1QFEA

The structure of type i 3-dehydroquinate dehydratase from salmonella typhi
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
252
structure length
252
Chain Sequence
MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHNVYVVMSNHDFHQTPSAEEMVSRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILHNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The two types of 3-dehydroquinase have distinct structures but catalyze the same overall reaction.
pubmed doi rcsb
molecule tags Lyase
molecule keywords PROTEIN (3-DEHYDROQUINATE DEHYDRATASE)
total genus 89
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 1999-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1qfeA00
1H5YA 2Y7GA 3NYZA 4IOTA 2VENA 1QNVA 4O53A 4M6VA 2H6RA 3EWUA 3G1YA 3G8RA 5HWNA 1GYNA 1YPIA 2VFIA 2GUUA 4PCFA 3I7SA 4UIOA 3MO7A 1XBVA 3M44A 1ME9A 3WK1A 4S2CA 4Q4KA 1XBZA 4JYDA 4OBTA 3BARA 3W1RA 3LV6A 3DU0A 2CLMA 4ZVJA 1FWSA 2Y85A 4ADSA 4LVDA 4FB7A 1L6SA 1HO1A 2Y70A 4IGHA 4JTHA 5CZSA 1OFPA 1GOXA 4PODA 4IMEA 4IXHA 3TU9A 5I3GA 3EX1A 4HHPA 3CU2A 2ZCGA 3DFTA 3WFAA 1KTCA 4Z1AA 2GQ8A 4CQ9A 3O8AA 4LTSA 1K8ZA 1SSGA 3TMQA 3TQ0A 2VKZG 4XZ9A 1E51A 2A1YA 3L21A 2RDWA 4OE7A 2WSYA 4TIMA 4S1FA 3WJZA 3L65A 1YTKA 2DU2A 1LOQA 3DI0A 1ICSA 1I2NA 5LNUA 3LTSA 2VOMA 3V1PA 2DZTA 1M6JA 2FIQA 2J9XA 2GPTA 4O4WA 1QPOA 3NXFA 2Q3OA 5LGZA 3I7RA 2YPIA 3FLUA 3TDFA 2B7PA 1WOBA 1W5PA 3BLFA 3F4WA 3KHJA 1H7OA 4KWWA 3C8FA 4PL1A 1I2PA 3D0CA 2Y7EA 1RR2A 4FNRA 2A5HA 4O1BA 4PEKA 2Y62A 5AOUA 2F7FA 1R30A 8TIMA 1WX0A 1FWNA 1ZHAA 3TKFA 1H7XA 2YDAA 3LOTA 2CZEA 3W1XA 3QSRA 4JNMA 2ZRWA 3NG3A 4IX0A 1IXNA 2GQ9A 4GUFA 4O50A 2ZZ2A 4KKXA 2J27A 4CNNA 5J5DA 3F4NA 4X2RA 1BWLA 4Y96A 2Y6ZA 1TPB1 2DZVA 4FEZA 3LHVA 2ZRVA 1Z41A 2E6FA 5ABTA 2B7NA 4RR4A 1C9DA 2G96A 2NWRA 1H61A 1F6PA 3P8JA 2VFFA 2P1FA 4LUIA 1ZJIA 2PURA 1EIXA 1TV8A 3LHZA 5G1TA 1VLWA 3NZRA 2V2CA 3BK0A 3S1UA 1XXXA 2Y7FA 3BW4A 3W1QA 1G67A 1KFKA 5GVJA 3ATYA 3UWZA 4UFMA 1GPWA 4JIPA 1JR1A 4FNUA 3N3MA 5AC8A 3NQVA 3NPUA 2R14A 2QDHA 3W71A 4YMZA 3BW2A 2VFGA 3TJLA 5D03A 1HG3A 3G1SA 3EEGA 1SZEA 2ZZ3A 5F2MA 2Q8ZA 5I3FA 4YL2A 1M7OA 3ELFA 1K8YA 1I2RA 3L66A 1S5TA 2YSWA 1VGAA 1TJRA 1OJXA 1QFEA 1F7BA 1TPWA 1KFBA 3HGSA 1W3IA 3M6YA 2JBMA 3TUUA 3RU6A 1TTQA 3TR2A 2E1DA 1J2WA 1SUXA 1PS9A 3CLMA 4UXDA 5LKYA 2X1RA 3EWYA 4O1CA 4TMBA 3W7HA 1KFJA 2VEIA 3A5FA 5I3KA 1THFD 4H6KA 3L5LA 4FIQA 3P5ZA 2YCEA 1TPEA 4JIQA 3OG3A 3M0ZA 2E77A 4BI5A 6TIMA 3PUEA 5K9DA 1W5NA 2CLKA 3QYQA 2QCGA 1LYXA 2E6AA 2ISVA 1W37A 3MI3A 4YCPA 4AXKA 1VS1A 1KW1A 1TPDA 1TPVA 2QEZA 1K8XA 3P7YA 5LNVA 2LLEA 1EA0A 2C6QA 4WJEA 4DBEA 5D05A 3S42A 4LV4A 1AW1A 1MSSA 2E5DA 5K9XA 4MFDA 1WA3A 4LUJA 2E5BA 3RF9A 4QIUA 1AL8A 4MZYA 1JCXA 2VFEA 3EXSA 3NQAA 3LCIA 1QR7A 5D30A 1KTNA 2B0MA 1K03A 3G18A 3KAOA 3HGJA 4GC4A 4UTMA 3HG4A 3N9RA 4JTFA 2C18A 5G4EA 3W23A 4A21A 3DFSA 4MZ8A 2QAPA 2NV2A 2FB3A 2A0NA 1JCYA 3QSTA 2V5BA 4N9BA 3NQMA 4JTEA 1B57A 1QPRA 3UZJA 4M19A 1LLZA 3SGUA 3S1VA 4UFLA 4HNNA 5H2ZA 5DY2A 1EP2A 4UNKA 4NX0A 1DL3A 3PB0A 3B05A 2HS6A 4TU1A 5EYWA 1EP1A 2V8ZA 2XFWA 2G97A 1VCGA 2ZTJA 1NAL1 3QMRA 2YZRA 2EKCA 1VH7A 4RLIA 4QM1A 4EF8A 1LORA 1VZWA 3BGJA 1W0MA 2HSAA 4KFPA 5K9CA 4N02A 4IMCA 3IVSA 3A22A 1QPNA 4UTWC 3LLDA 1Q6RA 2H3BA 1P5BA 2P0OA 1OX5A 4RKAA 4E2DA 2WJZA 2J88A 5EBUA 4UTLA 4LVFA 2E68A 2X30A 2VC6A 2CFFA 5CPNA 4WD0A 5HNRA 1FDJA 4P2VA 2H3DA 4FNTA 3M5ZA 1UUMA 3C2RA 4ZQPA 1TRDA 1SFLA 4QNEA 3QPYA 3DH7A 3NM1A 3FKRA 5C54A 5L9FA 3NL6A 1X7FA 4OT7A 3GR7A 4O12A 1A5BA 3JS3A 4K39A 1RZMA 5FF0A 1R2SA 5C5YA 3E0IA 4Y8FA 4O28A 4FO4A 5EA9A 1K7FA 1QDSA 2OT1A 1OFDA 3W2UA 3HOJA 3M47A 4UCGA 1JUKA 1LM1A 1O60A 2V2DA 1WBHA 2OT0A 1T99A 5BMWA 4N6EA 3P8IA 4UFKA 3UWYA 3QRHA 3LCXA 2QF7A 2UV8G 3LHYA 4UTTC 3IIVA 3WJYA 1EWEA 2BLEA 3OEXA 4CQAA 4LRSA 1KTBA 4IQLA 1RQHA 2DZPA 5CKSA 1C29A 2R8WA 4JGDA 3RLVA 1JQVA 1AMKA 1GYLA 1RVGA 3EWWA 4NX5A 1QO5A 4I9AA 2Y88A 4O1DA 3R13A 1H7PA 5FF7A 3HIJA 1YPFA 2CLOA 3PG9A 3L9CA 1P0KA 1SPQA 1H7NA 3MUXA 4GJ1A 5HUPA 3VI2A 1M5WA 3UWWA 3HG2A 1EEPA 3UWVA 4MIMA 2HTMA 1KBJA 3L2IA 4WXZA 3SR7A 3C56A 3R8RA 4IXXA 4EWND 3M5VA 4UR8A 1QO2A 3TJXA 3PUOA 3HB9A 3SJ3A 2ISWA 4NNCA 1J5TA 3LCHA 3EX4A 3GB6A 3W76A 3AJXA 2GVJA 4JTGA 1LRQA 4AHOA 1LBLA 3NL2A 3W72A 4WY0F 3QJAA 3FOKA 3H55A 4MVAA 3DHDA 3P62A 1W3NA 4N4QA 2Q8LA 4D2JA 1AL7A 3W7MA 4CCDA 5LNWA 1XUUA 3H53A 1KM2A 4JYFA 3OVPA 3QF0A 1ZENA 5G2WA 1MO0A 1TRIA 5D2VA 5KINA 4OWGA 3W70A 4MYXA 3HMJG 1XBXA 2PRHA 2NUXA 2GVGA 5A5WA 1MEHA 5F1VA 3E9AA 3LDVA 2Q3RA 4LVBA 3LCLA 3W75A 2TYSA 3MJYA 4CNPA 1LOSA 4QISA 1HUVA 1T8XA 1W1ZA 3P61A 1TMHA 2R91A 5FEPA 5HUOA 4R34A 2NV1A 4EVZA 3F03K 3M1ZA 2I1OA 3CWOX 3LI0A 4E38A 3GXPA 2Z1BA 3OHIA 1ADOA 3SECA 2NX9A 2J9YA 4K36A 4L4LA 4RK8A 2QJHA 2BX7A 4ONVA 1ZALA 3LV5A 2WNNA 2VXNA 3INPA 3TW7A 1BTMA 2QAFA 1OX6A 2C3ZA 3LBMA 2CLIA 5AN7A 5D02A 4WOZA 2C19A 3S5NA 4UNLA 4O0KA 1DKWA 4JICA 3PS7A 5EY5A 4AWTA 2RH9A 4JX4A 1G7VA 5DN1A 4Z0JA 3KVJA 2BSLA 3W7QA 1WBJA 3PUDA 3R2GA 1ML1A 5AHLA 4O57A 1JRCA 1X1ZA 4UUIA 4HPJA 5EL1A 2QCEA 1SFJA 3HGRA 1YXYA 1BWKA 2R94A 3DI1A 3G3DA 1X6UA 3TW6A 1JULA 1W54A 5DBUA 3CQ0A 2A6LA 3BPWA 1BKSA 4P61A 2C13A 3TSBA 3EKZA 4WX2A 1F05A 4O18A 3C3NA 3Q37A 1DHPA 3Q58A 4OQVA 1OFQA 2ZRZA 5I3JA 3G1VA 1XKYA 3KRZA 4O0ZA 3T78A 5D2TA 1I8JA 3E02A 4GUIA 1Q3NA 1A5CA 1N7KA 5DY3A 1FWRA 3LRKA 4TMCA 3USBA 4RCXA 4M7SA 3GYEA 3B0UX 4IPIA 2AQWA 4Y9AA 4BWLC 5KMYA 3MWAA 2X1TA 4AWSA 2CU0A 1L9WA 3MYOA 3KXQA 4ZZ9A 4IPJA 2TRSA 5CSSA 3MP5A 3TCEA 1GVOA 1VYRA 2YW4A 4X3ZA 1KLYA 4QSHA 2QCLA 3SW6A 2RKXA 2C16A 3W3OA 1LLWA 3Q2DA 1LBMA 5LHEA 1NVMA 1EWDA 2ATMA 3WK3A 4LC6A 4Q33A 3ATZA 3QMSA 4EIVA 3PSWA 4FF7A 3T44A 4UFJA 1SZFA 1ONRA 3I7QA 3MHUA 2NXGA 3MBFA 1PL9A 1OF8A 1FQ0A 1GEQA 1W5MA 4HKPA 4N9DA 3W7OA 1LZOA 5H91A 3TSDA 1B9BA 4HIBA 3OA3A 1SO3A 1EPXA 3QEZA 4Z1BA 3NNTA 3W1PA 1LCOA 3LBCA 3O6CA 4MY9A 1KM3A 2QCDB 2B7QA 2VFDA 1G69A 3BV4A 4R33A 1G4SA 5G1YA 3NQGA 4ZMGA 1VQTA 2Y63A 1W31A 1GTEA 5HULA 4JTUA 3M41A 4OHQA 4WZHA 1ZNNA 4MOZA 1NF7A 3FFSA 1EB3A 4DF2A 2X1UA 4O1AA 4Z0SA 4O11A 3UPBA 5HR6A 3C0JA 2J24A 5KZDA 2CLFA 2ZDRA 3MW7A 4DXVA 3FEMA 4XQ6A 3C2EA 4YCOA 3B04A 3A21A 3GDTA 3HGOA 3S1WA 4G1KA 5C55A 2QCMA 1BEUA 2QJGA 3IGXA 3TK7A 1O5KA 3O6YX 1KFEA 2F84A 3LTYA 4PL2A 4LW7A 5KSWA 2YX0A 4N6FA 4LVGA 3HG3A 1W5QA 3ABQA 3PM6A 3M43A 3SFKA 3GDLA 3P84A 1PCWA 3A23A 4A2RA 1MEIA 3MBDA 2A4AA 1IXQA 3LRMA 3E49A 1F2JA 1OX4B 1F74A 2GVLA 2DZWA 4BF9A 1XBYA 1DJQA 1G4EA 1TPH1 1OVDA 1OFAA 4K37A 3U2OA 3P74A 1TJPA 3SGZA 3BGGA 2B4GA 3ABRA 2HMCA 3WK0A 3NR0A 2E6DA 4NJHA 1UJPA 2YW3A 3LCFA 1GTHA 3TXZA 1ZAHA 5A8GA 3R5EA 6ALDA 1DOSA 5F2GA 3IVTA 4WY0B 1DBTA 3UYCA 4RZ6A 3PVFA 2XN0A 1I45A 5E1QA 1SR9A 1O4UA 3NAVA 4AF0B 5E93A 3BG5A 4DPQA 3NQ2A 3QQ0A 1VPXA 3CHVA 4PFMA 3MI2A 1PV8A 2CZ5A 2ZZ5A 3NZ1A 5LSMA 1OYCA 1YYAA 3C2OA 2WSQA 2AGKA 4E0CA 1TO3A 2VEMA 3MP4A 2JKAA 1X1OA 2JKPA 3NO5A 3W1TA 2YR1A 5G2IA 5LHFA 4NUWA 3SIZA 4NU7A 1D3HA 2EHHA 2EAWA 4AHPA 1AW2A 3G22A 2OX1A 3O16A 3GKFA 4YXGA 4A2SA 2NXIA 4NJIA 1DORA 1EX5A 3A5VA 3IIXA 5CZTA 4O17A 2VEKA 2AAMA 1H60A 3FKKA 3BG9A 4NZJA 3W7RA 4BR1A 3IV3A 2EF9A 2C1HA 3C2VA 2NLIA 3P5YA 3UY7A 4MJZA 5LZLA 3FYOA 2DJLA 2VEPA 3PF3A 1YTEA 5FEZA 3PB2A 3LHUA 1TTPA 4JS3A 4N9EA 3L68A 4PA8A 2QUUA 3LXAA 4O10A 3STGA 3F1QA 3FYPA 3EWZA 2ZRYA 4XWUA 1JCLA 2PC4A 4UTIA 2H90A 1Y0EA 1WQ5A 4MUZA 5AHIA 2J6XA 1B4KA 2QCHA 2ZFAA 4JTSA 3KFTA 1DVJA 5I3HA 5U4NA 1VJIA 2Z6JA 3W7PA 4DF0A 1SZGA 4K7YA 1KLZA 1OK4A 1SO6A 4WQ6A 2V81A 5FEWA 3W74A 5U7SA 2V5LA 3KVKA 3L0GA 2V9DA 4XBKA 1WAUA 2QKFA 2CZDA 3DGRA 4HPXA 2C0AA 4FXSA 2OZ0A 1VC4A 2GJNA 3WJWA 3L0NA 2WSRA 1XL9A 3B06A 1F6KA 5D09A 1YDVA 1F76A 1JQXA 4WY0A 3KOFA 3CM4A 3W7CA 3W86A 4XKYB 1SSDA 1L2UA 4CLMA 1V7YA 5L6UA 3IGSA 2ZA1A 3ZWTA 3QC3A 3E96A 3N9SA 4CQ8A 3CT7A 3UPWA 2YYTA 2G95A 4AWUA 4FX7A 4GBUA 3W84A 2I14A 1AW5A 5DLCA 3W7IA 1KV5A 3GNDA 2KZHA 1S5VA 3VFLA 1VCVA 4GE8A 4UFIA 5AB3A 3N34A 4X9SA 2CW6A 3W1UA 4DBDA 2A7RA 3CIWA 1QOPA 2Y61A 2FJKA 2NWSA 3TNOA 3PAJA 4RZ4A 2E5CA 4RXGA 3JR2A 3NVTA 3TC7A 3LCGA 1LOLA 3HG5A 4GWEA 2YFNA 1OABA 3CEUA 1O5XA 4OV4A 4HT3A 4J9JA 3ZS4A 4UMBA 3PBWA 3BG3A 4ZL1A 1QWGA 5DCDA 3T55A 4ZQOA 1EP3A 5K7JA 4U4MA 3DXIA 3BLEA 3U8GA 1KM0A 1IF2A 1VLIA 2O7SA 2NX3A 4NQ1A 1TPFA 3THQA 5DXXA 2QJIA 1YADA 3HF3A 1GVRA 3HO8A 3C6CA 1OFBA 3EWXA 5AC6A 4ZQCA 1U83A 5FF4A 3W7GA 3CIXA 5KZEA 5D04C 5I3IA 4GUHA 4MJMA 3WK2A 5BOOA 1IGSA 3UXAA 2WPBA 1EUAA 1F5ZA 3W88A 5FF2A 2RDUA 2FPTA 3M7WA 4BWLA 3GVGA 4IJBA 3TXVA 3O63A 1WOAA 1M7PA 2V2HA 1PHQA 3IRDA 3H54A 3QFEA 3DBPA 3TROA 1SW0A 4IUOA 2E6YA 3PY2A 1TQJA 4TO8A 1XDMA 1D9EA 4Z08A 3BLIA 4A29A 2QCDA 1G4PA 2FPYA 5AYZA 4YLWA 5FF3A 5CPMA 1PE1A 4QJ1A 4JXCA 3S5ZA 4XBSA 1H51A 5HWJA 1IIHA 3FJLA 4LNYA 4C1LA 3QMTA 4PC8A 1FWWA 2FB2A 4UR7A 3TSMA 4HNTA 2YFOA 3RFAA 1OX4A 3DHFA 2ABAA 5D2XA 3LGEA 3STEA 1HTIA 3HPSA 4WOQA 4M6QA 4DEFA 4I7WA 4K7VA 4DF1A 3TQKA 4LOCA 3CEPA 1K7EA 1LROA 4UMCA 2A7PA 1CX9A 2TMDA 1TCDA 3P60A 3LM7A 3W83A 4JTIA 3EXTA 1FCVA 2J9ZA 2X16A 3W7NA 3W22A 3W7KA 2NUWA 5MHBA 3GDMA 4JDBA 5C2XA 2QDGA 2Z2UA 3T7VA 4IMDA 1TIMA 1JCNA 4K6AA 4CNOA 2JK2A 4MPQA 4DQWA 4LS1A 4AF0A 1ALDA 4K8EA 1XCFA 5AHMA 4MLRA 1IXOA 1RV8A 1LP6A 2A21A 3UQNA 3A9IA 4JR5A 1JUBA 3G3MA 5BNKA 1FY6A 3NA8A 4B5NA 1ME7A 4L4MA 1PHWA 1OYBA 3IGUA 2BWGA 1H7RA 1Z42A 3RMJA 1T0OA 3CTLA 3W07A 4R7JA 4DO4A 4NNAA 3E12A 2ZA2A 2PCQA 5D32A 4EOUA 3M5YA 1VHCA 4LWWA 3LTPA 3LHTA 1Z48A 1T96A 2H8XA 1TREA 3G24A 3G1DA 3SZ8A 4OV9A 4H4IA 3W2LA 3BW3A 2DJXA 3L5AA 2BZNA 1FDYA 1OG0A 1P1XA 5BW6A 1VRDA 3G0UA 1KM4A 3EB2A 3EX3A 4MZ1A 4ADUA 1W56A 2JGQA 1WXJA 1YDOA 4GRSA 2O7QA 4ICNA 2WO5A 4HSNA 3GXNA 2IQTA 3GLCA 1XUZA 4TR9A 5G2HA 3NQ7A 3O07A 2XN2A 3C4UA 2Z0IA 3JRKA 1H63A 2FDSA 1W3TA 2QCCA 4O14A 4Z1DA 3GKAA 3N19B 2W0UA 4POCA 2GJLA 3MHGA 3NQ8A 5K4ZA 4JEQA 2YXGA 5D2WA 1VCFA 5D37A 1CW2A 3DENA 2WV8A 1QAPA 3PBUA 4X22A 5TQLA 3EX6A 2TPSA 5FI8A 4AHQA 1GG0A 1G6CA 4K8HA 5HJLA 2RHGA 1FUYA 2ZRUA 3DZ1A 1A53A 1JCMP 2NX1A 1B4EA 5CGQA 4O8RA 4OGZA 1FWTA 5DCBA 2V0TA 4JY8A 3UXDA 4HNUA 1K7XA 3S9YA 4ZQMA 3RNDA 5LNSA 3CB8A 3MMTA 3GXTA 4AMAA 3VNDA 5E0KA 5DXYA 1TPC1 4XTDA 5K3VA 4UTWA 4UTTA 2WOQA 1NFBA 1KBIA 3STFA 3Q94A 1V5XA 1TV5A 2W79A 2A2IA 3TA6A 4Y6GA 3EXRA 3NEVA 1PVNA 1UASA 4JX5A 2GOUA 2XN1A 4KFOA 2NXHA 3QZEA 4K38A 3W9ZA 3PBYA 2ZZ4A 4RZ5A 1YXDA 3GR8A 2RFGA 4O15A 5K2ZA 3NDOA 1S3HA 1YXCA 2E09A 3P80A 4R53A 4AVFA 5IM51 3M16A 5D2YA 1SO5A 1DV7A 3P82A 1PCKA 2ATSA 3TAKA 3L0KA 2CLLA 5F4SA 3TX9A 5IBXA 4BI6A 2Y7DA 5J5RA 1MXSA 1Q6LA 1SW3A 2ZZ6A 2WNQA 3TE9A 4O54A 1W5OA 3EX2A 1JCJA 1R46A 4FX8A 4JTJA 3R12A 4LVAA 3CC1A 1DQWA 4BK9A 1RD5A 4Q32A 3L5MA 4ORMA 3PSVA 2A85A 1XI3A 4ADTA 2P10A 4LC8A 1FCQA 4UTKA 5SWUA 1KA9F 1J4EA 5FESA 5LGXA 5EPDA 3S0CA 5CPLA 4JTKA 3FS2A 3DFNA 1KM6A 5CZJA 1LRTA 4FNPA 1TSIA 4I7VA 4JTLA 2EGZA 1I2OA 1H50A 3LRLA 1R2RA 2Z6IA 3STCA 4XUGA 3K30A 5HQEA 1DQXA 2A6NA 3TQVA 1I4NA 3DFQA 4RJEA 1AG1O 1OF6A 5AFDA 3G0SA 3NQEA 4NNBA 3UZ5A 1LRNA 1L6YA 3P67A 4WXYA 4JY9A 5TIMA 3W1MA 1EUNA 3W2NA 3SY5A 1N55A 4HN4A 3RK8A 3IIZA 1HO4A 3ZWSA 1FCBA 1FDZA 4I7UA 3MI6A 3GIYA 4UTUA 3IIPA 3IEBA 2RDTA 5D38A 1P4CA 2BTMA 1H62A 3O15A 1NF0A 1LTDA 3HBLA 1QOQA 1Q6OA 1UB3A 2WQPA 3N73A 4NXSA 4XTIA 1VHNA 4KWVA 3NQ6A 3GDKA 1VR6A 5EKYA 1ZAIA 4UMAA 4QAIA 3T40A 4ORIA 1XM3A 3FJ6A 2H8ZA 4NXKA 4GNJA 3W87A 3VCRA 4MLJA 4QNWA 3HQ1A 4XKYA 5BMXA 3W7JA 4MY1A 2CLEA 2WKJA 3TFXA 3N2MA 3LERA 3G8EA 1Q45A 5HMSA 1H1YA 1WV2A 4N4PA 1JUEA 4PH6A 5F2IA 2FFCA 3UWQA 4IWWA 3QM3A 2W6RA 4QITA 4Y90A 4WUIA 3VKJA 4LS2A 5CPOA 3B4UA 4ZQNA 3W73A 1QCWA 3LXBA 1H1ZA 3B8DA 3KRSA 3LX9A 1OFOA 1XC4A 5HWMA 3GX9A 2ZYFA 1HFBA 2D73A 4FIRA 5TBOA 2VFHA 2YGYA 1CI1A 4RXFA 3VE7A 3W85A 1TB3A 3I65A 5HINA 4DELA 4N9CA 3R89A 1X8FA 4U28A 1TV7A 1ZY9A 4JD4A 1OFEA 4ML9A 2GQAA 2DORA 1KM5A 3W6YA 3S1XA 3W1AA 1L6WA 2ZBTA 3A24A 5BRBA 4NJGA 3B03A 1I2QA 1IIGA 5HR7A 3LB0A 2ZA3A 1MEWA 1VYPX 4UTJA 3HJZA 5LNRA 4LS0A 5K4XA 4AH7A 1N8FA 4MFEA 3TV8A 1C8VA 4FHAA 2PRLA 3PC0A 3KVLA 1H7WA 4FX6M 3W2KA 3ABOA 1SZNA 3BO9A 3B0VC 1KFLA 3FA5A 3DKJA 3G1HA 3YPIA 2NZLA 4CCEA 3PR2A 5CZ0A 3W1LA 4JX6A 3UWUA 3HPXA 3W1NA 3NL3A 4LV9A 1FBAA 3S5YA 1TQXA 4EF9A 1O95A 1GWJA 1TTIA 4FXRA 5DELA 4O13A 3HPZA 4M5PA 1FXQA 2QUVA 2B7OA 4KFNA 2ALDA 1WYIA 4UFHA 5KZMA 4GXMA 3M9YA 2FPVA 3GAYA 4JN6A 2DZUA 4IX2A 4M6PA 4LY8A 1R47A 3TIMA 3NM3A 3TH6A 4W9TA 3TAOA 4YWIA 3L67A 1Q6QA 3C61A 3WJSA 1OK6A 3FIGA 3O1NA 4TX9A 2Y89A 3G1FA 4ZQRA 2PE4A 4LT9A 2ISSA 2ZZ7A 4FNSA 1ICQA 1PIIA 4DO5A 1KM1A 1UCWA 3G1AA 4MYAA 5DBTA 4PTNA 3G1XA 1MZHA 3RLUA 1QMLA 3MYPA 4AB4A 3EKLA 3NQCA 1RQBA 3W7EA 4DO6A 3S8HA 3GAKA 1G7UA 3I6RA 2DZXA 3NQDA 1IXPA 1HL2A 2OMAA 4BFAA 1FXPA 2QUTA 3GNNA 3OIXA 3O6DA 3UY8A 3CPRA 1GZGA 4NJKA 3TFCA 1FCUA 5D33A 1O94A 3C52A 4NZFA 2HS8A 3ANYA 4N2YA 3GK0A 3BVJA 3KX6A 5G5IA 5G4WA 1LBFA 1KV8A 3C2FA 3LCWA 1LDCA 2V30A 1WDWA 3MHFA 3ZR4A 5AHFA 3QW3A 1DJNA 2X1SA 3KRUA 2V82A 2TSYA 3S6DA 1ZAJA 4QQ3A 4UTHA 4LRTA 3W2JA 1U5JA 3TMLA 1Z44A 3S5OA 2QCNA 4MY8A 2FLIA 3MP3A 1FX6A 3LLFA 1UUOA 1A5SA 1GVFA 3QW4B 1D3GA 4GFSA 5T26A 2CZFA 4NJJA 2X2GA 1K02A 4C1KA 1SW7A 1GVQA 5AHNA 4H3DA 3EWBX 1GVSA 5EMUA 3LHWA 2ABBA 4JDYA 5CSRA 1K3UA 2ZTKA 3PG8A 1RPXA 2WNZA 4O4VA 1OYAA 1JJKA 1TTJA 3OVQA 2FTPA 4GUGA 3OVRA 3DFPA 4Z1CA 4RV8A 3I68A 1KFCA 1A50A 4S2BA 3GDRA 1R2TA 4A3UA 4AAJA 4JTTA 5CG7A 3W7LA 4FNQA 1VYSX 5DCEA 3DFOA 3T4CA 4IMFA 4MKNA 3NPWA 3NPXA 4CCCA 1ZCOA 3SI9A 4E2BA 1YDNA 1GG1A 3NQFA 5F2LA 2ZQ0A 3PWAA 3AO0A 5F1UA 3VE9A 4RX0A 4A22A 4NT0A 4NVTA 1GT8A 4O19A 5F4XA 2PRMA 3UNDA 1OHLA 2C14A 3ABSA 1XDLA 2CWNA 4HSOA 3V75A 3THAA 1XFBA 1UBSA 5KITA 4AEOA 2C15A 4O52A 3IVUA 1RQEA 1B3OA 2G5WA 4IMGA 3LXCA 5KTLA 1NEYA 3QPZA 1JRBA 2QCFA 2JGYA 2CLHA 1P0NA 2EPHA 1QPQA 2DP3A 2ZRXA 2OJPA 1F73A 5C6MA 4DPPA 4OU1A 3QQ1A 3TC6A 4JYEA 1ME8A 4O16A 5AYYA 1A5AA 2DZSA 1GQNA 1SQ7A 3P81A 2QR6A 3QH2A 1GJPA 4M7TA 3UD6A 3DAQA 3NGJA 3WJXA 3M5XA 3SSJA 4HNVA 2VELA 3NPVA 3B0PA 5AC7A 3DKLA 5IBXC 1YTDA 4LU0A 1SU5A 7TIMA 5FEXA 5AYXA 1NSJA 3W7DA 1G4TA 3O06A 5F4WA 4BI7A 2BXVA 4UC5A 1OFRA 1W8SA 4ALDA 3KVMA 3IIOA 3PBVA 2A7NA 3O05A 3LI1A 3GZ3A 2JKEA 3ZFHA 2I9EA 1TPUA 3N2XA 3U6WA 1SO4A 5AHEA 3N14A 4GUJA 1YLVA 3OBKA 2NUYA 3CWNA 3PULA 1ICPA 2FQIA 2YYUA 2ZZ1A 3W2MA 1JVNA 3G0XA 1ZFJA 1AK5A 2OCZA 1S5WA 3NL5A 3NOEA 1TYGA
chains in the Genus database with same CATH superfamily
3NYZA 2EQDA 2VENA 4DJEC 4FXJA 3PFRA 3MUY1 4O1EA 4QEEA 3KDOA 2C79A 5HWNA 2VFIA 3QTGA 3KOWA 2I5QA 1Q6FA 5DQPA 3WD2A 3D47A 1XBVA 3M44A 1PEZA 1EDTA 4YTQA 2RUSA 5A6BA 2AMGA 2GUYA 5I00A 4S3KA 3DU0A 2FVKA 4PB3A 5JXQA 3TA9A 4ZVJA 1QU4A 4ADSA 4LVDA 4FB7A 1NP2A 2Y70A 1G9HA 1OFPA 2BFGA 4S3GA 1ZBVA 4HHPA 3CU2A 1V4YA 3B8WA 3E5BA 4PMYA 2IMRA 1R8LA 3WFAA 2G3NA 4EAYA 2GQ8A 4CQ9A 3AYSA 4LTSA 4XAYA 1MXGA 4HPHA 4XZ9A 2BXZA 4AD4A 3L21A 4OE7A 1XLKA 4W89A 4PULA 3WJZA 1R0MA 2DU2A 3AI0A 3ZLHA 1S46A 5LNUA 4OOZA 1J10A 4ZODA 3LTSA 3UXKA 2DZTA 4FS9A 3RUBL 3NXLA 2WCSA 3NXFA 3DECA 2ONEA 1DJXA 1WOBA 1W5PA 3F4WA 1KO0A 1XPYA 3AQUA 4LSBA 1W9BM 4B15A 1AH3A 3I3EA 4C7GA 3D0CA 4CUCA 1RR2A 3DC0A 4O1BA 4PEKA 4A35A 3KHDA 5AOUA 3RM8A 1R30A 1DJWA 1J2BA 1EJRC 1UC5A 1ZHAA 3HU7A 4L7ZA 4W5ZA 3TLLA 4XZIA 5DMNA 2XG9A 5FAJA 5C9WA 3CHEA 2Z1VA 3W1XA 4JNMA 2ZRWA 3VILA 4IX0A 5DMYA 2GQ9A 2ZZ2A 1FH9A 5CPSA 3ZZ1A 4MB1A 3MQTA 4IIGA 2Z29A 4WRHA 1WDSA 3CUXA 2ZRVA 4DBSA 4GI6A 3KBSA 1UIPA 2B7NA 1C9DA 3KBNA 2G96A 3SUSA 1F6PA 3P8JA 3MB9A 4H8VA 1ZJIA 1TV8A 3TP4A 4NZ1A 2J8FA 4NZ3A 2OWCA 4DM1A 3MVTA 1LT8A 2UY4A 3NWRA 2V2CA 3S1UA 2Y7FA 2CZVA 4OZOA 1CB2A 4GY0A 3R94A 3E0VA 3ZSTA 4PMJA 1XRFA 4P8XA 3UWZA 1GPWA 2VO5A 1ELSA 4R27A 3ONBA 3R8HA 1R9XA 1ADDA 4DYJA 3TJLA 1HG3A 3BAIA 3EA3A 3PK7A 1A3HA 2OZ3A 3EWCA 4K1WA 2ZADA 5ABGA 2VRJA 1R3SA 1GVEA 1FKWA 1SZEA 3TC3A 5FJUA 1KGXA 2ZZ3A 3CZGA 3KUMA 3ZJ6A 2Q8ZA 3H70A 1WAWA 3L66A 1E4LA 1FH7A 1OJXA 4J2MA 2ANUA 1KFBA 3I10A 1QHOA 3M6YA 3TUUA 1B3XA 1V8EA 3VUSA 1V6XA 1J2WA 2XFYA 5I7GA 5LKYA 5AVNA 3EWYA 3GFXA 3MCNA 1KFJA 2POTA 5I3KA 1THFD 1IGWA 2P8BA 1FWCC 4GYKA 2E7FA 2V3EA 1TPEA 4JIQA 3M0ZA 4MAZA 3PUEA 5K9DA 3SQSA 1W37A 4YCPA 3TYDA 4MUPA 3CPUA 2LLEA 3VMOA 2PTZA 2C6QA 1EFZA 1NM9A 1RCOB 4LGXA 4DBEA 1WCGA 3S42A 2OTDA 2QZRA 4Q4SA 1MSSA 2E5DA 5K9XA 1P6WA 1JGMA 3A3HA 1A3XA 1UD4A 4F0RA 1AL8A 1JCXA 3NQAA 1PIGA 5D30A 1RBAA 2I5GA 2B0MA 3G18A 3KAOA 1SM9A 3HGJA 4GC4A 2VWTA 4JTFA 1B3YA 4GX8A 4A21A 4J3TA 5IFTA 3LENA 4JIHA 3VDHA 2RAGA 1W1IE 2QAPA 2PGFA 1FKXA 2FB3A 3HZ3A 3BLKA 4N9BA 3QVQA 3PZUA 3ZVHB 3NQMA 1QTWA 3UZJA 4M19A 3SGUA 2X2YA 3N29A 2VM8A 1DPMA 1XDJA 3A6OA 3E38A 3RRXA 1JZ2A 3I6TA 5XIAA 3ARVA 3GHTA 1EP2A 1H0GA 1E9YB 5CSYA 3PB0A 3EDFA 3KOYA 1VEMA 1QHPA 4GVGA 3IRSA 4OUEA 2HS6A 2GDUA 4PTVA 4PCSA 2D1ZA 1Z8AA 2XFWA 1VCGA 2PFHA 1VH7A 4DNHA 3NYDA 4TVDA 1NP0A 2XM2A 3CV6A 1DXFA 1FOBA 2E8YA 4N02A 4AMCA 1XIJA 3IVSA 3U2ZA 4W7WA 3RM9A 4UTWC 1Q6RA 4W8BA 3AHZA 4RKAA 4E2DA 2CC0A 5EMJA 3TZNA 4LVFA 1YMYA 1UIOA 3LGDA 3ZSSA 1B2YA 1BVZA 3HV8A 2NQHA 3C2RA 3GXMA 2ZE3A 4QNEA 1P0DA 3NM1A 2B81A 3WDRA 5C54A 3NL6A 1RP9A 1A5BA 3JS3A 3LPOA 5FF0A 1R2SA 5C5YA 3BCDA 4DO7A 3E0IA 1R3TA 4O28A 3GUGA 5EA9A 5G4HC 3HOJA 2XIQA 4IIHA 3VO0A 2D22A 4GK8A 4GINA 1JPHA 5C71A 3MDUA 5BMWA 4HZ7A 3UWYA 1KQYA 4IQDA 4R5EA 3SQMA 2WNWA 4PRWA 1QI5A 3ZM8A 4TX6A 1KTBA 5AVHA 4IQLA 2HCVA 2XZ7A 1IEQA 4LYKA 2FGZA 4AD2A 3UWEA 1JQVA 1AMKA 4JN7A 4NX5A 3VZYA 3SCRA 2I9UA 4GI9A 3R13A 5M17A 4AYGA 1V51A 4DJFA 2WVSA 3H21A 4NRRA 3GVWA 3VKCA 3PG9A 3RCNA 1P0KA 5HUPA 4DUOA 7ENLA 2V67A 3UWVA 5A94A 1KBJA 3L2IA 2HROA 3QV7A 4UR8A 3THUA 2W67A 3L7RA 3TJXA 1AH0A 3EX4A 3W76A 3AJXA 4GQRA 1KRCC 1DIEA 4LBSA 4DLFA 4NI8A 4E4FA 1BQCA 1LBLA 3NL2A 3W72A 3QJAA 3QGVA 4LNCA 3H55A 3EB3A 1W3NA 4D2JA 3U48A 2YDRA 1GOMA 2X40A 3VDAA 1MO0A 4Q4QA 2BVWA 2XSXA 2QMJA 3S2JA 3VKAA 3CZKA 5KINA 1Z3NA 4PRRA 2NUXA 3TEVA 4X61A 2GVGA 5F1VA 3LDVA 1V0KA 2Q3RA 2TYSA 2NSXA 2PAJA 4QISA 4IL2A 1W1ZA 5DF0A 2BASA 1TELA 1JI2A 2R91A 3R10A 5KZ6A 5FJOA 3F03K 4TQTA 3VZZA 3U0HA 4B9ZA 3PN8A 2NX9A 1RJRA 4QXIA 1EZWA 1AODA 3TNBA 4ONVA 5EMLA 4PTDA 2VXNA 3INPA 1BTMA 2HJPA 1RLDA 3WMBA 2CCRA 3VUPA 2C3ZA 2OFJA 2CLIA 4U5IA 3AYVA 2C19A 1Q63A 3S5NA 4UNLA 4O0KA 1QOXA 3R0UA 3FAXA 3V0TA 4JX4A 1G7VA 1C92A 5DN1A 4Z0JA 2FZ8A 3K2GA 3W7QA 4YWSA 3R2GA 3GHUA 4WDWA 4DJFD 1QNRA 2R94A 1MVYA 3G3DA 3DN5A 3TW6A 4GIYA 1BSIA 3UXLA 4N0RA 3V5CA 2C13A 4HMCA 3TSBA 2Y8VA 4LAZA 4KPLA 4O18A 3C3NA 3UU0A 3SDOA 2F2KA 4YYFA 1DHPA 5FCZA 3QLLA 4OQVA 3BMVA 3EOUA 4J3UA 2J8GA 3MA8A 5CGMA 4LFYA 1L2QA 1EEXA 3E02A 3OVGA 3TYEA 1A5CA 3UESA 3AXIA 3P93A 1FWRA 4J27A 1XLBA 3USBA 1GJUA 3CQKA 3GYEA 1MRQA 3W37A 2GDQA 4EWJA 4US6A 3WH8A 4BWLC 4DYEA 1ZPTA 1UZ1A 3G5EA 3TCEA 5CSSA 3MP5A 1BKHA 1UROA 1UYQA 3M0JA 4BKNA 2RKXA 4J7RA 3W3OA 1LLWA 2HE8A 5LHEA 2ATMA 4Q33A 4EIVA 1W8GA 2PDQA 3PSWA 1LQ2A 4FF7A 4HA1A 1RAKA 4RNIA 1ONRA 4XVDA 3ZLGA 1LZOA 2WLZA 4G7EB 4QFUA 3H6OA 3WF1A 3RCMA 1BF2A 1TX0A 3K1GA 3WFZA 2BOFX 4HBKA 2VFDA 2SFPA 1PWLA 3BV4A 1MFUA 5G1YA 5EU9A 3H12A 1VQTA 3KLKA 4S38A 1NF7A 1UKQA 1V7AA 4I9MA 1EB3A 1K70A 2PBGA 9XIMA 1AFSA 4Q4PA 4DWSD 4S23A 3NJ3A 2GQ3A 5KZDA 3KBMA 3MW7A 3TN5A 3BLLA 3FEMA 3PTQA 3C2EA 1HKJA 3A21A 2D69A 4CNTA 5C55A 4QS5A 3VFCA 2QJGA 1UQYA 2XH0A 2VDGA 3ZOAA 1QJWA 3T81A 4L5ZA 4PL2A 1CGWA 2QV5A 3N17A 3PZGA 1A5LC 1K9EA 1AJ0A 2AMXA 4LVGA 1E0WA 1S39A 1W5QA 3PM6A 3M43A 4DXXA 1LT7A 2W9MA 2BODX 3FGCA 5CC6A 1JDCA 1MEIA 1QI3A 3MBDA 1OC5A 1FRBA 5DMMA 2OQYA 3SADA 1OX4B 1F74A 1DJQA 1TPH1 2PD9A 3U2OA 3SGZA 1E6RA 2B4GA 3AAMA 3XIMA 4IQEA 1UJPA 3NDZA 5A8GA 3CB3A 3DFHA 4X63A 3OBAA 3VD9A 3IVTA 2VQUA 2DIJA 2XN0A 4DPQA 3BMWA 3CHVA 3MI2A 2HBXA 5D8ZA 2PGWA 3SN4A 1JNDA 5LSMA 1YYAA 4YU1A 4I8YA 4JKLA 2UWFA 1X1OA 4QJ5B 1RK6A 2EAWA 3WH9A 3WSUA 3G22A 3MSRA 2W66A 4M51A 3W82A 3MT1A 4A3RA 2Z1XA 1TV4A 1BSLA 4QBXA 4YXGA 1PPIA 1EX5A 3A5VA 2PD5A 7XIMA 4WKHA 5TNVA 4NI3A 5IRPA 5E09A 2VEKA 1JZ4A 3FKKA 1IQ8A 2C1HA 3FYOA 4JKKA 3PZIA 4U5KA 1XLEA 3TOPA 1VPQA 3PB2A 1XYZA 1BPLB 3L68A 4JOMA 3UJFA 3SRKA 4O10A 3H4XA 3FYPA 4LJ3A 2ZRYA 1E9IA 1JCLA 2J62A 5CXPA 4L1GA 1Y0EA 3RIKA 4CD4A 4JL1A 4MUZA 4NZCA 3T1GA 2HNEA 2QCHA 2ZFAA 4L65A 4DF0A 4UQEA 1SZGA 1KLZA 4FA3A 2V81A 1DWAM 3W74A 3WQ6A 1LWJA 2VHLA 5HATA 3CL8A 1P6CA 3IGHX 1E6PA 2Q8XA 4GNVA 5H1WA 1FH8A 1KXHA 4PZVA 2GGJA 4ASTA 2OZ0A 2KX9A 3L0NA 4XD6A 1S3TC 1XL9A 1FHVA 3RU8X 3WQ8A 1YDVA 1KNWA 1F76A 2VGBA 4KCUA 3R0KA 1H5VA 4H7CA 1A5OC 4XKYB 3VINA 3UR2A 3ZWTA 3QC3A 3E96A 2YCKX 3N9SA 3TR9A 3CT7A 3UPWA 5A2BA 4AWUA 4E4PA 4B5VA 2IKIA 4LCRA 2I14A 2Z7KA 4BJHA 1S5VA 1NWTA 3W1UA 3ES7A 3ECQA 1VFFA 2EJAA 1QOPA 3BTNA 1E4NA 1RA5A 4GQGA 1KD0A 3UT0A 3PAJA 4RZ4A 5C9XA 1CZ1A 1IR2A 1VFUA 2Y1HA 2UZ9A 3HG5A 2WVVB 3E0WA 4ICCX 1Y8BA 5EGRA 4WGXA 3RRAA 1Y65A 4ZR8A 1F4HA 5DCDA 3T55A 4ZQOA 4KIEA 1VBRA 1EGVA 1RUSA 1VLIA 4GXPA 1Z7AA 3U7BA 1EHAA 4F2TA 2PLMA 2QJIA 5DXXA 3HF3A 2EXOA 1RCQA 3ICJA 1MDLA 5A6JA 3HO8A 6XIMA 5GNZA 5AC6A 4QDMA 3W7GA 5KZEA 3H2AA 5GJNA 4ILSA 4GUHA 4MJMA 2GOKA 5BOOA 1KBBA 1TUXA 4HTBA 1F5ZA 1MUMA 3W88A 3VOIA 3WDHA 3DERA 3AUOA 2V2HA 1PHQA 3ZJ8A 2NQZA 3WD4A 4WDTA 2E6YA 3CO4A 1VD6A 3VD4A 1HJSA 4A29A 2VEFA 5AYZA 2VCAA 4IICA 3MPGA 1KXTA 2PDXA 5CPMA 1PE1A 3ITVA 3S5ZA 4JXCA 1H51A 5HWJA 1GHSA 2DT0A 3QMTA 3T0AA 5B7ZA 2YFOA 4UZSA 1OX4A 3GVQA 3LGEA 3HPSA 4WOQA 3OTRA 3KEHA 3V0UA 1MYRA 1NQKA 5EMKA 4HA0A 5I6SA 1QXLA 3WQFA 3OQ8A 3CS2A 2YL8A 3PJXA 3W27A 2DT3A 2X0YA 2F9RA 2Y0FA 2BXYA 4MMWA 2NUWA 3T7VA 1TIMA 1WKEA 4LALA 3T05A 3GNOA 1ZTVA 4AF0A 3D3AA 3WEMA 1CGTA 5AHMA 1V6YA 1AMYA 3VD3A 3WQGA 4GPNA 4EANA 2WJEA 1LP6A 3EMQA 3A9IA 3H23A 1JUBA 4IIFA 5A2CA 5BZAA 2JEPA 4CKQA 4I5XA 4X0NA 1V3IA 4A3HA 3T6CA 3ZJ7A 3DC8A 3S2NA 2PBOA 2ZVRA 1EJXC 4DZ5A 3PANA 1ZBWA 1DYSA 3BANA 3W2LA 3F2BA 3IJ9A 2DJXA 2BZNA 1OG0A 3VNMA 3BLOA 2XDFA 3G0UA 3AMCA 1XG3A 2X1IA 1X98A 3T9PA 4XAFA 4MZ1A 1I6NA 4S3BA 3SY1A 2JGQA 4GRSA 4ZA0A 1EBHA 1C9WA 4HSNA 5HJYA 3AIUA 3F4DA 4OVXA 2PS2A 3P3BA 2XISA 4TR9A 5G2HA 3O07A 4G8TA 3C4UA 3JRKA 2FDSA 2QCCA 1EOMA 3BH4A 4Z1DA 3FX4A 4JQAA 3B8VA 3VNIA 3MHGA 1QW7A 2YXGA 2YDQA 4ZB0A 1CW2A 2OZTA 2WV8A 3PBUA 2DUAA 2TPSA 4U10A 2FYMA 1GG0A 4JIRA 3GS6A 1JCMP 5CGQA 4GCAA 3WNOA 1FWTA 3A64A 4Q3MA 2DSUA 1J0ZA 2YB4A 4X9YA 1EGMA 2J79A 3H7RA 4ZQMA 3RNDA 3HURA 5I06A 3MMTA 5LIKX 2XFFA 4IHCA 2J78A 4YJ5A 2WOQA 1U22A 4MJ2A 3GFYA 1HKMA 3P6LA 1UASA 1ENUA 4JX5A 2GOUA 3MCOA 2AL2B 2A79A 1BQGA 3HQPA 4RZ5A 2OSWA 4C6EA 3FXYA 4NYYA 3N15A 4WDXA 5K2ZA 2ZXDA 1YXCA 3DESA 4R53A 3M16A 4ENLA 1SO5A 5HANA 1DV7A 3P82A 3GXIA 5JH1A 1PCKA 3BE7A 5F4SA 1XLCA 2QGHA 3PPHA 1MXSA 4O54A 4JNZA 4BEUA 4FX8A 3R12A 1JCTA 2DIEA 4ORMA 1A5NC 3TN3A 3LSCA 3F4CA 4A6GA 1XI3A 1LQAA 2Z4GA 3BICA 4LC8A 4UTKA 3E2VA 2OSYA 1J0JA 1OIFA 3GU9A 4JTKA 4H7ZA 1LRTA 4FNPA 1TSIA 4GGHA 4H6QA 3TOYA 2XIOA 3TQVA 2HVMA 4NASA 4ZE5A 3EWDA 1E4MM 2UY3A 1LRNA 3P67A 3RJXA 2QJMA 2WZIA 3W1MA 3W2NA 3SY5A 5CEWA 1M7XA 4HU4A 1HO4A 2GUBA 3EA2A 4DVOA 3VKBA 3IEBA 4HCHA 3O15A 1XYBA 1GZ1A 1ZP3A 1QOQA 1Q6OA 1M01A 2OOFA 5FA5A 1EF2A 3IWPA 2GDVA 3EB4A 4MADA 1ZAIA 3CUJA 1POJA 2H8ZA 3N11A 3W87A 3VCRA 4MLJA 5A6MA 4QNWA 2A3BA 5AZ0A 5FAGA 1B5TA 3G8EA 2O56A 5HMSA 1JUEA 1DJIA 2VX5A 3PHAA 1V02A 3QM3A 4IWWA 4Y90A 3VKJA 4LS2A 1KRMA 2DT1A 1DWIM 3ZO9A 2ON3A 3EPOA 3B8DA 3KRSA 3LX9A 4UOZA 2XWEA 4C1NB 5LXEA 1OFOA 1HFBA 2D73A 3S3GA 1VBUA 5ABFB 4F0LA 3VGGA 3DOPA 4JN8A 1XP3A 2A3CA 3I65A 4U28A 1KCZA 2GQAA 3RPDA 2DORA 1KM5A 2OEKA 3W6YA 3N4EA 2GGIA 4HK6A 3S1XA 5TAOA 3BAJA 5CPQA 3M0VA 4XO7A 4LUTA 3PZ9A 1XSJA 1I2QA 1WB0A 2ZA3A 1MEWA 1VYPX 4LS0A 1N8FA 3SCOA 1H7WA 4AIUA 3CUHA 4ZEPA 3W2KA 3ABOA 1KKOA 1SZNA 2WMGA 1KFLA 4FMVA 2NZLA 2VCCA 3W1LA 1BYDA 4ZTXA 2IPGA 3UWUA 2BMBA 1EO7A 3HPXA 4GYPA 4F2BA 2FH8A 4UQDA 4EF9A 1TQXA 3GTIA 1JYWA 1O95A 1V0NA 3H2NA 5DELA 1FXQA 3RXZA 2B7OA 5KZMA 2FPVA 1M7JA 1OCJA 3GAYA 6XIAA 1ISXA 2DZUA 4IX2A 4M6PA 2O0TA 2Y2WA 1KWGA 1X8CA 4CVWA 1VBJA 3L67A 3C61A 3WJSA 1OK6A 2BHUA 4TX9A 4KCVA 1UR3M 3UJRA 4ZQRA 2ISSA 1M3UA 1ICQA 1PIIA 4DO5A 5DBTA 1E9ZB 1J96A 1UWRA 1BGGA 3HV9A 2QT3A 3EKLA 3W7EA 1G7UA 3OGSA 3HPAA 3I6RA 3Q4DA 4XKMA 2OMAA 3HM7A 4M1BA 2QUTA 3B8UA 1GZGA 1VJZA 3IUDA 3F5JA 4PEEA 4N2YA 2J6VA 3VX0A 3OIHA 1DWJM 2VQTA 3GH4A 3C2FA 3ITTA 1LDCA 2XINA 3DEQA 1WDWA 3MHFA 5AHFA 1DJNA 2X1SA 5IOBA 2JALA 3AROA 3TMLA 4AFYA 3VMPA 4GZ7A 4MY8A 1FP9A 1UUOA 1A5SA 3QW4B 3A9BA 2X42A 1V3KA 1A5MC 1P43A 3LMYA 1U1HA 5EMUA 3VOFA 1K3UA 4YS1A 2ZTKA 1RPXA 3WUFA 1JJKA 1TTJA 3G77A 3SCUA 1I9CB 1KFCA 3WZ0E 4WIWA 1A50A 2H9AB 2J7EA 3UVIA 2HWGA 5CPTA 5HJXA 4GX9A 4JTTA 4GZEA 3PPCA 3W7LA 1XJBA 2WM1A 1W9PA 3NPWA 3SIMA 3EPMA 3SI9A 4E2BA 4HOWA 4HJFA 4Q7BA 5LXXA 5F2LA 3N18A 2WCAA 4O19A 3UNDA 4BY3A 1DJZA 2VZVA 2CWNA 4HSOA 3WBEA 4L4OA 2YA1A 4NSBA 2GLKA 2C15A 5CLWA 1RQEA 1CXIA 3LXCA 1NEYA 2QCFA 2CLHA 1P0NA 3PZTA 4ATDA 4OBSA 3LPGA 1T41A 1D8CA 3UJSA 4OU1A 1T5AA 1BXCA 1ME8A 1A5AA 1JAKA 1E1FA 3ES8A 1FWGC 4H2CA 1SQ7A 2QR6A 4LUSB 1A4LA 3MUCA 4M7TA 4B3ZA 4S3JA 3NGJA 3WJXA 4DWSA 1W1VA 3SSJA 1HKIA 2VELA 3NUKA 3B0PA 3N6HA 3P14A 2HXUA 4OOUA 4UCFA 1G4TA 3O06A 5IXEA 1W8SA 4QG9A 4ALDA 3IIOA 3KVMA 3UEQA 1TPUA 3BJFA 4HHLA 1YLVA 3MSYA 1US2A 2OX4A 4EPEC 3GG0A 4GMEA 3HFYA 1ZFJA 3T0BA 4CNUA 1HN1A 4TV5A 1S5WA 3NL5A 4UZUA 3NOEA 1FVPA 4O53A 4YPJA 2CBIA 3NSMA 2Y4SA 1GYNA 1YPIA 2GUUA 3MO7A 4LUSA 6TAAA 4S2CA 1H41A 5C70A 1F3EA 1FHDA 3E3HA 1SFTA 4IP5A 4GYFA 3BARA 3W1RA 3LV6A 5CC5A 3QBUA 2Y85A 5T9BG 2WB5A 1HO1A 2OLAA 4JTHA 4WCJA 3KRBA 4EK7A 4IMEA 4IXHA 4ZXLA 2X7WA 1F07A 4QAWA 3G6LA 4XIAA 5I23A 3AMGA 1KTCA 4DY1A 4Z1AA 5CQ1A 3CAKA 4R88A 3ARRA 4AZ5A 1E3ZA 3A3XA 3TMQA 3TQ0A 2OSXA 1E51A 3ITYA 3FA4A 4J3ZA 4QE4A 1YTKA 2EJ1A 8CGTA 4QLJA 1GVIA 1W17A 2O9PA 2EG8A 5BU9A 1A0CA 2WCGA 1RY0A 3V1PA 4GGBA 5C8BB 2GPTA 1QPOA 3TDFA 1OY0A 4E2VA 3KHJA 1WNOA 3C8FA 5CG0A 5GJMA 1B31A 4FNRA 4P7QA 3NIYA 3D6NA 2VMFA 2F7FA 1WXYA 1BFNA 4LUYA 4CU7A 1FWNA 1UKSA 4H9YA 3TKFA 1H7XA 4I6KA 1Q7ZA 3A4JA 1PBGA 1W3JA 1XIGA 1IXNA 2ISDA 4O50A 4KKXA 5BXPA 1I0DA 1IEVA 4CNNA 4F3HA 5J5DA 3F4NA 3WH7A 1BWLA 1TPB1 1EQCA 1Z41A 5CJNA 4X0VA 1W1TA 2WMHA 2VFFA 2P1FA 5A2AA 1TWIA 5CH9A 2PURA 1EIXA 1W6TA 4C60A 2FHFA 4FLSA 1FWDC 1XGEA 4PTXA 1VLWA 5A95A 3LBOA 3BW4A 3OB8A 4O0QA 4E4UA 1VRXA 5GVJA 1XCWA 4UFMA 1XIIA 3C3UA 3R7MA 4FNUA 1EA9C 3B4YA 3TN4A 2QDHA 2VFGA 2I5IA 1XIEA 3TTYA 4A8LA 4XAPA 1FWBC 3SCPA 1LWHA 3G1SA 1DWHM 4J40A 5AZ1A 3BURA 3LK6A 2VGIA 2QNEA 5I09A 5F2MA 1H3GA 4GABA 4YL2A 3ELFA 2BOEX 1TWDA 1XLFA 2AKZA 1F7BA 4JQ2A 4HOZA 1TPWA 1KRAC 2BY1A 3RU6A 3ARSA 1PS9A 2YLLA 5HNNA 3VNJA 4GCXA 2X1RA 3UW6A 4LUTB 3A5FA 4ERIA 4RDVA 1BGAA 3RLGA 3D5HA 4H6KA 3O7UA 5FJRA 5H8PA 3OG3A 4Y9NA 5HBFA 6TIMA 5C2CA 2EKGA 3T0TA 4NY2A 1LYXA 1VP5A 3ALGA 2YA2A 1CXHA 1VS1A 3ME3A 1TPVA 3UZXA 2I16A 3REQB 4DWSB 3P7YA 5LNVA 4C6DA 1EA0A 4WJEA 3IJDA 4IJRA 1Y7VA 1CXFA 1AW1A 1E43A 3QN3A 1QUMA 3HA1A 4HK7A 4MFDA 2PP3A 2INZA 4I6VA 2F2HA 4PTWA 3AMKA 4ICMA 1EJVC 5DT5A 3BV7A 3CYVA 3LCIA 1QR7A 4UTMA 3VNZA 3HG4A 2C18A 3W23A 3TYUA 4AQLA 1XLMA 5MF5A 2A0NA 3QSTA 1YDYA 1JDDA 4JTEA 3PJTA 1KB3A 1LLZA 2W91A 3S1VA 5CBBA 2BOGX 2Q01A 4UFLA 4V2XA 4HNNA 3LYEA 4G7EA 5DY2A 3VK5A 4S3FA 1D8WA 1TWSA 3VGHA 4NX0A 4D8ZA 1TJ0A 4L61A 2Y5SA 5EYWA 1TR1A 2V8ZA 2E40A 3PZVA 4GIEA 1ODZA 3BQ5A 2G97A 2MANA 1KFWA 3QZAA 1REQB 2YZRA 3OPSA 3OZYA 1XIDA 1LORA 1XISA 5ABFA 4EXAA 2PC8A 5E70A 3VIJA 3UVAA 4IMCA 3RJYA 3A22A 3WBYA 3FVMA 3LLDA 3FA3A 1P5BA 3TYZA 2WJZA 1O66A 2J88A 3OBEA 3II1A 1E1CA 5EBUA 4UTLA 1E4IA 2E68A 2E9MA 2FHBA 4RUBA 2CFFA 2Y5EA 2PWDA 1FDJA 3L2LA 2R1NA 4P2VA 5JIWA 1UUMA 2E3ZA 4ZQPA 4W5UA 1R3WA 4QP0A 3QPYA 4XO6A 3GR7A 3WD1A 6CGTA 1AD4A 2XGZA 4OJYA 4AC7C 3AXKA 4FO4A 3N2CA 1TZ7A 1K7FA 2OT1A 3E2QA 3AHVA 1LM1A 4CQDA 2V2DA 3WLNA 1WBHA 3R1ZA 1T99A 4PMOA 3AMDA 3VGDA 2OYMA 3P8IA 4UFKA 3QRHA 4HNCA 3SCNA 2AL1A 2QF7A 2UV8G 5ABEA 1E0XA 1X6LA 3KBJA 1HZYA 4L80A 3N25A 1EWEA 4A3YA 2WMKA 2E25A 1SGJA 4LRSA 4JFTA 4GVIA 1E40A 3M7SA 5CKSA 4NRSA 2Z1KA 1JDEA 4B5TA 1MW3A 1QO5A 2DW6A 2Y88A 4LAUA 1YEYA 4GYJA 1KR1A 4M80A 4Q8TA 3GH7A 1D7KA 3R79A 3ZIZA 5FF7A 2DVTA 1YPFA 3HIJA 5XIMA 2BGNE 3L9CA 1SPQA 4KMQA 3T0CA 3VI2A 4GJ1A 1HP5A 1M5WA 4DNMA 1UKOA 1EEPA 3TZFA 1ECQA 3ZT7A 2GVEA 4O1FA 4ROQA 5D9PA 3M5VA 4BCEA 1N8WA 3HB9A 2ISWA 3LCHA 1VFSA 2HVOA 1UH4A 1F3TA 2Z00A 4RDYA 2WBKA 2QYGA 4P7NA 3SCSA 1TE6A 3LLXA 4MVAA 3DHUA 3EPNA 4N4QA 2Q8LA 5LNWA 2I56A 1TWZA 3PZOA 3H53A 1A49A 3DYMA 1KM2A 4JYFA 1ZENA 5G2WA 1TRIA 4REQB 1R7AA 4GQ0A 4GO9A 4MF4A 4OWGA 3WEZA 4MYXA 4MHBA 4L9YA 4CU8A 5A5WA 2WC7A 3E9AA 1YHTA 3MJYA 4NAFA 4HHHA 4MTVA 4MPKA 1Q4WA 1HUVA 1TMHA 1ZLPA 1JEZA 4R34A 1Q4NX 4EVZA 3FDGA 3TJIA 2I1OA 3B97A 3GXPA 1W91A 2J9YA 2P3ZA 4L4LA 2POZA 2QJHA 2V3GA 2BX7A 3GFZA 4GHRA 1ZALA 3CBWA 3N13A 3MDWA 2DSVA 2QAFA 3IAQA 4MB4A 1KXQA 5IHSA 3VM7A 4BZYA 2Q09A 3LBMA 5AN7A 5ECUA 5D02A 4W88A 1L8NA 2XH4A 3PS7A 4TTUA 5EY5A 4RPQA 2RH9A 1HJQA 4DJED 1K9TA 4HK5A 4URIA 2GSJA 3KVJA 2BSLA 3M0MA 1ML1A 2E8ZA 3HGRA 1H1NA 3ARUA 1X6UA 3CTTA 5JUVA 1MWOA 1R7OA 2J74A 3QQWA 5DBUA 3CQ0A 2J75A 3WLKX 3GD6A 1EJ7L 4K68A 4WX2A 1F05A 4XUYA 4GIAA 4HZ8A 3PBGA 5BCAA 3MC5A 2OEJA 3RAOA 3GH5A 4C6MA 1SVDA 1OGSA 1Q65A 1R3YA 2DZBA 1OFQA 1ZCCA 2ZRZA 5E9AA 2REQB 5E0CA 3WEOA 3G1VA 1XKYA 3CMFA 3T78A 4OFCA 2PCEA 4C6FA 1N7KA 5DY3A 3LRKA 1CEOA 2OVLA 4TMCA 4IGNA 5EMYA 1L0PA 3MWAA 3GTXA 2VT0A 3KXQA 1RALA 4XZLX 4QS6A 4IPJA 1OCBA 4YIWA 1U33A 1O1HA 3RYSA 2EPLX 4A8RA 1XV8A 3GUWA 1LBMA 1NVMA 1EWDA 3WK3A 4ZO9A 3KZPA 2DVXA 1B30A 3WLSA 2WW5A 1SZFA 1IHIA 4M81A 4CU6A 3MHUA 1W5MA 3W7OA 1E5NA 5H91A 3DYOA 3TSDA 1UWQA 4HIBA 1SO3A 1EPXA 2REQA 2IUZA 4IL0A 1KM3A 5TF0A 2GJXB 1G69A 3CH9A 2GFTA 1WDDA 1ISYA 4ZMGA 1GONA 2Y63A 1W31A 3M41A 4WZHA 3TQPA 1ZNNA 2YZ5A 3FFSA 3S1GA 4MNMA 4DF2A 1V6WA 1L6FA 4US5D 2X1UA 4O1AA 4O11A 3UPBA 3EDEA 2ZX8A 5HR6A 2J24A 1QI0A 3CUGA 4EPDC 1XRSA 4XQ6A 4WJ8A 4B92A 1MW0A 3HGOA 3S1WA 1QBAA 4CQBA 3MJMA 2RDXA 4F9DA 4KWOA 3COTA 4YVVA 1TV2A 1TVLA 4KWSA 4L9ZA 5C2GA 5KSWA 2Z26A 5HA7A 3VC5A 4N6FA 2VJXA 3HG3A 3ABQA 3NQBA 4B5XA 1S2TA 1IR1A 4JEJA 1UQZA 9XIAA 1ZP4A 1NWUA 1IXQA 4ZO6A 1NJJA 3KDNA 2CXGA 4QRNA 1XBYA 3ARZA 3CLWA 3I6EA 2D3NA 4XZMX 1OFAA 4FLQA 3T8QA 3VKKA 3P74A 3TTSA 2HMCA 3GIQA 1JL8A 3WK0A 3S9IA 1LUCA 4EPKA 4IPLA 1EYEA 4WY0B 1E55A 3MY9A 2G3MA 2PDCA 5AC5A 3AIQA 3ARYA 2QVHA 3GC4A 3NAVA 4AF0B 4PUDA 5E93A 1KRBC 3BG5A 3NQ2A 5BWAA 3QQ0A 4PUJA 4D1JA 4B16A 3V5OA 4DB7A 3C2OA 1K9DA 2WSQA 4KH2A 1CNVA 2AGKA 5TD4A 4KEMA 1CTNA 1VF8A 5G2IA 1PX3A 3AXMA 4NUWA 2PZ0A 3WQOA 4AHPA 1AW2A 4FR6A 1I75A 2HK1A 3GKFA 4F0HA 2QIIA 1O5QA 3AICA 2NXIA 1N2VA 4US5A 1RP8A 1V0MA 1Q8AA 5CZTA 4DBWA 2PEVA 4NZJA 4EP8C 4AD0A 4BR1A 2EF9A 3C2VA 4QCEA 3UY7A 1Q8JA 2YCIX 3EAUA 4PRTA 2WZEA 2DJLA 4QX4A 4UWMA 2VEPA 1YTEA 3Q67A 4PA8A 1HGWA 2QUUA 3PWIA 3LXAA 1TJ1A 3F1QA 3ZMRA 2BNJA 1QW9A 3E0FA 4HU0A 4XWUA 1OD0A 4IFOA 4DUVA 4DIAA 2ACUA 4JTSA 3KFTA 5I3HA 3VIMA 2Z6JA 3W7PA 1R87A 4MG4A 4K7YA 3S4TA 4KT2A 4WQ6A 1AA1B 3NCOA 4AIEA 1UWUA 1WAUA 2QVNA 1HL9A 2EBNA 3M0KA 3D3FA 2QKFA 5LIUX 3MUZ1 1VENA 5HNTA 2C0AA 2O4MA 2GJNA 5A6LA 4HMNA 2WSRA 1F6KA 3SFWA 4PMUA 4GY1A 1O6IA 3CM4A 5T8GA 3MKCA 4CQ8A 4W8AA 4D8LA 4HOXA 5AYIA 4AEEA 5JBEA 4FX7A 3W38A 1EC8A 2O55A 4GBUA 3W84A 5DLCA 3GNDA 4C6BA 1V08A 2OR2A 3VFLA 4GE8A 3W28A 5AB3A 3N34A 2F6KA 4S39A 2A7RA 3ZJKA 7ODCA 3VNYA 1J5SA 2FJKA 1NY1A 5A6SA 4NZ4A 4HQVA 2QUMA 3JR2A 1QI4A 1LOLA 2YFNA 1OABA 2PLCA 3CZLA 2GK1B 2V3DA 4OV4A 1ZL1A 2OXNA 3K46A 3ZS4A 2BP1A 1FFQA 3SCVA 2WKLA 1M1BA 3DXIA 3BLEA 3B9AA 4QE1A 2O7SA 2NX3A 1HT6A 1ODUA 3CV2A 4M6UA 3W26A 4MWAC 1WZAA 1Z89A 1OFBA 3EWXA 3TYCA 3JZEA 4H00A 4ZQCA 4DJDC 1U83A 2RJHA 4FPSA 4YHEA 5D04C 1IT7A 1PZ0A 3I3DA 3WK2A 1IGSA 1J8VA 1QWKA 5FF2A 2RDUA 1VAHA 3KBVA 4L4PA 4BWLA 3GVGA 4IJBA 3O63A 5C7HA 1M7PA 3H54A 3UR7A 3TROA 2DZAA 1SW0A 4IUOA 3PY2A 3WF3A 1JXKA 1RH9A 4Z08A 2FPYA 3O2LA 3AYTA 3NO1A 4AXNA 4XBSA 3BOLA 4U3AA 3B40A 2FGBA 4UQ9A 3UETA 3TSMA 2FGLA 3K8MA 4YHGA 3RFAA 1RJQA 3TVAA 1GGOA 4M6QA 4DEFA 4PMXA 2XJ7A 2F6XA 1JPKA 2KAUC 5FJPA 3LPFA 2G4JA 3TQKA 4LOCA 3USZA 2VRKA 4UMCA 2A7PA 1CX9A 1DEDA 1TCDA 5E6YA 4QE5A 1ITQA 1TVPA 3VDBA 4QDPA 3RPTA 5HQMA 4Q7IA 1XX1A 3CV1A 3H2FA 2O9RA 4JBRA 2J9ZA 2EO7A 2X16A 4L1WA 3W7NA 2E28A 3W22A 4W86A 4ZB2A 5A3HA 5C2XA 2HRWA 1JCNA 4K6AA 1U5HA 1J6PA 4Q8WA 3VD5A 4D6DA 4K8EA 2EEXA 2IXVA 3LUTA 4MLRA 2RGLA 1UKPA 2VZTA 4Q8OA 1SJDA 3E2RA 5D9OA 1XS2A 2JIWA 3AFBA 2PDIA 3QHOA 3ID7A 2G50A 5BXSA 4AUBA 2P8CA 3G3MA 5BNKA 1ITUA 4B5NA 1TA3A 5EB8A 4HA3A 1OYBA 1E71M 2BS9A 2BWGA 3LNMA 1UD6A 3Q45A 1Z42A 1EF3A 4NNAA 4ZENA 3E12A 4V27A 3HPFA 2ZA2A 4LBUA 4EOUA 3VCNA 3M5YA 3LHTA 2WXDM 2HEJA 1Z48A 2IKJA 4XZWA 1T96A 3WELA 1TREA 3SZ8A 4W85A 4AD1A 1P1XA 4C6IA 2ZDSA 3GG8A 3MVIA 4N7QA 3EX3A 4H9UA 4Z1YA 1W56A 5B80A 3ARWA 3GRIA 2E0PA 2CETA 4ICNA 4ERAA 2CBVA 3GXNA 2IQTA 3GLCA 4GVHA 3WBAA 3LQLA 4WKFA 4Y8EA 4JFSA 5EBAA 4Q6XA 4EKJA 3GKAA 3NZQA 3WQWA 3N19B 2W0UA 1E6QM 3AXXA 1W9UA 2NVAA 3TJ4A 5I3DA 4PYSA 5LA2A 1AZ1A 4ACYA 1UPPA 3EOSA 2WSKA 1XYLA 3DENA 6ENLA 2Q02A 5TQLA 3W00A 5FI8A 3QLDA 4M29A 1FUYA 2ZRUA 1A53A 2NX1A 1BVNP 1PJ9A 4O8RA 4OGZA 1E0TA 2Q71A 3IJ6A 1K7XA 3EGJA 3I3BA 3S9YA 1XG4A 5LNSA 2J8TA 3GXTA 4JTCA 4AMAA 4GQBA 4RNFA 2D0HA 4CEUC 4XTDA 5K3VA 3PFMA 4RE4A 1PIFA 2PB1A 3WQ4A 3PBMA 4D8AA 3MWCA 4Y6GA 3EXRA 2YBVA 1W2VA 4GH1A 4RE3A 2DDXA 3QZEA 3W9ZA 2Z1SA 4JHOA 1F8IA 2ZZ4A 5FJJA 4U2ZA 3GR8A 1VIZA 1E73M 4O15A 3KCLA 2CIPA 1M9HA 3SSZA 2ATSA 1R3VA 1US0A 2PLJA 2CLLA 4FOJA 5I78A 1UWIA 1ZUAX 3KS6A 1XRTA 1YBQA 3KOXA 5DO8A 3WBXA 2ZZ6A 4PBFA 4U33A 3U5YA 5MKGB 2C71A 1W5OA 3EX2A 1R46A 4JTJA 2DSKA 3CC1A 1DQWA 4BK9A 1RD5A 2WHLA 4Q32A 2A85A 1D2KA 4ADTA 2XYLA 1Q2SA 4AD5A 1KA9F 3FHAA 3GU2A 2HQAA 5EPDA 3S0CA 5CPLA 2AGTA 1TKKA 5CZJA 2QJNA 4JTLA 1HVXA 2EGZA 1H50A 2P76A 2Z6IA 5HQEA 3LGGA 3W53A 1JZ3A 1DQXA 2NSOA 1AG1O 3QYSA 5AFDA 3CHCA 3CXOA 4CVUA 4NNBA 1GOKA 2NQLA 1L6YA 1PKMA 3QOKA 1C8YA 1F3WA 1LQ0A 1LUCB 4Z2GA 1N55A 4HN4A 3RK8A 3DYPA 3WH5A 3UP8A 3ZWSA 1AQFA 3GIYA 4UTUA 1C3FA 5D38A 2BTMA 1H62A 4GLEA 1LTDA 4KRZA 3HBLA 1QATA 2WQPA 2GWNA 1MUWA 1VHNA 4KWVA 1NOUA 3L4VA 4GC3A 3GDKA 1VR6A 4UMAA 3K4DA 4P7OA 1XM3A 3EMCA 3FJ6A 4NXKA 4GNJA 3WD3A 1A3WA 5M3WA 2QV4A 4XKYA 2D0FA 1MMFA 1US3A 5BMXA 4MY1A 2CLEA 1QASA 1BG9A 1Q45A 4XD3A 3ZXWA 1DIOA 3PWGA 4N4PA 1DWGM 4DN1A 5F2IA 2FFCA 2P53A 3JZUA 3KCJA 3F2DA 1JFHA 1NARA 1CBGA 5CJ5A 2ALRA 4ZBCA 1H1ZA 1XC4A 4Z2IA 5HWMA 3GX9A 4F79A 4HZMA 1ONWA 1MNZA 2YGYA 1NDZA 3KWSA 1CI1A 3VE7A 4XIMA 1HJUA 1SMDA 4AD3A 4JKMA 2Z2BA 3JW7A 4CEXC 4JD4A 4HSHA 3QTPA 1L6WA 3A24A 5JH2A 5BRBA 4NJGA 3B03A 6REQB 4NG3A 1VFOA 1S1PA 3B8SA 3HJZA 5LNRA 5K4XA 4AH7A 4PTMA 3UFYA 1Q6EA 3KVLA 3FA5A 3DKJA 1XIFA 5CZ0A 4JX6A 1A47A 2C0HA 3ANVA 3MV11 3H7VA 1NELA 5DFAA 3H24A 4PMDA 3JU2A 1FBAA 1GCYA 3U9IA 3IJIA 1GWJA 1TTIA 4FXRA 4M5PA 4KFNA 1WYIA 1EZ2A 2ZXAA 1BXNA 4ZSUA 2VDHA 3M9YA 1V0LA 4JN6A 1PSCA 4LY8A 3K1DA 4Q6JA 3NM3A 5FJIA 3TH6A 4Q8NA 1F6YA 3VNKA 4EXBA 4W9TA 3TAOA 3MZ2A 4YWIA 2PF8A 3FIGA 3WCZA 3O1NA 3AYRA 3KZSA 3IAPA 1XYCA 4RV3A 2Y89A 4JCLA 5CC7A 5FKYA 4GXWA 2OLHA 2MUCA 1JYNA 2PGRA 1B0IA 2D2OA 2J25A 3TN6A 3CQHA 2QGYA 1RQBA 3UXIA 3S83A 3NQDA 1H4PA 3RR4A 3AIBA 4B90A 4PSPA 1FCUA 1UH3A 3KP0A 3C52A 3TCSA 4MKSA 3N1AA 1KV8A 3LCWA 2V30A 3WMSA 4IG2A 3QHNA 2OZ8A 2XH2A 1ZAJA 4QQ3A 4LRTA 1U5JA 3AMLA 1IT0A 4GVFA 3MP3A 1Q5MA 2D23A 4P7RA 1GVFA 1D3GA 4HU3A 5T26A 1K02A 1SW7A 3VDGA 3AWNA 1TUFA 3GVVA 4HU8A 3UYIA 3EWBX 1GVSA 4Y9OA 5A69A 3VGBA 1W2PA 5CSRA 1EJTC 3PG8A 4O4VA 2WNZA 5C9UA 4GO8A 4GUGA 3OVRA 3DFPA 1OC7A 4RV8A 1ZB5A 1Q6CA 4INFA 1MW1A 3U3HA 4S2BA 3GDRA 1OCNA 3T4CA 3WUEA 1GPFA 2CNCA 3IS4A 4CCCA 1ZCOA 1DTNA 2HZGA 1YDNA 4B3LA 3FSUA 1ONEA 4AX7A 2QJJA 5KETA 4NT0A 4NVTA 1GT8A 5F4XA 3UR5A 1K1DA 3ABSA 2OODA 1XDLA 1Z6KA 4AEOA 4O52A 1A4MA 2G5WA 4K8GA 2BVDA 1UUQA 4QQUA 4ZTYA 4LAMA 1UWAA 1QPQA 2DP3A 1J79A 3M0IA 1WDQA 3TC6A 1UC4A 3M0XA 1WKFA 4Z2HA 2HE5A 3ZR6A 4OTKA 2DZSA 1GQNA 1XH2A 3APGA 3AC0A 4Q8PA 3UA4A 3ZT6A 2VOTA 4TV6A 1GJPA 1LL6A 4CQCA 1XH1A 4YNGA 5AC7A 5IBXC 1YTDA 4LU0A 1SU5A 4REQA 1DXIA 2TODA 5F4WA 4BI7A 4UC5A 1REQA 1OFRA 1XLDA 4RE2A 2YJQA 3LI1A 3GZ3A 2VR2A 2JKEA 2J7DA 1YE4A 3VM5A 3SBFA 3N14A 3OBKA 3IK2A 2IKHA 1ICPA 1HJWA 1Z9AA 2FZNA 2YXXA 3IACA 4HNLA 4JQ3A 2XH7A 1XD1A 2BY2A 5B7YA 3URBA 1V3HA 4L56A 1JZ7A 5DT7A 1X6NA 3SRHA 4Z2KA 1OIMA 3WLQA 3G1RA 3I7SA 4UIOA 1I0BA 3B3DA 5T91A 4I9JA 4H9VA 3SN1A 3WK1A 1OZMA 4Q4KA 4JYDA 1S2VA 2YCJA 4OBTA 4QCFA 4R3UA 1FWSA 3VIPA 4IGHA 1A0DA 2PUZA 1UA7A 4OKDA 3EYPA 3TU9A 5I3GA 1VEOA 2VD9A 2YL5A 3DFTA 1NDVA 1UG6A 4HYVA 2V3FA 1MQQA 2FFIA 4MNLA 1N82A 3O8AA 1SSGA 3EOEA 1IEXA 2A1YA 1OQFA 2RDWA 5REQA 3NTYA 2WSYA 1E6XM 1S2AA 3L65A 4PSRA 3DI0A 2ZVIA 3BLDA 2OO6A 1I2NA 2PP0A 2R6OA 3RN6A 2FIQA 3OP2A 2XVKA 2RJGA 4O4WA 2YA0A 2XVNA 2Q3OA 5LGZA 5I0DA 5RUBA 2YPIA 1H7OA 4KWWA 2XSBA 1TE1A 1WDPA 2Y7EA 2A5HA 1C7SA 4RNJA 4DUXA 8TIMA 2R82A 2V68A 1WO2A 1EQPA 4S3EA 3NG3A 4F48A 1XLGA 4D6FA 4GUFA 2CPUA 1HKWA 4DAFA 3KW3A 6A3HA 4KW2A 2Y6ZA 2DZVA 3AS1A 4FEZA 3AS3A 3LHVA 3EOLA 1IZKA 4J3VA 5ABTA 4RR4A 4HN8A 2NWRA 1H61A 2WMJA 1VFHA 3AALA 5MKGA 5IDZA 2PDNA 3ZR5A 4EPBC 2NT0A 1HL8A 1CXEA 1XKJA 4H01A 1YIXA 1XXXA 1CENA 1XWYA 3ABZA 5DRCA 1KFKA 3S5SA 2Y8KA 3ATYA 2ACRA 1S5MA 4NKCA 1F61A 4JIPA 4DZAA 3BAWA 3CMGA 5AC8A 3NQVA 3NPUA 2YLAA 4LEFA 4YMZA 3BW2A 5D03A 3A4WA 1UR8A 2PU1A 3OZMA 1F3XA 1DJYA 2GJPA 4KQNA 4YTTA 2BDQA 4V15A 3T09A 1KBKA 2HISA 5I3FA 4Y9MA 1I2RA 1S5TA 1GHRA 3P2VA 2X05A 1VGAA 3G2GA 4LQ1A 3CAWA 1TJRA 3SUWA 3QKZA 2YCLA 2ZUUA 1M65A 1W3IA 1FFRA 1TTQA 2E1DA 2F8QA 3CLMA 3NSXA 7REQA 3TTOA 4TMBA 3W7HA 3BXWA 2VEIA 3BSHA 2VRQA 2DVUA 4MNJA 4FIQA 1CGYA 2PZNA 2YCEA 3SY8A 1ADSA 4TTGA 3WF4A 4BI5A 1W5NA 2CLKA 3QYQA 4B2DA 2E6AA 1MQRA 3MI3A 2P88A 4YTRA 4AU0A 1KW1A 2QEZA 1K8XA 1CCWB 1XLHA 2J4GA 4X2PA 1EXBA 1AJZA 5C9RA 3UF9A 4LV4A 1WA3A 2I57A 1J11A 4QIUA 1C90A 3I4KA 1XLIA 4MZYA 2VFEA 3EXSA 1M04A 4L6DA 1JYXA 1KTNA 1K03A 2XGBA 3N9RA 1NDWA 5D8WA 3UGRA 2NV2A 4D72A 4JTDA 3R4IA 1B57A 1QPRA 4JCMA 2VURA 2NQ5A 3AZRA 4XISA 3KTSA 4AY7A 4LY4A 4KRTA 5C0QA 2PF0A 1HKVA 4BQ4A 4CD6A 2F61A 1CGUA 3MS8A 4WGHA 3B05A 1WUFA 4TU1A 3MUIA 1KCXA 1EP1A 5CBIA 3SURA 1S2WA 2FZMA 1H49A 2J66A 3ZLFA 2E67A 2G3JA 5IHRA 2INFA 2WHKA 4FP1A 3DG6A 3CK5A 3BGJA 3CL7A 1T8QA 2HSAA 2PGEA 3FW6A 3AJ7A 4ECLA 3QFWA 3OG2A 4UOJA 2H3BA 2P0OA 4BA0A 3W24A 4A8NA 4V1XA 2NLYA 2GYIA 2VC6A 4H6EA 5CPNA 4WD0A 3PJWA 5BU6A 3K8KA 5HNRA 1ECEA 5REQB 3URAA 3M5ZA 4Q8MA 2ZUMA 1SFLA 4F0SA 3T07A 3AIWA 1IV8A 3ALFA 3DH7A 3FKRA 2QW5A 5L9FA 2D2JA 2VR4A 2GZXA 2PU0A 3UPMA 4K39A 1RZMA 3WNKA 1E56A 3C0LA 3VABA 1OFDA 3W2UA 3M47A 1GW9A 1JUKA 3M4HA 3LNPA 3B9EA 2OT0A 1GKRA 1TG7A 4H8NA 4UTTC 3IIVA 4DI8A 3WJYA 2Z2AA 2BLEA 3OEXA 4CQAA 4HD5A 3OGRA 2PDUA 4HP5A 2ZXQA 2PWFA 2R8WA 3RLVA 3H4GA 3GNPA 1RVGA 3EWWA 4WDUA 4DAIA 1QRQA 4M1RA 4KIRA 1GORA 3WX7A 1H7PA 2IS7A 4KETA 1IEWA 4HJWA 1W1PA 5D9NA 2OOGA 3OW1A 4BF5A 2C8NA 3HG2A 3LN3A 4WSJA 3EDJA 3SR7A 1GUVA 3R8RA 3ARTA 1C8XA 1FTXA 1QO2A 3DG7A 4NNCA 1XGDA 3GB6A 2CHNA 2GVJA 3GWQA 2EG6A 3R11A 3WMCA 1LRQA 4WY0F 1CGVA 3FOKA 3DHDA 3WLHA 1RJPA 3W7MA 4PUWA 4B3KA 2G0WA 3OVPA 1HKKA 4CN1A 3BZJA 1R86A 1O7AA 5D2VA 1SJAA 4I3GA 5LIXX 1NH6A 3HMJG 1XBXA 2PRHA 1MEHA 4H1ZA 3UZZA 3BSMA 3LCLA 3W75A 2A3LA 1LOSA 1PZ2A 1MNSA 1T8XA 3T0DA 2VL4A 2CWXA 4AWEA 3FNDA 2NV1A 4S3DA 3M1ZA 4E38A 1ADOA 3NDYA 1IZCA 3SECA 1OADA 4LCQA 4JIIX 2DUZA 4RK8A 5FSEC 4R9XA 5A6AA 1Q6DA 3LV5A 3VOCA 2WNNA 3VIHA 3TW7A 4ZB5A 1UZ4A 3OO2A 4J3SA 4UNIA 3TYAA 3M64A 1KC7A 2ZWZA 1E1CB 1GOOA 1DKWA 4H8HA 4JICA 2FH6A 4AWTA 3QHMA 2C1GA 2PDFA 4PUUA 5BROA 3SEPA 5AHLA 1JRCA 1X1ZA 1TV3A 4UUIA 4CD5A 3JUGA 1ONXA 1SFJA 4KCTA 3SUVA 1BWKA 1XYMA 3DI1A 3U4AA 3H7UA 4V33A 1JF6A 3MZNA 3BPWA 4IFKB 1GQLA 3GVRA 3KLLA 1E1EA 3Q37A 2OWXA 4WEVX 3S2MA 3H2CA 3VX1A 3Q58A 2PWEA 3KRZA 4O0ZA 3WNNA 1I8JA 4DJFC 2CKRA 4GUIA 1Q3NA 1BYBA 1V6VA 4RCXA 3WNPA 4BF7A 2ZUTA 3B0UX 4IPIA 3AS0A 1FWIC 5KMYA 1CPUA 2X1TA 3FEQA 1L6GA 3MKKA 2O92A 2W3ZA 3MYOA 5H6HA 4PMQA 4ZZ9A 4AEFA 2TRSA 2OB3A 4AISA 2OO0A 2YW4A 4X3ZA 4F8XA 3U2EA 4AVOA 1KQZA 2FJUB 5EFDA 2ADAA 1CLXA 1H11A 1KWKA 5AYBA 3ATZA 3QMSA 5M1TA 1EL3A 3LS9A 4D71A 2CEQA 1AQHA 3CMJA 3B0YA 4UFJA 3HTWA 1RY8A 2XIBA 1PL9A 4NF7A 5JBDA 1AZ2A 4N9DA 2DPEA 3VA8A 1B9BA 3OA3A 5HQLA 3SRDA 3UNTA 3QEZA 4Z1BA 3NNTA 3WIJA 4QTGA 3W1PA 2ZX7A 5FIPA 3LBCA 3O6CA 4MY9A 5DRIA 2QCDB 1Y5XA 2B7QA 1XGZA 4XX6A 5A6KA 4IIEA 1G4SA 3NQGA 1SMAA 3OGVA 3CAQA 1JG9A 1GTEA 1W3KA 2JQXA 1EDQA 3GZAA 4GD0A 4HA4A 3CYJA 4Z0SA 2FTWA 1NTHA 2C7FA 1FHLA 1U1UA 1M53A 3H2MA 3OJGA 4AVNA 3SUTA 2CLFA 4C5YA 2ZDRA 4DXVA 4FK9A 3EBVA 1S1RA 2ICSA 4YCOA 3QPEA 3PZNA 3E74A 3GDTA 4G1KA 3CHFA 1DTUA 3IGXA 1O5KA 1F8MA 3O6YX 3KTXA 2VTFA 4QJ3B 3M6DA 2YX0A 3ITXA 3V18A 3IJQA 3H8AA 3QR3A 3SFKA 4XAGA 3A23A 3NOYA 1ZJAA 2DY3A 3LRMA 1B90A 3E49A 2BY0A 2DZWA 4KWUA 3M0LA 4E6MA 2J77A 2DQWA 1RD6A 4AZGA 2OG9A 1PO9A 4K37A 1G01A 8RUCA 1TJPA 4AZ7A 4R7WA 3NR0A 2WVUA 2E6DA 3WLTA 2YW3A 3LCFA 2XUCA 2WK2A 3TXZA 1ZAHA 3R5EA 3CH0A 4IIBA 4DWSC 5F2GA 2AL2A 1DBTA 2BVTA 3VTRA 3UYCA 3AISA 2W4XA 5JU6A 3A12A 3PVFA 1I45A 5E1QA 1SR9A 4Z2JA 4F4RA 1CT5A 1XYFA 1CLKA 7TAAA 4PFMA 1XIHA 2V38A 2CZ5A 1OYCA 4ATLA 5FL1A 2O9TA 4E0CA 1TO3A 1LJYA 2JKAA 3GNXA 3MP4A 2JKPA 1OSEA 1HVQA 3W1TA 5LHFA 4PCPA 4NU7A 1D3HA 2EHHA 4U2YA 3T4WA 3V36A 2PMQA 3GBEA 1TZZA 5JMUA 4A2SA 1DORA 1A0EA 4C6KA 3L2MA 8A3HA 3IIXA 4O17A 5JIPA 2AAMA 2XFRA 1H60A 1QNSA 3W7RA 4XSLA 3WDPP 2NLIA 3P5YA 3U7VA 2QPSA 4MJZA 5LZLA 1L8PA 3R43A 1PTAA 3U4FA 4IT1A 2ZUVA