1QF3A

Peanut lectin complexed with methyl-beta-galactose
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
232
structure length
232
Chain Sequence
b'AETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYDPADGIIFFIAPEDTQIPAGSIGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTSTLITT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (PEANUT LECTIN)
publication title Structures of the complexes of peanut lectin with methyl-beta-galactose and N-acetyllactosamine and a comparative study of carbohydrate binding in Gal/GalNAc-specific legume lectins.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 56
structure length 232
sequence length 232
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qf3A00
3T1MA 1LOAA 2DVFA 1LHVA 4Q26A 4YG0A 1V6JA 4FPFA 3VKLA 3O0VA 2EXIA 3OJBA 1ENQA 3SH5A 1MZ6A 1QU0A 2DURA 3AZVA 3WHTA 1SBEA 3ILNA 1AX2A 5HCAA 2RHPA 2ZZJA 4Q8KA 4YG6A 3JU9A 1DLLA 5H9SA 4CTEA 2OUJA 2D6PA 5IT6A 2D3PA 3M3EA 5EXOA 1N1SA 3WCSA 1G9FA 1H9PA 1QKQA 2ZBJA 1JN2P 2YY1A 3AX4A 4Q1RA 1KJRA 1MVQA 1DQ6A 1G86A 2AGSA 2H0BA 2OUHA 5AVAA 4NO4A 1KJLA 1JBCA 1V6IA 5JLVA 1VALA 3FBYA 1WD3A 3WDUA 2FMDA 2HYKA 1CONA 4YM1A 3UK9A 1IS6A 4Y24A 4DS0A 3AJZA 3V65A 4I30A 3SITA 2A7AA 1LOGA 2R0HA 3LSEA 2DWRA 3M2MA 4P9YA 5T5JA 4LBQA 4GA9A 5CA6A 3VUOA 2GNDA 4ZKTB 2ZABA 4BLJA 1Y7BA 3WDVA 4Y1ZA 2I2SA 3AP9A 4W65A 1SCRA 3AZWA 3OYWB 1LOBA 4XJAA 3SNMA 3PVOA 1HDKA 1HLCA 4FPGA 4YGEA 3AJYA 4FPLA 4YZ4A 1SBFA 2UWAA 2P3KA 5SV8A 5GM0A 3B3QE 1S0DA 1S0BA 4UW3A 3QCWA 4L8QA 4H55A 3MPPG 5CBLA 4P9WA 2ZGKA 4ISQA 1N3PA 1UZZA 3APBA 1U0AA 5F9TA 2ZGLA 1IS3A 3IM0A 1FNZA 4YW1A 1OQ1A 3RG0A 4FPEA 5IK7A 1AJOA 1ONAA 1Z0HA 4Z8BA 3V0AA 2YROA 1UZYA 3ZXFA 4FPYA 3KM5A 3WOGA 4RL7A 3DGTA 2LALA 1V6NA 4U2AA 3WUDA 2D44A 2XG3A 3WNXA 1GYKA 3ZSMA 4YFZA 1JYIA 3L2YA 3FUQA 3A4UA 3ZYPA 2ZGMA 2EAKA 1MS4A 1G8WA 4Y1VA 1SBDA 3VKFC 5GZGA 4AVVA 3V0BA 4YM0A 1S0CA 4XXPA 2TEPA 1A3KA 4FQZA 4XMAA 1C57A 5FREA 4AGGA 2CL2A 1LGNA 1IKPA 3MW4A 4UW4A 5GZEA 1AVBA 2A6YA 1N3QA 1GNHA 5JOWA 2GALA 3HMYA 1SLCA 1LOEA 2D6NA 3AP5A 2KM2A 2WT1A 3UJQA 4DPNA 2ZGPA 1BZWA 4YW5A 1UX6A 1UPSA 1YO8A 2A6WA 3WCRA 1W6MA 1CIWA 1WW5A 4Y1UA 2UWCA 1BYHA 4XYXA 3V0AB 1SFYA 1W6OA 4C1XA 3AZXA 3M3QA 1GANA 5HCBA 4CRQA 3WG4A 5GJ6A 1DHKB 1JOJA 5H9QA 3JUUA 4M00A 1N3OA 1O4ZA 1GBGA 4LBKA 1G9CA 5H9RA 1NXD1 2UWBA 5BYNA 3R05A 3ZXKA 4XTMA 1MVEA 2PHRA 1WBLA 1JW6A 3NV1A 4Y22B 3MW2A 3WDWA 2D3SA 1LU2A 2JJ6A 3PVEA 1OKQA 3FUOA 4D69A 2E7TA 4ITCA 3WG3A 4Y26A 3OPZA 1DQ2A 3TAYA 1A78A 2AREA 2NZ9A 2XB6C 4KBBA 5H9PA 1DYKA 3O5SA 3KQRA 2ZGSA 2JD4A 2A6ZA 1QOTA 1S0GA 2PHTA 2SBAA 1TEIA 3ZXEA 1AXZA 2W52A 3RMYA 1UL9A 3OGGA 1FNYA 1W6PB 2ZMLA 3ILFA 3WVJA 5JDBA 1G9DA 1WD4A 1IS4A 1LHWA 2R0FA 4FOVA 2NYYA 3IPVA 5DZGA 1SLLA 3SH3A 3ZXLA 3H0OA 4FPOB 1W6OB 4YGBA 1Q8QA 1KRIA 1LEDA 2JKBA 1FV3A 1FATA 2B7YA 1ULFA 3OYWA 3ZVXA 3D6EA 3WHUA 1BKZA 3FLPA 1WW6A 1URXA 1F31A 1PZ9A 2GN3A 3NV4A 4PF5A 1YXWA 2DVAA 1CPMA 1FV2A 2CWSA 1ULGA 5CB7A 1FX5A 2Z42A 4Q27A 5JOZA 4FOWA 1GZ9A 1LHOA 5T5PA 4WVVA 1WLDA 2D6OX 5JMCA 1CQ9A 5KXEA 1LOFA 2A71A 5DUUA 3O0WA 4K21A 3ASIA 4ATFA 4YZ5A 3GALA 3AYCA 2DYCA 1WBFA 1I1EA 1GV9A 1IOAA 4AWDA 5T54A 3SLIA 1LHNA 4DQAA 1LULA 2WKKA 3IPVB 4XIKA 3MW3A 5IK8A 1VAMA 1Q56A 2E51A 1ENRA 2AYHA 3M3CA 3IMNA 2D6MA 4WV8A 4Y1YA 1LECA 3Q9OA 2WSUA 1N1YA 2EXJA 1RIRA 1F5FA 1SLAA 3AP4A 2V73A 3AZZA 3NV2A 2LTNA 2W39A 4DRVA 4FPHA 5KXDA 5GALA 1YIFA 4XIOA 4DRRA 3OBTA 5JOXA 3USUA 1KDMA 3M1HA 4JCKA 1JXNA 4YGCA 5IK5A 2DU0A 1W0PA 3AP6A 1DQ4A 4UW6A 1G9AA 2WLQA 3T2TA 2P3IA 1UKGA 1VAVA 4XHBA 5E8AA 4U36A 2R1DA 3N7MA 5E89A 3ZSJA 2ZHLA 1GKBA 1QDCA 1R1ZA 3POYA 4YW4A 2ZGQA 3AXEA 1F9KA 5GLUA 4M3CA 5DG2A 2OW4A 2JDZA 1G7YA 3FLRA 1QMJA 1DQ0A 3ZYRA 1GICA 5DZFA 3ENRA 2JE7A 3ZSKA 2EF6A 1Z78A 2E6VA 4YZ1A 1JUIA 1CR7A 4YW3A 2A3WA 4FPKA 2A6VA 1SCSA 4Y22A 4AVTA 1AX0A 1MS5A 3BTAA 4P9XA 4TYSA 5GZDA 2YXSA 4K1ZA 1RINA 1GSLA 2DVGA 2EALA 5T5OA 4XJWA 5GLTA 1S0FA 2ZGTA 3RMXA 2WJSA 3BOPA 3TB0A 2GNMA 3USUB 3BODA 2W08A 5DUXA 4ISRA 5IUQA 4ATEA 4FPCA 1W6PA 4Q1PA 2DVDA 2A3YA 2DUPA 3RQ0A 2WQZC 2ES3A 2DVBA 1C1LA 1HKDA 1CN1A 5CAZA 1X50A 1DIWA 2BQPA 1BXHA 3ZXJA 1MACA 3AP7A 3SH4A 4IQPA 4M3CB 1AJKA 4YZ3A 1APNA 1LEMA 3LSDA 4LBNA 4XILA 4LBMA 5E88A 1WUVA 2PHUA 3WUCA 4GWNA 2NP0A 2A6XA 4PBPA 2NM1A 4Y1XA 1QOOA 1LENA 5L73A 4GALA 5IK4A 1I3HA 1SLBA 2NN8A 3RS6A 1CVNA 3ILRA 4K20A 4UW5A 5GZCA 1RITA 4F83A 1LOFC 4XBQA 4YG3A 2CY6A 2P2KA 3FLTA 4PQ9A 1IS5A 4M3CF 1B09A 1N1VA 4FPJA 1HQWA 1KQRA 1DQ1A 1DZQA 1VIWB 1W6QB 4FQ4A 4XZPA 3WV6A 4AVSA 2G4IA 1ZM1A 1FAYA 1KDKA 2NMOA 1V6MA 2D43A 4XOGA 2W68A 3I8TA 1LGBA 3A0NA 3PVNA 1V6OA 4ZXKA 1DBNA 1Q8OA 3OBRA 3C2UA 4Y20A 3R4SA 2JE9A 1VLNA 2D7FA 5T52A 3AYDA 3WDXA 4BMBA 1QNYA 1YRZA 1QNWA 1DYPA 2UURA 3B01A 1Q8VA 1UN1A 2E53A 2YZ4A 3WZ1A 2PHWA 2UU8A 1AZDA 2CWMA 3B00A 2WSVA 4XJUA 1AXYA 1N1TA 2WT2A 2A3XA 4K1YA 5GLZA 1WW7A 1MS3A 3BIWE 1W6NA 2R16A 1GLHA 1PZ8A 2FHRA 2P34A 5JOYA 1S0JA 3VKMA 3B69A 4YM3A 4XHXA 4OZXA 4Q2FA 1MS0A 1UMZA 2WNEA 3T1LA 1CPNA 2WT0A 1S0IA 5JVVA 2GDFA 2ARXA 4MYEA 1H30A 3U4XA 1J1TA 3N7LA 4GWMA 2VH9A 1D0HA 3NWKA 3LCPA 4BPZA 1SLTA 3O0XA 2V5YA 1C1FA 3N7JA 2ZGRA 3ZPYA 4YW2A 3POWA 3OY8A 1UAIA 1SLIA 4LBLA 4XBNA 4Y20B 2ZMNA 3O12A 1O4YA 2EXHA 3HN1A 3V64A 2DV9A 2CNAA 4FOYA 4C1WA 1ENSA 2AUYA 2GNTA 1LODA 1GZWB 2ZKNA 4JC1A 4R9BA 1D2SA 1LGCA 5DZEA 3N7KA 1WLCA 2CYFA 1Q8SA 4LBOA 2ZACA 3NV3A 1ZA4A 1FYUA 2VW2A 1W6NB 2DTWA 2EIGA 1AX1A 1ULDA 4LBQD 1CJPA 2PHFA 3ZSLA 2ZGOA 1H9WA 4XJ8A 5DG1A 5HCFA 5DXDA 4YGDA 3UJOA 1DGLA 1CESA 2R1BA 2ARBA 3POSA 4FOQA 3QLQA 5DUWA 3A0KA 2ZHMA 1QF3A 1LCLA 4SLIA 3WLUA 1G9BA 3OY8B 4XE9A 4HL0A 1LESA 3GNEA 2VW1A 1DQ5A 1ULCA 3WG1A 2C5DA 4HANA 5GLWA 4CZSA 3SISA 4PBOA 1SACA 3N36A 5CNAA 4AGRA 2JECA 4AYUA 4XDQA 5T55A 4BLIA 3D5OA 4M3CE 4XJ9A 4ASMB 1NLSA 4R9CA 4FVVA 1MS1A 1W6QA 3MEPA 2A5ZA 3HR9A 2A70A 2GN7A 2DU1A 3RSJA 3VV1A 2P3JA 1MZ5A 1GNZA 1MR5A 1WLWA 1LHUA 4GXLA 3I4IA 2ZGNA 1BQPA 4LBQB 4FP2A 4P14A 4R9AA 2ENRA 3PMEA 5EYXA 2GMEA 3B9CA 4NOTA 4XXAA 1ULEA 5EYYA 3VKNA 4GKYA 1WW4A 1YYNA 2DUOA 5T5LA 1S1AA 1V6LA 2CTVA 1C4RA 2GNBA 2YMZA 4YM2A 3AXDA 1LTEA 2AENA 1MS8A 1LJ7A 3CNAA 1DFQA 2PHXA 4M01A 3WG2A 1QDOA 1MS9A 2A75A 1LOCA 4YZ2A 4WVWA 3WDTA 2ERFA 2OVUA 3DUIA 3AYEA 3N3HA 1N47A 3PJQA 4PCRA 5F5QA 2YV8A 1AXKA 3UL2A 3AK0A 4FP3A 2R49A 4XTPA 1W0OA 4RA0A 3N35A 2P37A 1AF9A 3AYAA 4TZDA 5KXBA 5GLVA 4DFSA 3AFKA 3IKWA 4XJZA 5FRAA 4LBJA 3W59A 4BOWA 1KITA 2ZGUA 4BQ1A 5KXCA 1LU1A 2AH2A 1HQLA 2Q5TA 4JRAA 2C9AA 2VY0A 2VUAA 4R9DA 4YFWA 5GZFA 5T50A 3VKOA 3W58A 4BMEA 2DTYA 4YLZA 4Q8LA 1QGLA 5DUVA 3R4UA 2PELA 4XMIA 3V0BB 1IKQA 3RRDA 1V00A 3FFZA 4XBLA 4BM8A 3IN9A 1QOSA 1GZWA 4AGVA 1GZCA 2D6LX 2GMMA 2ZAAA 4WZFA 5EWSA 1OFSA 1BJQA 3M3OA 3WDYA 2NMNA 1PZ7A 2VU9A 1JYCA 2D3RA 1A8DA 3D4KA 1S0EA 5LK5A 2E7QA 2SLIA 2ZHNA 3INAA 1JHNA 1WCSA 2D6KA 2ZMKA 1EPWA 3AZYA 4GKXA 1XQNA 1Q8PA 1V6KA 1W6MB 2DUQA 2VXRA 2EXKA 1YI7A 2VW0A 2ZHKA 3ATGA 2GMPA 2AR6A 2ZA9A
chains in the Genus database with same CATH superfamily
4Q26A 3VHOA 2E26A 1X8EA 2EXIA 3O0VA 2K9ZA 1QU0A 2DURA 2FQPA 2XJVA 1SBEA 2RVAA 2WYFA 2JXAA 4QGMA 5JIAA 2WNOA 4GD4A 4FCAA 5GKAC 3JU9A 5H9SA 4HKOA 2OUJA 2D6PA 2XBO2 5LA9A 2D3PA 2VZ3A 4FAHA 3BU0A 2JDPA 2MEV3 3HNBM 5I0UA 1VBC1 3P3NA 1G9FA 1QKQA 2GC1A 2X53S 1R083 3AX4A 5CU1A 2VL4A 3WCSA 5ABJC 1AR63 1MVQA 1POV0 3K48A 3WW1A 4RR3B 3WP5A 1OUSA 1IQAA 2OUHA 4AQSA 4DEQA 5JSOA 4M0HA 5AVAA 2VOKA 3EMRA 5FMDA 1V6IA 2X5IC 3GBFA 4KWJA 2F17A 3WDUA 5JI7A 4BQYA 2VOVA 1ZX5A 2RS51 3M3IA 5FZ9A 1VJ2A 4JAAA 2PN5A 1K5MB 1PVC3 4I30A 4P5YA 3LSEA 3M2MA 2DWRA 4MHRA 4RN5A 3WINE 3OD4A 2PHDA 1YFWA 4GH4A 4HLTA 3C7GA 2J7MA 2OKXA 4QKNA 4BLJA 1Y7BA 3WDVA 5C8CB 2XJTA 1REDA 2C24A 2QZ2A 1RUOA 4XJAA 3SNMA 3PVOA 1HLCA 4Z1VA 3AJYA 2P5BA 1E5IA 2XBO3 4EN8B 3DXUA 1W28A 5SV8A 2PLV2 2ZX0A 3PIGA 1UYYA 5F6LB 4H55A 2HWB2 3MPPG 3SEPA 5CBLA 1C3HA 2ZGKA 1U0AA 1HXS2 2Q8CA 2C1FA 1FNZA 1U12A 2UY8A 5I93A 5K0UC 1HRI2 4LKSA 2BERA 3VB9A 3KT7A 3I2HA 1AJOA 5IK7A 1UY2A 1Z0HA 5FZCA 2W87A 4MADA 4QXCA 2JE8A 1QJU1 5EJ3A 1VBD3 3VBFA 2P6HA 1C28A 3H8UA 1GQGA 3HAGA 3ZKYA 2VMHA 2D44A 3WNXA 1NA1B 5FYSA 1JYIA 4NIDA 2RDSA 2VMDA 2DCTA 1FT9A 1AR72 1MS4A 2OZJA 2Y33A 4QKDA 3MYXA 5IVFA 4BQ2A 4AVVA 5BY5A 1J59A 3I2OA 3WQ7A 1S0CA 2RM22 1W9SA 3KSCA 4YYOA 3FBMA 5FYCA 1ZRDA 1VBE1 4FQZA 1C57A 5FREA 1IKPA 3MW4A 3WQBA 5DDJ1 4D6QA 1OVSA 5AC92 5JOWA 4LO4B 2Z79A 5A7OA 3WW3A 1SLCA 1LOEA 2D6NA 5J98B 2VD7A 2HWB3 3BKZA 1BZWA 3K46A 1W9TA 5DAXA 1YO8A 4D94A 1EP0A 1ZNPA 2P4EA 3F2ZA 3OBZA 3VDAA 3WCRA 4JGZB 4BQ5A 4E4HA 5LW9A 1ZZ7A 1CIWA 5FO7B 1EPZA 1WW5A 1WLTA 1MPXA 3HIFA 4NUBA 3AZXA 3M3QA 2R071 1GANA 4XFCA 1KXGA 4ZONA 1W2TA 5FYTA 3MI8A 5HCBA 3AL6A 3WG4A 4CRQA 2Q1FA 5FZ3A 1LB2A 1JOJA 5H9QA 3EYPA 4LHSA 2FDKA 4GMP1 3HBZA 4Q0PA 1G9CA 4TN7A 5KBFA 5FP3A 1G6NA 1AR73 3R05A 1YFXA 2Z4FA 5E6HA 1OFNA 4LHKA 4FBFA 3IIIA 5G05L 1WBLA 2OX0A 2RM23 4TLGA 4Y22B 1OURA 4A41A 4UI9L 1PO12 3ZYJB 2XL7A 3UYJA 3WG3A 2W1QA 5F3CA 4COYA 5AC93 3UV9A 4LA2A 3TAYA 2AREA 4KBBA 1HJFA 1DYKA 3O5SA 3KQRA 2YBPA 3POIA 4MV2A 5C4WA 3WP4A 1AXZA 1CAUA 3OUIA 4QWNA 2R041 1FNYA 3WVJA 2HJIA 1SDWA 1WD4A 1PMHX 1LHWA 2OQ6A 3SEEA 1GWMA 4Q0VA 4RFT0 1D4M2 1SLLA 2Q4SA 5D8AC 5AFBA 2W2IA 1LEDA 2JKBA 1XYNA 2B7YA 1ULFA 1CX4A 1ODNA 3T0BA 2Y38A 3WHUA 2QQKA 2QQVA 1URXA 5FCCA 5KHJA 4DINB 4MXWA 5JSRA 1Y9MA 4PF5A 1JZ6A 1CPMA 5I0SA 2WWUA 3H7YA 3A7QA 2B46X 4XAAA 4Q27A 2XXZA 4AFDA 5AVPA 2AC1A 1GZ9A 1TME1 4LMFA 3L2HA 3PDQA 2EIEA 1PO13 4MX3A 4TSVA 3H1YA 2XJRA 5A3LA 5LWBA 3OGVA 5KXEA 2ZJCA 2VOXA 3RWNA 3VZNA 4ATFA 2G9GA 4NROA 5JXHA 3AYCA 2ZXQA 5FO8B 1OMIA 2XJPA 1CAUB 1T2XA 1YUDA 4LKFA 1GV9A 2JDHA 3NKGA 4G9SB 1OQDA 5ACA2 1AR82 3I49A 5T54A 4XW3A 2D97A 2RDNA 4XIKA 3MIFA 5FXZA 5IK8A 3N4MA 2BP6A 1RUE3 1Q56A 1UMHA 1ENRA 3TN91 1CGPA 1UNBA 4WV8A 1SEFA 2FBEA 4IGPA 2WSUA 2GP3A 4LOSA 1EV11 4NE9A 4HSLA 4BA6A 4NIIA 2LTNA 4DRVA 2F6BA 3PUSA 4FPHA 4PT6A 5LEKA 5KXDA 5GALA 3A22A 1JUHA 3USUA 1H2NA 1KDMA 4XUTA 4YGCA 1UU6A 1YHFA 2DU0A 3AP6A 4MVTA 4UW6A 5FFOC 5FMBA 5IATA 2R30A 3Q8AA 2YBSA 3T2TA 1G9AA 2BTVC 2WLPA 4XHBA 2WO2A 4PDWA 5B4NA 3ALQA 3ZSJA 2WO1A 3H9AA 2WS91 1OKOA 2G9ZA 4ES9A 2ZGQA 3AXEA 4H2AA 5EV7A 5BNNB 1VBA1 1RUG2 5DAPA 3AVSA 2OW4A 2W1WA 3OG2A 4GB31 4C8DA 3O1VA 5ACA3 1AR83 1X36A 2X29A 1U5XA 3ENRA 4A6OA 5D21A 3ABZA 4A4AA 1Z78A 2HWF1 2RS32 5BNOC 3O1UA 3S7IA 1GP6A 1CR7A 3FHAA 4AHYA 1VRH2 4H7LA 1GUIA 1AX0A 1MS5A 2E63A 4TYSA 1VBB1 4UAPA 5FO9B 5HPOA 5CVRA 5GZDA 3LDKA 1ZBE1 4LE3A 4TTGA 4XJWA 4ZXEA 3ETPA 3D0SA 2VZRA 2Z5WA 2GNMA 1JU3A 2VZTA 5FJKA 4LT5A 3USUB 3SQOA 2PAKA 1UZVA 3AMQA 5DUXA 3OUHA 3MIBA 1RTVA 1WWYA 5IUQA 2VNGA 1GZTA 3LIGA 1W6PA 2EIBA 2DVDA 2VZQA 4KG8A 4GWIA 4KWUA 4EE2A 4PDWB 3S5AA 3POJA 2JG9A 2Y6GA 2ES3A 2RE9A 1C1LA 3GYDA 4W6XA 2BQPA 3VZMA 3ZXJA 1MACA 3AP7A 4N53A 3ZFFA 2Y6KA 4FI9A 3D0JA 3LSDA 3FHIB 3I3MA 2PHUA 4GWNA 4ET7A 5BNPC 2RS33 2B5HA 3MICA 5IW0A 4GALA 2ID4A 1YNAA 3PHMA 1VRH3 1SLBA 2HWD1 4AW7A 1W8FA 1CVNA 4K20A 4UW5A 5J1XA 3FMGA 4K8FA 2QQNA 2BJSA 4XBQA 4YG3A 1OQEA 2BYVE 3FLTA 4A7KA 4CCDA 1IS5A 3K3OA 1B09A 1N1VA 2WNUB 4C0BA 2KA3A 1DZQA 1UZ0A 2ZKLA 4QPGA 1CD3G 1H2KA 4FQ4A 2HKXA 2JEMA 2G4IA 4AVSA 4DMIA 1FAYA 1KDKA 1PGW1 2NMOA 3KF3A 3G7DA 2W68A 3ZFGA 4E27A 4XZUG 1JZ5A 2IXKA 3PVNA 5A80A 2OQ7A 1Q8OA 1HRV1 1RUH2 4R4ZA 2FD8A 2ILMA 1HX6A 1Y3TA 2JG9B 3ACHA 3NO8A 1QNWA 1DYPA 4XUOA 4AQ2A 2WYSA 1BCXA 3WXPA 3EB7A 4NN0A 2IZWA 4N53B 3ZFFB 2EA7A 1WMEA 2CWMA 4CCLA 4ASLA 1GFF2 2MNGA 2L9LA 2H6BA 3DYOA 4PF1A 2VZ1A 1MS3A 2WO3A 4HXCA 2DFCA 3ACFA 3C7EA 5CEHA 2XR4A 1XNBA 3SMHA 1W0NA 4N43C 1UMZA 2PHLA 4JGZC 3WD5A 2QBXA 4N9IA 4W8JA 1NAEA 1CPNA 2WT0A 1S0IA 3OCPA 4MYEA 2ARXA 4NRQA 3UETA 2R7EB 3EXUA 1RJ7A 3FN9A 3LEKA 4QPGB 4CDQC 4BPZA 1RUD2 1SLTA 2WA3A 1YWKA 3IT8A 3O0XA 3MIGA 4XCAA 5CKQA 3VHRA 3VZJA 4RS5A 3WNPA 2PYTA 3VBRA 1UAIA 3NQHA 4AG4A 5JPNB 5DAWA 1J3RA 1IGOA 4QPIA 1NY71 3VLBB 3HN1A 4C1WA 4FOYA 3WP6A 1NUKA 3I97A 3I59A 1H6YA 3HT1A 2W1UA 3RPQA 4IERA 4OLLA 3VHNA 2E31A 5FZLA 5IYYA 4JC1A 5FDBA 1CJDA 1STMA 1WLCA 2CYFA 1Q8SA 4LORA 2ZACA 4XCBA 1ZA4A 1QH6A 2DCKA 2VW2A 1ND3A 3TRSB 3VBHC 3GBWA 5F2WA 5I8TA 4OFGA 5JZGB 2MEV1 2FCTA 2WAAA 4LO8A 1PO22 4XF0A 5A32A 5HCFA 4EQVA 1R081 1MEC2 1AR61 4QX5A 4RGAA 1RUD3 2VTFA 3DN7A 5IWFA 4Q4V2 4QU1A 1VBE3 2QE3A 2JG8C 3A0KA 1QF3A 1LCLA 2J1TA 3WLUA 1G9BA 4J1WA 3IDCB 3WW4A 1QXJA 2TNFA 4XE9A 2IWGB 2F4PA 4SBVA 4QPIB 3GNEA 3K75B 1PVC1 3LZZA 4MG2A 3J9SA 4IV1C 2C5DA 1PK6C 2J1AA 2I07B 4HANA 3I59B 1OPOA 4FSJA 3LWCA 1U5YA 1UZWA 5KHIA 3AMNA 4CPBA 2JECA 1O8PA 3AKTA 4LHNA 3M7AA 4HETA 3K4DA 4AHXA 4DY5A 1NLSA 3RYRA 2XBO1 4KQ7A 2Z2SB 1PO23 2YC4A 1MR5A 3ELNA 1ZZ9A 3LFIA 1LHUA 3NNLA 3VBUC 1BQPA 2XVGA 2QUOA 3R0RA 3DCQA 4LBQB 4P14A 1EY2A 2GMEA 5EYYA 4Q4V3 4JKLA 2XLGA 5T5LA 1B35A 3C7FA 4MXVA 4YVSC 5FPAA 1C4RA 4GMP0 4YM2A 2C0ZA 4L97A 4S2FA 4QX2A 1LJ7A 1DFQA 2JDMA 1H6XA 2A75A 1LOCA 4CUBA 4RGKA 2ARCA 3N3HA 5FPUA 5CFDC 2BFUL 1N47A 4PCRA 5F5QA 1AXKA 3AK0A 2R49A 3UESA 1W0OA 1S4CA 3NAPC 3AYAA 2IXLA 5LY1A 5KXBA 1H1MA 3H1WA 4NHLA 4PIYA 4CDUA 1OSGA 3VBOC 3W59A 5ABJB 4BQ1A 3I2IA 1RMU2 2RG4A 5K0UA 2W9XA 2PLV1 2W1SA 1HQLA 1C8NA 2QDRA 2BZDA 2X5IB 5T50A 4JDNA 2BVVA 2CV6A 5FZAA 2ZEYA 2HWB1 2B42B 5FUPA 5A3OA 3VKOA 3VL9A 2FZ2A 2WABA 3RZGA 1GOHA 1HXS1 1PMJX 1FOD2 1S2BA 1GWKA 1HRI1 3CKHA 2V4VA 5DUVA 4E2SA 5C9AA 3PL0A 1PX3A 2CHHA 3B02A 4HKWA 4MHUA 1GZWA 1M4WA 1WZXA 4AGVA 1GZCA 3ZYFA 1SMVA 4CDXC 4WZFA 5EWSA 1BJQA 5DMYA 3DEMA 1UU4A 3TNPB 1PM4A 1O3SA 1HQNA 1UYPA 1W8WA 2BWAA 5BUVA 5CG9A 1AR71 3DYPA 2VO5A 4QGLA 4JKKA 1PIV2 2F4LA 2RM21 4FFHA 1JHNA 2D6KA 1EPWA 3AZYA 2D5FA 1XQNA 4FTSA 2ZZQA 1W6MB 2VXRA 1UXXX 1W8UA 3TN93 3ZYHA 1YI7A 2A1XA 1RMU3 4BQWA 3U0ZA 5AC91 2GMPA 1CIYA 2AR6A 1UW8A 2P3YA 3W5MA 1LHVA 1L7RA 4YG0A 3VKLA 4FPFA 4CUAA 2JENA 3OJBA 1ENQA 3SH5A 1MZ6A 3AZVA 3WHTA 3HVDA 3ILNA 1FOD3 1XU1A 4COUA 1BEV2 5C70A 5HCAA 2RJKA 2ZZJA 3DKWA 4Q8KA 4IESA 4MGYE 4QB2A 1RHI2 4CCEA 1N1SA 3MLJA 1H9PA 4AEKA 5J7MA 1BK1A 1ND2C 2JKXA 3N9QA 4BQ3A 2WS93 3FZ3A 5F6KA 5LZ6A 1VB2A 3KMHA 1DLCA 2VNOA 3KV6A 1OXCA 1EAH2 3CEWA 3JQWA 1KJLA 3M4FA 2YGLA 2XJSA 3WNOA 1VALA 5FZMA 1PIV3 1IS6A 2BFUS 2YGMA 4ZZ5A 2ZTNA 1PO11 3SITA 3GCXA 2BEOA 1Y9GA 4GA9A 1UY1A 4D3WA 2XQRA 4CEYA 1ZA7A 4IGQA 4CEWC 5D8AA 1VBB3 1CAWA 3HQUA 5APAA 1Y9QA 1NCQC 1TQ5A 2XPJA 5IFPA 1HN1A 3KHBA 5L7OB 4FPLA 1GOGA 3POEA 5FPXA 2HEVF 1GNYA 1RHI3 1W3XA 1Y43B 2Y64A 4PLMA 3B3QE 1D4M1 4QXHA 4W6WA 3WT3A 5JAXA 3QCWA 2QQWA 2VBDA 1RGSA 3J7MA 2QFEA 4P9WA 4NJ4A 5F9TA 3APBA 4KWKA 2ZGLA 1IS3A 3IM0A 4YW1A 2XHKA 3ECQA 2Q1ZB 5FZ4A 4ARXA 1IQDC 4MGZE 3IZOA 3LDBA 4FPEA 4E4SA 2YROA 2QQIA 2G19A 5FZKA 4CU8A 3KM5A 2WQ4A 3WOGA 3Q8CA 3WF4A 4DXRA 5KR7A 3DGTA 3GZTB 2LALA 3ZFEC 2DF7A 2XG3A 4XACA 3ZSMA 4KU8A 2V4AA 2ADEA 3CLPA 1G8WA 4IE5A 5D8AB 1UYZA 1WCDJ 2XVKA 5FZEA 1A3KA 4AE2A 1UOFA 4AGGA 4LK7A 1KS4A 2K2SA 3LQCA 4PIZA 2XH6A 4UW4A 5GZEA 3WNMA 5ACA1 1AR81 5JXJA 1GNHA 3LA3A 3MLLA 2GALA 2VMIA 5IAVA 1K3IA 4QDSA 5J48A 2WUHA 2VC9A 4ARYA 4GIQA 4DPNA 1YFUA 3RZMA 3WW2A 2O0OA 1QHDA 1BVVA 4TXWA 4CVUA 1ASJ2 4HPKB 1W9WA 3AL5A 4A3XA 1CZVA 1BYHA 2UWCA 3TWIA 2VZUA 1W6OA 2VBBA 5HBAA 2O14A 1VMFA 5FYIA 1NYWA 3MHZA 4L92A 5CKNA 1O4ZA 4LBKA 1GBGA 2EVXA 5H9RA 4QHBA 2BNOA 1YJLA 5BYNA 5FWJA 1D4VB 4AFMA 3ZXKA 2PHRA 1JW6A 1UO9A 5JPMB 2D3SA 1LU2A 2JJ6A 4MSVA 1RUG1 1SG3A 5FY8A 3E6DA 2OYZA 3D3AA 1HB2A 5SV5A 3WQ0A 4ZU5A 4JQTA 1IHMA 3U07A 3VDDC 2XB6C 3NKTA 5F3EA 3W21A 5FXXA 1YEWA 2RS31 1JYXA 2A6ZA 4MLOA 3FHQA 4A6SA 1TEIA 3POGA 4GAZA 2IC1A 2W52A 5EJZB 3OGGA 1VRH1 3ILFA 1UU5A 2VZPA 2N7GA 1IG3A 5C3SA 1ASJ3 1K5MA 5A7WA 1IS4A 2R0FA 2NYYA 4GZ9A 5I8YA 1UMIA 2XQXA 5DZGA 5BV6A 3SH3A 5J3UA 4LUKA 4CCMA 1PVXA 4BDVB 4DUWA 4FPOB 4YGBA 1W6OB 4CXXA 1Q8QA 2JD9A 5C8CA 4QX3A 1W2UA 2WNVC 2WN2A 4PJYA 3ZVXA 4FT8A 3FLPA 1WW6A 2ET7A 2LS6A 3HN3A 2QKDA 1W9YA 1YXWA 4K40A 4WVMA 1FV2A 4AEDC 1IPKA 1ULGA 3AKRA 1TG7A 5CB7A 1FX5A 2Z42A 5JOZA 5FJHA 5BNPA 4YPJA 4UFIA 4DXTA 1OHFA 1DGRA 1TNFA 5BNOB 1CQ9A 2JDYA 3T2PA 2HWC2 3P5BA 4IEZA 1J1LA 5B4XA 1QXRA 3ASIA 3OBAA 2DYCA 4J1XA 3BALA 2HEWF 4L11A 2ZEWA 5IVBA 5LEJA 4K7JA 1DGWX 1RYYA 1RUC2 1QEXA 2HLEA 2WDBA 4QQLA 2BOJA 1HN0A 4R52A 5JR7B 3KWVA 5A7WB 1K12A 4DQAA 1JHJA 2XL9A 1NA1A 1VAMA 3PJYA 4QXBA 5K4LA 1XNAA 1DCSA 1LECA 3H3LA 3VZKA 3ZOIA 2GAUA 4LPLA 3VBSC 4EYUA 5A7QA 3HD8B 2EXJA 3ZO0B 4DZGA 5L9RA 3NV2A 2V73A 1XRUA 1RUH1 2BRTA 4WVMB 2OZ6A 1YIFA 4XPVA 3M1HA 4HSJA 5BNPB 4JCKA 1JXNA 5C71A 1W0PA 1DQ4A 1AUYA 2WLQA 3GXUA 1W8TA 5FYHA 1VAVA 2HWC3 1NCRC 3N7MA 3I7DA 4KMQA 4N43A 4JGZA 2ZHLA 5JR2A 1QDCA 3BTXA 3PURA 3THPA 2CAUA 1HB1A 3WNKA 1F9KA 1OLME 3NL1A 4M3CA 1RUC3 2VZOA 3D8CA 4TLFA 4N9HA 5DG2A 3H8OA 5J96B 1QMJA 5FYMA 1GICA 4CPBD 1BBT2 2JB8A 2JE7A 3CU7A 3WF0A 4AQTA 4IV3C 4KGQA 5CIRA 2E6VA 4DNYA 2RMU2 2VNRA 4O65A 1SCSA 1RUD1 1WCQA 4Y22A 4Q0UA 1OD3A 4P9XA 5F2SA 1PNFA 3G6JB 3ES4A 4CE8A 5CFCC 1RUNA 1I9RA 2QVSB 4XAEA 2YXSA 3WR0A 1RINA 2DVGA 4OCTA 3E5UA 4AAXA 3H8RA 5T5OA 4AFCA 5IVEA 4UBGA 4H3WA 3PUIA 2ZGTA 2FDJA 2PLV3 4RHV2 3BOPA 3JCIA 3RMXA 3ZXGA 4B8EA 3OGSA 1OOPC 4FFGA 3LPFA 1HXS3 1U5ZA 3AM2A 3VBHA 3RQ0A 2MHFA 1HRI3 4N43B 4QX1A 1HKDA 4IDZA 2GH2A 5A3NA 4YRDA 4B1MA 4M3CB 4YZ3A 4CDQB 2XUMA 5L7OC 3VGIA 4LBNA 2JG8A 3KB5A 4XILA 4JQRA 4CCJA 1PO21 2Y0OA 2WN3A 2A6XA 4LKDA 5A7PA 4HG6B 4JTOA 2YC0A 1LENA 4Y1XA 5I91A 1MEC1 5L73A 2RMU3 2JDAA 1I3HA 2XONA 3GM8A 5FLHA 4IV1A 3ILRA 4Q0SA 5GZCA 2VECA 4Q4V1 4XABA 2CDPA 4YWAA 4HOOA 2VUCA 2P2KA 4OI4A 1UIJA 1X7NA 4LE4A 4PQ9A 1NQDA 3MF9A 4P9JA 1HQWA 1XYOA 4RHV3 3WV6A 1ZM1A 3I2KA 5F5IA 2X09A 1V6MA 2D43A 4LITA 5C7GA 3VBHB 1DBNA 3BVCA 5I0RA 3OBRA 5A33A 4IGOA 3CJXA 4D7SA 2JE9A 1VLNA 4HN1A 5T52A 1W06A 2G1MA 3AYDA 3H1MA 1TNRA 5FYUA 3VBUA 2V5DA 1F2NA 4NWVA 2UURA 3NW4A 3DF0A 4IETA 1ULOA 4IEYA 2E53A 4Y5SA 4Z2AA 4R4XA 4K6BA 2VOWA 3UKNA 3B00A 2JG8B 2JB4A 4XFHA 3T4HB 1DDLA 1I5PA 2QQUA 2A3XA 2W92A 4XF3A 1GP5A 2R16A 1GLHA 2WO7A 2VAUA 2P34A 4IV1B 1NE4A 1PK6B 1TMF2 1JODA 3B69A 4CU7A 1MS0A 2WNEA 4MGSA 3T1LA 4EWAA 3H3ZA 4ONUA 3NAPA 1NE6A 2GDFA 4LTAA 1H30A 3N7LA 4ZHNA 1Q43A 2VH9A 3NWKA 3BGAA 1HV1A 4NPRA 1W2OA 4OUEA 1XB9A 1C1FA 1W2AX 2B39A 5BNNA 3N7JA 2ZGRA 3T2OA 2D40A 1SPPA 3OY8A 4CXWA 4BWOA 2ZOEB 3GDBA 4XUNA 1P8JA 4LBLA 4P08A 3WNNA 5A33B 4LK6A 3O12A 4A44A 1D4M3 4HVRA 2OPWA 3VBUB 2CNAA 1JZ4A 5CZKA 1UPIA 2J1RA 1ENSA 4Q4Y2 1KD7A 1RMU1 2BDRA 5JI9A 3CDZB 4QB6A 4XQDA 1UX7A 1D2SA 4XEZA 3N7KA 5JXIA 1HB3A 4YVSB 2Q30A 5LRSA 4XFAA 1VMHA 4CDXA 1NZCA 1FOD1 3R6SA 3W20A 3KD4A 3TEZA 2G9FA 2VQ0A 2DBNA 3CHXA 1AX1A 1ULDA 2BU9A 3LAGA 4EZHA 1CJPA 2PHFA 4F8AA 5CFDB 1LR5A 4Y33A 4JDMA 5DG1A 3NAPB 5C6CA 3UJOA 3OTFA 2ARBA 2VM9A 5L9VA 3VBOB 3QLQA 3PU3A 4IE6A 4HONA 5K8SA 1SPPB 3OY8B 3NNFA 1QH7A 1PIV1 1XNDA 3MFCA 1JS9A 4RYDA 4H7MA 2VW1A 1ULCA 4EN7B 4S2HA 4Q4Y3 1OBNA 4RGGA 2VNVA 4CZSA 3SISA 2B9UA 2O1QA 4MH0E 1SACA 1R092 2OA2A 4AGRA 4LEJA 2K46A 2QQJA 1JMUB 3J7LA 2XLFA 3D5OA 4XDQA 4AYUA 1NX9A 2HEYF 4OI0A 3O1OA 4ES8A 1EYBA 3Q8FA 2WNUA 1ND2A 1BEV1 5FK8A 4CDXB 4FVVA 4FTEA 2A5ZA 4LKEA 1R1A2 1RHI1 2C6SA 3VV1A 2P3JA 2Z69A 4GJYA 3S7EA 1WLWA 1F5JA 1OA4A 5FPBA 4GXLA 4UXAA 3HQXA 2NQYA 4WZCA 4Q4X2 3AC0A 4YNIA 3PMEA 4NOTA 1ULEA 3MUZ1 1EAH1 1RUF2 2Y6HA 1RUG3 5FZ0A 1VP6A 2E33A 1S1AA 3CJIC 3FFQA 5I8SA 3N9NA 2RDRA 1QIQA 3OOXA 4CCOA 4X8NA 3CO2A 3JB4C 5FP8A 1QDOA 2FZ1A 1JOBA 4YZ2A 3KGLA 4WVWA 4DUVA 3DUIA 2ZX2A 3ZYBA 4XFIA 4FTBA 1OC1A 1L3JA 1R093 2B4KA 2YV8A 4FP3A 4QDQA 4R8HA 4X6RB 3RNSA 4RA0A 3GJAA 4CDWC 4I0WB 5FY4A 1ACCA 2RJ2A 4QPWA 4DFSA 3AFKA 3E97A 4CUCA 4UT5A 1ND2B 4LBJA 4PHZA 3O1RA 1KITA 1R1A3 2V72A 2R062 1QJY2 4A45A 4JRAA 4CCKA 2VY0A 2VUAA 3NRUA 4A2UA 4Q4X3 3GHMA 3M8LA 5KC5A 1REEA 4Q8LA 4LA3A 1QGLA 4Y3OA 3LEIA 4XMIA 1RUF3 3V0BB 3RRDA 3UT0A 1CAXB 4BM8A 5FZBA 3RFRA 4IEOA 4CEWB 3AVRA 1HIXA 1JYNA 4Q29A 1OFSA 1NCQB 3JD72 5FZFA 4BB3A 1JYCA 3P1IA 2CGOA 1V9U2 2KXLA 4ORFA 1NLRA 4BQXA 4Q4W2 5LK5A 4JHTA 4N7IA 2SLIA 2ZEXA 5JZGA 1WMFA 2ZHNA 3INAA 3WNLA 1BVP1 2ZMKA 2YFZA 4O7XA 5C3QA 1V6KA 2DUQA 5F39A 1UY4A 2EXKA 2ZHKA 4NPLA 3GZAA 2R063 1QJY3 3A4UA 1OA3A 4HKLA 3TNQA 4GWMA 3WX5A 5A6YA 3RGBA 3V56A 1LOAA 2DVFA 3HPNA 4HVOA 5F3IA 4LIVA 4UOJA 1YQ6A 2PAMA 1AX2A 1RUH3 3GGLA 2RHPA 3WF1A 5LA1A 4QX0A 4CTEA 3ZFEB 1ASJ1 3E5QA 5LASA 3U1XA 5FZHA 3LOBA 4L9BA 4JX0A 4JTNA 5EXOA 5DAQA 2HH9A 2RDQA 1PMIA 3B93A 2X8KA 2ZBJA 2YY1A 1AR92 4UF0B 2HBTA 2VXJA 3BPSA 3JD73 2BUKA 5FKBA 1DU3D 4AFAA 1V9U3 2D98A 2W5FA 3MGUA 3VBFC 4COZA 3GJBA 5BNQA 5IFTA 3RZHA 1JBCA 1QXPA 3VDDA 4Q4W3 3K4ZA 3FBYA 4KI5M 5CKMA 4AHZA 4Z82A 5JUVA 2V09A 1CONA 2WIIB 3NJZA 4NRPA 4YM1A 4DS0A 2YFUA 3AJZA 4QQPA 1JZ7A 4QX7A 3V65A 3O14A 1M06G 1LOGA 1C8M2 2R0HA 3ACIA 4P9YA 4LBQA 5CA6A 4W6YA 1IPSA 4P9IA 3J7HA 3OF1A 1V70A 4YVWC 4ZKTB 2ZABA 2QQPA 1FMD2 2VUDA 4W65A 1SCRA 3SCHA 3AZWA 1CX1A 3OYWB 2XDVA 5FOBB 1WKYA 2VZVA 2VVDA 3QH7A 3BI3A 4OMCA 4YGEA 1ST8A 1F8VA 3O1PA 2J1UA 1XOYA 1SBFA 2UWAA 4QD2A 1POV1 4MZUA 3O7OA 4YZ4A 5A1AA 4QQ2A 4LJHA 5GM0A 5A6ZA 1C5IA 1S0DA 3PIJA 1S0BA 1EUTA 4AEDA 5C8WA 4I09A 4L8QA 1SHWB 1AR93 2E9QA 4ISQA 5J09A 1E5HA 1UZZA 3ZN6B 1XPWA 4V2VA 5A3WA 2YC2A 5FZIA 4MUVA 3RG0A 5ABJA 2GC0A 3V0AA 4Z8BA 3VDDB 4CU6A 5K7PA 4MO3M 3Q8BA 5JIUA 2ZX1A 2J22A 3VZLA 1W8OA 1AL22 2X5IA 5FIXA 5FZ6A 2BPA2 3WUDA 2FDFA 3AFGA 4NPMA 1MEC3 1WCKA 3JXSA 4CUGA 4YFZA 2HWC1 4QU2A 3ZX7A 3FUQA 1H1IA 3ZYPA 4CU9A 4EN9B 2EAKA 1O3RA 2ZX4A 4WVZA 1SBDA 5GZGA 1WGPA 2GC2A 4YM0A 4BU2A 2W95A 4LHLA 5E16A 2TEPA 5LBBA 4KGGA 4XMAA 5J36A 2YU2A 4QM9A 1RUC1 3TOJA 2CL2A 1LGNA 2WNVB 3PUAA 1LAJA 1AVBA 2A6YA 1N3QA 3VBSA 3WEZA 5C4WC 1BLZA 1RL3A 2ZX3A 3AP5A 2KM2A 5DPNA 4AEDB 5FZDA 1I6XA 3UJQA 1DZTA 2ZGPA 4AI9A 4C0HA 4E9KA 4A42A 5JCTA 4YW5A 4KH9A 1UX6A 5KHGA 3DECA 3SKVA 1PM7A 1UY0A 1CAVA 1PGL2 1D7PM 3LA7A 1W6MA 1HB4A 3IWZA 4Y1UA 5EPAA 3V0AB 4AR2A 4JGYC 2IUWA 4JZRA 4JKMA 1AL23 4J6GA 5GJ6A 2ETEA 3S6PA 1DHKB 5EJ1B 1UQXA 3JUUA 5FYBA 3J8F2 1WA6X 4ASKA 3B7MA 5FMOS 2IXHA 1NXD1 1QJX2 2VQUA 2VQTA 4HN0A 4GQ7A 4JRLA 4AI3A 4A7ZA 1MVEA 1GMMA 2VBPA 1YFYA 3FX3A 2WR9A 3WDWA 4OQ9A 1W2NA 5DAVA 3FUOA 1BHGA 4M4PA 2E7TA 4ITCA 4WM7C 3DXTA 4Y26A 4OHWA 3VBSB 1TVGA 1A78A 2FDIA 1BBT1 2NZ9A 4AXOA 4XURA 4Z92B 2ZGSA 5FMCA 4P5HA 1QOTA 1S0GA 2LUWA 2RR12 4N7UA 4OMDA 4YW6A 2RMU1 5EHDA 3RMYA 1UL9A 1UOJA 4JVAA 3BYWA 1G9DA 5JDBA 3BUCA 2TUNA 4OUSA 2OIIA 4FOVA 3ZN4A 1CAVB 3U4SA 3OPWA 4LOTA 3D82A 1NCRB 1ZBA2 4QKBA 2OT7A 3ZXLA 2IVIB 4RHV1 3NJVA 2WZEA 3EHKA 2FCVA 1FATA 3E6CC 4NHXA 2ZAHA 3J8F3 1COV2 4IL7A 3NNMA 3NV4A 1PZ9A 3PVBB 5L7OA 2DVAA 1QJX3 4PLNA 2CWSA 3OGRA 3MDPA 4FOWA 4IV3B 4K9SA 1RUJ2 5T5PA 3CF6E 4P9LA 4WVVA 4B4RA 2B45X 2YU1A 3HJRA 3BIEA 1V0AA 3R4DB 4AI1A 3C7OA 4PQQA 5CFCB 5FKCA 3FJSA 3ZXAC 4LUMA 5DUUA 3O0WA 4K21A 3KV4A 4JDOA 4P9GA 5FLJA 4B3NA 4YZ5A 3GALA 5FQ0A 1WBFA 1WCUA 2RR13 4CCCA 1I1EA 1JYTA 3POBA 2IVJA 3P6BA 4AL9A 3ZPOA 1QJZA 1OOPB 5FZ8A 4AWDA 3SLIA 4NAOA 4XFFA 1RC6A 5F5AA 2AYHA 3M3CA 2XHNA 2D6MA 2VMCA 2W46A 3WP3A 3ZXDA 5A3PA 1COV3 3MV11 3VD4A 4IE7A 4IE4A 5BXXA 1O4TA 1BEV3 1F5FA 1RIRA 3I54A 3AP4A 2WL1A 1LKNA 3ZYIB 1W03A 5C3OA 1FPN2 2W39A 3NMBA 4C90A 4CP1A 3DKQA 3RYPA 5IVCA 2GZWA 1RUJ3 4AQ6A 4BXSV 1RUI2 3FE5A 1DF0A 1VE0A 2WQ8A 3LE0A 3QACA 3GBGA 4LULA 3E5XA 2O8OA 2UY9A 5E8AA 4U36A 3ZSEA 5L36A 5E89A 1VRBA 1NQJA 4AVCA 2W3JA 1Z7S2 4XC9A 2QQMA 4HPKA 3O1MA 1R1ZA 1EAH3 3POYA 5FQ0B 2Y60A 4N8MA 4V1PA 5HV4A 5A3TA 5GLUA 2PQSA 3VL8A 1GU3A 1H2LA 4Y5TA 5F32A 2JDZA 4Z07A 1G7YA 3FLRA 1OLRA 1TMF1 4XDOA 5DZFA 5EP9A 3B9IA 2XVLA 1RJ8A 4YZ1A 5LB6A 5FY5A 3ZM8A 4AF9A 5A6QA 1UD1A 1JUIA 4FPKA 2AEYA 2VJXA 3BTAA 1JI6A 1YI9A 4WM8B 4OHVA 4OI2A 1FPN3 4EWEA 2XJQA 3NNJA 1FI2A 2I45A 3ZIWA 4I0AA 2VCMA 3RJ2X 1YLLA 2WJSA 3ZFGC 1RUI3 3JB8A 4QQOA 5LCWL 2BVBA 2W08A 2ZEZA 3K4AA 1VR3A 4Q4Y1 4FPCA 2HWE2 3KVBA 3VD9A 5FBZA 3T2QA 1Z7S3 5F1RA 2DVBA 3QOPA 1X50A 3LA2A 2C9KA 3HEIA 4CP0A 2VR4A 2YDEA 1AJKA 1LEMA 1XNCA 3C3VA 4TWTA 3OSDA 3SKJE 4LBMA 5E88A 1WUVA 3WUCA 2NP0A 4PBPA 2NM1A 1NLQA 2Q8EA 3RYKA 1QOOA 3CBNA 2BGOA 3IAPA 2GU9A 5IK4A 3AKQA 5LBFA 5A1FA 2NN8A 3RS6A 2D93A 3IDBB 4HBNA 4L0PA 4D8MA 5BNOA 3LFMA 2J1VA 1RITA 4CCNA 1LOFC 2UYBA 4AK3A 3ZR5A 2CY6A 2PQQA 1MQTC 3USSA 4A3ZA 1YQ5A 5KC6A 1DQ1A 4UFKA 1W6QB 1E5SA 1RVF2 4P00B 4I02A 4LIUA 3GZUC 4RS5C 4XZPA 4Y4YA 5T3NA 4XUQA 3ZMNA 3VBRC 4XOGA 3U75A 3I8TA 1X9PA 2HWE3 1XSRA 1R091 4ZXKA 4A7YA 1V6OA 4DIQA 3URFA 2VTXA 4FFIA 3C2UA 2Y0IA 3R4SA 4MGIE 5LATA 4S2GA 1RXGA 2GP5A 3C8XA 5HXMA 1YRZA 4EV0A 4OHXA 4QT6A 3FC0A 4KG0A 3B01A 4UFMA 4I0BA 3MPBA 1Q8VA 1R1A1 2YZ4A 1REFA 3WZ1A 2PXJA 2PHWA 2UU8A 1H4GA 4XFGA 2WSVA 3CJIA 1AXYA 1N1TA 2WT2A 2WWJA 3PUQA 4XJUA 2PAEA 5I0DA 1ND3C 1WA4A 4K1YA 4WBBA 5GLZA 1WW7A 3CL1A 4NR1A 3BIWE 4Q4X1 5FP7A 2WFF2 1X8MA 4DEVA 3S5QA 3C7HA 3VN4A 1H2MA 1NT0A 5JOYA 1S0JA 3W5NA 3MLKA 1RUF1 3BOWA 4Q2FA 4UYBA 4YW7A 3OB8A 4NHMA 4BH9A 4DUXA 1XNTA 4KL1A 3ROUA 1W8HA 5L9BA 2WA4A 2IFRA 2K0GA 5JVVA 5IJRA 3UGHA 5K9YA 3U4XA 1RVF3 4E2QA 5A70A 1T6BX 2BBAA 4UWDA 2W94A 3RDIA 3LCPA 4UBHA 2V5YA 1ZZ6A 4ZZ8A 5LK7B 4YW2A 3POWA 1SLIA 1O91A 1POV3 2VG9A 4XBNA 2ZMNA 4LR4A 3E1F1 1O4YA 1S55A 3ZMOA 3KV5A 3NJYA 2DV9A 3N9OA 4Q5OA 1OH3A 3WY6A 1H0BA 3ZDVA 2GNTA 2AUYA 1A8MA 2QNKA 1DP0A 5FR3A 1YQ2A 2R061 1QJY1 5JMOA 1LODA 1O5UA 5DZEA 2GH8A 3ETQA 1E57A 4HFSA 1ZRFA 3CJIB 1D0GA 1HW5A 4IW3A 4LBOA 1X82A 2WFF3 3B5LB 1TZOA 5C3PA 4META 2EIGA 4LBQD 1ZREA 1VBD2 3ZSLA 2WC2A 1ZZCA 1JH5A 5FYVA 4QAWA 1E5RA 4IEXA 2VMEA 4CDWB 1PNGA 1CESA 1UCXA 1B35C 3JD71 5FRAA 1NG0A 1O3QA 1V9U1 2WZ8A 3LF7A 5FWEA 4K8RB 5DUWA 1XNKA 1ZVFA 2VCBA 2YYOA 2XKPA 2ZHMA 3AMPA 4Q4W1 4AEMA 4CDQA 3BTZA 4AAPA 1W9FA 4HL0A 1XE0A 5I0TA 4Y5Z0 1DQ5A 3H50A 5GLWA 4DY3A 2Q8DA 4N90A 5JSPA 4EN0A 2YB7A 4CDUC 2ZS6B 4MGTA 4BLIA 5EZWA 4XJ9A 4ASMB 5HCHA 2ZCWA 1OI6A 1H8TC 1J3QA 2J42A 3T09A 3DPRC 1PHMA 3L9JT 2WZPP 3MEPA 4B7KA 2IFWA 1POQA 3HNMA 3UNPA 2A70A 2PA7A 3ZIXA 1SQ4A 4B7EA 1MZ5A 3H3UA 3I4IA 3MF6A 1AR91 2ZGNA 1GOFA 5C9AC 5EYXA 1F4HA 3I2DA 1MZEA 2P17A 4GH4B 5FPZA 4JHZA 1LRHA 5A7NA 2XOMA 2ZPXA 1O8SA 1WW4A 1YYNA 1W8ZA 2DUOA 4GKYA 3I2JA 3K3NA 4INDA 4YVWA 2CTVA 2YMZA 4NMIA 3BPZA 1KFUL 1OPMA 4ZY9A 3S0MA 2AENA 3NNGA 1MS8A 3JBG2 3LPGA 2PHXA 1BBT3 1HJGA 5FTTC 1MS9A 2CAVA 5EQUA 1C8M1 1O6UA 2ERFA 1W99A 2OVUA 2XGXA 3AMHA 4W4ZA 3U10A 4OUMA 1Q3EA 2RS12 3I3DA 4XTPA 1QQP2 1PK6A 3EO6A 1FMD1 4HT1T 2P37A 4QX8A 4QPYA 2BV4A 4QM8A 3CZUA 5GLVA 1WMXA 1BMV2 4XF9A 4YSFA 5F37A 1NOVA 2C4XA 5C5UA 1DZRA 1LU1A 3VBFB 2AH2A 3LOIA 4LO5B 2C9AA 3KVAA 4R9DA 5GZFA 3SCFA 3W58A 4BMEA 4UFLA 2DTYA 3S57A 4PIXA 4D6SA 3A21A 4LLFA 3LKJA 3T30A 3CZJA 4C91A 3M70A 3R4UA 2PELA 4IEQA 1V00A 3FFZA 3BB6A 3IN9A 5F8PA 1QOSA 4WM8C 4YVWB 3T3YA 3WQ1A 4F7ZA 3OD0A 2D6LX 3AKSA 4UFJA 3JBG3 5M0TA 1AL21 2GMMA 2W0XA 4YVSA 3BTYA 4OVEA 2JDNA 3WDYA 2NMNA 2VU9A 1J3PA 3K51A 3THTA 2D3RA 3THDA 1A8DA 3T08A 2RS13 3ZKUA 1QQP3 1J58A 1SDDB 1S0EA 3DV8A 1O5LA 1OA2A 2I74A 2YPDA 4M0NA 5CFDA 1TE1B 1WCSA 2TBVA 5FXWA 4URAA 2XWBB 5F7UA 1Q8PA 3U11A 3T4VA 3OGJA 4CEYC 2ORZA 2VW0A 1PGSA 2Y34A 3H7JA 4L99A 1RUE2 3T1MA 1S2EA 3KLSA 3MIHA 5ANNA 3J4UH 3VBOA 1V6JA 4E2GA 4JGYA 3MV01 3ON7A 4Y4RA 4E8DA 3PTYA 2ARAA 4YG6A 1DLLA 4GULA 5IT6A 1PGL1 2O8QA 1CZTA 4QXKA 2FMYA 4W50A 4H14A 4OYUA 3M3EA 3A23A 2WWSA 1SFPA 1XE7A 2VTXJ 3U14A 1JN2P 4Q1RA 1KJRA 1OUXA 1UIKA 4I3PA 1DQ6A 1G86A 2AGSA 2H0BA 3J8F1 3N9MA 1UKRA 5HV0A 4WM7A 4NO4A 2KR2A 5JLVA 4BYYA 1QJX1 4O9GA 1WD3A 3GF6A 2FMDA 5C4WB 1TMF3 2HYKA 4G3YC 3UK9A 1YQCA 4Y24A 1W8NA 2LRPA 1AHSA 4I3GA 3KF5A 2A7AA 1NKGA 1XXNA 3HQRA 5T5JA 3DYMA 3VUOA 2DCJA 4LO7A 4B4PA 1YQ8A 2GNDA 2NPIA 1QWRA 1D2QA 4QHZA 4Y1ZA 2I2SA 3AP9A 4BISA 1RB8G 1T6GC 1UWWA 1LOBA 1R64A 2RR11 1PX4A 4JGYB 3SCGA 1HDKA 4FPGA 4RFRB 1AYN2 3HBKA 1XBFA 4MXWB 1AYM2 2HBUA 4V2WA 1OLMA 3WF2A 4COWA 2P3KA 2CGPA 4DB5A 2BOIA 1OH4A 1ZBA1 5FZGA 3I3QA 4E4DX 2YBKA 4UW3A 1YJKA 3ACLA 5FY0A 5J37A 3RZJA 5IVYA 1N3PA 3LD8A 4RQPC 2R32A 4KNCA 4OHZA 2QCSB 1COV1 1J83A 1OQ1A 2WZR2 3KGZA 4O9EA 3U37A 4WM7B 2ET1A 2FDHA 1ONAA 1O59A 1UZYA 3ZXFA 4FPYA 4CA9A 5HI0A 1XE8A 4B1LA 4RL7A 1RUJ1 3KCCA 2XKOA 4QHOA 3MUY1 3I2GA 1DG6A 1V6NA 3QBQA 4U2AA 5A1LA 5FV3A 1GYKA 2OPKA 2B8MA 1OT5A 3J7NA 3L2YA 2P6CA 2CGNA 3FL7A 4HK8A 2ZGMA 3ACGA 1L7QA 2WFPA 4Y1VA 3V0BA 3VKFC 5AFEA 1CAXA 3CIHA 4XXPA 1I5ZA 4RR3C 4AI8A 5FPVA 2JIJA 1AYN3 4CEWA 1AYM3 5KWRA 1JYVA 1NCQA 3BN6A 2VZSA 3HMYA 3K2OA 3TEYA 2WT1A 2DDUA 1GP4A 4AI0A 4ZS3A 1K5MC 3AKPA 1JZ2A 2HYXA 4IEUA 1UPSA 3MIDA 2AEZA 2A6WA 2WZR3 3T0DA 2EAAA 5C8CC 5LBEA 3HWJA 4OZOA 1FPN1 4LO6B 4XYXA 1VBC2 1SFYA 5ERLA 5TSWA 2GC3A 5LRRA 4NHKA 4QKFA 1JZ3A 3BU7A 1RUI1 2NLRA 2PFWA 5LA0A 1LNSA 4M00A 1ZRCA 4J25A 1N3OA 2E7AA 3CQOA 2AACA 1F35A 2UWBA 4QMAA 3P3PA 5FYZA 3ZFEA 3RJRA 1Z7S1 4UFHA 4BXFA 2VOTA 4XTMA 5DQ0A 1A34A 4GJZA 1W90A 2RS52 3NV1A 4XVHA 4I2OA 4OI1A 3GZEA 3MW2A 3PVEA 1OKQA 4OHYA 4D69A 4UF0A 2Q0AA 3OPZA 2BGCA 1US3A 3OPTA 1DQ2A 4PI2A 3T0AA 4C1XA 4KU7A 3VD3A 1H1AA 2IXIA 3TEWA 1IZ3A 5FY1A 5H9PA 4IEVA 3JZVA 3ZXEA 2JD4A 2PHTA 5D1IA 2SBAA 5DABA 4LQRA 1AL0G 3J26N 3QH6A 2Y6LA 1W6PB 2ZMLA 4DXSA 1NA1C 3CMGA 5CISA 3OEBA 4HZFA 4ZS2A 4B4QA 4GH4C 1GWLA 4D7YA 1UOGA 1ODMA 3IPVA 3ME2A 2RV9A 1F4AA 1K5JA 1VBC3 2VMGA 3PU8A 3H0OA 2YG0A 5EFUA 5C33A 1KRIA 3UGGA 2YUEA 1FV3A 3VD7A 5EIYB 3OYWA 1JU4A 3D6EA 1ZZBA 3IDAA 1BKZA 4EWDA 2PMWB 3K77A 1F31A 1ZYBA 2GN3A 2HWE1 2RJLA 2Y6JA 3ITQA 3N9LA 2EICA 4CYDA 3H8XA 1X9TA 2QTWB 4NVPA 1QJU2 3OUJA 3EJKA 3I3EA 2RS53 2IXJA 3I2FA 1LHOA 1A6CA 2YHJA 4OULA 1WLDA 2D6OX 4XF4A 1ULPA 3QD6A 4IEPA 3ZN6A 3MO4A 5JMCA 3Q8EA 4AEJA 4BIOA 1LOFA 2A71A 1MQTA 1ZRIA 3RVHA 2VQAA 1XSQA 1JTZX 2ZA9A 4XFBA 3U78A 2QQOA 3ZFGB 1VBE2 2VVEA 3PNAA 4I01A 1CWPA 3W9AA 2D5HA 2ADDA 5DDJ2 1IOAA 1EUUA 5FMOL 3HOBA 1LHNA 1LULA 2WKKA 3IPVB 4BQ4A 3MW3A 4O61A 2E51A 3SC7X 3IMNA 5BPXA 1RVF1 3PMSA 2B9VA 5CYYA 4KWLA 4BK5A 2LW8A 4Y1YA 3Q9OA 1O7FA 4NIAA 3IB3A 1N1YA 5IHRA 2WINB 1SLAA 2WNVA 3AZZA 2DBIA 1YIPA 3HT2A 4DOUA 1QJU3 5F5CA 2ORXA 3LIHA 4MGKE 4EROA 2R072 4XIOA 3OBTA 4QQHA 5FY9A 4AI2A 4DRRA 5A6XA 5JOXA 1FXZA 3ZDSA 5IK5A 3MBWA 2P3IA 1UYXA 1UKGA 4BJ0A 4QGNA 4DO0A 2R1DA 5KHHA 1GKBA 4BCUA 3KQ4B 1MQTB 4YW4A 4NRMA 5D2AA 2FDGA 2BNMA 3MIEA 5IAXA 1OF3A 1UY3A 2WFF1 4RS5B 4LXLA 5DDJ3 2JICA 3VBRB 5FOJB 1DQ0A 4CXYA 1H4HA 3ZYRA 2FCUA 3TYJA 1C8M3 4LNVA 3ZSKA 2EF6A 4HVQA 2IXCA 3I3BA 2VE1A 1FMD3 3RWKX 4YW3A 2R042 4D7TA 2A3WA 5C3RA 2JX9A 2A6VA 1JYWA 4AVTA 1XC6A 2J1SA 4BZ4A 2QDNA 1CZSA 4K1ZA 4XQWA 2XJUA 1GSLA 2EALA 5GLTA 1S0FA 2R073 3TB0A 3ZLIA 4CP9A 3RZLA 5G04L 1ND3B 2DCYA 3BODA 3H42B 3WF3A 3B94A 4ISRA 4RQPA 5FAXA 3HNYM 4NIGA 2J1EA 4E8CA 4GMP3 4NHYA 4ATEA 4Q1PA 4XDPA 2A3YA 2DUPA 4EJRA 5A32B 2WQZC 5L19A 3LEGA 4BHPA 1CN1A 5FP4A 5CAZA 1NCRA 1DIWA 1UF2C 1BXHA 3TEXA 1TME2 2JDUA 3SH4A 2JIGA 4IQPA 5FUNA 1Y4WA 1APNA 3NSTA 1VBD1 2VULA 4KBZA 2C26A 3KT1A 2R043 5FBJA 1JOPA 3KV9A 4IV3A 3KHCA 4EN6B 4F83A 1F15A 3GHNA 4AHWA 5CFCA 4M3CF 1Q5OA 4FPJA 1S2KA 3IIAA 1KQRA 3TN92 1VIWB 1VMJA 4CP9B 5A3UA 5BNNC 3WSOA 4M4RA 1RXFA 1H8TA 3DPRA 4IXLA 5FZOA 1VAKA 3AMMA 4X6QB 1EV12 1LGBA 2A73B 3A0NA 2QQLA 5CG8A 1OOPA 3EQEA 2QZ3A 4Y20A 1UOBA 5A3MA 4AVAA 3AB0A 2R6QA 3UKTA 3MZHA 1XJAA 2D7FA 3WDXA 5CADA 4BMBA 1TME3 1QNYA 4QB1A 4CSWA 3O1SA 3RI9A 1ENXA 4COVA 2DCZA 1O3TA 1ZZ8A 1B35B 1UN1A 3VDBA 2Y8KA 1AZDA 1K42A 2WS92 1VPHA 4F3JA 2BWCA 3LDRA 5F3GA 3NJXA 3LB9A 2XWJB 2Q8OA 1C5HA 1VBA2 1W6NA 1PZ8A 4XETA 2FHRA 2H6CA 4GB32 3POFA 3VKMA 4PDWC 4YM3A 4XHXA 4OZXA 2WBKA 4BK4A 3SXWA 2HWF2 4CDUB 3JBG1 3VZOA 4NWWA 1J1TA 3UKVA 1D0HA 4IE0A 2X05A 5K0UB 2AZ5A 3RI8A 4IEWA 1H8TB 2OXBA 4Q0QA 3DPRB 2XLAA 1VBB2 4G4FA 1EV13 5FZOB 3ZPYA 4BIFA 4FFFA 4ZU7A 1K45A 2RS11 1QQP1 5FLIA 4FO9A 1ZBE2 3ZYGA 5IVVA 3NVCA 4Y20B 4D6RA 2JDKA 1ZBA3 5KHKA 1BMV1 2EXHA 1VB4A 2BGPA 2PTMA 3V64A 1XYPA 1DGWA 5C9AB 2JWPA 1XU2A 1WMDA 4NIHA 1GQPA 4JV4A 1KS5A 1GZWB 2ZKNA 4R9BA 1LGCA 2WNUC 5E1RA 4WM8A 3ES1A 4Z2WA 1KFXL 3LGRA 1DYOA 4LLOA 2DFBA 2VUJA 3IDEA 3NV3A 3SHRA 1NXMA 1VBA3 1FYUA 3TBDA 4NAMA 1W6NB 2DTWA 3GCWA 2BNNA 1YCIA 2WAOA 4GB33 4EZ4A 2JG9C 2ZGOA 5C5TA 1H9WA 4XJ8A 5LBCA 2LM3A 2HWF3 1W3VA 1GR3A 2ATFA 2W47A 5DXDA 4YGDA 3ZN5A 1DGRN 3N9PA 1DGLA 4FXKB 2R1BA 4AVBA 1ALYA 2HWD2 4N53C 3POSA 3ZFFC 5B2GB 3KCXA 5FP9A 4QDRA 4XQ4A 4FOQA 4PLOA 3ST7A 4ZU4A 5FY7A 4SLIA 1ZBE3 4XF1A 3F95A 2VCCA 2CU5A 4URTA 4RSUA 3PTRB 1OF4A 1QY4A 1LESA 4L2NA 3ZR6A 5FZ7A 4FXGB 3WG1A 1PGW2 1QJFA 1OVPA 3RZKA 2MPFA 2XUEA 4S2DA 4PBOA 1KGYA 4XUPA 3VHPA 1RUE1 3N36A 5CNAA 3IMMA 1HRV2 3OEAA 2OS2A 3KCYA 5T55A 2VCAA 4QPGC 4M3CE 4HMZA 4AZZA 3IBMA 4R9CA 1MS1A 1W6QA 2VMFA 3HR9A 5FZ1A 2GN7A 2DU1A 3KZ4C 3RSJA 2GSYA 4HK9A 3ORJA 4X8PA 1SZBA 3E6BA 1GNZA 3LEMA 2BBVA 4D0QA 3PLQA 1H8VA 5FK7A 5FXVA 2Y26A 2HWD3 4FP2A 2ENRA 4R9AA 1MZFA 4E4ZA 2LROA 3B9CA 4XXAA 4MOAA 4CEYB 3VKNA 1J84A 1JZ8A 1CAWB 3PUHA 1V6LA 2E32A 2GNBA 1OLQA 3VD5A 3AXDA 3UGFA 1LTEA 4PI0A 4BE3A 1KEXA 1US2A 3CNAA 3S30A 5FUIA 4CP2A 4M01A 5FYYA 3WG2A 5IVJA 5ANQA 1W39A 1ZRRA 2XMLA 3WDTA 3AYEA 3PJQA 3UL2A 5JZGC 1HRV3 1L7LA 3N35A 2QJVA 2UYAA 1AF9A 5JXGA 4TZDA 1NY72 2CDOA 5ISLA 3KS7A 3IKWA 3KT4A 3DL3A 1W04A 1AYN1 2X10A 2WRAA 1IG0A 1AYM1 2Q1MA 2Y6FA 4XJZA 2ZGUA 5A7SA 3VDCA 4B29A 4BOWA 5JWPA 3IAQA 1UXZA 5KXCA 2YPJA 2Q5TA 1OD5A 5FPLA 4YFWA 3EBRA 2W91A 4OQ8A 4QPIC 1NZIA 2H0VA 2CSGA 3JQXA 1SFNA 4IUGA 4YLZA 4P02B 2WZR1 5DN2A 1IKQA 1GQHA 4XBLA 1W05A 2BW8A 4K3UA 2MEV2 1HV0A 1BK0A 4GWJA 5LA2A 1IPJA 4RD7A 3BCWA 4ZPIA 1R082 2ZAAA 1X33A 4RR3A 3M3OA 1AR62 1PZ7A 3RZZA 3THCA 5HXVA 4AFBA 3MFAA 4YARA 3D4KA 1QJEA 3O1TA 2VGDA 4DXZA 2E7QA 2KD7A 2VVFA 4MGQA 2EIDA 1PVC2 2P1BA 4GKXA 4CDWA 3X29B 4RQPB 5LY2A 3ATGA 4AOCA 1U5IA 4FAGA 1YC61 3FWEA 2VPVA
chains in the Genus database with same CATH topology
4Q26A 3VHOA 1X8EA 2EXIA 3O0VA 2K9ZA 1QU0A 2DURA 2FQPA 2XJVA 1SBEA 4QGMA 5JIAA 2JXAA 4FCAA 5GKAC 3JU9A 5H9SA 4HKOA 2OUJA 2D6PA 2XBO2 2D3PA 4FAHA 2MEV3 5I0UA 1VBC1 3P3NA 1G9FA 1QKQA 2GC1A 2X53S 1R083 3AX4A 5CU1A 3WCSA 5ABJC 1AR63 1MVQA 1POV0 3K48A 3WW1A 4RR3B 3WP5A 2OUHA 1IQAA 4AQSA 5JSOA 4M0HA 5AVAA 2VOKA 1V6IA 2X5IC 3GBFA 4KWJA 3WDUA 5JI7A 2VOVA 1ZX5A 2RS51 3M3IA 1VJ2A 4JAAA 2PN5A 1K5MB 1PVC3 4I30A 3LSEA 3M2MA 2DWRA 3WINE 3OD4A 2PHDA 1YFWA 4GH4A 4HLTA 4BLJA 1Y7BA 3WDVA 5C8CB 2XJTA 1REDA 2QZ2A 1RUOA 4XJAA 3SNMA 3PVOA 1HLCA 4Z1VA 3AJYA 2XBO3 4EN8B 5SV8A 2PLV2 2ZX0A 5F6LB 4H55A 2HWB2 3MPPG 5CBLA 1C3HA 2ZGKA 1U0AA 1HXS2 2C1FA 1FNZA 1U12A 2UY8A 5I93A 5K0UC 1HRI2 3KT7A 5IK7A 1AJOA 1Z0HA 5EJ3A 1QJU1 1VBD3 3VBFA 1C28A 3H8UA 1GQGA 3HAGA 2VMHA 2D44A 3WNXA 1NA1B 1JYIA 2DCTA 1FT9A 1AR72 1MS4A 2OZJA 1J59A 3MYXA 5BY5A 4AVVA 3WQ7A 1S0CA 2RM22 3KSCA 4YYOA 1ZRDA 3FBMA 1VBE1 4FQZA 1C57A 5FREA 1IKPA 3MW4A 5DDJ1 5AC92 5JOWA 4LO4B 2Z79A 3WW3A 1SLCA 1LOEA 2D6NA 5J98B 2HWB3 1BZWA 4D94A 1YO8A 1EP0A 1ZNPA 3WCRA 4JGZB 1ZZ7A 1CIWA 5FO7B 1EPZA 1WW5A 1WLTA 3HIFA 4C1XA 3AZXA 3M3QA 2R071 1GANA 4XFCA 1KXGA 3MI8A 5HCBA 3WG4A 4CRQA 1LB2A 1JOJA 5H9QA 4GMP1 3HBZA 4Q0PA 1G9CA 5KBFA 1G6NA 1AR73 3R05A 1YFXA 4FBFA 1OFNA 4LHKA 1WBLA 2RM23 4Y22B 1PO12 3ZYJB 2XL7A 3WG3A 4COYA 5AC93 3UV9A 4LA2A 3TAYA 2AREA 4KBBA 1DYKA 3O5SA 3KQRA 4MV2A 5C4WA 3WP4A 1AXZA 1CAUA 2R041 1FNYA 3WVJA 2HJIA 1SDWA 1WD4A 1LHWA 4Q0VA 4RFT0 1D4M2 1SLLA 2Q4SA 5D8AC 5AFBA 1LEDA 2JKBA 1XYNA 2B7YA 1ULFA 1CX4A 3WHUA 2Y38A 1URXA 5FCCA 5KHJA 4DINB 4MXWA 5JSRA 4PF5A 1CPMA 5I0SA 3H7YA 2B46X 4Q27A 4AFDA 5AVPA 1GZ9A 1TME1 4TSVA 3L2HA 4MX3A 1PO13 3H1YA 2XJRA 5A3LA 5KXEA 2ZJCA 2VOXA 3RWNA 3VZNA 4ATFA 2G9GA 3AYCA 5FO8B 1OMIA 2XJPA 1CAUB 1YUDA 1GV9A 3NKGA 4G9SB 1OQDA 5ACA2 1AR82 5T54A 4XW3A 2D97A 3N4MA 4XIKA 3MIFA 5IK8A 1RUE3 1Q56A 1ENRA 3TN91 1CGPA 4WV8A 1SEFA 2FBEA 2WSUA 1EV11 4HSLA 4BA6A 2LTNA 4DRVA 2F6BA 4FPHA 5LEKA 5KXDA 5GALA 1JUHA 3USUA 1H2NA 1KDMA 4YGCA 1UU6A 1YHFA 2DU0A 3AP6A 4MVTA 4UW6A 5FFOC 1G9AA 2R30A 3T2TA 2BTVC 2WLPA 4XHBA 4PDWA 3ALQA 3ZSJA 3H9AA 2WS91 4ES9A 2ZGQA 3AXEA 5EV7A 5BNNB 1VBA1 1RUG2 2OW4A 4GB31 5ACA3 1AR83 1X36A 2X29A 1U5XA 3ENRA 1Z78A 2HWF1 2RS32 5BNOC 3S7IA 1CR7A 4AHYA 1VRH2 4H7LA 1AX0A 1MS5A 2E63A 4TYSA 1VBB1 5FO9B 5CVRA 5GZDA 1ZBE1 4LE3A 4XJWA 3D0SA 2Z5WA 2GNMA 4LT5A 3USUB 2PAKA 3AMQA 5DUXA 3MIBA 1RTVA 5IUQA 2VNGA 1W6PA 2DVDA 4KG8A 4PDWB 2JG9A 2ES3A 2RE9A 1C1LA 3GYDA 4W6XA 2BQPA 3VZMA 3ZXJA 1MACA 3AP7A 4N53A 3ZFFA 3D0JA 3LSDA 3FHIB 2PHUA 4GWNA 5BNPC 2RS33 2B5HA 3MICA 4GALA 1YNAA 3PHMA 1VRH3 1SLBA 2HWD1 4AW7A 1CVNA 4K20A 4UW5A 3FMGA 4K8FA 4XBQA 4YG3A 1OQEA 2BYVE 3FLTA 4A7KA 1IS5A 1B09A 1N1VA 2WNUB 4C0BA 2KA3A 1DZQA 4QPGA 2ZKLA 1CD3G 1H2KA 4FQ4A 2HKXA 2JEMA 2G4IA 4AVSA 4DMIA 1FAYA 1KDKA 1PGW1 2NMOA 3G7DA 2W68A 3ZFGA 4E27A 2IXKA 3PVNA 1Q8OA 1HRV1 1RUH2 4R4ZA 2ILMA 1HX6A 1Y3TA 2JG9B 3NO8A 1QNWA 1DYPA 4AQ2A 1BCXA 3WXPA 4NN0A 2IZWA 4N53B 3ZFFB 2EA7A 1WMEA 2CWMA 4ASLA 1GFF2 2MNGA 2H6BA 1MS3A 2DFCA 1XNBA 3SMHA 4N43C 1UMZA 2PHLA 4JGZC 3WD5A 4N9IA 1CPNA 2WT0A 1S0IA 3OCPA 4MYEA 2ARXA 3EXUA 1RJ7A 4QPGB 4CDQC 4BPZA 1RUD2 1SLTA 2WA3A 1YWKA 3IT8A 3O0XA 3MIGA 3VHRA 3VZJA 4RS5A 2PYTA 3VBRA 1UAIA 4AG4A 5JPNB 1J3RA 1IGOA 4QPIA 1NY71 3VLBB 3HN1A 4C1WA 4FOYA 3WP6A 3I59A 3HT1A 3RPQA 4IERA 4OLLA 3VHNA 4JC1A 5FDBA 1CJDA 1WLCA 2CYFA 1Q8SA 2ZACA 1ZA4A 1QH6A 2DCKA 2VW2A 1ND3A 3TRSB 3VBHC 3GBWA 5I8TA 4OFGA 5JZGB 2MEV1 4LO8A 1PO22 4XF0A 5A32A 5HCFA 1R081 1MEC2 1AR61 4QX5A 4RGAA 1RUD3 3DN7A 4Q4V2 1VBE3 2QE3A 2JG8C 3A0KA 1QF3A 1LCLA 3WLUA 1G9BA 4J1WA 3IDCB 3WW4A 1QXJA 2TNFA 4XE9A 2IWGB 2F4PA 4SBVA 4QPIB 3GNEA 1PVC1 3LZZA 3J9SA 4IV1C 2C5DA 1PK6C 4HANA 2I07B 3I59B 1OPOA 4FSJA 3LWCA 1U5YA 5KHIA 3AMNA 2JECA 3AKTA 4LHNA 3M7AA 4HETA 4AHXA 4DY5A 1NLSA 3RYRA 2XBO1 4KQ7A 2Z2SB 1PO23 3ELNA 1MR5A 1ZZ9A 1LHUA 3VBUC 1BQPA 2XVGA 2QUOA 3R0RA 4LBQB 4P14A 1EY2A 2GMEA 5EYYA 4Q4V3 2XLGA 5T5LA 1B35A 4MXVA 4YVSC 1C4RA 4GMP0 4YM2A 2C0ZA 4L97A 4S2FA 1LJ7A 1DFQA 2A75A 1LOCA 3N3HA 5CFDC 2BFUL 1N47A 4PCRA 5F5QA 1AXKA 3AK0A 2R49A 1W0OA 3NAPC 3AYAA 2IXLA 5KXBA 1H1MA 3H1WA 4NHLA 4PIYA 4CDUA 1OSGA 3VBOC 3W59A 5ABJB 4BQ1A 1RMU2 5K0UA 2PLV1 1HQLA 1C8NA 2QDRA 2X5IB 5T50A 4JDNA 2BVVA 2CV6A 3VL9A 2HWB1 2B42B 3VKOA 2FZ2A 1HXS1 1S2BA 1FOD2 1HRI1 5DUVA 4E2SA 5C9AA 3B02A 4HKWA 1GZWA 1M4WA 4AGVA 1GZCA 1SMVA 4CDXC 4WZFA 5EWSA 1BJQA 1UU4A 3TNPB 1O3SA 1HQNA 2BWAA 5BUVA 5CG9A 1AR71 4QGLA 1PIV2 2RM21 1JHNA 2D6KA 1EPWA 3AZYA 2D5FA 1XQNA 4FTSA 2ZZQA 1W6MB 2VXRA 3U0ZA 3TN93 1YI7A 1RMU3 5AC91 2GMPA 2AR6A 1UW8A 1LHVA 4YG0A 3VKLA 4FPFA 2JENA 3OJBA 1ENQA 3SH5A 1MZ6A 3AZVA 3WHTA 3ILNA 1FOD3 1XU1A 4COUA 1BEV2 5HCAA 2RJKA 2ZZJA 3DKWA 4Q8KA 4IESA 4MGYE 1RHI2 1N1SA 3MLJA 1H9PA 4AEKA 5J7MA 1BK1A 1ND2C 2WS93 3FZ3A 5F6KA 1VB2A 3KMHA 2VNOA 1EAH2 3CEWA 3JQWA 1KJLA 3M4FA 2YGLA 2XJSA 1VALA 1PIV3 1IS6A 2BFUS 2YGMA 2ZTNA 1PO11 3SITA 2BEOA 4GA9A 4D3WA 4CEYA 4CEWC 5D8AA 1VBB3 1CAWA 1Y9QA 1NCQC 1TQ5A 2XPJA 5L7OB 4FPLA 5FPXA 2HEVF 1RHI3 1Y43B 3WT3A 4PLMA 3B3QE 1D4M1 4W6WA 5JAXA 3QCWA 1RGSA 2QFEA 4P9WA 5F9TA 3APBA 4KWKA 2ZGLA 1IS3A 3IM0A 4YW1A 2XHKA 3ECQA 2Q1ZB 4MGZE 4FPEA 4E4SA 2YROA 3KM5A 2WQ4A 3WOGA 3DGTA 3GZTB 2LALA 3ZFEC 2DF7A 2XG3A 3ZSMA 4KU8A 3CLPA 1G8WA 5D8AB 1WCDJ 2XVKA 1A3KA 4AE2A 4AGGA 1KS4A 2K2SA 4PIZA 4UW4A 2XH6A 5GZEA 5ACA1 1AR81 1GNHA 3LA3A 3MLLA 2GALA 2VMIA 5J48A 4GIQA 4DPNA 1YFUA 3WW2A 2O0OA 1QHDA 1BVVA 1ASJ2 4HPKB 4A3XA 2UWCA 1BYHA 3TWIA 1W6OA 5HBAA 1NYWA 4L92A 1O4ZA 4LBKA 1GBGA 2EVXA 5H9RA 4QHBA 2BNOA 1YJLA 5BYNA 1D4VB 4AFMA 3ZXKA 2PHRA 1JW6A 5JPMB 2D3SA 1LU2A 2JJ6A 4MSVA 1RUG1 2OYZA 3E6DA 3WQ0A 5SV5A 4ZU5A 1IHMA 3U07A 3VDDC 2XB6C 3NKTA 2RS31 2A6ZA 4MLOA 1TEIA 2IC1A 2W52A 3OGGA 1VRH1 3ILFA 1UU5A 2N7GA 1ASJ3 1K5MA 1IS4A 2R0FA 2NYYA 5I8YA 5J3UA 5BV6A 5DZGA 3SH3A 4LUKA 1PVXA 4FPOB 4YGBA 1W6OB 1Q8QA 5C8CA 1W2UA 2WNVC 4PJYA 3ZVXA 4FT8A 3FLPA 1WW6A 2ET7A 2QKDA 1YXWA 4K40A 4WVMA 1FV2A 4AEDC 1IPKA 1ULGA 3AKRA 5CB7A 1FX5A 2Z42A 5JOZA 5BNPA 1OHFA 1DGRA 1TNFA 5BNOB 1CQ9A 2HWC2 4IEZA 1J1LA 1QXRA 3ASIA 2DYCA 4J1XA 3BALA 2HEWF 4L11A 5LEJA 4K7JA 1DGWX 1RUC2 4QQLA 4R52A 5JR7B 4DQAA 2XL9A 1NA1A 1VAMA 3PJYA 3VZKA 1LECA 2GAUA 3VBSC 3HD8B 2EXJA 3ZO0B 4DZGA 3NV2A 2V73A 1XRUA 1RUH1 4WVMB 2OZ6A 1YIFA 4XPVA 3M1HA 4HSJA 5BNPB 4JCKA 1JXNA 1W0PA 1DQ4A 1AUYA 2WLQA 1VAVA 2HWC3 1NCRC 3N7MA 3I7DA 4N43A 4JGZA 2ZHLA 1QDCA 3THPA 2CAUA 1F9KA 3NL1A 4M3CA 1RUC3 5DG2A 3D8CA 4TLFA 4N9HA 5J96B 1QMJA 1GICA 1BBT2 2JE7A 3CU7A 4AQTA 4IV3C 4KGQA 5CIRA 2E6VA 4DNYA 2RMU2 2VNRA 1SCSA 1RUD1 4Y22A 5CFCC 4Q0UA 4P9XA 1PNFA 3G6JB 3ES4A 1RUNA 1I9RA 2QVSB 2YXSA 3WR0A 1RINA 2DVGA 3E5UA 5T5OA 4AFCA 4UBGA 4H3WA 2ZGTA 2PLV3 4RHV2 3RMXA 3BOPA 3JCIA 3ZXGA 4B8EA 1OOPC 1HXS3 1U5ZA 3AM2A 3VBHA 3RQ0A 2MHFA 1HRI3 4N43B 1HKDA 2GH2A 4YRDA 4M3CB 4YZ3A 4CDQB 2XUMA 5L7OC 3VGIA 4LBNA 2JG8A 3KB5A 4XILA 4JQRA 1PO21 2Y0OA 2A6XA 4JTOA 2YC0A 1LENA 4Y1XA 5I91A 1MEC1 5L73A 2RMU3 1I3HA 5FLHA 4IV1A 3ILRA 4Q0SA 5GZCA 2VECA 4Q4V1 2P2KA 4OI4A 1UIJA 1X7NA 4LE4A 4PQ9A 1NQDA 3MF9A 4P9JA 1HQWA 1XYOA 4RHV3 3WV6A 1ZM1A 1V6MA 2D43A 3VBHB 1DBNA 5I0RA 3OBRA 5A33A 3CJXA 4D7SA 2JE9A 1VLNA 4HN1A 5T52A 3AYDA 3H1MA 1TNRA 3VBUA 1F2NA 4NWVA 2UURA 3NW4A 3DF0A 4IETA 4IEYA 2E53A 4R4XA 4K6BA 2VOWA 3UKNA 3B00A 2JG8B 4XFHA 1DDLA 2A3XA 4XF3A 2R16A 1GLHA 2P34A 4IV1B 1NE4A 1PK6B 1TMF2 3B69A 1MS0A 2WNEA 3T1LA 4EWAA 3H3ZA 4ONUA 3NAPA 1NE6A 2GDFA 4LTAA 1H30A 3N7LA 1Q43A 2VH9A 3NWKA 1HV1A 4NPRA 1C1FA 2B39A 5BNNA 3N7JA 2ZGRA 2D40A 3OY8A 4BWOA 2ZOEB 4LBLA 5A33B 3O12A 1D4M3 4HVRA 3VBUB 2CNAA 1UPIA 4Q4Y2 1ENSA 1KD7A 1RMU1 5JI9A 4XQDA 1D2SA 4XEZA 3N7KA 4YVSB 2Q30A 5LRSA 4XFAA 4CDXA 1NZCA 1FOD1 3R6SA 3KD4A 2G9FA 2VQ0A 1AX1A 1ULDA 3LAGA 1CJPA 2PHFA 4F8AA 5CFDB