1QF3A

Peanut lectin complexed with methyl-beta-galactose
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
232
structure length
232
Chain Sequence
AETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYDPADGIIFFIAPEDTQIPAGSIGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTSTLITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the complexes of peanut lectin with methyl-beta-galactose and N-acetyllactosamine and a comparative study of carbohydrate binding in Gal/GalNAc-specific legume lectins.
pubmed doi rcsb
molecule tags Sugar binding protein
molecule keywords PROTEIN (PEANUT LECTIN)
total genus 56
structure length 232
sequence length 232
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qf3A00
1LU1A 2Q5TA 3R4UA 5DUVA 1LOEA 1VAVA 4WV8A 1LGBA 2EIGA 2PHFA 2D3PA 5E89A 3ZVXA 2VY0A 3R05A 1GSLA 2ZHMA 4NOTA 4XHBA 3T1LA 2XB6C 1S1AA 1MS4A 2A71A 2Z42A 4FPHA 4XOGA 4PQ9A 5T52A 3AYDA 1F31A 3M1HA 2CTVA 2PHXA 4R9DA 4K1YA 4D69A 1UPSA 4W65A 1V6JA 3NV4A 4R9BA 3USUA 3N36A 1ZM1A 2I2SA 2A7AA 1W6QB 3N7JA 1MR5A 1HQLA 3ASIA 3ZXJA 4XDQA 2DUQA 1MZ6A 1C1LA 3V0BB 4FPLA 5T50A 1W0PA 1MZ5A 4U2AA 1N47A 1O4ZA 1VAMA 1WBLA 2VXRA 4FOYA 1S0JA 5IUQA 1WLCA 4ITCA 3O12A 4XZPA 4YZ4A 3B69A 1A8DA 2ZA9A 4M3CE 1IOAA 1FYUA 1ZA4A 4YLZA 3USUB 2JDZA 2DUPA 4M3CF 4DFSA 1KDMA 1SACA 1JOJA 3LCPA 2VW2A 2A6YA 4FOVA 1YYNA 4GXLA 2HYKA 3SH3A 4DPNA 1FV3A 1WW7A 3O0XA 2NZ9A 1I3HA 4K20A 4LBQD 4FPFA 3N7KA 2ZKNA 3OJBA 4XXAA 3B00A 3FFZA 4YGDA 5GJ6A 1RINA 4FQ4A 2ZGPA 4LBNA 4YG0A 4BM8A 2UURA 4WVVA 4PBOA 4XIKA 1LU2A 1MS5A 3AP4A 1SCSA 2DTWA 5T5JA 4YG6A 1Q8PA 3WZ1A 1C57A 1LODA 4FP2A 1LEMA 1QKQA 1DGLA 1SCRA 4JRAA 4YW3A 4C1WA 3AFKA 3IN9A 1PZ7A 3ATGA 3M3EA 2WNEA 4GKYA 4RA0A 5DZGA 2GN7A 5IT6A 2ZHLA 1YI7A 3QLQA 2JJ6A 2NMNA 2UU8A 1LCLA 2WJSA 3V65A 1IKQA 2W39A 1LENA 1SLTA 4XTPA 1S0EA 1BXHA 1UZYA 1W6QA 3DGTA 5JOZA 5GLTA 1W6PA 1G9DA 1LJ7A 1OFSA 1QOSA 1MS1A 5DZFA 3DUIA 2DU1A 2BQPA 1V00A 4ASMB 2YXSA 5HCAA 5DUUA 2GMEA 4AVSA 2D43A 3POYA 4FPOB 4XBQA 1HQWA 2VUAA 3CNAA 1N3QA 2JE9A 3B9CA 4P9XA 3AJZA 2EALA 3ILNA 3KQRA 2W68A 3M3QA 4FPEA 3TB0A 3WDYA 1S0DA 2WSUA 4YM3A 3T2TA 2P3IA 1AJOA 4Y1UA 2OW4A 4AGVA 3U4XA 2UWCA 1ULDA 2R0FA 1AXYA 2JECA 4ZXKA 2D6KA 2DWRA 4NO4A 5H9RA 5T55A 1AX2A 1RITA 2VW0A 1UMZA 4Q1PA 4YM1A 2A6ZA 1GBGA 1WLWA 4M3CA 1N1YA 4Y1VA 3RMYA 3WG1A 5GLZA 1WLDA 5F9TA 1MS8A 1V6LA 1PZ8A 3W59A 3RS6A 1W6NA 5DXDA 4PF5A 1Q8VA 1SBDA 4TZDA 2EXKA 4M00A 4MYEA 3NV3A 1G9CA 3OPZA 2CL2A 1BJQA 1NXD1 2ZGUA 4C1XA 4P9WA 1D0HA 1ULFA 4Q8LA 1IKPA 1CESA 1LOAA 3ENRA 4LBOA 4UW5A 5AVAA 1S0FA 1FATA 1WW5A 3O0WA 2YY1A 5DG2A 2G4IA 4XBLA 1A3KA 4BMBA 2GDFA 2A6WA 3BIWE 5KXBA 3OY8A 2R49A 1WD4A 4R9CA 2UWBA 4BOWA 4PBPA 3W58A 4AGGA 3RQ0A 2DUOA 2KM2A 3C2UA 3A0KA 2R0HA 1W6OA 4XYXA 3Q9OA 1D2SA 1JXNA 4LBMA 4P9YA 4DQAA 2C9AA 3WCRA 3V0AA 1J1TA 2GMMA 3MW2A 5EYXA 2ZGLA 2DVBA 3IM0A 1S0BA 2A3YA 3T1MA 4Y1ZA 3BODA 4YZ2A 3NV1A 1VALA 2ZGTA 1LECA 2ZGQA 3AZYA 4UW4A 4BPZA 4FOQA 1N1SA 3GNEA 1KJLA 3LSEA 4FP3A 1AX1A 2GALA 3AP5A 2EXHA 1WW4A 4XJUA 1S0IA 1CONA 3WUCA 1V6OA 3WG2A 2CWMA 3WVJA 3SH4A 1QU0A 1KQRA 5CA6A 2WSVA 2EF6A 1DZQA 2SLIA 2YV8A 1IS5A 1LOBA 5BYNA 1JYIA 1N1TA 1Y7BA 4YZ1A 3VKFC 1AF9A 3ZSJA 3ZYPA 1G86A 1V6KA 1YIFA 3HR9A 4GALA 1AZDA 3ZPYA 1DQ5A 1FNYA 1WBFA 1H9PA 3I4IA 3WHUA 4BLJA 1LHOA 4YM0A 2E6VA 1G9FA 2YZ4A 3APBA 4GWMA 2YMZA 4AGRA 4XJZA 1W6OB 2AYHA 1WUVA 1JUIA 2JE7A 4FPGA 1F5FA 3FLPA 1KRIA 1ONAA 1SLBA 2DVGA 2DVDA 1AVBA 2ZAAA 4XILA 1YO8A 2ZZJA 2B7YA 3OY8B 4OZXA 1GZ9A 4M01A 2D6MA 5GZDA 3OYWA 2D6PA 1GV9A 4FPCA 1G8WA 2LALA 5DUWA 4Q8KA 2A70A 3R4SA 4K21A 1APNA 2H0BA 2OUJA 3ZXLA 4Y1YA 1CPNA 4YFWA 1ULEA 2GN3A 4XTMA 3B3QE 3UK9A 4YG3A 1VIWB 4JC1A 5DZEA 1FV2A 2V5YA 2UWAA 4XJ8A 5GZCA 1N3OA 1C1FA 2AENA 3MEPA 3VKMA 2D44A 1QDCA 4LBQB 1A78A 1HLCA 1CIWA 2ENRA 5JLVA 4YZ5A 3O0VA 1MS0A 2DURA 2CWSA 4ISQA 4WZFA 1RIRA 4Z8BA 1GANA 2SBAA 2PHWA 3B01A 3N7LA 5T5PA 1KITA 2A3WA 2DTYA 4Y22B 1DQ0A 1SLCA 3HMYA 3LSDA 1GZWB 2P3JA 3WG4A 4FOWA 2NN8A 4FPYA 4SLIA 3WG3A 1DQ1A 5E88A 4FQZA 3N3HA 3ZSLA 2E7QA 1FX5A 5EYYA 2ZGKA 1YXWA 5KXEA 2RHPA 3AZVA 1TEIA 4GWNA 5F5QA 3UJQA 4YGEA 3SITA 1IS3A 1DQ6A 3AP6A 5CAZA 5JDBA 4FPJA 1SFYA 1H30A 5JOYA 2ZHKA 5CBLA 3M2MA 2TEPA 4Q27A 1AX0A 3AZWA 1S0CA 1BKZA 3A0NA 3NWKA 3WNXA 4YGCA 4RL7A 3FUQA 1SLIA 1W0OA 2DVFA 3O5SA 3V0BA 1MS3A 4XMAA 1DIWA 3FBYA 2WT1A 1OKQA 1LESA 5GALA 2CYFA 3WOGA 4Q26A 2CNAA 3V0AB 1Z0HA 4Y1XA 5IK7A 2YROA 3N7MA 2ZGRA 4LBLA 2A6XA 2WKKA 1DYKA 5GLVA 4YGBA 1HDKA 1KJRA 3D4KA 3PJQA 5GLWA 5GM0A 3BTAA 3ZXKA 2CY6A 1CQ9A 4GA9A 1OQ1A 4AVVA 1UKGA 2EXJA 3FUOA 3AYAA 2GNTA 3WLUA 1GZWA 4XHXA 4YW5A 4YW4A 3A4UA 4AVTA 4CZSA 2GNMA 4Y22A 2ARXA 5T5OA 3JU9A 5FREA 5KXCA 1URXA 3JUUA 2P34A 5DG1A 1GLHA 5CB7A 3ZXFA 1LOFC 1CN1A 1SBEA 3I8TA 2LTNA 1QF3A 5JVVA 2D3RA 1MACA 4Y20B 4P14A 5KXDA 3ILRA 2EAKA 1GICA 3MW4A 2C5DA 4WVWA 1W6MB 2R16A 2E51A 3VKNA 4K1ZA 1AXZA 2AREA 3VKOA 3V64A 1GNZA 3UJOA 2E7TA 1LHWA 1SLAA 4BLIA 1DQ4A 1KDKA 2ZABA 5JOXA 1QNYA 3OGGA 2D6LX 4Y24A 2D3SA 1IS4A 1EPWA 1LGNA 2ERFA 4ATEA 4Y26A 1Z78A 2AUYA 1LOCA 2AR6A 4ISRA 2XG3A 3RRDA 4XJAA 1V6MA 3POWA 1S0GA 5HCBA 1O4YA 4DRRA 4M3CB 1DQ2A 3GALA 3IMNA 3PMEA 1PZ9A 4Q1RA 1G7YA 5H9SA 3IPVA 1CVNA 3AK0A 2ES3A 5SV8A 2ZMLA 1ULCA 3AXEA 3MPPG 2A3XA 4XE9A 5GZEA 1UN1A 4LBJA 1W6PB 1LGCA 2DYCA 3IKWA 1N1VA 2OVUA 1UX6A 1CJPA 3TAYA 1LOGA 1WD3A 2DVAA 3HN1A 1SLLA 2JD4A 1I1EA 4Y20A 3UL2A 1QMJA 2ZACA 1V6IA 2V73A 4YM2A 1Q8OA 3SISA 1QNWA 1DLLA 2WLQA 3AYCA 3M3OA 1LEDA 1DBNA 1UAIA 1G9BA 1UL9A 4HANA 3PVNA 2E53A 2DV9A 1JBCA 3OYWB 1W6MA 2NM1A 1AXKA 2FMDA 5GZFA 3SLIA 3ZYRA 3D5OA 4CRQA 2P37A 1LTEA 1FAYA 5IK5A 4H55A 4R9AA 2D6OX 2EXIA 2ZGSA 2ZGMA 5EWSA 1AJKA 3WDXA 2ZGOA 2NP0A 4AWDA 3RMXA 4BQ1A 3WHTA 3ILFA 5HCFA 4UW3A 1LHUA 3PVEA 1GYKA 4IQPA 1GNHA 1JW6A 2ZMNA 5JOWA 1Q8QA 3AZZA 4DRVA 1F9KA 4I30A 4Q2FA 2ZBJA 2DU0A 4XIOA 2OUHA 2A75A 3KM5A 1JYCA 2PHUA 2ARBA 1NLSA 1UZZA 3AP7A 3ZSKA 1GKBA 1CPMA 2VW1A 4FPKA 5T5LA 3FLRA 3L2YA 1WW6A 1LHVA 1LULA 2W08A 4AYUA 4XXPA 1SBFA 3H0OA 1B09A 1MS9A 1YRZA 3WUDA 4YZ3A 1GZCA 3WCSA 3VUOA 5GZGA 4F83A 4UW6A 1DYPA 3AYEA 4TYSA 4L8QA 5CNAA 1MVEA 3AJYA 2VU9A 5GLUA 4KBBA 2WT2A 5FRAA 4CTEA 1JN2P 4XJ9A 4XJWA 2ZMKA 2PELA 2ZHNA 4HL0A 4ZKTB 5H9PA 1QGLA 1W6NB 3OBRA 3MW3A 3WDWA 2A5ZA 1QOTA 3WDVA 4FVVA 2NMOA 3WV6A 1ENQA 2PHRA 3M3CA 3AP9A 5IK4A 2GMPA 3IPVB 4GKXA 2GNDA 2ZGNA 3WDTA 2D7FA 4U36A 3FLTA 3AZXA 2GNBA 5IK8A 3NV2A 2R1DA 1LHNA 1X50A 2R1BA 1DFQA 1R1ZA 3N35A 4DS0A 5JMCA 3SNMA 3VV1A 1ENSA 2WT0A 4YW1A 1XQNA 3INAA 4YW2A 3BOPA 1Q8SA 2FHRA 3D6EA 5T54A 1BQPA 1V6NA 3RG0A 1ULGA 3POSA 2D6NA 1LOFA 1C4RA 2VH9A 2NYYA 4YFZA 5H9QA 3AXDA 3SH5A 1MVQA 3ZSMA 1HKDA 2A6VA 2WQZC 3PVOA 2JKBA 1N3PA 4LBQA 1QOOA 4PCRA 1BYHA 5EXOA 5L73A 1JHNA 1WCSA 1G9AA 3QCWA 2W52A 4XBNA 3AX4A 1IS6A 3OBTA 1Q56A 1U0AA 2P3KA 2AH2A 1FNZA 2AGSA 4JCKA 1ENRA 4ATFA 3ZXEA 4LBKA 1VLNA 1H9WA 1QDOA 2PHTA 4BMEA 3WDUA 2P2KA 1DHKB 4XMIA 5E8AA 3RSJA 5LK5A 3VKLA 5DUXA 1CR7A 1BZWA
chains in the Genus database with same CATH superfamily
2Q5TA 5BUVA 4WV8A 1R091 2D3PA 2J1RA 4P08A 4E4ZA 3R05A 3OGSA 3T1LA 1OQEA 1S1AA 3NL1A 3OBZA 5JZGC 1PVC3 4XOGA 1ZBA1 1VBA3 3DCQA 4Q4V2 5T52A 4E2SA 4OI0A 2XHKA 5CEHA 4NPLA 2JG8A 5LWBA 3GZUC 4D69A 4EN0A 3KV5A 4LA2A 3NV4A 3T08A 1ZM1A 2I2SA 3WT3A 2A7AA 4CU9A 4D8MA 3ZKUA 4JQRA 1MR5A 3I2IA 4HKWA 2XQRA 1B35C 4XDQA 4CCEA 3V0BB 1VBB1 3H8UA 1W0PA 1MZ5A 1GNYA 2OZ6A 4KWLA 4U2AA 4AI3A 1VAMA 2VUJA 1RUH3 4WVZA 4MZUA 1K3IA 2GC2A 5DAPA 1A8DA 1X8MA 1IOAA 1E5RA 1FYUA 5A7NA 3USUB 1CAXB 1OD5A 1PX3A 1EPZA 1U5YA 2O8QA 5CFDC 3ZN5A 3VZKA 2A6YA 1UOGA 4FOVA 2RJLA 1YYNA 4UWDA 4KU8A 5CFCB 4LKFA 4L11A 4LBQD 2NZ9A 1JYNA 4FPFA 3C8XA 3HNBM 2ZKNA 4Q4V3 1XNDA 2GC0A 4LLFA 1PGW1 4NR1A 1T6BX 4FQ4A 5GJ6A 4WVVA 3NSTA 5DPNA 4B8EA 1SCSA 2KXLA 4IGPA 4QX7A 1CAXA 4YG6A 5FZOB 3CEWA 3WZ1A 1LODA 1QKQA 2UY9A 1BBT1 3MYXA 4PLNA 1W8HA 2WNEA 3GM8A 3PU3A 3EMRA 2VMEA 3K4AA 1YCIA 2Q1ZB 2GC3A 3BN6A 3QLQA 2JJ6A 4PHZA 4UAPA 2WJSA 2UU8A 1LCLA 2R042 2WFF2 5F6LB 3ZXDA 1IKQA 3THTA 1W9YA 3PMSA 1OOPA 1LRHA 2VQUA 2BFUS 3D8CA 3DGTA 4V2WA 4AHWA 4X8PA 5GLTA 1D2QA 4NAMA 2RG4A 2XGXA 5L7OC 2VOKA 2WO7A 1RUI3 3DUIA 1CZVA 1XYNA 2BQPA 2E9QA 1W2TA 2Y26A 4JHZA 5FY1A 3ORJA 1HXS2 4GIQA 3SCHA 4A7ZA 4CCKA 2D43A 4FPOB 5I8TA 2CV6A 1GOGA 2VUAA 2HWB1 2YU2A 1SDDB 4P9XA 3VDBA 1POQA 2XVKA 3AJZA 2WC2A 5C7GA 4IEXA 4QQPA 5FYVA 1S4CA 1HXS1 3TB0A 1PO21 1S0DA 1AL21 2P3IA 1AJOA 3ROUA 2VNGA 5FYBA 4ZXKA 1J3PA 1GP4A 2D6KA 2DWRA 3O1PA 5CG8A 3SXWA 5J96B 1NZCA 1RITA 3AC0A 5IJRA 2A6ZA 1GBGA 3CZJA 4M3CA 5AVPA 1MQTC 1HN1A 4HOOA 1Z7S2 1M06G 4OQ9A 4CP9B 3ZX7A 3GHNA 1Q8VA 1SBDA 2W1WA 3EQEA 5CKQA 2EXKA 3B02A 1X8EA 4M00A 3PJYA 3I2HA 2VZQA 4AEDA 4B4QA 3C3VA 4RS5C 2CL2A 1G9CA 3VBSB 4META 5CYYA 1MZEA 3C7GA 2FDGA 5A32B 1PO11 4P9WA 1ULFA 3M3IA 2HWE3 1ND2B 1ULOA 4CEYC 4WM8A 1WZXA 1NE6A 1S0FA 4MXVA 3O0WA 3WD5A 2LM3A 2RMU3 2G4IA 4XBLA 2YPDA 1FOD1 3BIWE 3GXUA 3WF3A 3QBQA 4FI9A 4JAAA 5ISLA 4AOCA 2R49A 4XFAA 2WN2A 2WZ8A 2HYXA 4PBPA 3W58A 4AGGA 2Q0AA 2KM2A 3C2UA 1D0GA 2CU5A 2VG9A 3A0KA 5HV4A 2VAUA 3WX5A 2VCAA 2EA7A 4O7XA 4QHBA 3NJZA 2IXHA 4XQ4A 1HN0A 4CDQC 2B9UA 4NROA 5C5TA 4JGZC 3AKQA 3U37A 1JXNA 2CDOA 3MIEA 3V0AA 3WCRA 3CQOA 4YPJA 4COVA 3CO2A 3MW2A 2JICA 3O1TA 2W9XA 2WS92 2VTXA 1JS9A 1K42A 3UGFA 1W2OA 3NV1A 5LBFA 2ZGTA 4LNVA 4JHTA 5LEJA 1PIV2 4L2NA 1TME1 2Y0OA 4HN0A 1RUD1 1C8M2 4FOQA 4BPZA 3IT8A 2RMU1 1HJFA 2UY8A 4FP3A 3K51A 1AUYA 3FFQA 4IEQA 2YGMA 4AHYA 3AKPA 2K0GA 5F1RA 1S0IA 4LT5A 1CONA 3WUCA 1RUJ3 2EIEA 2RMU2 5LRSA 1ZRIA 3SH4A 1E5IA 2ZPXA 2WBKA 2H6BA 1GWLA 1X7NA 2WL1A 3PUQA 1IS5A 1LOBA 2P17A 4CDUA 4Q29A 2VVEA 3T0AA 5F2WA 1I5PA 4X6QB 3ZSJA 3PVBB 3WNOA 1SPPB 4RQPC 3ZPYA 2QKDA 4GWIA 3ZYPA 4CDWB 1DQ5A 4EYUA 1ALYA 1H2NA 1PVXA 3BPZA 2E6VA 1AR82 4G3YC 3APBA 4D6RA 4AGRA 3E5QA 4RR3A 3HWJA 2AYHA 2GP3A 1JUIA 1YFWA 2DCZA 1KRIA 4NIIA 2DVGA 1AVBA 1TQ5A 3J7LA 2JG8C 4GH4B 2B7YA 4OZXA 1GZ9A 3J8F3 1YQ6A 1RUJ1 4C91A 4EQVA 1GQHA 5F3IA 5FO9B 3B93A 4QDQA 1R082 2J1TA 2W87A 4A6OA 1JZ7A 4YSFA 2D6PA 5C9AC 1AYN1 3BI3A 4QGMA 4KU7A 3WF2A 1G8WA 2A70A 1VBD3 2H0BA 2B42B 2OUJA 3ZXLA 4Y1YA 4YFWA 1DGWX 5FMOS 5IVVA 4NWWA 5DZEA 2V4VA 5KHIA 2XDVA 1QXJA 1MEC1 4J25A 2ZJCA 4J1WA 4W50A 2Y6JA 1BEV2 4QGNA 3VBUA 5GZCA 2ID4A 3MEPA 1NCQB 3VKMA 1HJGA 1CIWA 2ENRA 1FOD3 1F35A 1AR71 2DURA 1VB2A 2W47A 5DABA 2YC2A 4WZFA 3G6JB 3VD4A 4UI9L 2WQ4A 3N7LA 3H3ZA 3I3MA 5EJZB 4E9KA 1RVF3 4N8MA 5C4WA 1CWPA 3VBOA 2R062 3S0MA 1HB4A 1W06A 3HMYA 3E6CC 4FFIA 2NN8A 4FPYA 4XDOA 3CIHA 5LW9A 5E88A 2Z4FA 1NQJA 5EYYA 5KXEA 1OA4A 1A34A 3AZVA 3ALQA 4RFT0 1HW5A 2BZDA 4EZ4A 4QPIC 4LPLA 5L7OB 5JDBA 1SFYA 2HWC2 1H30A 2CHHA 1SMVA 5FLHA 5FWJA 4Q27A 1BKZA 2VNVA 3PUAA 4SBVA 1OURA 5ERLA 4YGCA 4RL7A 3FUQA 3MFAA 1YEWA 1W3VA 2PQSA 1H0BA 4AL9A 4PLMA 1LESA 3MIGA 4IERA 3TBDA 4DUWA 5C3PA 5FOBB 1E57A 2HEWF 3MV01 4KWKA 5L7OA 1AR61 1H8TB 2XBO2 5FJKA 5IK7A 1HIXA 4S2HA 3RZKA 1QJZA 4E2GA 3WSOA 3PJQA 3WP3A 5ABJB 2HH9A 1T6GC 1VB4A 3HOBA 4AVVA 2ZEWA 2GNTA 3DV8A 4EN6B 4AVTA 1C5HA 3POFA 3JU9A 3BUCA 1QJU3 1URXA 5TSWA 3JUUA 3OSDA 4HKOA 2V72A 3WW2A 3ZXFA 3LF7A 3ZYHA 1RUF2 2WA3A 3KV6A 4KG8A 5JI9A 5JR7B 4XW3A 1SBEA 1UU6A 3K77A 1JZ4A 2LTNA 1QF3A 3LDRA 4ZU7A 2D3RA 3PIGA 3H7YA 4MV2A 2EAKA 1KEXA 2RV9A 5FO7B 1ZA7A 1W2AX 2XWJB 4Y4RA 1ASJ3 1YNAA 4XUOA 4LHNA 4Q4V1 1NKGA 4K1ZA 1AXZA 4MHUA 4GJZA 1WCUA 5A6ZA 2YGLA 1NQDA 1W0NA 1GOHA 3UESA 3JQWA 1LHWA 4AFAA 4MXWB 1F2NA 4HVQA 2XKOA 1ND3B 4OHVA 2B9VA 2YC4A 4XF3A 1QNYA 5JOXA 2D3SA 1LGNA 4BJ0A 3VBHA 3D82A 2XLAA 5LRRA 2XLGA 5IWFA 5JSRA 4M0HA 4DRRA 4LITA 3ZR6A 1DQ2A 4CEWC 4E8DA 4EWEA 1XE0A 1PZ9A 3U0ZA 4QKNA 5CVRA 5FY7A 4A3XA 1V9U3 3HQXA 1SZBA 1ULCA 1QQP3 1UN1A 4XURA 2DYCA 2JIGA 4GMP0 2OVUA 1UX6A 1CJPA 5I0TA 4LUMA 3TAYA 2VVFA 4IV3B 2Z2SB 3RJ2X 1ZNPA 4IE6A 4BQ5A 5EIYB 4QM9A 1FMD1 2VOTA 3UL2A 3ECQA 3VHRA 1RUC2 1WA6X 1Y9MA 2BWCA 2RJ2A 3OUHA 1BEV1 1MZFA 2BGPA 5JIUA 1QQP2 4K3UA 4CCLA 5A3LA 3DXTA 3JXSA 4FCAA 1UX7A 5FP3A 4MGKE 2VZVA 1U5XA 1UAIA 2WABA 2JG9C 1BBT2 1UL9A 2FCUA 2NPIA 2GZWA 2E53A 4HANA 3FL7A 5IVFA 4ORFA 3LOBA 4C8DA 1AXKA 2BW8A 2VMCA 4G4FA 2HKXA 4CPBD 1J83A 1FAYA 3A22A 3GCWA 4H55A 1X33A 4YW7A 4FO9A 2EXIA 1COV3 2ZGSA 1VBE1 5FZCA 1NA1A 5FXWA 4KGQA 3WDXA 3DL3A 2NP0A 4AWDA 4OMCA 1LR5A 2E7AA 3AB0A 1ZZ9A 3ZN4A 4R52A 1WMEA 4F3JA 5JXJA 5A7PA 3PVEA 1GYKA 3P5BA 2HWB2 4IQPA 4AK3A 2E33A 2VNRA 2QZ2A 1Q8QA 5IAVA 3WINE 3X29B 1F9KA 2ADDA 1AL0G 3VBRA 1O59A 3VBRC 2RE9A 5FMBA 3H42B 4EE2A 3KM5A 3NAPB 5FY5A 3ZSKA 4UOJA 3LB9A 3WW1A 4BQ4A 5IVBA 2VW1A 1PM4A 1O8PA 3L2YA 1WW6A 1H8TA 5A3MA 4AYUA 4G9SB 1SBFA 3JZVA 4WM8B 4CA9A 5BNQA 1MS9A 1RHI2 3WUDA 5BNPB 2BNOA 2BOIA 1CX4A 1VJ2A 3NAPA 3AYEA 1UU5A 1MVEA 2PXJA 2TUNA 2XH6A 2XUEA 3DPRC 4O61A 4KBBA 5FRAA 4CTEA 3VBRB 3D0JA 3I2JA 4WM7A 5EZWA 1RUG2 2VZRA 2ZHNA 3RZMA 1PO23 1ZBA2 2K9ZA 2ZTNA 4P9IA 3AKRA 3ACLA 3WV6A 4CCJA 4E4DX 1TVGA 2Y6HA 2PHRA 5HI0A 3E1F1 4GKXA 2DCYA 2GNDA 3KCYA 1JODA 4JDOA 3H1MA 4MHRA 2ARCA 4ZY9A 2FZ2A 4H14A 2PLV2 5IFTA 2R043 3T0DA 1DP0A 5CIRA 5FYHA 4CPBA 4DS0A 5LBCA 1PHMA 1R1ZA 3UT0A 1A8MA 1YUDA 3IWZA 5FO8B 3INAA 5A3UA 3D6EA 5I0DA 2X29A 1ZZ8A 2JG9B 1RUE3 5IVJA 4LE3A 3POSA 1JHJA 3C7FA 2VPVA 3FMGA 4YFZA 1J58A 3U4SA 1MVQA 1HKDA 3HPNA 4PCRA 2JKBA 3ZPOA 5EXOA 1QOOA 5L73A 3HT1A 1EAH3 5I0UA 3EB7A 4LKEA 3VBUB 3POEA 3E5UA 4Q4Y3 4QQOA 4XBNA 3AX4A 3TWIA 3I2DA 2AH2A 1ZBA3 2R7EB 1ENRA 2CGNA 3GBWA 4JDNA 4OFGA 5E8AA 3WDUA 1ODNA 1YFXA 2AEYA 3KD4A 5K7PA 5LK5A 5FPLA 4D7YA 3ZIXA 1Q5OA 1CR7A 1EAH2 2W46A 5C3RA 1IG0A 3DKQA 3MGUA 3VZNA 2FD8A 3RZHA 5C8CC 3AMPA 2QCSB 1H2LA 5SV5A 2DFBA 5E89A 5G04L 3ZVXA 2VY0A 4QHOA 4NOTA 3QACA 1JUHA 4XHBA 2MEV3 4XUQA 5FY8A 3VBHB 1JZ8A 1XC6A 1RMU2 3AYDA 1ND3A 1PMIA 3K3NA 1AL22 1F31A 2CTVA 4R9DA 4IGQA 4MGYE 1GZTA 3EBRA 4IDZA 1XXNA 1UPSA 3NJYA 3HNYM 1JMUB 1W8FA 4W65A 3OGRA 3USUA 2ILMA 2DF7A 4CDWA 1NY72 2X09A 4YVWA 2O0OA 5FZIA 5L9VA 1HQLA 1RVF1 1PK6C 3ASIA 1ENXA 1ND2C 4CCDA 1MZ6A 2JDPA 2CDPA 1H6YA 3ETPA 4AFBA 4LUKA 1WBLA 1KFUL 1NYWA 1H1AA 1O4ZA 3K48A 3U14A 5JUVA 1WLCA 3R6SA 5A7QA 2WZEA 3ACFA 3MIHA 4ZU5A 5LEKA 4QPGC 4FBFA 2VTXJ 2ET1A 3JQXA 2LUWA 1UIJA 4CEYA 1KDMA 3LCPA 1JOJA 4UF0B 4Z1VA 3VLBB 4EV0A 3OEBA 4GXLA 2HYKA 2JDMA 1FV3A 3O0XA 1I3HA 2H0VA 2X5IA 2XJQA 3M70A 4UFMA 1IQDC 2O8OA 4XXAA 1W04A 1HRV3 5CADA 2WNOA 2ZGPA 4BM8A 2VCBA 1S55A 3RJRA 3IDAA 1H8TC 4HLTA 1AR91 3MLJA 5B4XA 5AFBA 3KB5A 4NRMA 1C57A 5LA0A 1LEMA 4YW3A 4C1WA 3IN9A 1PZ7A 5EQUA 3ZFGB 5M0TA 1HRV2 3N9NA 2Z69A 2BEOA 5LY2A 4XF4A 1XNAA 1PO13 1SFNA 3LQCA 4CDXB 1FOD2 3HBKA 2XOMA 5FYIA 1UXXX 1UZVA 5JOZA 1BXHA 1UZYA 1W6QA 1RUE2 1UY3A 3PL0A 5K0UC 3JCIA 1W6PA 1G9DA 1T2XA 1IZ3A 1FI2A 2L9LA 4BQ3A 4KQ7A 5DZFA 4FXKB 4PIXA 2Y64A 4ASMB 3BTZA 4RSUA 3WF4A 5HCAA 5DUUA 1H1IA 3VHOA 3BKZA 3CNAA 2PLV3 2OX0A 2JE9A 2OQ6A 4KI5M 1RUH2 2AC1A 2G9FA 1XSRA 4MG2A 2W68A 2IUWA 4Y5TA 1SDWA 1D7PM 1PIV1 3ZR5A 4UT5A 4Y1UA 4UXAA 2OW4A 4FT8A 4AGVA 2UWCA 3SCFA 4AQ2A 1AXYA 3SEEA 4O9EA 1ZZ7A 5D2AA 5H9RA 1PM7A 5T55A 4Q4Y1 3T09A 3VZLA 1AX2A 3THCA 1AR62 5DN2A 1UMZA 4Q1PA 3MBWA 4YM1A 4Y1VA 1TME3 4RHV2 4HKLA 4UBHA 1MS8A 1PZ8A 1K5JA 1HB2A 3W59A 5LB6A 3RS6A 5J48A 4R4ZA 4PQQA 4Z82A 5DXDA 2RS33 2BERA 3CZUA 3WEZA 5C8WA 4TZDA 4NRPA 4DXZA 1XNCA 4QKDA 2WYSA 4S2GA 4CDXA 4D6QA 4K7JA 4OHWA 2LROA 5JIAA 4QKBA 3LPFA 1OI6A 1IG3A 3TN91 5A6QA 1D0HA 4RHV3 5FPUA 3UNPA 1RJ8A 4UW5A 1REFA 3ENRA 1PIV3 1DZRA 2JDKA 4PI0A 1FMD2 1GWKA 1AYM1 3FJSA 2VUDA 3UGHA 4H2AA 3W5NA 2KD7A 3UYJA 2GDFA 1WCDJ 2WNVC 1FT9A 1K12A 2RS13 3CJIB 4R9CA 4QQ2A 2X5IB 1W03A 4B7EA 2PFWA 3U07A 2R0HA 4JGYA 1WMXA 2XJSA 1D2SA 4WVMA 2VUCA 4P9YA 2JENA 4W6YA 1J1TA 2GMMA 3AM2A 2F4LA 2WWSA 4HZFA 4QU1A 3VBFC 2ZGLA 2DVBA 3IM0A 4ZXEA 4CEWA 2A3YA 3T1MA 4Y1ZA 1OA3A 1RC6A 1R1A2 1Y9QA 2A73B 5C5UA 1LECA 3L9JT 5FTTC 1RHI3 3MLKA 4Q4X2 1N1SA 4NRQA 3LSEA 1AX1A 2GALA 3AP5A 4YWAA 1QIQA 2ZEZA 2ZEYA 4LMFA 4XJUA 4H7LA 1HRV1 3EJKA 2BOJA 3ZXAC 1JZ2A 1JOBA 5F8PA 3RGBA 3WVJA 2I07B 5CA6A 1I5ZA 2GSYA 2WSVA 5A6XA 3OGJA 3WQ1A 4QU2A 1BK1A 3OCPA 5BYNA 3Q8CA 3OPTA 5FZ7A 1Y7BA 4RGAA 5FY0A 4CU6A 3T4HB 1AR73 4JTOA 5A7WB 3ZXGA 1G86A 1YIFA 3CLPA 4GALA 2HEVF 1AZDA 3LFIA 3SCGA 3UGGA 4AG4A 1H9PA 3I4IA 5EV7A 1W8ZA 4AHXA 1DF0A 1LHOA 4AVBA 2G9ZA 5J3UA 4Y33A 1G9FA 4YYOA 5A33B 5FV3A 2BV4A 4WM8C 5FYYA 1RUG1 1XE8A 2BDRA 4PDWA 4FPGA 1W8UA 4ZONA 5FK8A 4RS5A 4JX0A 3FE5A 4O65A 2ZZQA 1VPHA 2WZPP 4OUEA 5CU1A 3J8F1 4XETA 4E4SA 1CZSA 3MZHA 5DDJ2 1TMF1 4L0PA 2D6MA 3C7EA 3OYWA 1RUNA 1VBE2 4Y5SA 4AFDA 2PLV1 1GV9A 2JKXA 2LALA 2Z5WA 2JEMA 2Y6FA 3RZGA 5JZGB 2W1SA 5FPVA 1APNA 1TMF2 1CPNA 5A32A 4DMIA 1YI9A 2GN3A 1K5MC 3B3QE 1RUF1 3UK9A 4YG3A 1VIWB 4UFJA 5E16A 4E2QA 4K6BA 4MGSA 4Q4W2 2BNMA 5F3EA 1UO9A 1HB3A 2Y60A 3PHMA 2OKXA 4B1MA 1QY4A 1X82A 4OUMA 2AENA 2B8MA 4PDWC 3GGLA 1OVPA 1QDCA 3KV9A 1JYTA 1HLCA 2XXZA 2RS11 5FXXA 3O0VA 5LZ6A 3MHZA 4ARXA 4ISQA 4ARYA 2SBAA 2AEZA 2VNOA 5F32A 4D94A 5T5PA 1UIKA 1KITA 1VP6A 5BXXA 1W2NA 1OUSA 2JDNA 3I97A 4MADA 4MVTA 2DTYA 3SKVA 1DQ0A 2VZUA 5C8CA 5C6CA 1SLCA 3LSDA 3R0RA 1GZWB 1VBD2 1RYYA 4FOWA 4AW7A 2XBO3 4SLIA 4IEOA 4Q4X3 4LXLA 1UY1A 3DEMA 4FQZA 2VQAA 3ZSLA 2E7QA 1FX5A 3ZDVA 3ZOIA 2ZGKA 1YXWA 2FCVA 5BV6A 4PDWB 4BQYA 4GWNA 3UJQA 5BNPA 1QH7A 5A33A 4DEQA 3PU8A 3I2FA 4NPMA 5D1IA 2ZS6B 1R083 3MIDA 3VBFB 2FCTA 5KHJA 3NWKA 3IDCB 3WNXA 1IHMA 1CGPA 4CVUA 1W0OA 2HEYF 4CUCA 2YFZA 3BPSA 3ZFFA 4TLFA 4EJRA 5HBAA 5B4NA 3V56A 4BH9A 1HRI3 1NE4A 4LHLA 4OYUA 4Q26A 4X6RB 4V2VA 1Z0HA 3LFMA 2WR9A 1QQP1 1QJX1 1YJLA 1ZZBA 2A6XA 2WKKA 2WNVB 2ZGRA 2ZOEB 3D4KA 5GLWA 2OA2A 1RUJ2 3H50A 2VZPA 2Q8CA 4A45A 3J26N 1CQ9A 5IFPA 1UKGA 4XFFA 2RS32 3AYAA 4IEVA 1TZOA 4LOTA 3WLUA 4YW4A 5CFCC 5HPOA 3OF1A 4R8HA 3HEIA 1K5MB 1YC61 2PHDA 2VJXA 4ZZ5A 1QJFA 4AQSA 2QJVA 1VBB3 2BVBA 4GQ7A 3MV11 1OSGA 4JGYB 4BQ2A 2ADEA 1CN1A 4A7YA 1ZVFA 1CJDA 4LLOA 2IXLA 2WDBA 3CHXA 3GZTB 4NMIA 4FTBA 1UD1A 3GZEA 4ES8A 1BMV1 5L9RA 2BPA2 2PHLA 3MW4A 2E31A 1C3HA 1NCRA 1QJX3 4GH4C 1YQ2A 2E51A 3BVCA 1R1A1 5FJHA 3HBZA 4IV1B 2ET7A 4Q0PA 1YWKA 4KMQA 1GNZA 2HWD1 3G7DA 4Q0UA 2BP6A 2PN5A 2J1EA 2UYAA 2B45X 3OUJA 2R061 3OGGA 1IS4A 4GB31 1ZYBA 4IEUA 2XR4A 3NMBA 2AUYA 1LOCA 4IETA 2W2IA 2WS91 1POV3 4QXBA 3OBAA 3RI8A 4DXSA 5ANNA 1BBT3 1UOFA 1V6MA 5FR3A 3WP5A 3THDA 1US3A 5FP7A 3GALA 4BIOA 5K0UB 1OVSA 2F4PA 3ACIA 2QQVA 3VD9A 3H9AA 3IPVA 3AK0A 2WAOA 4IV3C 2ZMLA 4XE9A 1W90A 5GZEA 2A3XA 4AHZA 5A70A 5C33A 1Q3EA 1VBC1 1LGCA 3IKWA 3AMMA 1LOGA 1WD3A 5A1FA 2VBDA 1GMMA 3HN1A 1O3QA 2QQLA 1COV1 2HWB3 4D6SA 4Z92B 1JTZX 2IXCA 2V73A 2J1SA 3ZYIB 4YM2A 5IYYA 2CGOA 4OLLA 2WA4A 1QNWA 3SISA 5J09A 4NIGA 4FSJA 3AYCA 3M3OA 1LEDA 5F6KA 3VD5A 5C3QA 1JZ3A 3AMHA 1NLQA 2OPKA 2ZXQA 1UYYA 3POJA 3LEIA 4YNIA 2X5IC 4IE0A 2FZ1A 1TNFA 3ZYRA 5FWEA 3IZOA 3D5OA 4W4ZA 4WBBA 1LTEA 1PGSA 5A1AA 3J7MA 3VN4A 3ZFGA 2D6OX 4AR2A 2QVSB 2VQTA 5FPAA 5FZDA 1POV0 3RMXA 4LEJA 4BQ1A 3ILFA 1XPWA 4QB2A 1AL23 4XFCA 1QJY2 1LB2A 4KWJA 1GNHA 4YVSB 2ZMNA 4OZOA 1EAH1 3EXUA 3E5XA 3LE0A 2X05A 3WW4A 3ACGA 2HWE1 1X9TA 4I30A 2ZBJA 4HG6B 2OUHA 1S2EA 2IFWA 1DU3D 4HPKA 5FFOC 4C90A 5HXMA 3ST7A 2PHUA 4XF9A 2ARBA 3OD0A 4UF0A 2EVXA 2YBPA 1VBB2 3OGVA 1ZZ6A 4MSVA 1FPN1 1TG7A 1LULA 1REDA 3NNJA 4P5YA 2FQPA 1YRZA 3ZIWA 4QHZA 1GZCA 1EP0A 2R041 3N9MA 4UW6A 1DYPA 5FZ8A 4D3WA 2Y6GA 4ZHNA 1JN2P 1OFNA 5IVCA 3MF6A 1AR63 3AFGA 4HL0A 3H7JA 4NHMA 4XFIA 5H9PA 3EHKA 2VZ1A 4HETA 2C9KA 2ETEA 1DLCA 3VZJA 2P6CA 1ZRDA 1I6XA 1IPJA 1VMFA 1SQ4A 2OS2A 3LWCA 1HV1A 3M3CA 3AP9A 1HV0A 2WIIB 3IPVB 2ZGNA 4U36A 3I49A 4JZRA 3M4FA 1W8NA 5AC92 3LA2A 2GH8A 3Q8BA 4LO5B 3RWNA 4UBGA 1UMIA 2GNBA 2R30A 1X36A 3NV2A 1UY2A 2R1BA 3N35A 2XQXA 2R073 4EROA 1D4M1 3SKJE 4YW1A 4OULA 1PO12 2F17A 4YW2A 4GB33 2QQWA 3ZFGC 1PVC2 5T54A 1L7QA 1V6NA 3RG0A 3SC7X 3KSCA 4OMDA 3WNKA 1C4RA 2B46X 5H9QA 2W1QA 3VZMA 4BQWA 2PAMA 1EUUA 1J3QA 1N3PA 1AR92 2QDRA 3HNMA 3PVOA 1JHNA 2P1BA 5FKBA 1S2KA 3ELNA 2VR4A 3RWKX 3WR0A 3QCWA 5IAXA 2W52A 5JXGA 1G9AA 1IS6A 1Q56A 1NZIA 1FNZA 4QXHA 1RUD3 5FZ0A 3P1IA 5G05L 3NW4A 4LBKA 1H9WA 4RGKA 4BMEA 5F5AA 3AVRA 3WXPA 1JYVA 4JGYC 1W8TA 1D4M3 4QPGB 4TSVA 3VKLA 4F8AA 1BZWA 4LULA 1LU1A 4HVOA 4Y5Z0 4AXOA 4DOUA 3U1XA 5DUVA 4XQDA 1LOEA 3CDZB 2EIGA 2PHFA 3DPRA 3VL8A 3QD6A 1W9FA 1U5ZA 1RUD2 5IATA 1GSLA 2ZHMA 4JGZB 3O1RA 4BWOA 2D97A 1MS4A 3E97A 4FPHA 3JB8A 2HWC1 4PQ9A 2TBVA 4XAEA 4AQ6A 3N9QA 3M1HA 4D7SA 2PHXA 5CKNA 3IDBB 4K1YA 2B39A 1V6JA 3ZM8A 5FMCA 4GD4A 1ULPA 2XVGA 4NIHA 4LIVA 4QKFA 5I93A 4JKKA 2JDHA 3J8F2 5I91A 3J9SA 3ZXJA 5C3OA 4CCCA 1C1LA 3MUZ1 3W21A 1JH5A 2ZEXA 3FHIB 1XBFA 2VXRA 3CKHA 4YZ4A 4ITCA 4XZPA 4HT1T 2X8KA 2ZA9A 3DN7A 3O1VA 1KS5A 3ZSEA 4CCMA 3CBNA 3EO6A 2DUPA 4PLOA 5F7UA 2ZX4A 1W8OA 1M4WA 4TTGA 1SACA 2VW2A 1KGYA 5HV0A 4KH9A 2VMFA 3SH3A 4DPNA 2WO3A 1WW7A 1G6NA 1PNFA 1IPKA 4OI2A 3N7KA 3BGAA 3OJBA 5FZKA 3B00A 4CDXC 3GF6A 1GU3A 3FFZA 1UW8A 1RINA 5FLIA 2UURA 5A1LA 4XIKA 1LU2A 1MS5A 3N4MA 2QQNA 3NQHA 3H8XA 2WFF1 4M4PA 1DGLA 2FMYA 2W3JA 4BB3A 4ES9A 1FPN2 4ET7A 3ATGA 5A3OA 5LA1A 1QJU2 3M3EA 4GKYA 5DZGA 1V9U2 1B35A 2VBBA 2GN7A 1XOYA 4P00B 4BK4A 2ZHLA 3OG2A 3F2ZA 3SMHA 2Y33A 4DINB 1HRI2 2NMNA 4DUXA 4XUTA 1UPIA 4XTPA 5FZLA 3K4DA 1DGWA 5F37A 2XJRA 2YG0A 1OF3A 1OFSA 1W39A 1E5SA 1Y43B 4FFHA 4LHSA 5EHDA 4GWJA 5CFDB 2JDYA 2RR13 1MS1A 5JAXA 1JYWA 5J1XA 5KBFA 1KD7A 5BNNB 3T4VA 2YXSA 3PDQA 5FKCA 2OZJA 5ACA1 1AYN3 4EN8B 3POYA 4XBQA 5JZGA 2WN3A 4L97A 2RDRA 4YVSC 4IESA 3B9CA 2EALA 2GU9A 2Q30A 3KQRA 3M8LA 1JU3A 2DDUA 4DB5A 2J22A 3DPRB 5K4LA 3WDYA 5ACA2 3I3EA 2WO2A 5FYZA 5HCHA 4A42A 2Y34A 3U4XA 4IV1C 3TN93 2R0FA 2D98A 4RS5B 1EYBA 4QPGA 4A3ZA 2Q1FA 1RUG3 1W9TA 1D4VB 2VW0A 1GUIA 1RB8G 2BU9A 3WG1A 1RHI1 3A7QA 3KQ4B 4LQRA 1OH4A 3RMYA 4AI0A 1WLDA 5F9TA 3LEGA 1VE0A 3JD71 1W6NA 1OF4A 4PF5A 3IIAA 3NNLA 4XC9A 1OH3A 3VZOA 4BXSV 4YARA 4NIDA 1RTVA 1UOBA 3MICA 2WS93 4A7KA 5I0RA 3J7HA 5LK7B 4GMP1 4NHYA 3ES1A 2G19A 3OPZA 4I3PA 4AZZA 1BJQA 2QQOA 4AE2A 2ZGUA 2R32A 4C1XA 4A44A 2HJIA 2OT7A 4MXWA 2IXJA 4Q8LA 1CESA 2DBNA 1LOAA 4LBOA 1ASJ1 4AEMA 3S5QA 4COUA 3HVDA 1JYXA 1FATA 1H6XA 1WW5A 2Y0IA 2YY1A 1K5MA 1A3KA 3IB3A 3AKSA 3OPWA 4BMBA 4EWDA 2A6WA 1WCKA 3T30A 3UKVA 5FBJA 3OY8A 4BOWA 3Q8FA 4CEWB 2YDEA 4ZS2A 3I3DA 4P5HA 4XYXA 3Q9OA 3D0SA 1EV11 4QWNA 2C9AA 3TRSB 3ZYGA 1O6UA 4UFLA 5A7SA 1RUH1 3BCWA 3N9PA 4CSWA 1ND3C 4FFFA 4YZ2A 2JX9A 1W05A 3BODA 3HQRA 3N9OA 1GOFA 1VALA 4NIAA 2WLPA 1R092 2WFF3 3PUSA 4EZHA 2ZX3A 4UW4A 1DYOA 1BVVA 1QJY1 1YQ8A 1UU4A 3GNEA 3N9LA 1KJLA 4IUGA 5HXVA 3VBFA 1JZ5A 1CIYA 3AL5A 1XU2A 3HN3A 2VZ3A 3Q8EA 4IE7A 1WW4A 1NG0A 4KWUA 4LO8A 4DZGA 3K2OA 5CZKA 3KMHA 3WG2A 3WW3A 1ZRRA 2K2SA 1QU0A 2NQYA 3T3YA 3ZYBA 2EF6A 2XVLA 2YV8A 1YHFA 1RXFA 3GCXA 1QXRA 5B2GB 3VBOC 1N1TA 4LA3A 2QTWB 4MGIE 1EV13 4BXFA 3VKFC 1RJ7A 2QZ3A 5ACA3 2W94A 4PIZA 1V6KA 3VHNA 2DCJA 4QB1A 5EFUA 1FNYA 1WBFA 4YVSA 3WHUA 4BLJA 1DGRN 1Y4WA 4PJYA 4KG0A 3RVHA 2W92A 2WZR3 3LEKA 3BU7A 4GWMA 1PGW2 4XJZA 1W6OB 3S5AA 2JE7A 3ZFEA 2BGCA 3FLPA 3QH6A 1SLBA 1PGL1 1WWYA 2DVDA 2ZAAA 4PT6A 4Y3OA 3S57A 1QXPA 3EYPA 5D8AB 1YO8A 4OI4A 3TYJA 4DUVA 1C8M3 5A3TA 4K40A 2ZX1A 1EUTA 5GZDA 3PURA 4ONUA 2WNUA 4I02A 2XONA 4FTSA 1HRI1 4URAA 2D93A 4IL7A 1UZ0A 1VR3A 4QX3A 5BNNC 4P02B 1O7FA 1RMU3 3I59B 1ULEA 4AEKA 4LJHA 3ZN6A 1AYN2 1NCQA 1PX4A 1NUKA 1US2A 3ZFFC 3W5MA 4AVAA 2QQPA 2UWAA 1WGPA 1N3OA 2IVJA 3KV4A 2VQ0A 4N90A 2D44A 5FZ3A 4LBQB 2HWD3 1A78A 3O1OA 4GULA 4Z2AA 4FXGB 4YZ5A 1MS0A 2MHFA 4P9GA 2CWSA 4ZU4A 5FPZA 1GANA 3B01A 2PHWA 2PMWB 1J3RA 2A3WA 1PMHX 3LEMA 3MF9A 4Y22B 2XLFA 2Q4SA 1BVP1 5ANQA 2GP5A 3FN9A 4JKMA 4JQTA 1DQ1A 1F4HA 1XE7A 3FZ3A 2RM23 1VBA1 4IEWA 4B3NA 2YYOA 2XHNA 2RHPA 4FAHA 3VD7A 5F5QA 1IS3A 1DQ6A 3AP6A 2WQ8A 2BBVA 3HQUA 5FY4A 4UFHA 3WP6A 3H1WA 2VGDA 2OIIA 3GBGA 3ZYJB 1XJAA 2RDNA 4JV4A 3M2MA 2TEPA 4QB6A 3RYRA 3AZWA 1XNKA 1NCRB 3A0NA 4YRDA 1SHWB 3S7IA 4QMAA 5LCWL 1UY4A 3JD72 2G1MA 1SLIA 3KCCA 1PK6B 3H3LA 1TE1B 4CDUB 5FZAA 4GZ9A 5F5CA 3FBYA 1O8SA 2ARAA 4ZPIA 5C9AB 4LK6A 1COV2 4IXLA 2V09A 4K9SA 2CYFA 2WZR2 4JTNA 5GALA 4OHXA 3WOGA 4EN7B 1HX6A 2EIDA 3LGRA 3GZAA 2YROA 3N7MA 4PI2A 5KC6A 4QXCA 4BIFA 4HK9A 4LBLA 5IVYA 4YGBA 5GM0A 1KJRA 3TNPB 1UNBA 3BTAA 3LA3A 2BNNA 3MFCA 3ON7A 1DGRA 4I3GA 5CKMA 2WZR1 1EV12 2CY6A 3LPGA 1OQ1A 3VBHC 5BNOB 2EXJA 5J36A 5LY1A 4I2OA 5J7MA 3KT4A 4WZCA 3CJIA 2GNMA 4MX3A 4EN9B 4Y22A 2ARXA 5T5OA 3NNFA 4YVWC 5FREA 1RL3A 3RYKA 3VBSC 1XU1A 5KXCA 4CDWC 4QQHA 2FDHA 2Y6LA 5DG1A 5CB7A 5FMDA 3AVSA 2VMGA 5C4WC 5FZ1A 3O14A 1NLRA 4NAOA 5FOJB 1OA2A 3I8TA 5FY9A 4NN0A 5JVVA 4DNYA 2C6SA 5FXZA 4IGOA 3DKWA 1MQTB 5FP8A 2QQKA 1O91A 4M0NA 5FZEA 5KXDA 3ILRA 1GICA 4P9JA 3BTYA 4W8JA 4KL1A 4AF9A 1C8NA 2C5DA 1R1A3 1W6MB 4WVWA 3VBUC 3VKNA 4AI8A 1GR3A 5JWPA 4NE9A 2AREA 5KHHA 2VZOA 4FTEA 3V64A 1GQPA 4QM8A 3OD4A 4UYBA 3UJOA 1ND2A 5L36A 1NXMA 2QFEA 5IW0A 4XCAA 4BLIA 4C0BA 1DQ4A 4BZ4A 1OT5A 4M4RA 2ZABA 3I2GA 3HAGA 3ME2A 1CAVA 1EPWA 2VECA 4E4HA 4RQPB 4ATEA 4RN5A 3MO4A 2AR6A 5FZ4A 4ISRA 3IBMA 2XG3A 4JKLA 2XL7A 1RMU1 1F15A 2EICA 1O3SA 1AR72 1CAWB 4BYYA 3POWA 5HCBA 4M3CB 3KVAA 1WKYA 2R072 3IMNA 3PMEA 3S7EA 3WQBA 4Q1RA 1ZRCA 1G7YA 4LR4A 1W8WA 1H1MA 1RUC3 1CVNA 1QJX2 4N43B 4WM7C 5SV8A 1OOPC 5DMYA 5EJ1B 3MPPG 3VB9A 1W6PB 4JDMA 1CAWA 4QQLA 4QX5A 5FYUA 4CUBA 1EY2A 1JOPA 4K8FA 1AR93 4N43C 4WM7B 5FIXA 2IVIB 3TOJA 1UQXA 2MEV2 4RQPA 2JD4A 4Y20A 5L9BA 1QMJA 3KGZA 3M7AA 1D4M2 1V6IA 4MO3M 5I8SA 1Q43A 3UETA 4CDUC 1Q8OA 2HWF3 4XDPA 5A3PA 1O3RA 4CXYA 1DBNA 1G9BA 4BISA 3OTFA 2DV9A 3OYWB 5JXIA 1W6MA 5LASA 5FPBA 4CRQA 2FMDA 3JD73 2DCKA 3ACHA 5FZOA 1H8VA 2VMIA 2YB7A 3TEXA 3I3BA 5FPXA 4W6XA 4R9AA 2ZGMA 5EWSA 4XUNA 1AJKA 4RYDA 2ZGOA 1XB9A 1QEXA 4CEYB 3MI8A 3LKJA 3WHTA 3CMGA 4Q4X1 2Q8OA 5KR7A 4HK8A 5JOWA 1ZZCA 3FHAA 4DRVA 5FQ0B 4XIOA 4Q2FA 1OD3A 2DU0A 2H6CA 3NRUA 5CFCA 1JYCA 2ZAHA 3BTXA 1NLSA 1OLQA 3AP7A 5FP9A 2CAVA 4QX2A 4YVWB 5FZGA 1CPMA 3ZO0B 4COZA 1OHFA 4FFGA 2QQUA 5T5LA 3VGIA 3FLRA 3H8RA 1LHVA 2DBIA 5I0SA 5J37A 4B4RA 3H0OA 1TME2 3SQOA 4B7KA 4YZ3A 3QOPA 5C9AA 1OQDA 1VBC2 1QH6A 4OVEA 2WO1A 2Y6KA 3W9AA 3VUOA 1Z7S1 3K3OA 5CNAA 1JU4A 1XYOA 4L8QA 4TYSA 2C26A 3AJYA 4L92A 2VU9A 4IE5A 4A41A 2WT2A 3LA7A 3T2OA 4XJ9A 4XJWA 3GBFA 2JIJA 4HSJA 5E1RA 4AEDC 2PELA 2VL4A 2D5FA 4ZKTB 1W6NB 4LORA 2FDJA 3OBRA 3IAPA 4Q4W3 3WDWA 1W9WA 1QOTA 2A5ZA 3KVBA 1YFUA 2NMOA 4FVVA 1H4HA 4INDA 5IK4A 1Y3TA 3T2PA 4DY5A 4B29A 2IC1A 5CG9A 5EPAA 4AQTA 2AZ5A 2D7FA 2E32A 2GH2A 1K45A 1AYM3 5FZMA 2HWC3 3KGLA 2ZX0A 5IK8A 1HB1A 1LNSA 4BCUA 1STMA 1GP6A 2R1DA 1LHNA 4HONA 4XACA 2JB4A 2ATFA 3QH7A 4I0WB 2W5FA 5JMCA 3WY6A 3VV1A 1ENSA 3NO8A 4O9GA 2WT0A 1UZWA 1PGL2 3ZMOA 1XYPA 3D3AA 1U12A 2G9GA 3BOPA 4MH0E 3GDBA 5DDJ3 1BQPA 4LIUA 4QDSA 2QDNA 3RZJA 3GHMA 4CP0A 1AYM2 1LOFA 1QJEA 2D6NA 2NYYA 3AXDA 2PTMA 2VOVA 3SH5A 3ZSMA 4AI1A 2WQZC 4LBQA 4QDRA 2JG9A 4QXKA 3USSA 5FYCA 1WCSA 4ZZ8A 3U75A 2J7MA 2XJPA 5KC5A 3GJBA 1RUC1 3ES4A 1V9U1 1C8M1 2P3KA 5DQ0A 2AGSA 4XFBA 3POGA 4P9LA 4OI1A 3THPA 4HBNA 5JXHA 3ZXEA 5K8SA 3H1YA 1TNRA 2PHTA 4OCTA 3ZN6B 2JXAA 1DHKB 2P2KA 4XMIA 5FZ6A 2RS52 4N43A 2J1UA 4GJYA 3SEPA 2VMHA 2VULA 2P4EA 2VXJA 5DUXA 3FWEA 1L7RA 4Q4Y2 3R4UA 4AEJA 3E6BA 3U10A 1VAVA 4AVCA 1LGBA 1YIPA 1R093 1YFYA 2HWF1 1PNGA 3PNAA 3L2HA 1FXZA 2XB6C 5LA9A 2XUMA 3WNNA 5DAXA 2A71A 2Z42A 1CAVB 1O4TA 5LBEA 4HMZA 2X53S 4Q0SA 5F3CA 5FAXA 3MLLA 4LTAA 5BY5A 2WAAA 4R9BA 2YBSA 3N36A 1BK0A 2VBPA 1VAKA 2WWUA 3PTYA 1W6QB 3RZZA 2PAEA 4XAAA 3N7JA 4CYDA 4LKSA 3NNMA 5FMOL 4GB32 5FBZA 2VZTA 4NHXA 3KHBA 2DUQA 2OYZA 1AR83 2PQQA 4TWTA 4FPLA 4QPIA 2BRTA 5T50A 1XRUA 1W3XA 1MQTA 4AFMA 4DEVA 1N47A 3VDDB 4FOYA 1PVC1 1F5JA 4NHKA 1S0JA 5IUQA 1UYPA 2MPFA 3JBG2 3O12A 4B1LA 1F4AA 3B69A 3C7HA 5APAA 1NX9A 4M3CE 1ZA4A 3I54A 4QAWA 4YLZA 2JDZA 3A23A 4M3CF 2ORZA 4B4PA 4DFSA 1XNTA 1U5IA 4COWA 1J84A 3WF1A 4CUGA 1NA1B 4KNCA 5LATA 3Q8AA 4K20A 1MEC2 3PLQA 5I8YA 5BNOA 1L7LA 2CGPA 2W95A 2VE1A 2GAUA 4YGDA 4E8CA 3A21A 4HN1A 3LOIA 4LBNA 2W91A 1BHGA 4YG0A 4PBOA 2XJVA 3AP4A 3DF0A 3DYOA 2DTWA 2X10A 5T5JA 5EP9A 2WFPA 1Q8PA 4Z2WA 4FP2A 2K46A 1SCRA 4JRAA 2YBKA 5DAQA 3WQ0A 3AFKA 4BQXA 2PA7A 3CF6E 5D21A 4K8RB 4RA0A 1NCQC 3MPBA 1PK6A 4QD2A 1MPXA 5IT6A 1YI7A 4QX8A 2WUHA 1QJY3 4CUAA 1AHSA 3V65A 2N7GA 1OXCA 1LENA 1I9RA 1SLTA 2W1UA 1S0EA 2W39A 3JBG3 4IV3A 3VDCA 5JSOA 3KT1A 2I74A 3NVCA 3KF5A 4QT6A 4C0HA 1LJ7A 4LOSA 3TEZA 1QOSA 3NAPC 3MUY1 1QWRA 1UKRA 5FUNA 2DU1A 1V00A 3B94A 2OPWA 1GP5A 2GMEA 4AVSA 1VRH3 1HQWA 2R063 4QPYA 1FMD3 1N3QA 2YHJA 3ILNA 3OB8A 3SHRA 2HWE2 4MGZE 3VD3A 2YPJA 3M3QA 4FPEA 3FX3A 4I09A 4RR3C 5F3GA 2IFRA 2WSUA 4YM3A 3T2TA 1ULDA 2JECA 3IAQA 2HLEA 4NO4A 1H2KA 4V1PA 2LRPA 1WLWA 1N1YA 3DYPA 5GLZA 1V6LA 4AAPA 2QUOA 4KBZA 3PTRB 3KT7A 3VHPA 4MYEA 3NV3A 1UF2C 4XZUG 4CU8A 1NXD1 5T3NA 2Q8DA 1BEV3 3I59A 2RS53 5KHGA 3U78A 2TNFA 1IKPA 1UXZA 1NAEA 2VOWA 2WINB 4OUSA 5CFDA 3K4ZA 2P3YA 2OXBA 5AVAA 2RVAA 2VCCA 2WNUB 2PAKA 5ABJC 5DG2A 4HFSA 1YQCA 2RDSA 3TN92 1OPMA 2QQMA 1ZX5A 3OEAA 4D7TA 4N7UA 2AACA 1CAUA 5KXBA 3RPQA 2JD9A 1WD4A 3HIFA 1YLLA 5D8AA 2UWBA 1X9PA 5JPNB 1RUI2 1ZRFA 1WA4A 3RQ0A 1R081 2DUOA 1W28A 2FDKA 3T0BA 4IW3A 3DXUA 3UKNA 3URFA 5ABJA 1IGOA 1W6OA 3J4UH 1OUXA 2UYBA 1DZTA 2J42A 1V0AA 3IDEA 4LBMA 1RUI1 1H2MA 4DQAA 4A2UA 2VC9A 2IXKA 5EYXA 1UMHA 5F2SA 2BWAA 5FDBA 1W99A 4RFRB 1S0BA 4I01A 1REEA 4S2DA 2ZKLA 5FZFA 2ZX2A 5C3SA 4R4XA 2RDQA 4QPIB 4Q5OA 3RFRA 3O1MA 1DG6A 2WRAA 2ZGQA 3AZYA 5DAWA 2HWF2 1ZBE2 1LKNA 4CU7A 4UFIA 4IEYA 1VBA2 2EXHA 3KWVA 2NLRA 4CP1A 5A3WA 1QHDA 3O1SA 1GFF2 1E5HA 1V6OA 2CWMA 2IZWA 3P6BA 3PUIA 4ASLA 4BDVB 1KQRA 4I0AA 1VRBA 1CZTA 1DZQA 2PYTA 2SLIA 1VMJA 3CU7A 3PUHA 4CDQA 5L19A 2DFCA 1GQGA 1PO22 1RUE1 3FC0A 4XUPA 4AEDB 5FUPA 2VCMA 2MEV1 3CJXA 4YZ1A 1AF9A 1UCXA 3ZKYA 2VTFA 2V4AA 3HR9A 1SEFA 2W0XA 3AMNA 3BU0A 2WYFA 4YM0A 2QQJA 1UY0A 2ZCWA 2YZ4A 2BTVC 2YMZA 1O5LA 1WUVA 1F5FA 1ONAA 2FDFA 3WP4A 4XILA 5FLJA 4Z07A 1VMHA 3ZYFA 2ZZJA 4JGZA 3OY8B 4M01A 1ZBE3 5C70A 5FCCA 1OC1A 3CJIC 2BJSA 4IE4A 5BPXA 3NNGA 3NKTA 1BCXA 4GAZA 4FPCA 4IEZA 5DUWA 4BHPA 4DXRA 4OHYA 3R4SA 5KHKA 4K21A 4AI9A 3WNMA 3TNQA 3F95A 4N53B 1ACCA 2Y8KA 4XTMA 2RM22 1A6CA 5FYTA 1R64A 1OPOA 4JC1A 4IV1A 2D5HA 1FPN3 1FV2A 4H7MA 3BOWA 2RS12 3DYMA 1RXGA 2V5YA 4BK5A 1MEC3 2RR11 4XJ8A 3BALA 3MDPA 5EJ3A 2RM21 2VD7A 3MIFA 3OUIA 1C1FA 3HT2A 4GH4A 4H3WA 4A6SA 2C24A 2XPJA 1XNBA 4N9HA 5FUIA 3J7NA 1XSQA 1NOVA 2A1XA 4DXTA 5JLVA 1JYIA 4N53A 4DIQA 4LKDA 3VDAA 4Y4YA 1S2BA 3IMMA 5JPMB 1RIRA 1VBD1 4Z8BA 4QX1A 1IQAA 3BIEA 2VM9A 4D0QA 5KWRA 2YFUA 4F7ZA 4LHKA 2RS51 2VOXA 3RZLA 2O14A 3UV9A 4RHV1 3U11A 2P3JA 1HXS3 3WG4A 4QX0A 1OLMA 3WG3A 5GKAC 4CXXA 3N3HA 3NKGA 3RYPA 3K46A 4NWVA 4NHLA 3P3NA 4COYA 5BNNA 1TEIA 4XABA 5CAZA 4YGEA 3HD8B 1V70A 4XPVA 2R071 5JI7A 3SITA 2Q1MA 4AFCA 4AI2A 3TEYA 4FPJA 3IIIA 4OHZA 1NT0A 2ZHKA 5JOYA 5A7OA 5F5IA 5CBLA 1AX0A 1WCQA 1S0CA 2KA3A 3ITQA 3KF3A 4CP2A 4QGLA 5A3NA 3V0BA 2DVFA 3O5SA 1B35B 3POIA 1MS3A 4XMAA 5FP4A 4CDQB 5FQ0A 1DIWA 2CAUA 2Z79A 1CX1A 2WT1A 2ORXA 1OKQA 1RVF2 4ZS3A 1OLRA 2QBXA 4NVPA 2CNAA 3V0AB 1P8JA 4L9BA 4Y1XA 3O7OA 4XEZA 4LO6B 5GLVA 5F39A 1DYKA 2JG8B 4Q8KA 1HDKA 1ODMA 2JWPA 1W2UA 2J1AA 4ASKA 3ZXKA 2QNKA 4CCNA 3RDIA 2WNUC 3POBA 4GA9A 1L3JA 3FUOA 1LAJA 1C28A 5FYMA 1GZWA 4XHXA 4XQWA 4YW5A 3A4UA 4CZSA 4DY3A 3WNPA 3I2OA 3ETQA 2MNGA 5C8CB 4LO4B 1OBNA 1QJU1 2XMLA 2P34A 3P3PA 1GLHA 3CL1A 5AC91 1BMV2 2RS31 3KLSA 1UYXA 2C4XA 2QE3A 5LBBA 3ZFEC 1LOFC 2XJTA 4JRLA 5J98B 2KR2A 1RGSA 1MACA 1WMFA 2CSGA 5JR2A 3KZ4C 3I3QA 4Y20B 4A4AA 4P14A 5FZ9A 1CAUB 1WMDA 3PIJA 5JMOA 4LK7A 4HXCA 4N9IA 2R16A 2C1FA 2XWBB 4CP9A 2BFUL 1CD3G 3VKOA 4RD7A 1KFXL 2LW8A 1VRH2 2C0ZA 2E7TA 3H3UA 1SLAA 4NUBA 3ZMNA 4EWAA 1YJKA 1OLME 4XF1A 4BE3A 4KGGA 1KDKA 3AKTA 2RR12 2D6LX 4Y24A 2ERFA 3RNSA 4MLOA 5AC93 4Y26A 1Z78A 5A80A 4BU2A 1O5UA 2XL9A 5DAVA 2F6BA 3RRDA 4XJAA 4DO0A 1C5IA 2JDUA 3VBOB 5C4WB 1NCRC 3E6DA 1UWWA 4L99A 5IHRA 1S0GA 3JBG1 1O4YA 2XJUA 4LO7A 4W6WA 5C71A 3K75B 3UKTA 3FBMA 3NJVA 5H9SA 2VVDA 4MOAA 5BNOC 2ES3A 1J59A 5K0UA 3AXEA 1IPSA 3HJRA 4LBJA 4Q0VA 1ZREA 4YW6A 1N1VA 1ST8A 3BYWA 1DCSA 2V5DA 3FHQA 1RUOA 1OOPB 1WLTA 5A7WA 2J1VA 2OQ7A 2DVAA 1SLLA 3NJXA 4Q0QA 1Y9GA 3AMQA 2B5HA 4Q4W1 5DDJ1 1I1EA 3VL9A 1Z7S3 2P5BA 2ZACA 3I2KA 2D40A 2QQIA 1BLZA 2XKPA 4CE8A 3LD8A 5BNPC 4CXWA 1DLLA 2WLQA 3B5LB 3BB6A 2Y38A 4CCOA 3PVNA 2BYVE 1NA1C 1UOJA 4QPWA 5FYSA 1JBCA 3O1UA 1O3TA 2NM1A 2IXIA 3SLIA 2YUEA 4XFGA 5GZFA 5K9YA 4XF0A 2P37A 1W9SA 5IK5A 3LDBA 1GWMA 2B4KA 2FDIA 5A6YA 5FK7A 3VDDC 3WF0A 1KXGA 4RR3B 2LS6A 4N53C 1OKOA 4WVMB 2O1QA 3C7OA 1LHUA 4UW3A 5HCFA 3ZLIA 1TMF3 5JSPA 3RI9A 4NJ4A 4FAGA 1JW6A 1J1LA 1SPPA 2VZSA 3AZZA 4MGTA 4HVRA 4MUVA 2A75A 4RGGA 1DDLA 3W20A 4TXWA 4URTA 5D8AC 2GC1A 1KS4A 1UZZA 2E63A 2WWJA 1GKBA 2E26A 1HQNA 2WNVA 4FPKA 2BGOA 3B9IA 5E6HA 2W08A 4XXPA 3R4DB 2DCTA 1B09A 3KCXA 5FXVA 2JB8A 2VO5A 4TLGA 3ZFFB 4N7IA 4E27A 3OOXA 3WCSA 2P6HA 5GZGA 4F83A 3WQ7A 3VDDA 2YC0A 4I0BA 4HPKB 1JI6A 3KS7A 1AR81 5GLUA 5IVEA 4OQ8A 2ZMKA 5FZHA 2BVVA 3JB4C 3S6PA 1H4GA 4IEPA 1QGLA 4TN7A 1F8VA 3MW3A 3AL6A 3S30A 3WDVA 2RJKA 1UYZA 2FBEA 4UFKA 1ENQA 3GYDA 2GMPA 3WDTA 2Q8EA 3MIBA 1SFPA 1VBE3 3FLTA 5JCTA 4MGQA 3AZXA 2HBTA 3LIHA 1NY71 3LIGA 2R6QA 3LAGA 4J1XA 3T2QA 3LZZA 1X50A 3I7DA 1DFQA 4NPRA 5LA2A 3SNMA 3WNLA 1SG3A 1XQNA 3ABZA 4X8NA 1Q8SA 2FHRA 2EAAA 4J6GA 4PF1A 4XFHA 4XCBA 3DECA 1ULGA 2VH9A 4S2FA 1POV1 4BA6A 2VMDA 2JDAA 3B7MA 1YQ5A 2XBO1 2A6VA 4LE4A 1OMIA 1RUF3 2BBAA 5CISA 3H8OA 3ZDSA 3TEWA 1BYHA 3VBSA 4JVAA 2I45A 5AFEA 4PIYA 4XVHA 2IWGB 3OBTA 3LDKA 4AAXA 1U0AA 1ZBE1 3GJAA 5FZBA 3KHCA 4JCKA 1JZ6A 4ATFA 1ASJ2 1VBC3 1VLNA 1QDOA 2EIBA 2JE8A 2BUKA 3RSJA 1PMJX 4HSLA 2YU1A 3ZFEB 2HWD2 2HBUA 4GMP3 1VRH1
chains in the Genus database with same CATH topology
2Q5TA 5BUVA 4WV8A 1R091 2D3PA 4E4ZA 3R05A 3T1LA 1OQEA 1S1AA 3NL1A 5JZGC 1PVC3 4XOGA 1ZBA1 1VBA3 4E2SA 4Q4V2 5T52A 4OI0A 2XHKA 2JG8A 3GZUC 4D69A 4EN0A 4LA2A 3NV4A 1ZM1A 2I2SA 3WT3A 2A7AA 4JQRA 1MR5A 4HKWA 1B35C 4XDQA 3V0BB 1VBB1 3H8UA 1W0PA 1MZ5A 2OZ6A 4KWLA 4U2AA 4AI3A 1VAMA 2VUJA 1RUH3 4WVZA 4MZUA 2GC2A 1A8DA 1X8MA 1IOAA 1FYUA 3USUB 1CAXB 1OD5A 1EPZA 1U5YA 2O8QA 5CFDC 3ZN5A 3VZKA 2A6YA 4FOVA 2RJLA 1YYNA 4KU8A 5CFCB 4L11A 4LBQD 2NZ9A 4FPFA 2ZKNA 4Q4V3 1XNDA 2GC0A 4LLFA 1PGW1 4NR1A 5GJ6A 4FQ4A 4WVVA 3NSTA 4B8EA 1SCSA 2KXLA 1CAXA 4YG6A 3CEWA 3WZ1A 1LODA 1QKQA 2UY9A 1BBT1 3MYXA 4PLNA 2WNEA 1YCIA 2Q1ZB 2GC3A 3QLQA 4DNYA 2JJ6A 2WJSA 2UU8A 1LCLA 2R042 2WFF2 5F6LB 3ZXDA 1IKQA 3THTA 3PMSA 1OOPA 1LRHA 2BFUS 3DGTA 3D8CA 4AHWA 4X8PA 5GLTA 1D2QA 2XGXA 5L7OC 2VOKA 1RUI3 3DUIA 1XYNA 3E6CC 2BQPA 2E9QA 2Y26A 3SCHA 4A7ZA 1HXS2 4GIQA 5I8TA 2D43A 4FPOB 2CV6A 2VUAA 2HWB1 4P9XA 3AJZA 2XVKA 2WC2A 4IEXA 4QQPA 1HXS1 3TB0A 1PO21 1S0DA 1AL21 2P3IA 1AJOA 3ROUA 2VNGA 4ZXKA 1J3PA 2D6KA 5CG8A 2DWRA 3SXWA 5J96B 1NZCA 1RITA 2A6ZA 1GBGA 4M3CA 5AVPA 1MQTC 1Z7S2 1M06G 3ZX7A 3GHNA 1Q8VA 1SBDA 3EQEA 2EXKA 3B02A 1X8EA 4M00A 3PJYA 4AEDA 4B4QA 3C3VA 4RS5C 2CL2A 1G9CA 3VBSB 4META 1MZEA 5A32B 1PO11 4P9WA 1ULFA 3M3IA 2HWE3 1ND2B 4CEYC 4WM8A 1NE6A 1S0FA 4MXVA 3O0WA 3WD5A 2LM3A 2RMU3 2G4IA 4XBLA 1FOD1 3BIWE 3QBQA 4JAAA 2R49A 4XFAA 4PBPA 3W58A 4AGGA 2Q0AA 2KM2A 3C2UA 1D0GA 2VG9A 3A0KA 3WX5A 2EA7A 4XQ4A 4QHBA 3NJZA 2IXHA 4CDQC 2B9UA 4JGZC 3AKQA 1JXNA 3MIEA 3V0AA 3WCRA 4COVA 3CO2A 3MW2A 2JICA 2WS92 3NV1A 2ZGTA 4LNVA 5LEJA 1PIV2 4L2NA 1TME1 2Y0OA 4HN0A 1RUD1 1C8M2 4FOQA 4BPZA 3IT8A 2RMU1 2UY8A 4FP3A 3K51A 1AUYA 3FFQA 4IEQA 2YGMA 4AHYA 3AKPA 2K0GA 5F1RA 1S0IA 4LT5A 1CONA 3WUCA 1RUJ3 2RMU2 5LRSA 3SH4A 2ZPXA 2H6BA 1X7NA 2WL1A 1IS5A 1LOBA 2P17A 4CDUA 4Q29A 2VVEA 4X6QB 3ZSJA 3PVBB 3ZYPA 4RQPC 3ZPYA 2QKDA 4CDWB 1DQ5A 1ALYA 1H2NA 1PVXA 3BPZA 2E6VA 1AR82 4G3YC 3APBA 4AGRA 3E5QA 4RR3A 3HWJA 2AYHA 1YFWA 1JUIA 2DCZA 1KRIA 2DVGA 1AVBA 1TQ5A 2JG8C 4GH4B 2B7YA 4OZXA 1GZ9A 3J8F3 4C91A 1RUJ1 5FO9B 1GQHA 3B93A 1R082 4YSFA 2D6PA 5C9AC 1AYN1 4QGMA 4KU7A 1G8WA 2A70A 1VBD3 2H0BA 2B42B 2OUJA 3ZXLA 4Y1YA 4YFWA 1DGWX 5FMOS 4NWWA 5DZEA 5KHIA 1QXJA 1MEC1 2ZJCA 4J1WA 3VBUA 1BEV2 4QGNA 5GZCA 3MEPA 1NCQB 3VKMA 2ENRA 1CIWA 1FOD3 1AR71 2DURA 1VB2A 4WZFA 3G6JB 2WQ4A 3N7LA 3H3ZA 4E9KA 1RVF3 5C4WA 3VBOA 2R062 3S0MA 3HMYA 2NN8A 4FPYA 5E88A 1NQJA 5EYYA 5KXEA 1OA4A 3AZVA 3ALQA 4RFT0 1HW5A 4QPIC 5L7OB 5JDBA 1SFYA 2HWC2 1H30A 1SMVA 5FLHA 4Q27A 1BKZA 4SBVA 4YGCA 4RL7A 3FUQA 3MFAA 1H0BA 4PLMA 1LESA 3MIGA 4IERA 3TBDA 5FOBB 1E57A 2HEWF 4KWKA 5L7OA 1AR61 1H8TB 2XBO2 5IK7A 1HIXA 4S2HA 1QJZA 4E2GA 3PJQA 3WP3A 5ABJB 1T6GC 1VB4A 4EN6B 2GNTA 3DV8A 4AVTA 1C5HA 3JU9A 1QJU3 1URXA 5TSWA 3JUUA 4HKOA 3WW2A 3ZXFA 1RUF2 2WA3A 4KG8A 5JI9A 5JR7B 4XW3A 1SBEA 1UU6A 2LTNA 1QF3A 4ZU7A 2D3RA 3H7YA 4MV2A 2EAKA 5FO7B 2XWJB 1ASJ3 1YNAA 4LHNA 4Q4V1 4K1ZA 1AXZA 2YGLA 1NQDA 3JQWA 1LHWA 4AFAA 4MXWB 1F2NA 4HVQA 2XKOA 1ND3B 4OHVA 5JOXA 4XF3A 1QNYA 2D3SA 1LGNA 3VBHA 3D82A 2XLAA 5LRRA 2XLGA 5JSRA 4M0HA 4DRRA 1DQ2A 4CEWC 4EWEA 1PZ9A 3U0ZA 5CVRA 4A3XA 1V9U3 3HQXA 1ULCA 1QQP3 1UN1A 2DYCA 4GMP0 2OVUA 1UX6A 1CJPA 5I0TA 4LUMA 3TAYA 2VVFA 4IV3B 2Z2SB 3RJ2X 1ZNPA 4QM9A 1FMD1 3UL2A 3ECQA 3VHRA 1RUC2 2BWCA 1BEV1 1MZFA 5JIUA 1QQP2 4K3UA 5A3LA 4FCAA 4MGKE 1U5XA 1UAIA 2JG9C 1BBT2 1UL9A 2NPIA 4HANA 2GZWA 2E53A 3LOBA 4ORFA 1AXKA 2BW8A 4G4FA 2HKXA 1FAYA 4H55A 1X33A 4FO9A 2EXIA 1COV3 2ZGSA 1VBE1 1NA1A 3WDXA 4KGQA 3DL3A 2NP0A 4AWDA 1LR5A 2E7AA 3AB0A 1ZZ9A 3ZN4A 4R52A 1WMEA 4F3JA 3PVEA 1GYKA 4AK3A 2HWB2 4IQPA 2VNRA 2QZ2A 1Q8QA 3WINE 3X29B 1F9KA 1AL0G 3VBRA 3VBRC 2RE9A 3KM5A 3NAPB 3ZSKA 3WW1A 3LB9A 2VW1A 3L2YA 1WW6A 1H8TA 5A3MA 4AYUA 4G9SB 1SBFA 3JZVA 4WM8B 5BNQA 1MS9A 1RHI2 3WUDA 5BNPB 2BNOA 1CX4A 1VJ2A 3NAPA 3AYEA 1UU5A 1MVEA 2TUNA 2XH6A 3DPRC 4KBBA 5FRAA 4CTEA 3VBRB 3D0JA 4WM7A 5EZWA 1RUG2 2ZHNA 1PO23 1ZBA2 2K9ZA 2ZTNA 4P9IA 3AKRA 3ACLA 3WV6A 4E4DX 2PHRA 5HI0A 4GKXA 2DCYA 2GNDA 3KCYA 4JDOA 3H1MA 2FZ2A 4H14A 2PLV2 2R043 5CIRA 4DS0A 1PHMA 1R1ZA 1A8MA 1YUDA 3IWZA 5FO8B 3INAA 3D6EA 2X29A 1ZZ8A 2JG9B 1RUE3 4LE3A 3POSA 3FMGA 4YFZA 2VPVA 1J58A 1MVQA 1HKDA 4PCRA 2JKBA 5EXOA 1QOOA 5L73A 3HT1A 1EAH3 5I0UA 3VBUB 3E5UA 4Q4Y3 4QQOA 4XBNA 3AX4A 3TWIA 3I2DA 2AH2A 1ZBA3 1ENRA 2CGNA 3GBWA 4JDNA 4OFGA 5E8AA 3WDUA 1YFXA 3KD4A 5K7PA 5LK5A 4D7YA 3ZIXA 1Q5OA 1CR7A 1EAH2 3MGUA 3VZNA 5C8CC 3AMPA 2QCSB 1H2LA 5SV5A 2DFBA 5E89A 3ZVXA 2VY0A 4NOTA 3QACA 1JUHA 4XHBA 2MEV3 3VBHB 1RMU2 3AYDA 1ND3A 1PMIA 1AL22 1F31A 2CTVA 4R9DA 4MGYE 3EBRA 1XXNA 1UPSA 4W65A 3USUA 2ILMA 2DF7A 4CDWA 1NY72 4YVWA 2O0OA 1HQLA 1RVF1 1PK6C 3ASIA 1ENXA 1ND2C 1MZ6A 4AFBA 4LUKA 1WBLA 1KFUL 1NYWA 1H1AA 1O4ZA 3K48A 1WLCA 3R6SA 3MIHA 4ZU5A 5LEKA 4QPGC 4FBFA 2ET1A 3JQXA 2LUWA 1UIJA 4CEYA 1KDMA 3LCPA 1JOJA 4Z1VA 3VLBB 4EV0A 4GXLA 2HYKA 1FV3A 3O0XA 1I3HA 2H0VA 2X5IA 2XJQA 3M70A 2O8OA 4XXAA 1HRV3 5CADA 2ZGPA 4BM8A 1S55A 3RJRA 1H8TC 4HLTA 1AR91 3MLJA 5AFBA 3KB5A 1C57A 1LEMA 4YW3A 4C1WA 3IN9A 1PZ7A 3ZFGB 1HRV2 2Z69A 2BEOA 4XF4A 1PO13 1SFNA 4CDXB 1FOD2 5K0UC 5JOZA 1BXHA 1UZYA 1W6QA 1RUE2 3JCIA 1W6PA 1G9DA 1IZ3A 1FI2A 4KQ7A 5DZFA 4FXKB 4PIXA 4ASMB 4RSUA 5HCAA 5DUUA 1H1IA 3VHOA 3CNAA 2PLV3 2JE9A 1RUH2 2G9FA 2W68A 1SDWA 1PIV1 4Y1UA 4UXAA 2OW4A 4FT8A 4AGVA 2UWCA 3SCFA 4AQ2A 1AXYA 4O9EA 1ZZ7A 5T55A 5H9RA 1PM7A 4Q4Y1 3VZLA 1AX2A 1AR62 1UMZA 4Q1PA 4YM1A 4Y1VA 1TME3 4RHV2 4HKLA 4UBHA 1MS8A 1PZ8A 5J48A 3W59A 3RS6A 4R4ZA 4Z82A 5DXDA 2RS33 5C8WA 4TZDA 4DXZA 1XNCA 4S2GA 4CDXA 4K7JA 4OHWA 5JIAA 1OI6A 3TN91 1D0HA 4RHV3 1RJ8A 4UW5A 1REFA 3ENRA 1PIV3 1DZRA 1FMD2 1AYM1 3FJSA 2GDFA 1WCDJ 2WNVC 1FT9A 2RS13 3CJIB 4R9CA 4QQ2A 2X5IB 4B7EA 2PFWA 3U07A 2R0HA 4JGYA 2XJSA 1D2SA 4WVMA 4P9YA 2JENA 4W6YA 1J1TA 2GMMA 3AM2A 4HZFA 2WWSA 3VBFC 2ZGLA 2DVBA 3IM0A 4CEWA 2A3YA 3T1MA 4Y1ZA 1OA3A 1RC6A 1R1A2 1Y9QA 2A73B 1LECA 3L9JT 5FTTC 1RHI3 3MLKA 4Q4X2 1N1SA 3LSEA 1AX1A 2GALA 3AP5A 4XJUA 4H7LA 1HRV1 3EJKA 3ZXAC 3WVJA 2I07B 5CA6A 1I5ZA 2GSYA 2WSVA 3OGJA 3WQ1A 4QU2A 1BK1A 3OCPA 5BYNA 1Y7BA 4RGAA 1AR73 4JTOA 4COWA 3ZXGA 1G86A 1YIFA 3CLPA 4GALA 2HEVF 1AZDA 3SCGA 4AG4A 4AVVA 4AVBA 1H9PA 3I4IA 5EV7A 4AHXA 1DF0A 1LHOA 5J3UA 1G9FA 4YYOA 5A33B 4WM8C 1RUG1 1XE8A 4PDWA 4FPGA 4RS5A 3FE5A 2ZZQA 2WZPP 5CU1A 3J8F1 4XETA 4E4SA 3MZHA 5DDJ2 1TMF1 2D6MA 3OYWA 1RUNA 1VBE2 4AFDA 2PLV1 1GV9A 2LALA 2Z5WA 2JEMA 5JZGB 1APNA 1TMF2 1CPNA 5A32A 4DMIA 1YI9A 2GN3A 1K5MC 3B3QE 1RUF1 3UK9A 4YG3A 1VIWB 5E16A 4E2QA 4K6BA 4Q4W2 2BNMA 3PHMA 1QY4A 1X82A 4OUMA 2AENA 2B8MA 4PDWC 1QDCA 1HLCA 2RS11 3O0VA 4ISQA 2SBAA 2VNOA 4D94A 5T5PA 1UIKA 1KITA 1VP6A 5BXXA 4MVTA 5C8CA 2DTYA 1DQ0A 5C6CA 1SLCA 3LSDA 3R0RA 1GZWB 1VBD2 4FOWA 4AW7A 2XBO3 4SLIA 4IEOA 4Q4X3 4FQZA 2VQAA 3ZSLA 2E7QA 1FX5A 2ZGKA 1YXWA 5BV6A 4PDWB 4GWNA 3UJQA 5BNPA 1QH7A 5A33A 5D1IA 2ZS6B 1R083 3MIDA 3VBFB 5KHJA 3NWKA 3IDCB 3WNXA 1IHMA 1CGPA 1W0OA 2HEYF 3ZFFA 4TLFA 4EJRA 5HBAA 3V56A 4BH9A 1HRI3 1NE4A 4LHLA 4X6RB 4Q26A 1Z0HA 1QQP1 2ZGRA 1QJX1 1YJLA 1ZZBA 2A6XA 2WKKA 2ZOEB 3D4KA 2WNVB 5GLWA 2OA2A 1RUJ2 3H50A 3J26N 1CQ9A 1UKGA 4XFFA 2RS32 3AYAA 4IEVA 3WLUA 4YW4A 5CFCC 3OF1A 4R8HA 1K5MB 2PHDA 4AQSA 2QJVA 1VBB3 2BVBA 4GQ7A 1OSGA 4JGYB 1CN1A 4A7YA 1ZVFA 1CJDA 4LLOA 2IXLA 3GZTB 4FTBA 1UD1A 4ES8A 1BMV1 2BPA2 2PHLA 3MW4A 1C3HA 1NCRA 1QJX3 4GH4C 2E51A 1R1A1 3HBZA 4IV1B 2ET7A 4Q0PA 1YWKA 1GNZA 2HWD1 3G7DA 4Q0UA 2PN5A 2UYAA 2B45X 2R061 3OGGA 1IS4A 4GB31 1ZYBA 4IEUA 2AUYA 1LOCA 4IETA 2WS91 1POV3 3RI8A 1BBT3 1V6MA 3WP5A 4BIOA 3GALA 5K0UB 2F4PA 3H9AA 3IPVA 3AK0A 4IV3C 2ZMLA 4XE9A 5GZEA 2A3XA 4AHZA 5C33A 1Q3EA 1VBC1 1LGCA 3IKWA 3AMMA 1LOGA 1WD3A 3HN1A 1O3QA 1COV1 2HWB3 4Z92B 1JTZX 2IXCA 2V73A 3ZYIB 4YM2A 2CGOA 4OLLA 2WA4A 1QNWA 3SISA 5J09A 4FSJA