23A 3HOYB 4DR4L 4RGTA 3TP7A 1S72A 1A15A 3TBIB 1LV9A 4GNXA 2EOTA 4QGUA 2HDMA 3NELA 1MHWC 1X6OA 3E5SA 1KNAA 1G2SA 2K5WA 1JMCA 1Q81C 1PTOH 1AN8A 2M00A 4AYBG 4CBVA 3L0OA 2CW0C 5FJ8H 3DM1A 3K0XA 1ESRA 1A2TA 2N78A 2QEXA 4DPGA 1SRUA 5D65A 1X3FA 5KYLA 2DN8A 1BVSA 3CP0A 5LMNQ 3SR1A 5BN3A 1O78A 3KJPA 2R93G 3CQZB 3J81E 4KMUC 4P74A 4C3JH 4DV2Q 2VXWA 2JJQA 1P8LA 4A4IA 3SDZA 2RHQB 2Y0SB 1AFPA 3KF6B 4A3JH 3V96A 1SNMA 3DEPA 3DUZA 4NPSA 4TSSA 4PMCA 3HP3A 5LMNL 4XTCS 4GN4B 2XRSD 5IY0A 1EYCA 4DV2L 1SNDA 3ULLA 1KXLA 3RLFA 1PH4A 2FMCA 1LO5D 1V1OA 2YU9H 1IYVA 4UPAA 2UUCQ 2HHHQ 1F2MA 1BBXC 3D3RA 4OXPA 1LT4D 1WTPA 5IYDG 3HZXA 2Q2IA 1KQSA 4R4QA 3NTIA 3UE1A 5IGEA 2OXPA 1HHVA 4ME5A 4IUVA 4YHHQ 1SJHD 3Q6SA 4K8JA 2UUCL 4IJLA 4LFCQ 2HHHL 1BQQT 1CZWA 2PMZE 4Y7NB 3CCSA 4PG3A 4DXFA 2FHTA 5EPJA 5M5WB 4YHHL 4IFDG 3ERQA 3OYYA 3UDFA 2QDLA 4I7AA 4LFCL 4K8IA 4OO1G 1JICA 4G7OC 2YTVA 1KD1C 1KAAA 4HN7A 3SHLA 4LUVA 1NY4A 3GTPH 1UNSA 1JOOA 1FD7D 2KA7A 4P72A 4F88A 2R92B 3N52A 2VUMG 1LTSD 2N3SA 5K36H 3GTPB 4LJZC 4CKBA 3F2CA 2AHOB 4KN7C 4HJ9A 1YNJC 3A5UA 2HT1A 5C4JH 1A6XA 3FMCA 5KNBA 4HEDA 2QILA 4EQ5A 4CJ0B 3VYTA 1EIGA 2K7VA 4A3KH 2F03A 4JV5Q 4LFBQ 3PF5A 3AB9A 3K81C 3PO3G 4DR6Q 3FP9A 1S3OA 2K05A 5HURA 3R93A 5DLQE 1KHIA 3F2UA 4A93H 3PMFA 1NMFA 4HCEA 4WJWA 4LF4Q 5M5XB 4WJ3M 3J80L 1T5EA 4ABNA 3D4DA 1G51A 3SVMA 4JV5L 3BVMA 4LFBL 1KNEA 4PMWA 1WTOA 2B29A 1QZGA 4DR6L 3STBC 5JOBA 4X3TA 4A3BG 1HCZA 2IPKD 2X6GA 2C9OA 3FKIG 1N9WA 3QJYA 3OTOQ 4DU9A 1SJED 1WVLA 1IKMA 4LF4L 2IHFA 3RLNA 3IAYA 1TWCB 3M3YB 1JJGA 4HJ8A 1HRJA 1K28A 1WTRA 1Q86C 3FVQA 4PV1C 1H9SB 4BBRH 3MFYA 2GA4B 2L4NA 2Q8RE 3A8KE 3NK9A 4O42A 1IL2A 4JC0A 1ONLA 4XQNA 2CWAA 1B44D 2JA9A 3OTOL 4QY7A 2F0DA 1PRTB 1Z47A 5C3EG 4PQXA 1CHPD 5EKLA 1MJCA 1HQRD 2RVLA 1V1PA 1A63A 4RGNA 2L55A 1JJ2A 4UHVA 1Q3LA
chains in the Genus database with same CATH topology
1C48A 5CBEE 1W6JA 1HTPA 3GV6A 1PFBA 3T13A 1QNKA 1DM0B 1SNPA 3QB3A 3DHQA 2NZ1D 1DZ1A 4DAVA 3OMCA 2IX1A 1I4HA 1PTOC 5ELDA 3G7LA 2A6HD 4I65A 1NR4A 1SNOA 5ELEA 4UDUC 4NDXA 1ENFA 3R2TA 2WB1B 1I4PA 3SK4A 3K58A 3BYTB 1OXSC 3C3LA 2JA5B 2EXZA 3MEHA 2NVYB 2WIIB 3PUVA 2ICIA 5EQ0A 1RJTA 1BCPD 2B2UA 2A68D 4DK1A 4ZUIA 1MSGA 5I6WA 2X69A 4OIKA 1K83B 5I2YA 1EQTA 4HSPA 5CV7A 2KEEA 4LK1C 3NHHA 4KY7A 5JEAJ 1EU4A 5AFWA 3IFDA 3LNNA 2F0TA 2NB0A 1Y8PB 3T4AC 3K59A 2KEDA 4KY6A 4RH6A 4ZLTF 1XWEA 2RBMA 2LS01 4HCSA 3URYA 5CV5A 3GTMB 2FJ2A 2WINB 4J8QA 2WV6D 2PZWA 4V0BA 3C46A 3TSSA 3J7AF 2A74C 5IGDA 3L9AX 4CKEA 1QE6A 4H44C 1EZ6A 1GOZA 3MXNA 3GTKB 4IUUA 2F0MA 2BDNA 1KLUD 3VR6A 3DWQA 1PMRA 3ND9A 3J81L 3ND8A 4RKBA 1DOKA 3S2DB 4N9TA 3QOJA 1IKLA 3VYUA 1L0YB 4DNRB 2KECA 2EYMA 1OO9B 3HG9A 2NVXB 3EROA 1M8AA 2KCCA 2B2YA 4ZKCB 3MXGA 4QMGA 1SMYD 4KJNA 4A3FB 5JPMC 2E76C 2F0WA 3QWNA 1OXVA 5G3LF 1TWGB 4KTAA 1LT6D 4OL7A 2EYOA 4R8NA 1SNCA 4NMZA 5C3WA 1CZGA 4FNFA 4GZYC 4RAUC 4C56C 2F0EA 3MC0B 1SAPA 1QILA 4LMQD 3S1QB 3DWPA 2B8GA 2AQ1B 2F0FA 2I07B 3J7YW 2B2TC 2CVRA 3NQTA 4F87A 3CRLC 2NVQB 5A2QE 4MN3A 1I4XA 2Z4HA 3A56A 5FO8B 4XDXA 2PPBC 2LFNA 4RA8A 1CK1A 1BF4A 5NUCA 2Z4IA 4DGZA 5EPLA 4C3JG 2EYPA 4TKOB 2BE5D 1TT2A 1XYIA 3FPPA 1MI2A 4EVOA 2PYKA 1UUPA 3VA5A 4WFN3 4A3GB 4C1NK 4Z9CB 1MSHA 3VR3A 3GP7A 1D2BA 2A69D 1AW7A 4KD4A 5DNFA 5EBDA 2WP8J 4NKLA 1EQVA 1CQVA 1SYEA 1D5ZC 1L0XB 1DONA 4K5XA 4QF4A 4KHZA 1G91A 3JAME 3R8BA 5I2XA 1Q1EA 5C3XA 3OHXC 4KI0A 1IHZA 2PNRC 3P75A 4ZK9B 1J8IA 3X3MA 4HTHA 1JCKB 3VR2A 4HMIA 3PV0A 5KEEA 1I6HB 4C1NI 2QCPX 3GTJB 1ICWA 2HDLA 3OIQA 2PZUA 1LTID 5CV9A 2F0KA 5M3FB 1TR5A 3L7ZC 1B53A 3VR4A 2EVBA 1D5MC 2A6HC 3TP6A 2E2IB 4ODGA 3EFXD 1JWUD 2PW5A 5C4XB 2E75C 1GUOA 3A7LA 5F2DA 1PTOF 3T51B 1TQOA 1GHKA 5EPKA 1JOKA 1I4RA 3PUYA 2IJ0A 1S5CD 3KLSX 1F9SA 2KCNA 1TY0A 2BOSA 2LKVA 4KV6A 1WCMB 1KDCA 3TZUA 1BCPC 2A68C 3MVVA 3R3OA 5DEHA 3D4WA 5BN4A 1HA5A 1DCZA 1KDBA 5CV6A 2LMCB 5EKKA 3AU7A 3CKIB 1GUTA 3FRPB 4ID6A 3GTOB 4M1UB 1LTBD 3I3CA 1AZQA 2IX3A 3HEJA 4OIJA 4G4KA 5ELBA 2R7ZB 1XXGA 4OHJA 2OT2A 3D6CA 4R8IA 2K28A 1I6VC 2KQ3A 2J0TD 4C3IB 1STEA 1ZYRD 2FINB 2ID0A 3NUCA 4IUTA 3GO5A 5IT9E 1EY6A 2XRQD 5FO7B 5D14A 3IFTA 4KY5A 4CGYB 2SNMA 4QUCA 2EY1A 3I4NB 1B9NA 5E3FA 3HOWB 1STAA 2MHVA 2RSNA 2NN6H 2ZXRA 1B4OA 1E2VA 2EE1A 4CJ1B 3Q22A 1B2TA 3MXPA 4DK0A 3H94A 1PRTD 3S17B 1CQFA 1RTNA 1W6KA 1F77A 2EDGA 3AMUA 1FGBD 4H7BA 4ZQ3A 1SYFA 4RHRA 2RQXA 5FKAC 4IFDJ 3S15B 4ZYSA 1SMYC 3NE5B 5E1FA 3SEBA 1TU2B 4C3HG 2NN6I 2Z1CA 4G7ZC 2HQEA 2NVTB 1EFID 4O1NA 5C44B 5HGTA 4N9PA 1RODA 2JA8B 1RKNA 3UI2A 5IGGA 1R4PB 4IZ8A 3NTKA 1RDPD 3MFGA 5I6YA 4XIGS 4FF4A 5M3MB 4CHTB 2OF1A 3W2DA 2YYZA 2ENBA 1NUCA 2D62A 1S5ED 1WTVA 3OWFA 3A7AB 1V1PB 1LABA 3MZ5A 5A2QL 3SK5A 1GUSA 4AYBB 4IN3A 3DMUA 4KKSA 2Q8IB 3WOFA 5JJZA 2F0SA 1G2TA 1A3VA 1B9MA 2R93B 1E2WA 2E2DC 2BE5C 3FPUB 3NPPA 1J9OA 3KLRA 1EY5A 1DJRD 2K01A 4PMBA 1V43A 4ILWA 2O2LD 2L12A 2A69C 1SE4A 1ILQA 2RDHA 2B8FA 1I3QB 5FLXE 1HUMA 1WTXA 4KHVA 1JC7A 5IIFA 2AQ3B 5KGUA 1JORA 1STHA 2PW7A 1TWAB 2AUJD 1ET9A 3OPOA 1HUNA 2MGSA 1ENAA 4H0LC 2IX0A 2F0IA 2Q8TA 3PUWA 2B2TA 3LWEA 2KJXA 2KOLA 3A8IE 1I4GA 3GTGB 1NCVA 1QJOA 5JAVA 1GJXA 2KUMA 2EY5A 3S9WA 4H13C 2O5JC 2PO4A 4FF2A 4CJ2C 1U4MA 3TN2A 3K6OA 4DXGA 5I4DA 1SEBD 2K5QA 4V190 1KLGD 4K5VA 2H1EA 2VUMB 1VF7A 1QG7A 3RD4A 1EY7A 2EJGC 1JOQA 1Q8IA 5COYA 1R4QB 1O7LA 1R9TB 3OW7A 3PO3B 1QWYA 1TS5A 3ITPA 1SXTA 4C2MB 4FF3A 4XXEA 5FK9C 3Q0AA 3QO2A 3HGBA 2ZT9C 1QNUA 5I9OA 1TWHB 1JB3A 3I73A 1I50B 3J7AV 4X3SA 1BCPF 1HPCA 2K03A 2G9HD 3TZDA 4A3BB 4QCLA 3FKIB 4G7HC 1EEID 2BA1A 2PQEA 3QOLA 3RZDB 3NP8A 1Y69U 1ZYRC 4EQNA 3M7NA 4RKLA 3U9OA 1C8CA 4RFBA 5C3EB 2JEBI 1OXXK 3GQBA 3K7AB 4XQJA 5CMDA 3S1NB 5IT9L 2G9DA 5C0XG 3T56B 5J1ZA 2XVSA 1X32A 3ONAB 4B9XA 3ZYYX 1DD2A 2R61A 2EY2A 1SYBA 1TIID 1EY0A 1C4QA 3M4OB 1EOTA 2F0HA 2B63B 2JEAI 1VCIA 1LTAD 3M85A 2F0VA 1HTLD 4XYOA 2EPBA 5CV8A 4ULLA 1K8MA 1PRTC 4K6LA 4DNTB 1E0BA 1XTCD 2MJ8A 5E4XA 2NTTA 4TRDA 2K32A 3RUZA 1DXMA 1STGA 3MTSA 3K5MA 3J80E 5FOBB 3HOUB 3S2HB 1Z7TA 2Z8LA 3BYYB 3NSWA 1SYDA 1LLRD 3TP5A 5JEAH 1SE3A 2DNEA 4HSVA 5IGFA 1EYDA 1A2UA 4IUQA 4KKTA 2NBFA 3VA7A 1O80A 5T1IA 2K5DA 3HRZC 2JA7B 1BNZA 1G6ZA 2KVMA 2E74C 1TS4A 4A3MB 1TS2A 5TSSA 3DEOA 1QCBD 1D6EC 1YNND 2E2HB 1NAPA 2AUKA 3DXJC 3N6RA 3CHBD 2K04A 1TS3A 3QIAA 1VMCA 4R9WA 1Q12A 1FNUA 1STBA 1SBBB 3WOEA 2O4XA 4QB4A 1H9MA 4X3UA 1ZEQX 4JK1C 2EYJA 5M9OA 1HA6A 2E2JB 2VB3X 1IL8A 1PXUA 1B1ZA 2NN6G 4J6HA 1PZID 5CORA 1JQYD 3H09A 5KYIA 1JR0D 2QKIC 4EQOA 1SNQA 5DM63 4MHEA 5IGCA 1H9RA 2DY8A 3I91A 1D1IA 2B2VC 4A3DB 1BO0A 5A35A 3BZDB 1F9QA 5ISRA 5FLXL 1DOMA 3C1FA 4YIJA 5K36G 3CU7A 1SDFA 1LT5D 1FR3A 1X3QA 3P7JA 5C4ZA 1JWMD 4BWGB 1CFMA 1TWFB 3OIPA 1UAPA 4QIWB 3QG1A 3P20A 2M2LA 2B2WC 4CKCA 3K5OA 1LT3D 1Y1WB 1F9RA 3H0GB 4XYQA 2A5HA 4BS9A 1LACA 1BXTA 1SFOB 5J39A 3LWUA 3M4YA 1BR9A 4FXDA 1EWCA 1RCVD 3NXWA 5EGTA 4K5WA 2F3VA 4FP5D 5IGBA 2CQAA 1GUWA 1Y8NB 1GUGA 3BS1A 1FYCA 4Q0FA 3BG3A 3I4MB 4KN4C 1S4ZA 4K2KA 1SSOA 1CHQD 4EQPA 2K6AA 4PNYA 1PFNA 1PTOB 3C2PA 1RHPA 2X6LA 4IALA 2VNUD 3FEWX 3PUZA 1H9JA 2EYFA 2R6GA 5LL6X 2L11A 4C3JB 2B39A 2EYLA 4ZKBB 4HAEA 1TVXA 5M5YB 4A3JB 1MGSA 2VB2X 1F2YA 3U9SA 2RDFA 1PZKD 2K1BA 2NTSA 2MPMA 4DFAA 1S5FD 3VYSA 1ML0D 2N55A 5C4HA 2YU9B 3K5NA 1EWHA 1FNVA 4G57A 3FDTA 4U673 2EJMA 3HKZB 4BA1I 2BA0A 2ZXPA 4B9WA 2DY7A 1OXTA 1CTMA 5EBCA 4EGVA 3IKJA 3H6MA 2QF7A 2SNSA 3GD7A 3RMHA 3E0JA 2SEBD 2TMPA 1MBYA 2HUGA 5ELCA 1CM9A 2IT1A 2NUCA 5CC4A 3PIO3 1O7ZA 4RHSA 4FF1A 2L5TA 3KK7A 4K14A 1O7YA 4RCOA 1EY9A 2JXMB 1G291 3DWAA 5JVG3 3X3NA 1A3TA 4IURA 2C5CA 4KKUA 3OWEB 1PRTF 3TMEA 5CBAE 1BUVT 5C5MA 5C4JB 4IUPA 2JE6I 1Q1BA 3A8JE 4DN4M 4M8AA 1T5XD 4A3KB 5FO9B 5CR3A 5EKIA 4A93B 1WD1A 4RCNA 3SXHA 3CRKC 1LTTD 4OGQC 2K33A 1EY4A 2RKSA 1PLFA 1PFMA 1F9PA 2F0QA 3BVZA 2L0CA 1IW7D 5DAUA 1S5BD 4L8JA 5ELFA 4XT1B 1EL0A 1ESFA 3Q24A 1SYGA 4ZRZA 2PZTA 1D5XC 4QUFA 1YNNC 3EVQA 3M7GA 4BBRB 1Q90A 3O13A 5JVH3 4RWSC 1H9SA 5D3IB 1KABA 5CYUA 3E6ZX 1D1KA 2JP1A 3IL8A 3EQLC 5BN5A 2A6ED 2XWJB 2J7ZA 4F8MA 3D31A 1KTKA 3R2IA 3SE0A 4HMJA 1ILPA 1QOHA 2XNAC 1OXUA 3OOCA 3TDQA 2FFKB 1ENCA 4BA2I 2D5DA 2WKCA 1G8ZD 3JAML 4FVMA 3H3VC 3I4LA 2M9VA 3I90A 1UEAB 4BY7B 2AQ2B 3S1RB 2F0JA 4IFDH 2F0OA 4OO1H 4K2LA 1CI3M 1EU3A 5E4WC 3I70A 1NSNS 5CGKA 3PUXA 1F2ZA 1Z6HA 3NQIA 2IL8A 1VF5C 4U68A 1BDOA 3S16B 4MIUA 3BDCA 3VYRA 1CA5A 1B3AA 3MAQA 2AWNA 2EJFC 3S14B 3D8GA 2NYZD 1PDQA 2CHBD 5I9PA 4P2CB 2V4DA 1AP0A 2XIWA 4C3HB 4S3SA 4K6DA 5JEAG 4L6TB 2EZVA 2CW0D 3T53B 2H4OA 2WACA 4IFDI 2EYHA 2MUYA 4XT3B 4OO1I 1JWSD 2XN9C 4ZUJA 1S5DD 2RSOA 2I46A 5KNDA 4KJOA 3NWTA 4KK7A 1CA6A 3OMGA 3NWSA 2WKDA 4BY1B 1ZKOA 2DNCA 1Y8OB 1MD2D 4ZAIA 1VDZA 1NR2A 3I72A 1E2ZA 3GTQB 4BBSB 2D9UA 1I4QA 5C6AA 5K5PA 2EY6A 3HS0C 5KIXA 1U4PA 3KBGA 4DF7A 3BVGA 5EJWA 1RTOA 5LL6S 1EEFD 4DAPA 5G3LD 2QEJC 5DM73 2IWHA 2HCIA 2B2VA 5KNCA 1U9RA 2FMMA 1RF2D 4TQUS 1AEXA 2QDBA 4E6IA 1GXDC 1X3PA 2F3WA 3D6WA 3MA2B 2TSSA 1GHJA 2BDOA 3LX0A 3HOVB 3PIP3 4NW2A 4B08A 2O5IC 1ET6A 1HQMC 3G6JB 1U4RA 1VMPA 2RA4A 2JYOA 5LHY1 1BCPB 2B2WA 2PMZB 5C0XJ 5J22A 2XSCA 4KD3A 1SE2A 2L9HA 2KHSA 1STYA 2SDFA 4IQZA 1B50A 3L3OC 4X3KA 3NBIA 2JA6B 3D4RA 3WDNA 1WD0A 3HOZB 1JE4A 1YNJD 3KUPA 4FO2A 4FXKC 3K0YA 5D3DA 2SOBA 3GTLB 2IW3A 2F1MA 4WORA 1QB5D 3BDLA 3I8ZA 4Q5VA 1K8OA 2F0GA 3NTHA 2D2CC 3KF8A 3P1HA 2F0UA 4UAIA 5JPNC 5IODA 1Y1VB 2HCCA 2R3ZA 1HFGA 1PYWD 3VR5A 1HXYD 1LTRD 4XQQA 4HR7B 1ZXTA 2N88A 4IUNA 4FXGC 3K5LA 2XWBB 2F0NA 1AZPA 4C3IG 3OSOA 2F0PA 2NWGA 2B2UC 4DAYA 1DOLA 3C1EA 3HOXB 2BCOA 4NP5A 3TP8A 5KRUA 1EY8A 1RD9D 3PO2B 5C5LA 3MHBA 1F2LA 3V2TA 2A73B 3SK8A 3T16A 4RGOS 5IOCA 1STNA 1KDAA 4L63B 3V05A 1IW7C 1DYQA 2J4XA 3RZOB 3KLSA 4LAAA 3SK6A 1EZ8A 3S1MB 2MP1A 1FNWA 1CT1D 2F4IA 2F0LA 1GUNA 1EIHA 3A55A 1PTOD 1WTWA 3W3AA 3K57A 1TKWB 1EYAA 1IYUA 2WAQB 2AWOA 2A6EC 1XX8A 1II3A 4A3IB 1LTGD 5C0XH 1U4LA 3MXUA 2ICEC 2JSOA 3EJIA 4F7XA 4DA2A 3MWYW 2L1BA 1TY2A 1SYCA 4FYDA 4I7ZC 2RDGA 1H9KA 3NBHA 1A3UA 3A54A 2LY7A 3EA6A 2OEOA 3BDOA 1V8QA 4JBWA 2B2YC 1PZJD 3KBXA 5CV4A 2ZXOA 1WTQA 4WRDA 4A3EB 2PCFB 5C0XI 1M4VA 4J1MA 4RGMA 1BOSA 5T1GA 1HFNA 3H91A 3GV3A 3Q23A 3HOYB 4RGTA 3TP7A 1A15A 3TBIB 1LV9A 2EOTA 2HDMA 3E5SA 1KNAA 1G2SA 2K5WA 1PTOH 1AN8A 2M00A 4CBVA 2CW0C 3DM1A 1ESRA 1A2TA 5D65A 5KYLA 2DN8A 3SR1A 5BN3A 1O78A 3CQZB 3J81E 4KMUC 2VXWA 3SDZA 2Y0SB 1AFPA 3V96A 1SNMA 3DEPA 3DUZA 4TSSA 4PMCA 3HP3A 4XTCS 2XRSD 1EYCA 1SNDA 3RLFA 2FMCA 1LO5D 1V1OA 1IYVA 1F2MA 1BBXC 3D3RA 1LT4D 1WTPA 3HZXA 3NTIA 5IGEA 2OXPA 1HHVA 4ME5A 4IUVA 1SJHD 3Q6SA 4K8JA 1BQQT 1CZWA 4Y7NB 4DXFA 2FHTA 5EPJA 5M5WB 4IFDG 3ERQA 4K8IA 4OO1G 1JICA 4G7OC 1KAAA 4HN7A 3SHLA 1UNSA 1JOOA 1FD7D 2KA7A 4F88A 2R92B 3N52A 1LTSD 5K36H 3GTPB 4LJZC 4CKBA 4KN7C 1YNJC 1A6XA 3FMCA 5KNBA 4HEDA 2QILA 4CJ0B 3VYTA 1EIGA 2K7VA 2F03A 3AB9A 2K05A 5HURA 3R93A 3F2UA 3PMFA 4HCEA 4WJWA 5M5XB 3J80L 1T5EA 4ABNA 3D4DA 3SVMA 3BVMA 1KNEA 4PMWA 1WTOA 5JOBA 4X3TA 1HCZA 2IPKD 2X6GA 2C9OA 3QJYA 1IKMA 1WVLA 4DU9A 1SJED 3IAYA 1TWCB 3M3YB 1HRJA 1WTRA 3FVQA 4PV1C 1H9SB 3MFYA 2GA4B 2L4NA 2Q8RE 3A8KE 3NK9A 4O42A 1ONLA 4XQNA 1B44D 2F0DA 1PRTB 1Z47A 4PQXA 1CHPD 5EKLA 1HQRD 2RVLA 1V1PA 4RGNA 2L55A 1Q3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3P A;  1DOL A;  1PFN A;  4HCS A;  3D6W A;  2FJ2 A;  2H1E A;  1QG7 A;  1IL8 A;  1JIC A;  1RHP A;  2B2T C;  2EPB A;  4IUR A;  5T1G A;  1HFN A;  2CVR A;  2RSN A;  2X6L A;  5CBE E;  3H91 A;  3GV3 A;  5E4W C;  5CBA E;  1B53 A;  5COY A;  4IUP A;  5COR A;  4NW2 A;  4MN3 A;  3GV6 A;  5JJZ A;  1A15 A;  1PFB A;  1B4O A;  1LV9 A;  1QNK A;  2EOT A;  1F2L A;  1QE6 A;  4DN4 M;  2IL8 A;  1G2T A;  1U4R A;  2EE1 A;  2HDM A;  1VMP A;  2RA4 A;  3N52 A;  2JYO A;  4XDX A;  1E0B A;  4CJ1 B;  2L11 A;  2MJ8 A;  5E4X A;  1KNA A;  1G2S A;  3FPU B;  2B2W A;  4RA8 A;  4U68 A;  1B2T A;  1CA5 A;  4IUU A;  1B3A A;  2NZ1 D;  2BDN A;  5EKI A;  1BF4 A;  1DZ1 A;  4ZKB B;  4HAE A;  1TVX A;  3DM1 A;  1ESR A;  4MHE A;  5D65 A;  2NYZ D;  2DY8 A;  3MTS A;  1WD1 A;  1J9O A;  3I91 A;  1PDQ A;  2L9H A;  1MGS A;  2B2V C;  5EPK A;  4HED A;  3G7L A;  1RTN A;  2SDF A;  2K1B A;  5EPL A;  1BO0 A;  1DOK A;  4CJ0 B;  1EIG A;  3QO2 A;  1NR4 A;  2K01 A;  1B50 A;  4X3K A;  2MPM A;  1IKL A;  1AP0 A;  2XIW A;  2VXW A;  1F9Q A;  1F9S A;  2MP1 A;  1ML0 D;  2L12 A;  2N55 A;  2K05 A;  1PLF A;  1ILQ A;  1PFM A;  1WD0 A;  3R93 A;  1EIH A;  1DOM A;  1JE4 A;  3KUP A;  4X3S A;  2K03 A;  1F9P A;  1XYI A;  1MI2 A;  3F2U A;  1SDF A;  3DEP A;  3TZD A;  2KEC A;  4HSV A;  3FDT A;  1WTW A;  1X3Q A;  4XT1 B;  3HP3 A;  3P7J A;  4XT3 B;  1HUM A;  1EL0 A;  1WTX A;  2RSO A;  3I8Z A;  4QUF A;  4IUQ A;  1XX8 A;  1MSH A;  3SVM A;  1M8A A;  2M2L A;  1KNE A;  2B2W C;  1CA6 A;  1O80 A;  5T1I A;  1WTO A;  2B2Y A;  2DY7 A;  1U4L A;  4ZKC B;  5DNF A;  4X3T A;  1HUN A;  2MGS A;  5EQ0 A;  1RJT A;  2B2U A;  4RWS C;  1BNZ A;  1G6Z A;  2KVM A;  2X6G A;  1F9R A;  1IKM A;  3I3C A;  2Q8T A;  1WVL A;  4UAI A;  4ZAI A;  1BBX C;  1AZQ A;  1DON A;  3MWY W;  1WTP A;  1NR2 A;  2JP1 A;  2L1B A;  1MSG A;  2B2T A;  3IL8 A;  4OIJ A;  1C8C A;  3DEO A;  1G91 A;  1ROD A;  2X69 A;  3LWE A;  2HCC A;  2R3Z A;  4OIK A;  2KOL A;  2D9U A;  2J7Z A;  1HFG A;  3UI2 A;  1WTR A;  1HRJ A;  5CMD A;  1U4P A;  1HHV A;  1EQT A;  2L4N A;  2KEE A;  1NCV A;  4IUV A;  1NAP A;  2Q8R E;  4O42 A;  2K28 A;  4R8I A;  1ILP A;  3Q6S A;  5AFW A;  4ZK9 B;  2K04 A;  1J8I A;  2HUG A;  3IFD A;  1ZXT A;  2FIN B;  5EJW A;  1CM9 A;  2N88 A;  1RTO A;  4IUT A;  1GUW A;  1X32 A;  3ONA B;  4RAU C;  1VMC A;  2FFK B;  2KUM A;  1O7Z A;  4R9W A;  2RVL A;  2FHT A;  5D14 A;  2HCI A;  1S4Z A;  2B2V A;  4CJ2 C;  1AZP A;  1SAP A;  4X3U A;  5EPJ A;  1SSO A;  1ICW A;  2B2Y C;  2FMM A;  2HDL A;  3I90 A;  1EOT A;  1O7Y A;  1U4M A;  3KBX A;  2KED A;  4LMQ D;  4QUC A;  3TN2 A;  4ZLT F;  1WTV A;  1WTQ A;  2NWG A;  2B2U C;  1HA6 A;  1Q3L A; 
#chains in the Genus database with same CATH topology
 5IYB G;  1EQR A;  3PSI A;  4GLA C;  3J7A 5;  1C48 A;  2P5Z X;  4N8X 1;  4KHP Q;  5CBE E;  1N36 Q;  1W6J A;  4IOA A;  4OWT B;  2B63 G;  1HTP A;  3GV6 A;  4BY7 H;  1PFB A;  3U4Z A;  3T13 A;  4BXX H;  1VQ5 A;  1QNK A;  1QUQ B;  4JBJ A;  4Y52 H;  1DM0 B;  1SNP A;  3QB3 A;  3DHQ A;  1FJG Q;  5JJK A;  2NZ1 D;  1DZ1 A;  3F8T A;  4DAV A;  3OMC A;  4KHP L;  2IX1 A;  1I4H A;  4MTK A;  1N36 L;  3CC7 A;  1PTO C;  2IHE A;  5ELD A;  3G7L A;  2A6H D;  1W2B A;  4I65 A;  1NR4 A;  1SNO A;  4P75 A;  5ELE A;  2L15 A;  3S16 H;  4UDU C;  4NDX A;  1ENF A;  3R2T A;  1FJG L;  2WB1 B;  1I4P A;  3S14 H;  3SK4 A;  3K58 A;  5EAY A;  4LFA Q;  2F4V Q;  3BYT B;  3HOU G;  1NMG A;  1OXS C;  3C3L A;  1X54 A;  2JA5 B;  2EXZ A;  3T1Y Q;  3DM3 A;  4L5Q A;  4QIW E;  3MEH A;  2NVY B;  4C3H H;  2WII B;  3CPW A;  3PUV A;  4LF6 Q;  1SN8 A;  5IP9 G;  2ICI A;  5EQ0 A;  1RJT A;  3J81 c;  4LFA L;  1BCP D;  2B2U A;  2A68 D;  2F4V L;  4DK1 A;  5IP7 G;  4ZUI A;  1MSG A;  5I6W A;  2X69 A;  4OIK A;  3W1B A;  1K83 B;  5I2Y A;  1EQT A;  4HSP A;  5CV7 A;  2KEE A;  4LK1 C;  3NHH A;  4LF6 L;  2JA7 G;  4BY1 H;  4KY7 A;  1YZ6 A;  1EU4 A;  2MO0 A;  5JEA J;  5AFW A;  4A3M G;  3IFD A;  4IO9 A;  1VQ6 A;  4X6A H;  3Q8D A;  1B70 B;  3LNN A;  2F0T A;  3GTQ H;  2NB0 A;  4BBS H;  1VQN A;  1CSQ A;  5IWA Q;  1Y8P B;  4NXM Q;  3T4A C;  3K59 A;  2JN4 A;  2KED A;  4KY6 A;  4RH6 A;  4GOP A;  4ZLT F;  1XWE A;  2RBM A;  2LS0 1;  4HCS A;  3URY A;  5CV5 A;  3GTM B;  2FJ2 A;  2WIN B;  4J8Q A;  2WV6 D;  1HNW Q;  2PZW A;  4V0B A;  3C46 A;  3TSS A;  2KCM A;  5IWA L;  4NXM L;  3J7A F;  2A74 C;  1KRS A;  5IGD A;  3L9A X;  4CKE A;  3ERS X;  1QE6 A;  4H44 C;  3HKS A;  3TRE A;  1EZ6 A;  1GOZ A;  2OTL A;  3KDF B;  3MXN A;  1EUJ A;  3GTK B;  4IUU A;  2F0M A;  2BDN A;  1HNW L;  1LTL A;  4JG2 A;  1KLU D;  3FHW A;  1X65 A;  3VR6 A;  3DWQ A;  1PMR A;  3ND9 A;  3J81 L;  1YNX A;  3ND8 A;  3AYH B;  2E8G A;  4RKB A;  3M4Q A;  1DOK A;  3S2D B;  4N9T A;  3KDF A;  3QOJ A;  1IKL A;  3VYU A;  2E5L Q;  1L0Y B;  1B8A A;  4DNR B;  2KEC A;  3HKZ E;  2EYM A;  4A3D G;  4OX9 Q;  1OO9 B;  3HG9 A;  3ULJ A;  1IBM Q;  1HZC A;  4DUZ Q;  2NVX B;  1PH5 A;  3ERO A;  1M8A A;  2JA6 H;  2KCC A;  3HOZ H;  2B2Y A;  4ZKC B;  1TWG H;  2E5L L;  3MXG A;  2G5D A;  2PI2 E;  1SMY D;  4JOI A;  4LUZ A;  1VQC A;  4KJN A;  4QMG A;  5JPM C;  5FLM G;  4A3F B;  2E76 C;  2F0W A;  3GTL H;  1VQ4 A;  5BR8 Q;  3QWN A;  5GQO A;  1OXV A;  5G3L F;  4DV1 Q;  4OX9 L;  1TWG B;  4KTA A;  1IBM L;  1LT6 D;  1LUZ A;  4OL7 A;  3KF8 B;  4DUZ L;  2Q2H A;  4OEM B;  4ME3 A;  3BJU A;  2F52 A;  1Y1W G;  3H0G G;  2RHS B;  2EYO A;  4R8N A;  1SNC A;  4NMZ A;  2AMC B;  5C3W A;  1CZG A;  4FNF A;  4X65 Q;  5BR8 L;  1Y1V H;  4GZY C;  3S1Q H;  4DV1 L;  4RAU C;  1PH3 A;  4C56 C;  2F0E A;  3MC0 B;  2A1A A;  1SAP A;  2LSS A;  1QIL A;  4GLX A;  4LMQ D;  3S1Q B;  3DWP A;  3CC2 A;  2B8G A;  2AQ1 B;  3PCO B;  2F0F A;  4X65 L;  2I07 B;  4IPH A;  3J7Y W;  2B2T C;  3I4M G;  2CVR A;  3NQT A;  4F87 A;  3CRL C;  2NVQ B;  5A2Q E;  4DAY B;  4MN3 A;  1I4X A;  5JJL A;  3E3X A;  2R7F A;  2Z4H A;  3A56 A;  5FO8 B;  4XDX A;  2PPB C;  2LFN A;  4RA8 A;  1CKO A;  4POF A;  1CK1 A;  3HOX H;  1VQD A;  3G4S A;  2K5N A;  4YY3 Q;  1BF4 A;  5NUC A;  1GD7 A;  2I5H A;  4DR1 Q;  4DV0 Q;  1V1Q A;  2Z4I A;  4DGZ A;  5EPL A;  4C3J G;  2EYP A;  4TKO B;  2BE5 D;  4OON A;  1XMO Q;  4A3J G;  1TT2 A;  2CQO A;  1XYI A;  4YY3 L;  3FPP A;  1MI2 A;  1XPR A;  4EVO A;  1VQO A;  2PYK A;  4POG A;  3RZO H;  3PQI A;  4RMF A;  4DR1 L;  4DV0 L;  1UUP A;  3CCL A;  1VQ8 A;  3VA5 A;  4WFN 3;  4A3G B;  3J80 i;  3S1M H;  4C1N K;  4Z9C B;  4APV A;  1MSH A;  3VR3 A;  2Q2U A;  3GP7 A;  5H1S E;  1XMO L;  1D2B A;  2A69 D;  1AW7 A;  4KD4 A;  5DNF A;  5EBD A;  2WP8 J;  4NKL A;  1EQV A;  1CQV A;  1SYE A;  3HKZ G;  1D5Z C;  1L0X B;  1PH8 A;  1DON A;  4K5X A;  4YWL A;  4QF4 A;  4KHZ A;  1G91 A;  3JAM E;  3CD6 A;  1VQB A;  3R8B A;  4A3I H;  5I2X A;  1EYG A;  1Q1E A;  5C3X A;  3OHX C;  1ICF B;  2UUA Q;  2OWO A;  1AE3 A;  4KI0 A;  1DGS A;  1IHZ A;  2PNR C;  3P75 A;  2ES2 A;  4ZK9 B;  2CFM A;  1J8I A;  3X3M A;  4HTH A;  1JCK B;  1MIU A;  3VR2 A;  2RCN A;  4HMI A;  2I5L X;  3PV0 A;  4JI1 Q;  5KEE A;  1IBL Q;  1I6H B;  4JI0 Q;  1G6P A;  4C1N I;  2QCP X;  3NBH B;  2UXD Q;  3GTJ B;  1VQK A;  1ICW A;  2HDL A;  3OIQ A;  2PZU A;  4LUO A;  2UUA L;  4LF8 Q;  1LTI D;  5CV9 A;  1GKH A;  2ALY B;  2F0K A;  2E2I H;  5JJI A;  5M3F B;  1TR5 A;  2ZJQ A;  3L7Z C;  4JI1 L;  5C4X H;  1B53 A;  3VR4 A;  1IBL L;  2Q2T A;  1WYD A;  4JI0 L;  1CUK A;  2UXD L;  2EVB A;  1D5M C;  2A6H C;  3TP6 A;  2E2I B;  2PNH A;  4ODG A;  3EFX D;  1JWU D;  4A3E H;  2C35 B;  2PW5 A;  3RR5 A;  5C4X B;  4LF8 L;  2E75 C;  1GUO A;  4DV4 Q;  3A7L A;  5F2D A;  1NNX A;  2VS1 A;  3PIO A;  1PTO F;  3T51 B;  1TQO A;  1GHK A;  5EPK A;  4CDD C;  1JOK A;  1I4R A;  3PUY A;  4A3K G;  4HJ5 A;  2IJ0 A;  1S5C D;  3KLS X;  1F9S A;  2KCN A;  1TY0 A;  2BOS A;  2LKV A;  4KV6 A;  4DV4 L;  4A93 G;  1WCM B;  1MJE A;  1KDC A;  3TZU A;  1BCP C;  2A68 C;  3MVV A;  3R3O A;  2MQH A;  2EXD A;  5DEH A;  3D4W A;  5BN4 A;  3E0E A;  3K80 C;  1HA5 A;  3CQZ H;  3RN2 A;  3OW2 A;  1DCZ A;  2V1C C;  1KDB A;  5CV6 A;  1L2F A;  2LMC B;  2MO1 A;  3AU7 A;  5EKK A;  1EWI A;  4LF7 Q;  2B3G A;  4R1J A;  3CKI B;  3H3V H;  1GUT A;  3FRP B;  4ID6 A;  3GTO B;  4M1U B;  1LTB D;  1XNR Q;  1QVC A;  3I3C A;  1AZQ A;  2IX3 A;  3HEJ A;  1E1T A;  4OIJ A;  4G4K A;  5ELB A;  4C3I H;  5IE8 A;  2R7Z B;  4BBR G;  1W3S A;  1XXG A;  4LF7 L;  1Q7Y C;  4OHJ A;  2OT2 A;  4AIM A;  3D6C A;  1JB7 A;  4R8I A;  2K28 A;  1I6V C;  2KQ3 A;  2J0T D;  4C3I B;  1FL0 A;  1STE A;  1ZYR D;  2FIN B;  2ID0 A;  2NZO A;  3NUC A;  4IUT A;  3GO5 A;  4JW0 A;  3W5O A;  4DR5 Q;  2XTI A;  5IT9 E;  1K3R A;  1EY6 A;  4IPC A;  2XRQ D;  5FO7 B;  5D14 A;  3IFT A;  4KY5 A;  4CGY B;  1OTC A;  2SNM A;  4QUC A;  2EY1 A;  4IJH A;  2QGQ A;  2XGT A;  3I4N B;  1B9N A;  1H95 A;  5E3F A;  4DR5 L;  3HOW B;  1STA A;  2MHV A;  4Y7N H;  2KHI A;  2RSN A;  2NN6 H;  2ZXR A;  4BY7 G;  4BXX G;  5M5W H;  1B4O A;  1E2V A;  4R4I A;  3I4O A;  2ZJP A;  2EE1 A;  4CJ1 B;  3Q22 A;  1B2T A;  3MXP A;  4DK0 A;  3H94 A;  3CF5 A;  1SMX A;  3EN2 A;  2Z6K C;  4X64 Q;  1PRT D;  3S17 B;  1CQF A;  1QVF A;  1RTN A;  1B7Y B;  3ICE A;  1W6K A;  3J81 i;  2R92 H;  1F77 A;  2EDG A;  3AMU A;  1FGB D;  1WFQ A;  4H7B A;  4ZQ3 A;  1SYF A;  3E9H A;  2RQX A;  4RHR A;  5FKA C;  4B3T Q;  4IFD J;  3S15 B;  3AQQ A;  4ZYS A;  1SMY C;  1K9M C;  3NE5 B;  1D8L A;  4X64 L;  2KBN A;  5E1F A;  3SEB A;  1TU2 B;  1A0I A;  4C3H G;  2NN6 I;  1PH1 A;  2PI2 A;  2Z1C A;  5C44 H;  4JI2 Q;  4G7Z C;  4A3C G;  1BBU A;  2HQE A;  4B3T L;  2NVT B;  1EFI D;  4O1N A;  5M5X H;  1PHJ A;  5C44 B;  4A3L H;  3AFQ A;  5HGT A;  4N9P A;  2JQO A;  3CCE A;  1ROD A;  2JA8 B;  1EQQ A;  4UP9 A;  1RKN A;  3UI2 A;  5IGG A;  1R4P B;  4UP8 A;  1Q46 A;  4IZ8 A;  4JI2 L;  4BY1 G;  1K8G A;  3NTK A;  1PV4 A;  4UP7 A;  1RDP D;  3MFG A;  5I6Y A;  2HQL A;  4R4C A;  4XIG S;  4FF4 A;  5M3M B;  4CHT B;  2OF1 A;  4BBS G;  1AH9 A;  4AH6 A;  1TWC H;  3W2D A;  3M3Y H;  4DV5 Q;  2YYZ A;  2ENB A;  1NUC A;  2D62 A;  1S5E D;  1VQI A;  1L0W A;  1WTV A;  3OWF A;  1NBW A;  3A7A B;  3JAM c;  3MEF A;  1J6Q A;  1V1P B;  1LAB A;  3F2D A;  3MZ5 A;  5A2Q L;  3F1Z A;  3SK5 A;  1GUS A;  1L1O C;  4AYB B;  4IN3 A;  4DV5 L;  3DMU A;  4KKS A;  2Q8I B;  3WOF A;  5JJZ A;  4JCV E;  1PYS B;  1PVO A;  2F0S A;  1K0R A;  1G2T A;  1A3V A;  1B9M A;  3D0F A;  3TEH B;  2R93 B;  1E2W A;  2E2D C;  2BE5 C;  3FPU B;  2FXQ A;  4R4O A;  3NPP A;  3HOV G;  1YBY A;  1J9O A;  3I56 A;  2GN5 A;  3KLR A;  1EY5 A;  1JT8 A;  1DJR D;  2K01 A;  4PMB A;  2OQK A;  4YCV A;  1V43 A;  4ILW A;  1BKB A;  2O2L D;  2L12 A;  2A69 C;  1KAW A;  3B6Y A;  1SE4 A;  1ILQ A;  1CKM A;  2RDH A;  2I5M X;  2B8F A;  1I3Q B;  4PZ8 A;  5FLX E;  2UUB Q;  2WAQ E;  1HUM A;  1PFS A;  1WTX A;  4KHV A;  1JC7 A;  5IIF A;  2AQ3 B;  5KGU A;  2JA6 G;  1JOR A;  3HOZ G;  1STH A;  2PW7 A;  1TWA B;  2OCE A;  2AUJ D;  1ET9 A;  3OPO A;  1CKN A;  1HUN A;  2MGS A;  2NZH A;  1ENA A;  1QVG A;  4H0L C;  4ZCK A;  2IX0 A;  4HJA A;  2F0I A;  2Q8T A;  2UUB L;  4JPB W;  2VW9 A;  2JA5 H;  3PUW A;  2K75 A;  2B2T A;  2NVY H;  3LWE A;  2KJX A;  2KOL A;  3A8I E;  1I4G A;  4DV6 Q;  1S40 A;  2QA4 A;  3GTG B;  1KL9 A;  1NCV A;  3KOJ A;  1QJO A;  1Y1V G;  5JAV A;  1GJX A;  2KUM A;  1N33 Q;  2EY5 A;  1K83 H;  3S9W A;  4H13 C;  2O5J C;  1EOV A;  2PO4 A;  4FF2 A;  1XNQ Q;  4CJ2 C;  5GAD C;  4DV6 L;  1U4M A;  3T1Y L;  2WFW A;  3TN2 A;  3K6O A;  4DXG A;  5I4D A;  1SEB D;  3AEV A;  2K5Q A;  4V19 0;  1KLG D;  4K5V A;  2H1E A;  2VUM B;  1VF7 A;  4QL5 A;  1QG7 A;  3RD4 A;  5ELO A;  3TS2 A;  1EY7 A;  4X62 Q;  2ZJR A;  2EJG C;  1N33 L;  4GOP B;  1JOQ A;  1Q8I A;  5COY A;  3W1G A;  1XNQ L;  1R4Q B;  1VS0 A;  5IT9 c;  2ZTE A;  1O7L A;  1R9T B;  3GTM H;  2KHJ A;  2VY3 A;  3HOX G;  1E3P A;  4C2M H;  1XPO A;  4YCU A;  1VQ7 A;  3OW7 A;  3PO3 B;  1YHB A;  1UWV A;  1QWY A;  4X62 L;  1TS5 A;  3ITP A;  3PO2 G;  4TVA B;  1SXT A;  1TWH H;  4C2M B;  1X3G A;  3CCQ A;  1I50 H;  4FF3 A;  1K73 C;  4XXE A;  5FK9 C;  3Q0A A;  3MXN B;  1E1O A;  3GDE A;  1XJV A;  3QO2 A;  3HGB A;  2ZT9 C;  1QNU A;  4A3B H;  1Z9F A;  2Y0S E;  5I9O A;  1PA6 A;  1E22 A;  1TWH B;  1JB3 A;  3I73 A;  4IPG A;  1I50 B;  2ZM6 Q;  2UU9 Q;  3GTK H;  2LXK A;  4DR7 Q;  3J7A V;  4X3S A;  1BCP F;  1HPC A;  2K03 A;  4DV3 Q;  2G9H D;  3RNU A;  5AJ3 Q;  3TZD A;  4A3B B;  4QCL A;  4J15 A;  3FKI B;  4G7H C;  3S2D H;  1EEI D;  3RZD H;  2BA1 A;  2PQE A;  2UU9 L;  4CDC C;  2ZM6 L;  4YWK A;  4DR7 L;  3QOL A;  3KYH C;  3RZD B;  1LM0 A;  4DV3 L;  2CKZ B;  3NP8 A;  1Y69 U;  5AJ3 L;  1ZYR C;  4MNO A;  2WAQ G;  3KFU A;  4EQN A;  3M7N A;  3S1N H;  4RKL A;  3U9O A;  1C8C A;  4RFB A;  2NVX H;  4A3I G;  5C3E B;  2JEB I;  1OXX K;  3GQB A;  3K7A B;  3UDX A;  3T1H Q;  4XQJ A;  3U4V A;  2YTX A;  5CMD A;  1YJ9 A;  4IPD A;  4A3F H;  3S1N B;  3I55 A;  5IT9 L;  2G9D A;  3ZJY C;  5C0X G;  3T56 B;  5J1Z A;  2XVS A;  3AFP A;  1FGU A;  3BZK A;  1K3B C;  1X32 A;  3ONA B;  4B9X A;  5ELN A;  1VQM A;  2B63 H;  1HZ9 A;  3ZYY X;  1DD2 A;  2R61 A;  2EY2 A;  5GAG C;  1SYB A;  3T1H L;  1TII D;  1EY0 A;  5IYC H;  1C4Q A;  3M4O B;  1EOT A;  2F0H A;  2B63 B;  2JEA I;  1VCI A;  3SGI A;  1LTA D;  3M85 A;  2F0V A;  1HTL D;  4XYO A;  4QJF A;  2EPB A;  1YJN A;  5CV8 A;  4ULL A;  1K8M A;  1PRT C;  4K6L A;  4LNQ A;  2CCZ A;  4DNT B;  4A3E G;  4HIM A;  2YTY A;  1E0B A;  1XTC D;  2MJ8 A;  4DUY Q;  5E4X A;  2NTT A;  1GVP A;  1YIT A;  3S2H H;  3U50 C;  4TRD A;  2K32 A;  3HOY G;  2KCT A;  2A19 A;  3RUZ A;  2NVQ H;  1DXM A;  1STG A;  3MTS A;  3K5M A;  1E7Z A;  3J80 E;  1XPU A;  4L5S A;  5FOB B;  3HOU B;  3S2H B;  4LWC A;  2VQE Q;  1Z7T A;  2Z8L A;  3BYY B;  5IP9 H;  3NSW A;  2BH2 A;  4DUY L;  1SYD A;  3ER0 A;  1LLR D;  3TP5 A;  5JEA H;  1T9H A;  1Y14 B;  1SE3 A;  3CAM A;  2DNE A;  3CPF A;  4HSV A;  2DJF C;  5IGF A;  4LF5 Q;  5FJ8 G;  1EYD A;  4HID A;  4L5R C;  2VQE L;  1A2U A;  4IUQ A;  4KKT A;  2NBF A;  2Y0S G;  4IOC A;  3VA7 A;  1O80 A;  5T1I A;  2K5D A;  2BH8 A;  1CSP A;  3HRZ C;  2JA7 B;  1BNZ A;  1G6Z A;  2KVM A;  3I7F A;  2E74 C;  1NE3 A;  1TS4 A;  4A3M B;  4LF5 L;  1TS2 A;  4A3G H;  4JBM A;  5TSS A;  3TRZ A;  3DEO A;  1GO3 E;  1QCB D;  4DK3 C;  1D6E C;  1YNN D;  4MZ9 A;  5FLX c;  2E2H B;  4AYB E;  3JC6 6;  1NAP A;  2AUK A;  4PZ7 A;  3DXJ C;  3N6R A;  1HR0 W;  3CHB D;  2K04 A;  4O2D A;  1TS3 A;  2VQF Q;  3QIA A;  1VMC A;  4R9W A;  1Q12 A;  1N8R C;  1FNU A;  1STB A;  1SBB B;  1IXR A;  2O4X A;  2Z6K A;  4QB4 A;  3WOE A;  4AQY Q;  1H9M A;  4X3U A;  1ZEQ X;  1PH2 A;  4JK1 C;  2EYJ A;  5M9O A;  1HA6 A;  2E2J B;  2VB3 X;  1A8V A;  3K8A A;  1IL8 A;  2QW7 A;  1PXU A;  1B1Z A;  2NN6 G;  2VQF L;  1I6H H;  4CDE C;  4J6H A;  5GAH C;  3GTJ H;  1PZI D;  5COR A;  4AQY L;  4JI7 Q;  1JQY D;  2N8N A;  3H09 A;  1UE6 A;  5KYI A;  4UY8 C;  1K8A C;  1JJC B;  1JR0 D;  1WOC A;  2MFI A;  2QKI C;  4EQO A;  1SNQ A;  5M3F H;  1EIY B;  5DM6 3;  4MHE A;  5IGC A;  1H9R A;  4NB3 A;  2DY8 A;  3I91 A;  1D1I A;  4JI6 Q;  1YEZ A;  2B2V C;  4JI7 L;  2R92 G;  2LXJ A;  4A3D B;  1BO0 A;  5A35 A;  4GLV B;  4DNI A;  2WB1 E;  3BZD B;  1F9Q A;  3CCU A;  3UE0 A;  1WTH A;  2KEN A;  5ISR A;  2VL6 A;  5FLX L;  2UXC Q;  1DOM A;  3C1F A;  4YIJ A;  5K36 G;  3CU7 A;  1SDF A;  2GVA A;  1LT5 D;  1FR3 A;  1X3Q A;  1I94 Q;  4JI6 L;  1WI5 A;  3P7J A;  5C4Z A;  1JWM D;  4BWG B;  2JK8 A;  4OWW B;  1CFM A;  1TWF B;  3OIP A;  3H0G H;  1UAP A;  4QIW B;  3QG1 A;  3P20 A;  2M2L A;  1L1O B;  2B2W C;  2Z6B A;  5HY6 A;  1WCM H;  4CKC A;  2UXC L;  3K5O A;  1LT3 D;  1Y1W B;  2DUD A;  1F9R A;  3H0G B;  4A3L G;  4XYQ A;  2A5H A;  1I94 L;  4BS9 A;  1L1O A;  1LAC A;  3H15 A;  1BXT A;  1SFO B;  5J39 A;  3K7U C;  3LWU A;  3M4Y A;  1BR9 A;  4FXD A;  1EWC A;  1RCV D;  3NXW A;  2D0P A;  5EGT A;  4K5W A;  3GTO H;  2F3V A;  4FP5 D;  5IGB A;  3I2Z A;  2CQA A;  1GUW A;  1Y8N B;  1GUG A;  1BBW A;  1SR3 A;  3BS1 A;  1FYC A;  1IBK Q;  2R7Z H;  4WJ4 A;  4Q0F A;  3BG3 A;  3I4M B;  4KN4 C;  1S4Z A;  1V9P A;  2PQA A;  4K2K A;  1SSO A;  1VQF A;  1CHQ D;  4EQP A;  1UEB A;  4X66 Q;  2K6A A;  1WJJ A;  1PFN A;  4PNY A;  2K5V A;  1PTO B;  3C2P A;  3CME A;  1RHP A;  3BU2 A;  2X6L A;  4IAL A;  1IBK L;  2VNU D;  3FEW X;  3PUZ A;  1H9J A;  2K14 A;  2EYF A;  2R6G A;  1NTG A;  5LL6 X;  5M5Y H;  1YHA A;  4A76 A;  3I4N H;  2L11 A;  4C3J B;  4X66 L;  2B39 A;  3HOW H;  2EYL A;  4ZKB B;  4HAE A;  1TVX A;  2K4K A;  5M5Y B;  4A3J B;  3G6E A;  1MGS A;  2IY5 B;  2VB2 X;  1F2Y A;  3KF6 A;  3U9S A;  3H3V I;  2RDF A;  1PZK D;  2EQS A;  2K1B A;  3TQY A;  3RLO A;  2NTS A;  2MPM A;  4DFA A;  3J81 j;  1FVI A;  1S5F D;  4GN3 B;  4P73 A;  3VYS A;  1ML0 D;  3WWV A;  2N55 A;  4R4T A;  5C4H A;  2YU9 B;  4DV7 Q;  3K5N A;  1EWH A;  1FNV A;  3S17 H;  4G57 A;  3FDT A;  4U67 3;  2EJM A;  2R7D A;  3S24 A;  3HKZ B;  4BA1 I;  2BA0 A;  2WB1 G;  1C0A A;  3A74 A;  3J80 c;  2ZXP A;  4B9W A;  2DY7 A;  3S15 H;  1OXT A;  3ULP A;  1CTM A;  2OQ0 A;  5EBC A;  4DV7 L;  1E24 A;  4EGV A;  3IKJ A;  2JA5 G;  1UE5 A;  3H6M A;  4JBK A;  2QF7 A;  1N34 Q;  4DR2 Q;  2SNS A;  4JYA Q;  3GD7 A;  4OEL B;  2NVT H;  3RMH A;  3E0J A;  2SEB D;  2TMP A;  1MBY A;  3UDG A;  2HUG A;  5ELC A;  1CM9 A;  2IT1 A;  2NUC A;  4DR3 Q;  1X55 A;  4RG1 A;  5CC4 A;  3PIO 3;  1O7Z A;  4RHS A;  4NXN Q;  1N34 L;  2JA8 H;  4FF1 A;  2L5T A;  4DR2 L;  3KK7 A;  4PZ6 A;  4JYA L;  4K14 A;  1O7Y A;  4RCO A;  1EY9 A;  2JXM B;  4K0K Q;  1G29 1;  3DWA A;  2Z9H A;  5JVG 3;  3X3N A;  5M3M H;  1A3T A;  4DR3 L;  1JE5 A;  3E9I A;  5GAE C;  4IUR A;  3PF4 A;  2C5C A;  4KKU A;  3OWE B;  4NXN L;  1PRT F;  3TME A;  5CBA E;  1BUV T;  5C5M A;  5C4J B;  4GKJ Q;  1MKH A;  2K5H A;  4IUP A;  2JE6 I;  1Q1B A;  3A8J E;  4DN4 M;  4M8A A;  1EFW A;  1T5X D;  4ALP A;  4A3K B;  5FO9 B;  4K0K L;  3M9B A;  1YHQ A;  5CR3 A;  5EKI A;  4A93 B;  1WD1 A;  4RCN A;  1VQH A;  4GKJ L;  3SXH A;  4HIK A;  3UDI A;  1X9N A;  3CRK C;  1LTT D;  2R93 H;  4OGQ C;  2ZTC A;  1X56 A;  2GVB A;  2K33 A;  1EY4 A;  2RKS A;  1PLF A;  1P16 A;  1PFM A;  1F9P A;  2F0Q A;  3BVZ A;  2L0C A;  1IW7 D;  5DAU A;  1S5B D;  4L8J A;  5ELF A;  1HH2 P;  4XT1 B;  1EL0 A;  4GNX C;  1ESF A;  3Q24 A;  1HJP A;  1SYG A;  4ZRZ A;  2PZT A;  1D5X C;  4O0A A;  4QUF A;  1YNN C;  3EVQ A;  3M7G A;  1VQA A;  4BBR B;  1UE1 A;  1Q90 A;  1I3Q H;  3O13 A;  5JVH 3;  1C7Y A;  4RWS C;  3TS0 A;  1H9S A;  2ATW A;  5D3I B;  1I5F A;  1KAB A;  1HNX Q;  4N8F A;  5CYU A;  3E6Z X;  1D1K A;  2JP1 A;  3IL8 A;  1SRO A;  3EQL C;  5IYD H;  5BN5 A;  1CKN B;  2A6E D;  2XWJ B;  2J7Z A;  4F8M A;  3PIP A;  3D31 A;  1TWA H;  2F3I A;  1KTK A;  4H02 A;  1VQP A;  1RIP A;  3R2I A;  3SE0 A;  4A3F G;  4HMJ A;  1ILP A;  1QOH A;  2XNA C;  3LGJ A;  1OXU A;  3OOC A;  3TDQ A;  1HNX L;  1TXY A;  2FFK B;  1ENC A;  3S1R H;  4JI4 Q;  2AKW B;  3CCJ A;  4BA2 I;  2D5D A;  2WKC A;  1G8Z D;  5IYC G;  3JAM L;  4FVM A;  3H3V C;  3GTG H;  3I4L A;  2M9V A;  3I90 A;  1UEA B;  4BY7 B;  2YV5 A;  2AQ2 B;  3S1R B;  2F0J A;  4CDF C;  1XTD A;  2ASB A;  4IFD H;  2F0O A;  5E7N A;  1QUQ A;  4YCW A;  3CW2 C;  1LYL A;  4OO1 H;  4MTN A;  4K2L A;  1CI3 M;  4JI4 L;  3BZC A;  1EU3 A;  5E4W C;  3I70 A;  1NSN S;  5CGK A;  2CH4 W;  1X3E A;  3PUX A;  1F2Z A;  1Z6H A;  3NQI A;  2IL8 A;  1VF5 C;  2MNA A;  3F2B A;  3CCR A;  1YVC A;  4U68 A;  4LF9 Q;  1BDO A;  2VUM H;  3NEN A;  4MIU A;  3BDC A;  3VYR A;  4HIO A;  1CA5 A;  3S16 B;  1B3A A;  3MAQ A;  2AWN A;  2EJF C;  3S14 B;  3D8G A;  2NYZ D;  1PDQ A;  1HNZ Q;  4LW1 A;  1IZ6 A;  1HZA A;  2D0O A;  2CHB D;  1J5E Q;  4A3C H;  5I9P A;  1R9T H;  4P2C B;  2V4D A;  1AP0 A;  2XIW A;  4C3H B;  1SLJ A;  4S3S A;  4DKA C;  4OWX B;  4K6D A;  4LF9 L;  5JEA G;  4L6T B;  2EZV A;  3PO3 H;  1C9O A;  2CW0 D;  3T53 B;  2H4O A;  2DJG C;  2WAC A;  1SE8 A;  4IFD I;  3HFZ B;  2EYH A;  2MUY A;  4XT3 B;  1HNZ L;  4OO1 I;  1JWS D;  2XN9 C;  4ZUJ A;  1S5D D;  2RSO A;  2I46 A;  1J5E L;  3G71 A;  5KND A;  4KJO A;  3NWT A;  4KK7 A;  1EIF A;  1CA6 A;  3OMG A;  3NWS A;  2WKD A;  3NEM A;  4JVZ A;  3CXC A;  4BY1 B;  1ZKO A;  2DNC A;  1Y8O B;  4A75 A;  1MD2 D;  3RN5 A;  4ZAI A;  3FKI H;  1VDZ A;  4A3G G;  1NR2 A;  1A62 A;  3I72 A;  1RL2 A;  1E2Z A;  3GTQ B;  4BBS B;  2D9U A;  1I4Q A;  5C6A A;  5K5P A;  2EY6 A;  3HS0 C;  2A8V A;  5KIX A;  1U4P A;  2CH4 A;  3KBG A;  4DF7 A;  1U0L A;  3BVG A;  5EJW A;  3CCV A;  1RTO A;  5LL6 S;  1EEF D;  4DAP A;  5G3L D;  5C3E H;  2QEJ C;  3K7A H;  2IWH A;  5DM7 3;  2HCI A;  1YJW A;  2B2V A;  5KNC A;  1U9R A;  1M90 C;  1VQL A;  2FMM A;  1RF2 D;  2K52 A;  4TQU S;  2UXB Q;  1AEX A;  2QDB A;  4E6I A;  1GXD C;  1X3P A;  3HOV H;  2F3W A;  3D6W A;  2DGY A;  5IYB H;  3CMA A;  2HIV A;  3MA2 B;  2TSS A;  1GHJ A;  1ASY A;  3KJO A;  2BDO A;  3LX0 A;  5LMU Q;  2Z0S A;  1YIJ A;  3HOV B;  3PIP 3;  4NW2 A;  4B08 A;  2O5I C;  3M4O H;  1ET6 A;  1HQM C;  1HZB A;  3G6J B;  1PH6 A;  1U4R A;  1PYB A;  1VMP A;  2RA4 A;  2JYO A;  2UXB L;  1VQJ A;  5LHY 1;  1BCP B;  2B2W A;  2PMZ B;  5M3F G;  5C0X J;  5GRO A;  5J22 A;  3U58 A;  2XSC A;  1D7Q A;  4EX5 A;  4KD3 A;  5LMU L;  1SE2 A;  2L9H A;  2KHS A;  1M1K C;  1AE2 A;  1STY A;  2SDF A;  2HD3 A;  5C4X G;  4IQZ A;  1B50 A;  3L3O C;  4X3K A;  1O7I A;  2RF4 A;  3A0J A;  3NBI A;  1YI2 A;  3L2P A;  2JA6 B;  3D4R A;  3WDN A;  1WD0 A;  1GM5 A;  3HOZ B;  1JE4 A;  1YNJ D;  3KUP A;  4JI8 Q;  1Q82 C;  4FO2 A;  1NJI C;  2VZA A;  1PH9 A;  4GKK Q;  4FXK C;  3K0Y A;  5D3D A;  2SOB A;  3HOU H;  3GTL B;  4KLK A;  2K50 A;  2CWP A;  2IW3 A;  2F1M A;  4WOR A;  1QB5 D;  3BDL A;  3I8Z A;  4FDB A;  4Q5V A;  4HJ7 A;  1K8O A;  2ZTD A;  1WCM G;  4B3S Q;  2F0G A;  3NTH A;  2D2C C;  4JI8 L;  3KF8 A;  4JI5 Q;  3P1H A;  2F0U A;  4GKK L;  4YWM A;  4UAI A;  5JPN C;  5IOD A;  1Y1V B;  5IP7 H;  2HCC A;  2R3Z A;  5HGQ A;  1HFG A;  3DLL A;  3STB D;  1N32 Q;  4B3S L;  2JA7 H;  1IYJ B;  1PYW D;  3VR5 A;  1HXY D;  4JI5 L;  1LTR D;  4XQQ A;  4HR7 B;  1ZXT A;  2N88 A;  1K0S A;  4A3M H;  4IUN A;  4FXG C;  1Q8K A;  2R7Z G;  3K5L A;  2XWB B;  4L5T A;  1XMQ Q;  2E2H H;  2F0N A;  2EIF A;  1AZP A;  4C3I G;  1N32 L;  3OSO A;  2F0P A;  2NWG A;  2B2U C;  3J7Z C;  4DAY A;  1DOL A;  3C1E A;  1VQE A;  3PGZ A;  3PO2 H;  3HOX B;  2BCO A;  2N49 A;  4DAM A;  4NP5 A;  3TP8 A;  5KRU A;  1EY8 A;  4QQB X;  1RD9 D;  1XMQ L;  3PO2 B;  3VDY A;  5C5L A;  3MHB A;  1F2L A;  3V2T A;  3I4N G;  2E2J H;  2A73 B;  5L37 A;  3SK8 A;  3HOW G;  1KC8 C;  3T16 A;  4RGO S;  5IOC A;  1STN A;  2OTJ A;  1KDA A;  4L63 B;  3V05 A;  1IW7 C;  1DYQ A;  1B3Q A;  2J4X A;  1XNR L;  3RZO B;  1UE7 A;  3KLS A;  4LAA A;  4GOP C;  3IRB A;  1VQ9 A;  3SK6 A;  1EZ8 A;  3S1M B;  2MP1 A;  4JI3 Q;  1FNW A;  1CT1 D;  2F4I A;  2F0L A;  1GUN A;  1KIX A;  1EIH A;  3EIV A;  3A55 A;  1PTO D;  1WTW A;  4DK6 C;  3W3A A;  4A3D H;  3K57 A;  1TKW B;  1EYA A;  1IYU A;  2WAQ B;  1PH7 A;  2AWO A;  1HR0 Q;  2A6E C;  1XX8 A;  1II3 A;  3G48 A;  4A3I B;  1LTG D;  4JI3 L;  5C0X H;  1U4L A;  3MXU A;  4P71 A;  3CCM A;  2ICE C;  2JSO A;  3EJI A;  4F7X A;  5FLM H;  3CC4 A;  4DA2 A;  3MWY W;  2HIX A;  2H5X A;  2L1B A;  1TY2 A;  1TWF H;  1SYC A;  4GS3 A;  4B3M Q;  1HR0 L;  5J3B A;  4FYD A;  4GN5 A;  2RCF A;  4I7Z C;  2RDG A;  1Y1W H;  5C44 G;  1H9K A;  3NBH A;  4B3R Q;  1U5K A;  1A3U A;  2I0Q A;  5LMN W;  3A54 A;  1QZH A;  2LY7 A;  2JA8 G;  3EA6 A;  3EBE A;  2OEO A;  4DR4 Q;  1SFO H;  4B3M L;  3BDO A;  1V8Q A;  4JBW A;  3M4P A;  3KLW A;  2B2Y C;  3JAM i;  1PZJ D;  3KBX A;  4JOI C;  5CV4 A;  1ASZ A;  2ZXO A;  1WTQ A;  4WRD A;  4GNX B;  3HOY H;  4A3E B;  2PCF B;  4B3R L;  1VQG A;  5M3M G;  5C0X I;  1KRT A;  1M4V A;  3QR8 A;  4J1M A;  4RGM A;  2PQA B;  1BOS A;  3A5Z B;  5T1G A;  1HFN A;  3I4M H;  3H91 A;  3GV3 A;  3Q23 A;  3HOY B;  4DR4 L;  4RGT A;  3TP7 A;  1S72 A;  1A15 A;  3TBI B;  1LV9 A;  4GNX A;  2EOT A;  4QGU A;  2HDM A;  3NEL A;  1MHW C;  1X6O A;  3E5S A;  1KNA A;  1G2S A;  2K5W A;  1JMC A;  1Q81 C;  1PTO H;  1AN8 A;  2M00 A;  4AYB G;  4CBV A;  3L0O A;  2CW0 C;  5FJ8 H;  3DM1 A;  3K0X A;  1ESR A;  1A2T A;  2N78 A;  2QEX A;  4DPG A;  1SRU A;  5D65 A;  1X3F A;  5KYL A;  2DN8 A;  1BVS A;  3CP0 A;  5LMN Q;  3SR1 A;  5BN3 A;  1O78 A;  3KJP A;  2R93 G;  3CQZ B;  3J81 E;  4KMU C;  4P74 A;  4C3J H;  4DV2 Q;  2VXW A;  2JJQ A;  1P8L A;  4A4I A;  3SDZ A;  2RHQ B;  2Y0S B;  1AFP A;  3KF6 B;  4A3J H;  3V96 A;  1SNM A;  3DEP A;  3DUZ A;  4NPS A;  4TSS A;  4PMC A;  3HP3 A;  5LMN L;  4XTC S;  4GN4 B;  2XRS D;  5IY0 A;  1EYC A;  4DV2 L;  1SND A;  3ULL A;  1KXL A;  3RLF A;  1PH4 A;  2FMC A;  1LO5 D;  1V1O A;  2YU9 H;  1IYV A;  4UPA A;  2UUC Q;  2HHH Q;  1F2M A;  1BBX C;  3D3R A;  4OXP A;  1LT4 D;  1WTP A;  5IYD G;  3HZX A;  2Q2I A;  1KQS A;  4R4Q A;  3NTI A;  3UE1 A;  5IGE A;  2OXP A;  1HHV A;  4ME5 A;  4IUV A;  4YHH Q;  1SJH D;  3Q6S A;  4K8J A;  2UUC L;  4IJL A;  4LFC Q;  2HHH L;  1BQQ T;  1CZW A;  2PMZ E;  4Y7N B;  3CCS A;  4PG3 A;  4DXF A;  2FHT A;  5EPJ A;  5M5W B;  4YHH L;  4IFD G;  3ERQ A;  3OYY A;  3UDF A;  2QDL A;  4I7A A;  4LFC L;  4K8I A;  4OO1 G;  1JIC A;  4G7O C;  2YTV A;  1KD1 C;  1KAA A;  4HN7 A;  3SHL A;  4LUV A;  1NY4 A;  3GTP H;  1UNS A;  1JOO A;  1FD7 D;  2KA7 A;  4P72 A;  4F88 A;  2R92 B;  3N52 A;  2VUM G;  1LTS D;  2N3S A;  5K36 H;  3GTP B;  4LJZ C;  4CKB A;  3F2C A;  2AHO B;  4KN7 C;  4HJ9 A;  1YNJ C;  3A5U A;  2HT1 A;  5C4J H;  1A6X A;  3FMC A;  5KNB A;  4HED A;  2QIL A;  4EQ5 A;  4CJ0 B;  3VYT A;  1EIG A;  2K7V A;  4A3K H;  2F03 A;  4JV5 Q;  4LFB Q;  3PF5 A;  3AB9 A;  3K81 C;  3PO3 G;  4DR6 Q;  3FP9 A;  1S3O A;  2K05 A;  5HUR A;  3R93 A;  5DLQ E;  1KHI A;  3F2U A;  4A93 H;  3PMF A;  1NMF A;  4HCE A;  4WJW A;  4LF4 Q;  5M5X B;  4WJ3 M;  3J80 L;  1T5E A;  4ABN A;  3D4D A;  1G51 A;  3SVM A;  4JV5 L;  3BVM A;  4LFB L;  1KNE A;  4PMW A;  1WTO A;  2B29 A;  1QZG A;  4DR6 L;  3STB C;  5JOB A;  4X3T A;  4A3B G;  1HCZ A;  2IPK D;  2X6G A;  2C9O A;  3FKI G;  1N9W A;  3QJY A;  3OTO Q;  4DU9 A;  1SJE D;  1WVL A;  1IKM A;  4LF4 L;  2IHF A;  3RLN A;  3IAY A;  1TWC B;  3M3Y B;  1JJG A;  4HJ8 A;  1HRJ A;  1K28 A;  1WTR A;  1Q86 C;  3FVQ A;  4PV1 C;  1H9S B;  4BBR H;  3MFY A;  2GA4 B;  2L4N A;  2Q8R E;  3A8K E;  3NK9 A;  4O42 A;  1IL2 A;  4JC0 A;  1ONL A;  4XQN A;  2CWA A;  1B44 D;  2JA9 A;  3OTO L;  4QY7 A;  2F0D A;  1PRT B;  1Z47 A;  5C3E G;  4PQX A;  1CHP D;  5EKL A;  1MJC A;  1HQR D;  2RVL A;  1V1P A;  1A63 A;  4RGN A;  2L55 A;  1JJ2 A;  4UHV A;  1Q3L A; 
#chains in the Genus database with same CATH homology
 1C48 A;  5CBE E;  1W6J A;  1HTP A;  3GV6 A;  1PFB A;  3T13 A;  1QNK A;  1DM0 B;  1SNP A;  3QB3 A;  3DHQ A;  2NZ1 D;  1DZ1 A;  4DAV A;  3OMC A;  2IX1 A;  1I4H A;  1PTO C;  5ELD A;  3G7L A;  2A6H D;  4I65 A;  1NR4 A;  1SNO A;  5ELE A;  4UDU C;  4NDX A;  1ENF A;  3R2T A;  2WB1 B;  1I4P A;  3SK4 A;  3K58 A;  3BYT B;  1OXS C;  3C3L A;  2JA5 B;  2EXZ A;  3MEH A;  2NVY B;  2WII B;  3PUV A;  2ICI A;  5EQ0 A;  1RJT A;  1BCP D;  2B2U A;  2A68 D;  4DK1 A;  4ZUI A;  1MSG A;  5I6W A;  2X69 A;  4OIK A;  1K83 B;  5I2Y A;  1EQT A;  4HSP A;  5CV7 A;  2KEE A;  4LK1 C;  3NHH A;  4KY7 A;  5JEA J;  1EU4 A;  5AFW A;  3IFD A;  3LNN A;  2F0T A;  2NB0 A;  1Y8P B;  3T4A C;  3K59 A;  2KED A;  4KY6 A;  4RH6 A;  4ZLT F;  1XWE A;  2RBM A;  2LS0 1;  4HCS A;  3URY A;  5CV5 A;  3GTM B;  2FJ2 A;  2WIN B;  4J8Q A;  2WV6 D;  2PZW A;  4V0B A;  3C46 A;  3TSS A;  3J7A F;  2A74 C;  5IGD A;  3L9A X;  4CKE A;  1QE6 A;  4H44 C;  1EZ6 A;  1GOZ A;  3MXN A;  3GTK B;  4IUU A;  2F0M A;  2BDN A;  1KLU D;  3VR6 A;  3DWQ A;  1PMR A;  3ND9 A;  3J81 L;  3ND8 A;  4RKB A;  1DOK A;  3S2D B;  4N9T A;  3QOJ A;  1IKL A;  3VYU A;  1L0Y B;  4DNR B;  2KEC A;  2EYM A;  1OO9 B;  3HG9 A;  2NVX B;  3ERO A;  1M8A A;  2KCC A;  2B2Y A;  4ZKC B;  3MXG A;  4QMG A;  1SMY D;  4KJN A;  4A3F B;  5JPM C;  2E76 C;  2F0W A;  3QWN A;  1OXV A;  5G3L F;  1TWG B;  4KTA A;  1LT6 D;  4OL7 A;  2EYO A;  4R8N A;  1SNC A;  4NMZ A;  5C3W A;  1CZG A;  4FNF A;  4GZY C;  4RAU C;  4C56 C;  2F0E A;  3MC0 B;  1SAP A;  1QIL A;  4LMQ D;  3S1Q B;  3DWP A;  2B8G A;  2AQ1 B;  2F0F A;  2I07 B;  3J7Y W;  2B2T C;  2CVR A;  3NQT A;  4F87 A;  3CRL C;  2NVQ B;  5A2Q E;  4MN3 A;  1I4X A;  2Z4H A;  3A56 A;  5FO8 B;  4XDX A;  2PPB C;  2LFN A;  4RA8 A;  1CK1 A;  1BF4 A;  5NUC A;  2Z4I A;  4DGZ A;  5EPL A;  4C3J G;  2EYP A;  4TKO B;  2BE5 D;  1TT2 A;  1XYI A;  3FPP A;  1MI2 A;  4EVO A;  2PYK A;  1UUP A;  3VA5 A;  4WFN 3;  4A3G B;  4C1N K;  4Z9C B;  1MSH A;  3VR3 A;  3GP7 A;  1D2B A;  2A69 D;  1AW7 A;  4KD4 A;  5DNF A;  5EBD A;  2WP8 J;  4NKL A;  1EQV A;  1CQV A;  1SYE A;  1D5Z C;  1L0X B;  1DON A;  4K5X A;  4QF4 A;  4KHZ A;  1G91 A;  3JAM E;  3R8B A;  5I2X A;  1Q1E A;  5C3X A;  3OHX C;  4KI0 A;  1IHZ A;  2PNR C;  3P75 A;  4ZK9 B;  1J8I A;  3X3M A;  4HTH A;  1JCK B;  3VR2 A;  4HMI A;  3PV0 A;  5KEE A;  1I6H B;  4C1N I;  2QCP X;  3GTJ B;  1ICW A;  2HDL A;  3OIQ A;  2PZU A;  1LTI D;  5CV9 A;  2F0K A;  5M3F B;  1TR5 A;  3L7Z C;  1B53 A;  3VR4 A;  2EVB A;  1D5M C;  2A6H C;  3TP6 A;  2E2I B;  4ODG A;  3EFX D;  1JWU D;  2PW5 A;  5C4X B;  2E75 C;  1GUO A;  3A7L A;  5F2D A;  1PTO F;  3T51 B;  1TQO A;  1GHK A;  5EPK A;  1JOK A;  1I4R A;  3PUY A;  2IJ0 A;  1S5C D;  3KLS X;  1F9S A;  2KCN A;  1TY0 A;  2BOS A;  2LKV A;  4KV6 A;  1WCM B;  1KDC A;  3TZU A;  1BCP C;  2A68 C;  3MVV A;  3R3O A;  5DEH A;  3D4W A;  5BN4 A;  1HA5 A;  1DCZ A;  1KDB A;  5CV6 A;  2LMC B;  5EKK A;  3AU7 A;  3CKI B;  1GUT A;  3FRP B;  4ID6 A;  3GTO B;  4M1U B;  1LTB D;  3I3C A;  1AZQ A;  2IX3 A;  3HEJ A;  4OIJ A;  4G4K A;  5ELB A;  2R7Z B;  1XXG A;  4OHJ A;  2OT2 A;  3D6C A;  4R8I A;  2K28 A;  1I6V C;  2KQ3 A;  2J0T D;  4C3I B;  1STE A;  1ZYR D;  2FIN B;  2ID0 A;  3NUC A;  4IUT A;  3GO5 A;  5IT9 E;  1EY6 A;  2XRQ D;  5FO7 B;  5D14 A;  3IFT A;  4KY5 A;  4CGY B;  2SNM A;  4QUC A;  2EY1 A;  3I4N B;  1B9N A;  5E3F A;  3HOW B;  1STA A;  2MHV A;  2RSN A;  2NN6 H;  2ZXR A;  1B4O A;  1E2V A;  2EE1 A;  4CJ1 B;  3Q22 A;  1B2T A;  3MXP A;  4DK0 A;  3H94 A;  1PRT D;  3S17 B;  1CQF A;  1RTN A;  1W6K A;  1F77 A;  2EDG A;  3AMU A;  1FGB D;  4H7B A;  4ZQ3 A;  1SYF A;  4RHR A;  2RQX A;  5FKA C;  4IFD J;  3S15 B;  4ZYS A;  1SMY C;  3NE5 B;  5E1F A;  3SEB A;  1TU2 B;  4C3H G;  2NN6 I;  2Z1C A;  4G7Z C;  2HQE A;  2NVT B;  1EFI D;  4O1N A;  5C44 B;  5HGT A;  4N9P A;  1ROD A;  2JA8 B;  1RKN A;  3UI2 A;  5IGG A;  1R4P B;  4IZ8 A;  3NTK A;  1RDP D;  3MFG A;  5I6Y A;  4XIG S;  4FF4 A;  5M3M B;  4CHT B;  2OF1 A;  3W2D A;  2YYZ A;  2ENB A;  1NUC A;  2D62 A;  1S5E D;  1WTV A;  3OWF A;  3A7A B;  1V1P B;  1LAB A;  3MZ5 A;  5A2Q L;  3SK5 A;  1GUS A;  4AYB B;  4IN3 A;  3DMU A;  4KKS A;  2Q8I B;  3WOF A;  5JJZ A;  2F0S A;  1G2T A;  1A3V A;  1B9M A;  2R93 B;  1E2W A;  2E2D C;  2BE5 C;  3FPU B;  3NPP A;  1J9O A;  3KLR A;  1EY5 A;  1DJR D;  2K01 A;  4PMB A;  1V43 A;  4ILW A;  2O2L D;  2L12 A;  2A69 C;  1SE4 A;  1ILQ A;  2RDH A;  2B8F A;  1I3Q B;  5FLX E;  1HUM A;  1WTX A;  4KHV A;  1JC7 A;  5IIF A;  2AQ3 B;  5KGU A;  1JOR A;  1STH A;  2PW7 A;  1TWA B;  2AUJ D;  1ET9 A;  3OPO A;  1HUN A;  2MGS A;  1ENA A;  4H0L C;  2IX0 A;  2F0I A;  2Q8T A;  3PUW A;  2B2T A;  3LWE A;  2KJX A;  2KOL A;  3A8I E;  1I4G A;  3GTG B;  1NCV A;  1QJO A;  5JAV A;  1GJX A;  2KUM A;  2EY5 A;  3S9W A;  4H13 C;  2O5J C;  2PO4 A;  4FF2 A;  4CJ2 C;  1U4M A;  3TN2 A;  3K6O A;  4DXG A;  5I4D A;  1SEB D;  2K5Q A;  4V19 0;  1KLG D;  4K5V A;  2H1E A;  2VUM B;  1VF7 A;  1QG7 A;  3RD4 A;  1EY7 A;  2EJG C;  1JOQ A;  1Q8I A;  5COY A;  1R4Q B;  1O7L A;  1R9T B;  3OW7 A;  3PO3 B;  1QWY A;  1TS5 A;  3ITP A;  1SXT A;  4C2M B;  4FF3 A;  4XXE A;  5FK9 C;  3Q0A A;  3QO2 A;  3HGB A;  2ZT9 C;  1QNU A;  5I9O A;  1TWH B;  1JB3 A;  3I73 A;  1I50 B;  3J7A V;  4X3S A;  1BCP F;  1HPC A;  2K03 A;  2G9H D;  3TZD A;  4A3B B;  4QCL A;  3FKI B;  4G7H C;  1EEI D;  2BA1 A;  2PQE A;  3QOL A;  3RZD B;  3NP8 A;  1Y69 U;  1ZYR C;  4EQN A;  3M7N A;  4RKL A;  3U9O A;  1C8C A;  4RFB A;  5C3E B;  2JEB I;  1OXX K;  3GQB A;  3K7A B;  4XQJ A;  5CMD A;  3S1N B;  5IT9 L;  2G9D A;  5C0X G;  3T56 B;  5J1Z A;  2XVS A;  1X32 A;  3ONA B;  4B9X A;  3ZYY X;  1DD2 A;  2R61 A;  2EY2 A;  1SYB A;  1TII D;  1EY0 A;  1C4Q A;  3M4O B;  1EOT A;  2F0H A;  2B63 B;  2JEA I;  1VCI A;  1LTA D;  3M85 A;  2F0V A;  1HTL D;  4XYO A;  2EPB A;  5CV8 A;  4ULL A;  1K8M A;  1PRT C;  4K6L A;  4DNT B;  1E0B A;  1XTC D;  2MJ8 A;  5E4X A;  2NTT A;  4TRD A;  2K32 A;  3RUZ A;  1DXM A;  1STG A;  3MTS A;  3K5M A;  3J80 E;  5FOB B;  3HOU B;  3S2H B;  1Z7T A;  2Z8L A;  3BYY B;  3NSW A;  1SYD A;  1LLR D;  3TP5 A;  5JEA H;  1SE3 A;  2DNE A;  4HSV A;  5IGF A;  1EYD A;  1A2U A;  4IUQ A;  4KKT A;  2NBF A;  3VA7 A;  1O80 A;  5T1I A;  2K5D A;  3HRZ C;  2JA7 B;  1BNZ A;  1G6Z A;  2KVM A;  2E74 C;  1TS4 A;  4A3M B;  1TS2 A;  5TSS A;  3DEO A;  1QCB D;  1D6E C;  1YNN D;  2E2H B;  1NAP A;  2AUK A;  3DXJ C;  3N6R A;  3CHB D;  2K04 A;  1TS3 A;  3QIA A;  1VMC A;  4R9W A;  1Q12 A;  1FNU A;  1STB A;  1SBB B;  3WOE A;  2O4X A;  4QB4 A;  1H9M A;  4X3U A;  1ZEQ X;  4JK1 C;  2EYJ A;  5M9O A;  1HA6 A;  2E2J B;  2VB3 X;  1IL8 A;  1PXU A;  1B1Z A;  2NN6 G;  4J6H A;  1PZI D;  5COR A;  1JQY D;  3H09 A;  5KYI A;  1JR0 D;  2QKI C;  4EQO A;  1SNQ A;  5DM6 3;  4MHE A;  5IGC A;  1H9R A;  2DY8 A;  3I91 A;  1D1I A;  2B2V C;  4A3D B;  1BO0 A;  5A35 A;  3BZD B;  1F9Q A;  5ISR A;  5FLX L;  1DOM A;  3C1F A;  4YIJ A;  5K36 G;  3CU7 A;  1SDF A;  1LT5 D;  1FR3 A;  1X3Q A;  3P7J A;  5C4Z A;  1JWM D;  4BWG B;  1CFM A;  1TWF B;  3OIP A;  1UAP A;  4QIW B;  3QG1 A;  3P20 A;  2M2L A;  2B2W C;  4CKC A;  3K5O A;  1LT3 D;  1Y1W B;  1F9R A;  3H0G B;  4XYQ A;  2A5H A;  4BS9 A;  1LAC A;  1BXT A;  1SFO B;  5J39 A;  3LWU A;  3M4Y A;  1BR9 A;  4FXD A;  1EWC A;  1RCV D;  3NXW A;  5EGT A;  4K5W A;  2F3V A;  4FP5 D;  5IGB A;  2CQA A;  1GUW A;  1Y8N B;  1GUG A;  3BS1 A;  1FYC A;  4Q0F A;  3BG3 A;  3I4M B;  4KN4 C;  1S4Z A;  4K2K A;  1SSO A;  1CHQ D;  4EQP A;  2K6A A;  4PNY A;  1PFN A;  1PTO B;  3C2P A;  1RHP A;  2X6L A;  4IAL A;  2VNU D;  3FEW X;  3PUZ A;  1H9J A;  2EYF A;  2R6G A;  5LL6 X;  2L11 A;  4C3J B;  2B39 A;  2EYL A;  4ZKB B;  4HAE A;  1TVX A;  5M5Y B;  4A3J B;  1MGS A;  2VB2 X;  1F2Y A;  3U9S A;  2RDF A;  1PZK D;  2K1B A;  2NTS A;  2MPM A;  4DFA A;  1S5F D;  3VYS A;  1ML0 D;  2N55 A;  5C4H A;  2YU9 B;  3K5N A;  1EWH A;  1FNV A;  4G57 A;  3FDT A;  4U67 3;  2EJM A;  3HKZ B;  4BA1 I;  2BA0 A;  2ZXP A;  4B9W A;  2DY7 A;  1OXT A;  1CTM A;  5EBC A;  4EGV A;  3IKJ A;  3H6M A;  2QF7 A;  2SNS A;  3GD7 A;  3RMH A;  3E0J A;  2SEB D;  2TMP A;  1MBY A;  2HUG A;  5ELC A;  1CM9 A;  2IT1 A;  2NUC A;  5CC4 A;  3PIO 3;  1O7Z A;  4RHS A;  4FF1 A;  2L5T A;  3KK7 A;  4K14 A;  1O7Y A;  4RCO A;  1EY9 A;  2JXM B;  1G29 1;  3DWA A;  5JVG 3;  3X3N A;  1A3T A;  4IUR A;  2C5C A;  4KKU A;  3OWE B;  1PRT F;  3TME A;  5CBA E;  1BUV T;  5C5M A;  5C4J B;  4IUP A;  2JE6 I;  1Q1B A;  3A8J E;  4DN4 M;  4M8A A;  1T5X D;  4A3K B;  5FO9 B;  5CR3 A;  5EKI A;  4A93 B;  1WD1 A;  4RCN A;  3SXH A;  3CRK C;  1LTT D;  4OGQ C;  2K33 A;  1EY4 A;  2RKS A;  1PLF A;  1PFM A;  1F9P A;  2F0Q A;  3BVZ A;  2L0C A;  1IW7 D;  5DAU A;  1S5B D;  4L8J A;  5ELF A;  4XT1 B;  1EL0 A;  1ESF A;  3Q24 A;  1SYG A;  4ZRZ A;  2PZT A;  1D5X C;  4QUF A;  1YNN C;  3EVQ A;  3M7G A;  4BBR B;  1Q90 A;  3O13 A;  5JVH 3;  4RWS C;  1H9S A;  5D3I B;  1KAB A;  5CYU A;  3E6Z X;  1D1K A;  2JP1 A;  3IL8 A;  3EQL C;  5BN5 A;  2A6E D;  2XWJ B;  2J7Z A;  4F8M A;  3D31 A;  1KTK A;  3R2I A;  3SE0 A;  4HMJ A;  1ILP A;  1QOH A;  2XNA C;  1OXU A;  3OOC A;  3TDQ A;  2FFK B;  1ENC A;  4BA2 I;  2D5D A;  2WKC A;  1G8Z D;  3JAM L;  4FVM A;  3H3V C;  3I4L A;  2M9V A;  3I90 A;  1UEA B;  4BY7 B;  2AQ2 B;  3S1R B;  2F0J A;  4IFD H;  2F0O A;  4OO1 H;  4K2L A;  1CI3 M;  1EU3 A;  5E4W C;  3I70 A;  1NSN S;  5CGK A;  3PUX A;  1F2Z A;  1Z6H A;  3NQI A;  2IL8 A;  1VF5 C;  4U68 A;  1BDO A;  3S16 B;  4MIU A;  3BDC A;  3VYR A;  1CA5 A;  1B3A A;  3MAQ A;  2AWN A;  2EJF C;  3S14 B;  3D8G A;  2NYZ D;  1PDQ A;  2CHB D;  5I9P A;  4P2C B;  2V4D A;  1AP0 A;  2XIW A;  4C3H B;  4S3S A;  4K6D A;  5JEA G;  4L6T B;  2EZV A;  2CW0 D;  3T53 B;  2H4O A;  2WAC A;  4IFD I;  2EYH A;  2MUY A;  4XT3 B;  4OO1 I;  1JWS D;  2XN9 C;  4ZUJ A;  1S5D D;  2RSO A;  2I46 A;  5KND A;  4KJO A;  3NWT A;  4KK7 A;  1CA6 A;  3OMG A;  3NWS A;  2WKD A;  4BY1 B;  1ZKO A;  2DNC A;  1Y8O B;  1MD2 D;  4ZAI A;  1VDZ A;  1NR2 A;  3I72 A;  1E2Z A;  3GTQ B;  4BBS B;  2D9U A;  1I4Q A;  5C6A A;  5K5P A;  2EY6 A;  3HS0 C;  5KIX A;  1U4P A;  3KBG A;  4DF7 A;  3BVG A;  5EJW A;  1RTO A;  5LL6 S;  1EEF D;  4DAP A;  5G3L D;  2QEJ C;  5DM7 3;  2IWH A;  2HCI A;  2B2V A;  5KNC A;  1U9R A;  2FMM A;  1RF2 D;  4TQU S;  1AEX A;  2QDB A;  4E6I A;  1GXD C;  1X3P A;  2F3W A;  3D6W A;  3MA2 B;  2TSS A;  1GHJ A;  2BDO A;  3LX0 A;  3HOV B;  3PIP 3;  4NW2 A;  4B08 A;  2O5I C;  1ET6 A;  1HQM C;  3G6J B;  1U4R A;  1VMP A;  2RA4 A;  2JYO A;  5LHY 1;  1BCP B;  2B2W A;  2PMZ B;  5C0X J;  5J22 A;  2XSC A;  4KD3 A;  1SE2 A;  2L9H A;  2KHS A;  1STY A;  2SDF A;  4IQZ A;  1B50 A;  3L3O C;  4X3K A;  3NBI A;  2JA6 B;  3D4R A;  3WDN A;  1WD0 A;  3HOZ B;  1JE4 A;  1YNJ D;  3KUP A;  4FO2 A;  4FXK C;  3K0Y A;  5D3D A;  2SOB A;  3GTL B;  2IW3 A;  2F1M A;  4WOR A;  1QB5 D;  3BDL A;  3I8Z A;  4Q5V A;  1K8O A;  2F0G A;  3NTH A;  2D2C C;  3KF8 A;  3P1H A;  2F0U A;  4UAI A;  5JPN C;  5IOD A;  1Y1V B;  2HCC A;  2R3Z A;  1HFG A;  1PYW D;  3VR5 A;  1HXY D;  1LTR D;  4XQQ A;  4HR7 B;  1ZXT A;  2N88 A;  4IUN A;  4FXG C;  3K5L A;  2XWB B;  2F0N A;  1AZP A;  4C3I G;  3OSO A;  2F0P A;  2NWG A;  2B2U C;  4DAY A;  1DOL A;  3C1E A;  3HOX B;  2BCO A;  4NP5 A;  3TP8 A;  5KRU A;  1EY8 A;  1RD9 D;  3PO2 B;  5C5L A;  3MHB A;  1F2L A;  3V2T A;  2A73 B;  3SK8 A;  3T16 A;  4RGO S;  5IOC A;  1STN A;  1KDA A;  4L63 B;  3V05 A;  1IW7 C;  1DYQ A;  2J4X A;  3RZO B;  3KLS A;  4LAA A;  3SK6 A;  1EZ8 A;  3S1M B;  2MP1 A;  1FNW A;  1CT1 D;  2F4I A;  2F0L A;  1GUN A;  1EIH A;  3A55 A;  1PTO D;  1WTW A;  3W3A A;  3K57 A;  1TKW B;  1EYA A;  1IYU A;  2WAQ B;  2AWO A;  2A6E C;  1XX8 A;  1II3 A;  4A3I B;  1LTG D;  5C0X H;  1U4L A;  3MXU A;  2ICE C;  2JSO A;  3EJI A;  4F7X A;  4DA2 A;  3MWY W;  2L1B A;  1TY2 A;  1SYC A;  4FYD A;  4I7Z C;  2RDG A;  1H9K A;  3NBH A;  1A3U A;  3A54 A;  2LY7 A;  3EA6 A;  2OEO A;  3BDO A;  1V8Q A;  4JBW A;  2B2Y C;  1PZJ D;  3KBX A;  5CV4 A;  2ZXO A;  1WTQ A;  4WRD A;  4A3E B;  2PCF B;  5C0X I;  1M4V A;  4J1M A;  4RGM A;  1BOS A;  5T1G A;  1HFN A;  3H91 A;  3GV3 A;  3Q23 A;  3HOY B;  4RGT A;  3TP7 A;  1A15 A;  3TBI B;  1LV9 A;  2EOT A;  2HDM A;  3E5S A;  1KNA A;  1G2S A;  2K5W A;  1PTO H;  1AN8 A;  2M00 A;  4CBV A;  2CW0 C;  3DM1 A;  1ESR A;  1A2T A;  5D65 A;  5KYL A;  2DN8 A;  3SR1 A;  5BN3 A;  1O78 A;  3CQZ B;  3J81 E;  4KMU C;  2VXW A;  3SDZ A;  2Y0S B;  1AFP A;  3V96 A;  1SNM A;  3DEP A;  3DUZ A;  4TSS A;  4PMC A;  3HP3 A;  4XTC S;  2XRS D;  1EYC A;  1SND A;  3RLF A;  2FMC A;  1LO5 D;  1V1O A;  1IYV A;  1F2M A;  1BBX C;  3D3R A;  1LT4 D;  1WTP A;  3HZX A;  3NTI A;  5IGE A;  2OXP A;  1HHV A;  4ME5 A;  4IUV A;  1SJH D;  3Q6S A;  4K8J A;  1BQQ T;  1CZW A;  4Y7N B;  4DXF A;  2FHT A;  5EPJ A;  5M5W B;  4IFD G;  3ERQ A;  4K8I A;  4OO1 G;  1JIC A;  4G7O C;  1KAA A;  4HN7 A;  3SHL A;  1UNS A;  1JOO A;  1FD7 D;  2KA7 A;  4F88 A;  2R92 B;  3N52 A;  1LTS D;  5K36 H;  3GTP B;  4LJZ C;  4CKB A;  4KN7 C;  1YNJ C;  1A6X A;  3FMC A;  5KNB A;  4HED A;  2QIL A;  4CJ0 B;  3VYT A;  1EIG A;  2K7V A;  2F03 A;  3AB9 A;  2K05 A;  5HUR A;  3R93 A;  3F2U A;  3PMF A;  4HCE A;  4WJW A;  5M5X B;  3J80 L;  1T5E A;  4ABN A;  3D4D A;  3SVM A;  3BVM A;  1KNE A;  4PMW A;  1WTO A;  5JOB A;  4X3T A;  1HCZ A;  2IPK D;  2X6G A;  2C9O A;  3QJY A;  1IKM A;  1WVL A;  4DU9 A;  1SJE D;  3IAY A;  1TWC B;  3M3Y B;  1HRJ A;  1WTR A;  3FVQ A;  4PV1 C;  1H9S B;  3MFY A;  2GA4 B;  2L4N A;  2Q8R E;  3A8K E;  3NK9 A;  4O42 A;  1ONL A;  4XQN A;  1B44 D;  2F0D A;  1PRT B;  1Z47 A;  4PQX A;  1CHP D;  5EKL A;  1HQR D;  2RVL A;  1V1P A;  4RGN A;  2L55 A;  1Q3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...