1QFEA

The structure of type i 3-dehydroquinate dehydratase from salmonella typhi
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
252
structure length
252
Chain Sequence
MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHNVYVVMSNHDFHQTPSAEEMVSRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILHNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The two types of 3-dehydroquinase have distinct structures but catalyze the same overall reaction.
pubmed doi rcsb
molecule tags Lyase
molecule keywords PROTEIN (3-DEHYDROQUINATE DEHYDRATASE)
total genus 89
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 1999-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1qfeA00
3M16A 4LC6A 1EWEA 2ISVA 1C29A 3R8RA 3T40A 3LGEA 4LVFA 4TIMA 3Q58A 4DF0A 1Z44A 5SWUA 1UBSA 4LVAA 5LKYA 3KXQA 4N4PA 3ZFHA 4UTJA 2FLIA 4N6EA 3LXBA 4IX0A 3O07A 4LC8A 4FX8A 3PBYA 1JJKA 1UB3A 2X16A 3MYPA 4A2SA 2EPHA 2ZTJA 1F74A 2DZPA 5D09A 2G5WA 2AGKA 1CI1A 1AMKA 1TIMA 1O4UA 1FXPA 3V75A 1EPXA 1FCVA 4HN4A 2XN2A 4TU1A 1O60A 1G7UA 3TROA 2WSYA 2ZZ2A 3HB9A 2W0UA 1I4NA 2BXVA 2EF9A 4R34A 4HPXA 3CQ0A 3GAYA 4Y90A 3N19B 4DO5A 3LI1A 2NUWA 3NQ8A 4AMAA 4AB4A 3AO0A 3O6YX 1FDZA 3W1AA 1QR7A 3M5YA 3NZRA 3TSDA 3LV5A 3PUEA 3LCLA 1ZJIA 1H1ZA 3EKZA 5K3VA 2RFGA 3NNTA 2QDGA 1L6WA 3LXCA 3E02A 3E49A 3S6DA 4I7WA 4NX0A 3UXAA 3P7YA 3KVKA 3LHZA 4O15A 4CCCA 3DI1A 3B0UX 4BI6A 1AW1A 3P8JA 1MEIA 4N2YA 3RLUA 3UD6A 3EX2A 1EX5A 1YTDA 3G0UA 3G3MA 4NXKA 1EB3A 4MY8A 1WBJA 3CU2A 3VCRA 1AK5A 4AEOA 3G8RA 4MZ8A 2ISSA 4NJIA 3TUUA 3BV4A 3DGRA 1OG0A 3R2GA 4RKAA 4DPPA 3TDFA 4CNPA 3OEXA 3WK1A 3DFOA 1K7FA 1MXSA 1O95A 3L5MA 3DHDA 5AFDA 3DFQA 5HR6A 4MVAA 1Y0EA 2VELA 1JQVA 3AJXA 1WX0A 3ZWSA 4UFHA 3LTYA 4JTGA 3SR7A 4JX6A 1TPH1 4PODA 1ME9A 1A5CA 1JRBA 1ALDA 1YLVA 5FEPA 3PSVA 4POCA 3JR2A 1FBAA 2Z2UA 3W1NA 3DBPA 3G1VA 3WK0A 4Q4KA 4OWGA 1CW2A 1W3TA 4K39A 4WUIA 1W5QA 2CWNA 3RLVA 2QCMA 4RR4A 4BWLA 2QCGA 4OT7A 1IIGA 5CGQA 5AYYA 3WJWA 4MLJA 5KZMA 2A7RA 3H54A 1JCNA 3PG9A 4HSNA 3TX9A 3W2MA 2Z6IA 1M7PA 5FESA 2C13A 5G5IA 3BGJA 1TPDA 4UTMA 3LHTA 3TCEA 3GXTA 3BW3A 4FNPA 3B05A 1LBLA 1K7EA 4LUJA 3W76A 5IM51 1TPEA 3GR7A 4UFIA 3MI6A 4MY1A 2C3ZA 2YFOA 3ABSA 5AHEA 5IBXA 2A0NA 3LCWA 4XZ9A 4FNSA 1GTEA 4ZL1A 3PSWA 1OFRA 4YCOA 2PE4A 1P4CA 3G1YA 5D02A 3W7QA 1B9BA 3C52A 1VHCA 2P10A 3TK7A 1QPQA 4QNEA 3LTSA 3UWUA 3C6CA 2E68A 4WXYA 3TNOA 3UWWA 3HGOA 3TKFA 4QITA 3ATZA 2VFHA 1OK6A 1OFDA 5I3HA 3GKFA 3TE9A 4QIUA 1VGAA 3W7GA 1SW0A 1ICQA 4C1LA 4PA8A 4UMBA 4NZJA 2E09A 2ISWA 4JS3A 3S1XA 1GVSA 5EMUA 3NQVA 4ONVA 1JULA 5BOOA 2DZWA 2Y89A 3PB0A 3DFSA 5D32A 2DORA 4JTEA 3C2OA 5LNUA 3GXNA 1F05A 3A9IA 3TSBA 3I6RA 3NPUA 3USBA 4HKPA 6TIMA 2QCEA 3FA5A 2VENA 2E5DA 3NPVA 1KBJA 3QSRA 4NJGA 1VLWA 3H55A 3U8GA 3OA3A 1OFBA 3ABOA 4RV8A 4ZQPA 4Z0SA 1SZEA 4NT0A 3EWUA 4O0ZA 3IEBA 3STGA 4ZQCA 2NV2A 3FFSA 1G4SA 4UFLA 4JDYA 5HJLA 3L65A 4RXFA 1H60A 4JIPA 1C9DA 3OVPA 1FUYA 2DZUA 3E9AA 3L0KA 3W23A 4ADTA 3BG5A 3OVQA 2E5CA 1YXYA 4MYXA 2Q8ZA 3ZWTA 4M5PA 1SO6A 4NUWA 4WZHA 3FOKA 3G0SA 2ZZ6A 3NEVA 4S2BA 1LOQA 2GUUA 5KZDA 1EUNA 5AN7A 4EVZA 5LNSA 5G4WA 5G2WA 1BTMA 1YYAA 2G96A 1H7PA 1M7OA 2V5LA 2Y6ZA 3GKAA 1VR6A 4DELA 1ME7A 5HUPA 1OHLA 4N6FA 1GOXA 1QO5A 1TPB1 4U28A 4RXGA 2E6FA 4NXSA 2A7NA 1KFLA 5D30A 3IGSA 4C1KA 3LHYA 4FHAA 2JKEA 4LS0A 4OBTA 1LP6A 1TSIA 3FJLA 2X30A 3NDOA 3GDKA 3B8DA 1LROA 3NO5A 1WDWA 3RNDA 3NYZA 3FKKA 2C15A 4JEQA 3ANYA 1OFPA 3NQ2A 2H8XA 2B7NA 4Z1CA 3GNNA 4IMCA 3KOFA 2V2HA 4XWUA 2ZCGA 1F5ZA 2ZA2A 2CLMA 4I7UA 4LW7A 4BR1A 2I9EA 3LV6A 5DN1A 3W2UA 1UUOA 1RQBA 4LV4A 2J88A 3W9ZA 3INPA 4Y6GA 4K8EA 1OFOA 1WOBA 5DELA 3FJ6A 1AW5A 3QPYA 3K30A 1KM6A 5AOUA 4M6QA 1KM5A 5HWNA 5E1QA 4MZ1A 3F03K 1OFAA 1W5PA 3HMJG 5BW6A 4O54A 1H63A 4JTFA 2YX0A 3L5LA 2WNNA 3QW4B 3N2XA 5G2IA 1GZGA 2QF7A 4WQ6A 3IVTA 4UMAA 3W75A 3HG5A 3MW7A 3LB0A 4IGHA 1ZAJA 3TH6A 3BO9A 3O6CA 4ZQMA 3W7OA 4K38A 1H7NA 5GVJA 4GBUA 1JUKA 1MZHA 3NL6A 2DZSA 3WFAA 3EWBX 1KM1A 4HPJA 2WSRA 1DJNA 3MI3A 3UNDA 3I7QA 3N14A 4MIMA 5A5WA 4O1DA 5LSMA 2DJXA 1FCBA 3T78A 1ML1A 3BW2A 3UY7A 4N4QA 3W88A 3EX6A 3UQNA 2FTPA 2VXNA 2WNZA 4JTKA 1VYPX 2XFWA 2A6NA 3G1DA 4O1BA 4UIOA 5TBOA 2ZZ4A 3W6YA 3CT7A 3NQAA 5CPOA 4GUIA 3TR2A 4FNRA 4LS1A 1TO3A 1UUMA 3T4CA 4K7VA 3CPRA 2BSLA 2LLEA 3ABRA 3NQCA 3PBWA 5FF7A 1UCWA 3SJ3A 3TMLA 1S5TA 3CIWA 4GFSA 3SGUA 5HMSA 3STEA 3OG3A 4M19A 3NM1A 3W83A 3C3NA 4NNAA 1W37A 3V1PA 3UZ5A 1XBYA 4WY0B 3T44A 2ABBA 4M7SA 3QYQA 4MKNA 2J27A 3C2FA 3L0NA 1DV7A 1KLZA 1XL9A 2A1YA 1TPFA 2CZEA 2B7QA 4IOTA 4RJEA 1QO2A 1O5KA 2WJZA 2QCNA 2DP3A 3THAA 3IVUA 3RU6A 1G69A 1TQXA 4RZ6A 1VRDA 5HINA 3LDVA 3MP4A 3R89A 2NV1A 3C4UA 1NVMA 1LBFA 4YLWA 2WQPA 1OYAA 1ADOA 4LS2A 2ZRZA 3EWWA 5C5YA 4N9CA 4X22A 4LV9A 4AHOA 3G1SA 3IIVA 3TJXA 5EBUA 1WV2A 1MSSA 3CEUA 1H61A 4NNBA 1K8YA 4ORIA 2BLEA 5K2ZA 4OGZA 1I45A 3NQEA 5CZJA 3G3DA 1YPFA 1N7KA 4MYAA 2QUVA 2QUUA 4QSHA 4KKXA 1BWLA 4XTIA 3UWYA 1HL2A 1TCDA 2O7SA 3P5YA 2TPSA 4LOCA 4DO4A 3RMJA 3M5ZA 4RLIA 1DQWA 4LTSA 4R7JA 1QPRA 4A29A 3TSMA 4QISA 3WJSA 3EX4A 3HJZA 3KX6A 4MJMA 3N34A 1G4TA 1GYNA 2PURA 3CWNA 1H5YA 3KFTA 4AF0A 3PUDA 1VCVA 2P1FA 2QCLA 2Y7FA 1X7FA 5AHFA 3BGGA 3MJYA 3BG9A 2Z1BA 4CCEA 4IMGA 2V81A 2WV8A 3DU0A 2VFGA 3Q2DA 3N3MA 1LRTA 2GPTA 4PL2A 1KM3A 1XDLA 5G4EA 3ABQA 2JK2A 1W3NA 2H8ZA 3BPWA 5AHNA 5FF2A 1IXPA 3P80A 5BMWA 2QR6A 5DCDA 3PC0A 3GLCA 3MBDA 1XC4A 1PHWA 3RFAA 1IF2A 1O94A 5F2GA 5T26A 1SW7A 3P5ZA 1S5WA 2V2CA 4O16A 5KMYA 1OX4B 3HPSA 5LHEA 4LUIA 1KFKA 4RZ5A 3BK0A 4LVGA 2FPTA 3M47A 3KRSA 4P61A 2QEZA 1GWJA 1GT8A 4HSOA 1HG3A 5D37A 1ZENA 5HUOA 4I7VA 4JYEA 2NXHA 5DXYA 1VC4A 4FNUA 5HR7A 3HO8A 7TIMA 4JDBA 1QMLA 4QJ1A 3LOTA 3HGJA 3A23A 4KWVA 3HQ1A 4L4MA 4MPQA 4OV4A 3QMTA 5KSWA 4D2JA 1PCWA 2YW4A 1SR9A 3Q94A 3VE7A 3W1LA 3KRUA 2GOUA 5A8GA 2Z0IA 2FFCA 1IXOA 2GVGA 1HO1A 3EXRA 3L66A 3E0IA 1KA9F 1XKYA 3W73A 3EWXA 4HNUA 2AAMA 3MHUA 4K37A 1A50A 4JXCA 3E96A 3IVSA 3G22A 4AF0B 3OBKA 4BI5A 4OV9A 1W5NA 1FDJA 3BW4A 4O0KA 3HG2A 1VCGA 2C18A 1H7OA 3GDLA 4HT3A 4AWTA 3MI2A 1H51A 1XCFA 3LCXA 1EUAA 3G0XA 3CM4A 2I1OA 2JGYA 5C2XA 3IGUA 3LCGA 3P74A 4MY9A 1S5VA 2V82A 4YMZA 1K3UA 2OMAA 4FNTA 4L4LA 2FB2A 3LLDA 4M7TA 3TA6A 2EGZA 4WOZA 2F84A 2H3BA 3TW6A 3C2EA 4HIBA 3W7JA 4H4IA 4K8HA 5CSRA 5K9CA 4FX6M 3PY2A 2WSQA 5L6UA 1KW1A 1KV5A 3CEPA 4IMDA 2RDTA 3HPXA 1LCOA 2GQAA 2R8WA 4GUJA 3FLUA 4Y9AA 3W72A 3L21A 2H90A 1X1ZA 3FIGA 2WNQA 1SQ7A 5AYXA 1ONRA 1ZNNA 1I2RA 3NQMA 1NF0A 3MMTA 5LHFA 4DXVA 3UPWA 2YZRA 4FEZA 1TQJA 1EIXA 4E2DA 4GUGA 3IIOA 2YSWA 3YPIA 5D05A 2C0AA 5LNRA 3B4UA 1G6CA 1W56A 2FPYA 3HIJA 1HTIA 2J9YA 1F73A 3HOJA 1VYRA 2RDUA 2RH9A 2YCEA 1ZAHA 2OT0A 3ATYA 1XXXA 3FS2A 2OT1A 3LM7A 4EF8A 3NPWA 3R12A 3SY5A 4UTUA 2Y62A 1JCXA 1X1OA 1AG1O 3DKLA 3HGSA 3GDTA 3P84A 2QJIA 2CLKA 4N02A 4TMBA 5FEXA 5BRBA 3DAQA 3UXDA 4O8RA 1KM0A 1JQXA 2C6QA 4OQVA 3SGZA 4I9AA 4BK9A 1U83A 3CTLA 1WA3A 1YXDA 1TPUA 1ICSA 1HO4A 3GR8A 5F2IA 3GB6A 3GNDA 4GUHA 2J24A 3C2VA 2JKPA 4PFMA 1KTNA 1GQNA 1KFJA 3MP5A 2KZHA 5F4XA 3QC3A 5F4WA 4YWIA 4JYFA 3A21A 2NXGA 5DCBA 3HG3A 2QAFA 2E6AA 2E1DA 2I14A 2Q3OA 4UFKA 4TX9A 1L6YA 5J5RA 4TR9A 4P2VA 4MOZA 2GVLA 2A85A 4IWWA 1XUZA 3M7WA 4CQ9A 2DZTA 3OVRA 4MZYA 1YDVA 2G97A 1GVQA 1EWDA 1LLZA 2ZRXA 2OJPA 2C19A 2VOMA 3G1AA 1KFCA 2VFFA 1Q6LA 2VFEA 2FJKA 5K4ZA 2Y88A 2QUTA 2OCZA 2QAPA 1GPWA 2QDHA 3IRDA 3BARA 2UV8G 3PBUA 4AH7A 2A6LA 5H91A 3GVGA 3W2JA 2CLEA 3QQ0A 2VEIA 3QRHA 1H7WA 3M41A 1TV8A 5D2YA 5C55A 3P61A 2QJHA 4EIVA 3LRLA 1FWNA 4Z1DA 2X1SA 3PB2A 3KVLA 1A5SA 4ICNA 2EKCA 3EXSA 4GNJA 3MHGA 3DXIA 5AC6A 3M0ZA 4IQLA 1ZFJA 5F1VA 3KHJA 2Q8LA 3NQDA 4GC4A 2ZQ0A 3LCFA 2J9ZA 1LTDA 3O05A 1T99A 3IGXA 3NXFA 1AL7A 2VEKA 2JGQA 4UNKA 1YDNA 5CG7A 1FCUA 4Y8FA 2CLHA 2FQIA 2FDSA 4JTHA 5D2VA 3W2NA 3PG8A 4QNWA 2ATMA 1M6JA 2H3DA 3A22A 4S1FA 3EX1A 4LT9A 4O4WA 5I3GA 4QAIA 1A5AA 1W3IA 2P0OA 1KM4A 4X9SA 5CPMA 4O50A 2X1RA 4DBDA 1ZAIA 4PTNA 1B4KA 2R91A 3A5FA 1SSDA 4N9DA 4NJJA 3VNDA 1I2PA 3CWOX 2QJGA 3LCHA 3MO7A 3OHIA 4FIQA 3QFEA 4KFOA 3DFNA 4AHPA 1B3OA 2ZYFA 3HGRA 1I2QA 3LHUA 1MO0A 3LHWA 3TQ0A 1QCWA 4EOUA 1NFBA 2PRLA 3CLMA 2CFFA 3O1NA 3DH7A 1H50A 2YFNA 1JCYA 1TTJA 1LM1A 4A21A 2BX7A 1Q6RA 3P67A 1OX4A 3L68A 5KTLA 3W7CA 5LZLA 1LYXA 4E0CA 1I2OA 3L67A 2QCFA 4O4VA 1J4EA 3TFXA 1XM3A 1SO4A 1TPWA 2NLIA 3KRZA 3LLFA 1XUUA 3W1QA 4UFMA 2BZNA 4NZFA 5LNWA 3OIXA 5AC8A 3NG3A 1Q6QA 3GAKA 1EEPA 4MJZA 4NX5A 1SU5A 4DF1A 4UTIA 1OFQA 1SSGA 2W6RA 4JTIA 4CQ8A 2Y63A 3ELFA 1JR1A 1AW2A 2B0MA 3M5VA 2GJNA 3SFKA 3W2LA 1LORA 4JTLA 3LX9A 1OYCA 1G67A 1FWWA 1VHNA 3EWZA 1DL3A 4JY8A 4JTJA 4E2BA 1GYLA 4IJBA 4GRSA 4LU0A 3DENA 1X8FA 3QMRA 4MFDA 3W22A 1KTBA 4AHQA 2RKXA 5CZ0A 3QM3A 5K7JA 4JR5A 2VEMA 1NF7A 2X2GA 4OU1A 1GVFA 1TTPA 3VFLA 4AAJA 1XDMA 1F7BA 5I3JA 5IBXC 4Z08A 1SFLA 3W87A 1OVDA 5DY3A 3BVJA 3W7EA 5EL1A 1QPOA 3MP3A 1GJPA 1OX5A 1A5BA 3RK8A 3PBVA 1F2JA 3DZ1A 3B03A 3C0JA 1HUVA 1TRDA 5AC7A 1R2SA 5C6MA 4LWWA 1M5WA 1X6UA 1LRNA 4R33A 3I7SA 1GEQA 1VLIA 1BWKA 1ZALA 1ZY9A 1TRIA 3W7DA 5F2MA 1RV8A 2IQTA 2FIQA 1VCFA 4A22A 1PHQA 3G18A 1GVOA 1QFEA 4JYDA 1FQ0A 4NVTA 3LERA 3SW6A 5EPDA 2HS6A 1QOPA 2AQWA 1GVRA 2Q3RA 3TV8A 1UJPA 1RQHA 1P5BA 4O28A 1XBZA 4H6KA 4FF7A 3M44A 5CKSA 2PRHA 3NM3A 2CZFA 3PULA 4FXRA 2Y85A 4O18A 5EYWA 1E51A 2DJLA 1VQTA 3WJZA 4MUZA 1B4EA 1ICPA 1TTQA 2EAWA 3NQ6A 1OK4A 1DKWA 4JN6A 3VI2A 1D3HA 1BKSA 3HPZA 4OE7A 3F4WA 4UTKA 3S1VA 3Q37A 3LCIA 1Z42A 2YYTA 3F4NA 2VEPA 4K7YA 1PCKA 2YPIA 3GDMA 3NPXA 1XI3A 1N55A 5D04C 1KLYA 2NUYA 4K6AA 2Y61A 3KVJA 2EHHA 1TTIA 2QKFA 4CCDA 4XUGA 3TFCA 1W54A 1W1ZA 1YTKA 4A2RA 1LRQA 1TPVA 2XN0A 3SSJA 2CZ5A 1EP2A 1JCLA 4LY8A 2DZXA 2Y7GA 4UUIA 1LLWA 4WJEA 3NQ7A 4PL1A 3HG4A 2QCDB 3HF3A 2HS8A 1ZCOA 5D38A 5F2LA 3W3OA 4CNNA 2F7FA 1JCJA 1LOSA 2V0TA 1L2UA 4CLMA 5FI8A 1V7YA 1K8XA 3ZS4A 4JD4A 4UTTA 3LI0A 5HWJA 1WAUA 5CPLA 5K9DA 5EKYA 4XKYA 3W7KA 4UR8A 3N9RA 4AWUA 1QDSA 3A24A 2NXIA 1KTCA 4O14A 2RDWA 4DPQA 3G24A 4QQ3A 1XBXA 3W7PA 3B06A 3DFPA 4O11A 4WX2A 3W7IA 1OF6A 4ORMA 3S0CA 2ZDRA 4JX4A 3W7RA 5AYZA 4HNTA 1TB3A 3M9YA 1Z48A 1OYBA 1H7XA 4LRSA 2DZVA 2QCCA 1PE1A 4N9EA 3F1QA 1IIHA 3UZJA 2Y7DA 4NJHA 4W9TA 4ADUA 3JS3A 1NSJA 1T96A 2NZLA 4UTWA 2OZ0A 2A4AA 4HHPA 3S5OA 1VS1A 5HNRA 2YW3A 1SFJA 3TMQA 3G1XA 4ML9A 3UWZA 4UNLA 1Q45A 3GYEA 3BG3A 2PC4A 2GQ8A 1NEYA 4EF9A 5DBUA 4PH6A 2RHGA 3W86A 3W84A 2CZDA 2WO5A 4JTSA 4YL2A 4UTWC 3PS7A 3QW3A 4NQ1A 3W1UA 3W7NA 5AHLA 4TMCA 1ZHAA 3EWYA 2VFIA 3TAOA 4J9JA 1R46A 1H1YA 3THQA 1RQEA 1O5XA 4BF9A 3S5NA 5ABTA 4U4MA 3GIYA 5FF0A 4LRTA 3LBCA 1PL9A 4UR7A 3EX3A 2R94A 5E93A 3L2IA 1FX6A 3W1RA 4KFNA 4RZ4A 3KAOA 5C54A 4A3UA 2TMDA 4ZVJA 1FXQA 1KFEA 3QH2A 1RPXA 2CLFA 4IPJA 5FEZA 1K02A 2NUXA 5I3IA 1DVJA 2NX3A 2VKZG 1W0MA 3NL3A 4Z1BA 1F6KA 1QAPA 3QSTA 3PF3A 3WK2A 3S8HA 1OABA 4FX7A 3QPZA 1EP3A 1C8VA 3NVTA 3DKJA 4GWEA 5FF3A 5U4NA 4XQ6A 2NX1A 1J2WA 3TW7A 5G2HA 3GDRA 1OFEA 1PIIA 3VKJA 3W07A 1Q6OA 3RF9A 3O15A 8TIMA 1XFBA 4OHQA 3CB8A 3LRKA 2ZRUA 3CHVA 1SZGA 4ZQRA 3M5XA 3EEGA 4AXKA 1FDYA 1YPIA 2HSAA 3W85A 1EP1A 2QCDA 4HNVA 1KM2A 2E5BA 1DORA 3FKRA 5D03A 1PS9A 2E6YA 1PVNA 3LHVA 3NQGA 4N9BA 2PRMA 3NA8A 5DCEA 1RZMA 3O16A 1PV8A 4X3ZA 5D2TA 3PR2A 5BNKA 1SUXA 3R5EA 1S3HA 2ZFAA 4PC8A 5EA9A 1KV8A 4BI7A 4IXHA 5EY5A 2QCHA 3GZ3A 3SIZA 3IV3A 3W1PA 5HWMA 2NWRA 4MLRA 4O10A 4AVFA 2CLIA 1T0OA 4R53A 4ZZ9A 3ZR4A 3TQKA 2YGYA 3G1HA 1T8XA 3DFTA 2JKAA 1TJRA 1TYGA 4GE8A 1JUEA 2E6DA 1GG1A 2X1UA 1KFBA 3H53A 2VFDA 4UC5A 3W1XA 5I3KA 1L9WA 2C16A 3WK3A 4FNQA 4UTLA 2W79A 2V2DA 1HFBA 4RK8A 2ZZ7A 5D2XA 3S9YA 2Y7EA 3O06A 3TJLA 1P0NA 4O1AA 4O52A 4ZQNA 3P8IA 2Z6JA 3B0PA 4FIRA 3I68A 3DI0A 4JNMA 1VPXA 1QOQA 2YXGA 4H3DA 3BLIA 2JBMA 3LTPA 5D33A 1MEHA 4UMCA 4UTTC 3W74A 2ZRWA 1VJIA 4JY9A 1VH7A 3M43A 2V5BA 1F76A 3R13A 5G1TA 1W8SA 1R2RA 3I65A 4KWWA 1KBIA 5CZTA 1SO3A 1Z41A 2A2IA 2WPBA 3TIMA 5KINA 1LOLA 1TJPA 2OX1A 3W1TA 3PUOA 3P81A 1FWSA 2ZTKA 3W7HA 1G4PA 2FB3A 3KVMA 1RD5A 3M6YA 4ADSA 3WJXA 1LBMA 5DBTA 4CNOA 2TRSA 4G1KA 4FO4A 4NU7A 4YCPA 3UWVA 3GK0A 2J6XA 3TC7A 4NNCA 5AHMA 3VE9A 2CLLA 2YR1A 1GG0A 2ALDA 4S2CA 1DHPA 1SPQA 1YADA 3L0GA 4DO6A 1FY6A 1VZWA 4Y96A 3P60A 1OJXA 1IXNA 2TSYA 4WXZA 3S1UA 1K03A 3P62A 5DY2A 2ZRYA 3CIXA 3JRKA 3WJYA 5D2WA 5DXXA 4QM1A 3HBLA 3TQVA 3L9CA 5FEWA 4GUFA 1FCQA 3QMSA 1WQ5A 3PM6A 3NR0A 3NAVA 3GX9A 5LGZA 2A7PA 3MHFA 2GQ9A 3P82A 4MFEA 2ZA1A 3NZ1A 3S5ZA 4JTTA 5AB3A 4IXXA 3PAJA 1D3GA 1A53A 4IPIA 2BWGA 1G7VA 4ZMGA 3UWQA 3QF0A 5L9FA 3TU9A 3L5AA 4UXDA 3PWAA 4JICA 1W5MA 4IX2A 3UY8A 4O53A 1THFD 2O7QA 1V5XA 3QJAA 2ATSA 5CZSA 5E0KA 5U7SA 1DQXA 1FWTA 3IIPA 4E38A 4IMFA 3G8EA 1DBTA 1RR2A 4ZQOA 4M6VA 3EXTA 2V9DA 2VC6A 5LGXA 4GJ1A 5K4XA 1CX9A 5CPNA 3GXPA 5CSSA 1DOSA 4YXGA 4JTUA 4DF2A 3E12A 1NAL1 2V8ZA 5KZEA 4LNYA 4RX0A 1IGSA 2ZA3A 3N2MA 2XN1A 1WOAA 4Z0JA 4NJKA 3MUXA 4LVBA 1F6PA 4FXSA 2G95A 3U6WA 4B5NA 5G1YA 3W7MA 2NX9A 3IIXA 3STCA 4JIQA 3FYPA 1FWRA 1U5JA 2WKJA 4CQAA 3TXVA 1WXJA 4X2RA 3NGJA 3N9SA 5HULA 3T7VA 3SI9A 6ALDA 3CC1A 1XBVA 1H7RA 1JCMP 1OX6A 3TC6A 1MEWA 2ABAA 4O13A 2X1TA 5I3FA 2Y70A 2H6RA 4O1CA 2C14A 1TPC1 4BWLC 2E77A 3I7RA 4GXMA 3MWAA 4IMEA 3C8FA 4JGDA 2ZZ5A 1ME8A 2C1HA 4XKYB 2TYSA 1B57A 3QZEA 4PCFA 2NWSA 4AWSA 2PCQA 3EB2A 3EKLA 4UCGA 3S42A 3O63A 3LBMA 3PVFA 3M1ZA 1RVGA 1DJQA 1W31A 2B4GA 2BTMA 4O12A 4RCXA 3T55A 4PEKA 3W1MA 4DBEA 4DEFA 3NL2A 3BLFA 3O8AA 1SZFA 2R14A 4M6PA 3MBFA 4WD0A 3NQFA 1N8FA 5AHIA 3B0VC 3SECA 1R30A 4HNNA 4O19A 1LDCA 2ZZ3A 3TAKA 4WY0A 3FEMA 5DLCA 1SZNA 3STFA 3FYOA 1W5OA 2FPVA 1EA0A 1P0KA 3UPBA 4K36A 2CW6A 1IXQA 1J5TA 2DU2A 4EWND 4JX5A 2CU0A 2HTMA 4XTDA 2HMCA 2GVJA 3C61A 1YDOA 1K8ZA 5F1UA 1YXCA 4BFAA 4UFJA 4XBSA 1TV5A 1I2NA 5HQEA 2A5HA 2B7OA 3U2OA 3NL5A 2WOQA 3A5VA 1G4EA 3BLEA 3W2KA 3LXAA 5TQLA 3UYCA 4WOQA 3S1WA 5KITA 1AL8A 1JUBA 2ZZ1A 4Q33A 1JVNA 1R47A 3SZ8A 1WBHA 3DHFA 4XBKA 4O57A 3C2RA 1Q3NA 1TV7A 1BEUA 1GTHA 1K7XA 4TO8A 1JRCA 1QWGA 1SW3A 1TMHA 1I8JA 5LNVA 3IIZA 1TREA 4O17A 3NOEA 4LVDA 1H62A 3W7LA 1L6SA 1QNVA 1R2TA 4ALDA 4FB7A 4Z1AA 2D73A 3QEZA 3LRMA 5BMXA 4UTHA 2GJLA 2CLOA 1OF8A 2A21A 2YDAA 5TIMA 2YYUA 1UASA 3N73A 4KFPA 5F4SA 4WY0F 3MYOA 1YTEA 1SO5A 1LZOA 5K9XA 3W71A 4IUOA 3QQ1A 3C56A 3O6DA 5J5DA 3S5YA 5H2ZA 3TXZA 5MHBA 1D9EA 1QPNA 2B7PA 2J9XA 3W70A 2ZBTA 2V30A 4DQWA 3B04A 1WYIA 2ZRVA 3G1FA 3D0CA 5FF4A 1P1XA 4Q32A 1VYSX
chains in the Genus database with same CATH superfamily
3M16A 3VUSA 5BU9A 4F4RA 1C29A 3UW6A 3VZZA 4GVFA 5XIMA 3R8RA 3ECQA 5SWUA 5JUVA 2W66A 5CZKA 3KXQA 3O2LA 3TWBA 3ZFHA 5CAHA 1H49A 2FLIA 4J35A 4N6EA 3A9BA 4UBPC 3DECA 4C5ZA 2ZX9A 4LC8A 4BEUA 4Q4RA 3PBYA 1JJKA 4W89A 3WLKX 2OODA 2OX4A 3TR9A 4GK8A 3PBGA 2XH0A 1U5HA 4ERAA 1KBKA 5HPCA 5MKGB 4BEQA 4LAUA 1FXPA 1FCVA 1QK0A 4HN4A 2XN2A 3SM0A 5C7VA 1XPYA 1R9ZA 4AIEA 1V6YA 1G7UA 4DBSA 1QTWA 4HPXA 3ZSTA 4K2SA 4Z2GA 4Q6JA 3GVRA 2PCEA 1YEYA 2PDIA 4XD6A 1UP3A 3NQ8A 1ZUAX 1FDZA 4JL2A 3W1AA 1RXOB 3VX1A 5IHSA 4KESA 3KBMA 1H1ZA 4PTWA 1JZ7A 2VX4A 1EJXC 2QDGA 1W1B1 1EQCA 2PWDA 1KO0A 5EFDA 2XVPA 1J11A 3S6DA 2HBVA 3UXAA 3P7YA 3KVKA 2DUXA 4N42A 3P8JA 1MEIA 2GUYA 5BWFA 1XIGA 3RLUA 3UD6A 1QHOA 2C71A 1XYFA 1B3YA 1GYMA 4QCFA 3CYVA 1W2PA 2XTKA 1BPLB 1OG0A 3FAXA 4IIFA 5E0FA 2D2JA 5A8OA 4JCMA 4U2YA 1OWQA 1BRLB 5AFDA 3DFQA 4A8IA 5HR6A 4MVAA 2PDNA 1WX0A 1XV8A 1JAEA 2GJPA 3ARXA 4PMJA 1ME9A 5BYWA 1A5CA 1JRBA 1MZRA 3AOFA 1KNWA 3PSVA 1B3WA 3JR2A 2Z2UA 4DJFA 6REQA 3G1VA 3U3HA 2P0IA 2CWNA 4CEUC 1BYCA 2J8FA 4WCJA 2X40A 3TOYA 2QCGA 4OT7A 1IIGA 2QV5A 3WJWA 4I8YA 4MLJA 1EJ7L 4L9XA 1HGYA 3KTXA 3W2MA 3R8HA 4DWDA 4ES4A 3WD1A 1XLFA 2PF0A 1X97A 1HKKA 3TCEA 5REQB 1Q7ZA 2CYGA 4RE2A 3B05A 3T2QA 3AAMA 2CC0A 2GK1B 2D1ZA 3PZTA 2X7WA 1DXIA 1ZTVA 2YFOA 3LCWA 4XZ9A 4DJFC 3VYLA 4UR9A 3PSWA 1OFRA 1P4CA 5D02A 1Q66A 4ZFCA 1VHCA 2P10A 4AX7A 5EBAA 4AYSA 3NZQA 3BAJA 1LQ2A 3MO4A 2R9RA 2O4MA 1WUFA 1UH4A 5I3HA 3TE9A 4DJDA 3W7GA 4HMCA 1IV8A 4C1LA 1ADDA 3WY1A 2ISWA 4DUVA 3V5FA 1JF5A 2I57A 3NQVA 4ONVA 3GZAA 1A3HA 4V15A 1RJPA 3DFSA 4GZEA 4GKTA 4Y9NA 1F05A 1WNOA 3I6RA 4YPJA 1DEDA 1UWIA 2QCEA 2VENA 3WF4A 2OOFA 4GO9A 2XDFA 3VNJA 4NJGA 4P7NA 4RDVA 1VLWA 4ZQPA 3VIHA 5HNTA 1SZEA 4NT0A 3LSCA 3GHRA 1LQ0A 2AL1A 1G4SA 1RH9A 4UFLA 4FK9A 1CIUA 4JDYA 3WBXA 1UP2A 4LQ1A 1C3FA 4JIPA 5A6MA 3OVPA 2DZUA 4QDMA 3L0KA 5A1AA 2D69A 3OO2A 5AY7A 1UH3A 2E5CA 3M0MA 4DM1A 3VDHA 4B4FA 4LSBA 4WZHA 4GQ0A 3V5CA 4S2BA 4Q4QA 1ZBKA 1MDLA 3FA4A 2VUNA 1QATA 1WDPA 1XLIA 1IWPA 5ECUA 4ZB5A 5HUPA 4N6FA 4JN7A 4BQ5A 4U28A 1XYZA 2PGRA 4GYJA 4GY7A 2A7NA 5FKYA 3NGFA 1KD0A 3SJNA 4CNSA 4UB9A 4LS0A 1A49A 4LAMA 2HVNA 3PWIA 1SJCA 4LYKA 2VWSA 4RNFA 5KZ6A 5LYRA 1PZ3A 3NO5A 2WQDA 2JEPA 3ANYA 3THDA 3W53A 3BLDA 2H8XA 2B7NA 4P8UA 3SN0A 3PFRA 2WNWA 3S5SA 1TE1A 5G1MA 1EF2A 4ZTYA 3QXBA 2D20A 4W93A 1EFZA 2PGFA 1LWIA 1AJ2A 1PZ1A 3INPA 1P6CA 5I23A 3FHAA 4K8EA 5DELA 3T0BA 4D6CA 2ESCA 4Z17A 1E0UA 3QLLA 4JIHA 1YQ2A 3FVDA 1HKJA 1PJ9A 4KGJA 2BVDA 1YBQB 1Y8BA 1KM5A 4EANA 4J1OA 5E1QA 4B16A 1W5PA 3HMJG 3W38A 3H4GA 4O54A 2HE8A 5FJPA 1US0A 3L5LA 2WNNA 5ENLA 3QR1A 1W1PA 5G2IA 1IEVA 1E0WA 1VJZA 3SRFA 3WUBA 3HG5A 2G3FA 4R27A 3TH6A 3BO9A 4ZQMA 3NO3A 3W7OA 3VOGA 2HK1A 3B9EA 1JUKA 5A95A 1YNPA 4TVCA 1V3JA 4GGBA 1CENA 3BAYA 4M6UA 1XYBA 1EGMA 3AIQA 4MIMA 4F66A 5CXPA 3A4WA 1Q8JA 3T78A 1ML1A 3HV9A 4N4QA 1H2JA 3FW6A 3UQNA 1KCZA 4FLOA 2FTPA 3KZPA 4P5UA 2WNZA 1ZPTA 4ERGA 5BRPA 4PB5A 5I5RA 2PWVA 4UIOA 4NZ3A 2WMFA 3AIWA 3TR2A 5I77A 4K7VA 2BSLA 2GSHA 2PFHA 3NQCA 3CV7A 5EMYA 4CQBA 2GLKA 1S5TA 2ZKMX 3CIWA 3H2CA 3V0UA 1BVWA 1Q6GA 1XLKA 3CL7A 3CK5A 2NVCA 4I5RA 2ABBA 3C2FA 1TVPA 1TPFA 3P3BA 1QO2A 2ZX7A 2DP3A 3AS1A 3RU6A 3TTOA 4Q8WA 1TQXA 4RZ6A 3MP4A 5T91A 4A3HA 3R89A 5CLTA 1FFQA 2B81A 2OELA 1TCMA 4YLWA 1AZ1A 2WVVB 3LS9A 1OYAA 1OCBA 4KWSA 1M3UA 3POCA 3CNYA 4LV9A 3G6LA 4XAZA 3TJXA 1FWJC 3CEUA 4GISA 4QFUA 1K8YA 4ORIA 2BLEA 1GQJA 2XIOA 5I07A 3N6HA 4H7CA 2BY1A 1GKPA 4H9TA 3U5UA 1HL2A 1TCDA 5JBDA 3MA8A 5CBBA 2TPSA 3S1GA 1W9UA 3TSMA 3IPWA 3EX4A 2WVVA 1CXKA 1TV2A 3AZRA 2PURA 2OLSA 3KFTA 3HFYA 1PKMA 5RUBA 3UU0A 3EMQA 4XB3A 4TQTA 2Y7FA 3B8VA 3BGGA 3MJYA 1J6PA 3BG9A 4UOJA 2A3HA 1GQIA 1ELSA 2VZVA 2VFGA 3CAWA 1LRTA 2GPTA 1X39A 2W92A 3FN9A 4MSSA 3K5XA 3BPWA 2XFFA 5E70A 2OZ8A 5FF2A 3EB3A 1M03A 3MBDA 4PRRA 1XC4A 1XD1A 1PX4A 1PEZA 1I1XA 4Q8UA 2PDGA 2YCLB 3O9NA 3HPSA 5AC4A 1O12A 2FPTA 4ILSA 1GWJA 1GT8A 1XSKA 4AZHA 1HG3A 3QHMA 2J25A 1UMYA 1WZLA 2NXHA 5DXYA 1VC4A 3BL3A 3WLTA 3Q65A 4A8NA 1IT0A 3WF1A 1OBAA 3WLLA 3LOTA 3WLRA 4KWVA 4L4MA 4CU7A 5KSWA 4HJWA 1UD5A 4HHHA 4JTQA 4GCXA 3Q94A 4INFA 1U1HA 5E6ZA 4IHCA 2GOUA 2FHFA 2P50A 3WQOA 1MW1A 2GVGA 4XAFA 3WLIA 2QUMA 5H8UA 3L66A 3V3WA 1YNYA 1LG2A 1I75A 1XKYA 3EWXA 3RRXA 1Q6EA 2AAMA 2Z28A 3G22A 4BI5A 5HATA 3KEHA 5IRPA 1W5NA 2EPKX 4MWAC 2D3NA 4EAYA 5DMNA 2C18A 1NARA 1W8GA 3GDLA 4HT3A 3H2NA 1XLJA 2B31A 1H51A 2HZGA 3LCXA 2VQUA 2WMKA 3KWSA 3WNLA 4EAMA 1XIHA 5C2XA 1PIGA 3EGJA 5F7UA 4YMZA 2AGTA 4M56A 2BOEX 1UR4A 4D8LA 1KBBA 4WOZA 2H3BA 3TW6A 5GQBA 3TTQA 3C2EA 4PUNA 1WZMA 2EJAA 3W7JA 4K8HA 5CC6A 2BHUA 3PY2A 5L6UA 1CBGA 2RDTA 3K4AA 1ISZA 2R8WA 2XHYA 3FLUA 1PIFA 1CZ1A 1V77A 1WB0A 3W29A 3CZ8A 3EWDA 1V02A 3L21A 3W72A 3GQYA 4U10A 3FIGA 1YX1A 1WDSA 3OU8A 4BQ4A 1BGAA 5LHFA 3KZSA 4GD0A 4FEZA 2W63A 1PWMA 1LWJA 4Z2KA 1TWSA 4PB4A 1R3VA 3URQA 4LYRA 1I0BA 1W56A 3HIJA 1HTIA 4I6VA 1VYRA 2YCEA 2OWCA 2OT0A 4GIYA 4EF8A 3R12A 2Z2BA 3BJSA 4F48A 2X41A 1X1OA 3KCJA 3DKLA 1AZ2A 2QJIA 4Z2LA 1DTNA 3M64A 4N02A 1C7SA 3QLDA 5BRBA 3TC3A 2G41A 1E56A 4B9ZA 2X05A 1EZWA 2C6QA 4OQVA 1U83A 3BOFA 1TPUA 5J04A 1GOWA 3UA3A 1HO4A 2PDJA 1EJUC 3GNDA 4X9YA 2J24A 2OYLA 2Q09A 4S38A 4W87A 4QEEA 1KTNA 1GQNA 1D2KA 3VX0A 3NDZA 5F4XA 3QC3A 2WMJA 4YWIA 4ZO6A 1EEXA 3ZR6A 5AC5A 1KR1A 2Z00A 2QAFA 2E6AA 5E5CA 2E1DA 3LN3A 4XX6A 3GO2A 3VOIA 3BAIA 4EXQA 2DIJA 4UFKA 2RAGA 5BZAA 1LJYA 3R0DA 4KWUA 4QRNA 3H12A 2YCIX 2J47A 3QV8A 1UUQA 2A85A 3W00A 1J18A 3OVRA 4LNCA 7ENLA 1YDVA 2G97A 3M0XA 5D9PA 1DIOA 4KIRA 1KFCA 3BWWA 4HK5A 2WKGA 2QUTA 2OCZA 2QAPA 1GPWA 3RLGA 2QDHA 1NFPA 2OU4A 3BARA 1IE7C 5DMLA 2CLEA 1K9TA 1GKRA 1VFMA 2VEIA 2V3FA 1H7WA 1TV8A 1PTGA 5D2YA 1OIFA 2XH7A 4GNVA 3ITOA 4IP7A 4HTBA 3KL5A 1PAMA 3K46A 4Z1DA 2X1SA 3ONBA 1A5SA 4ICNA 3EXSA 4JAWA 2EG6A 3MHGA 4GKLA 4DAIA 1ZFJA 3EWCA 3REQA 4DO7A 2Q8LA 4KS0A 1UP0A 1BRLA 3VGFA 1FWGC 3LCFA 1QNSA 3EBVA 1T99A 3IGXA 2CITA 1AL7A 2FMOA 4S3EA 2VO5A 1YDNA 4LB4A 5CG7A 4Y8FA 3REQB 3KP1A 2CLHA 2FDSA 4UNIA 5D2VA 1CGYA 2ATMA 3T07A 7A3HA 1MYRA 3VA8A 3A22A 4L1XA 3LSBA 1XIBA 4LT9A 4O4WA 1A5AA 1W3IA 5CPMA 1G5AA 4DBDA 5M03A 1ZAIA 4GYKA 1SSDA 4Y9PA 4D6JA 1UWSA 2QJGA 4XUYA 4FPSA 2XIMA 4AX6A 4C5YA 4AHPA 1RPKA 3HGRA 1I2QA 2HEJA 1QCWA 4EOUA 1NFBA 1CYGA 1J2BA 1X96A 4R7WA 1TTJA 4A21A 1Q6RA 3P67A 1IT8A 3L68A 5KTLA 3W7CA 4BHYA 1I2OA 1TMLA 1E9IA 3E5BA 1SO4A 1A4MA 4CD5A 5I79A 2NLIA 4LALA 2PD5A 3KCOA 4UQEA 4MJZA 4NX5A 4GYPA 2Y63A 2PLKA 3ELFA 1JR1A 4HGXA 1NQKA 2GJNA 3SFKA 2CKRA 3W2LA 2DSZA 2IKJA 2QT3A 3QKEA 3GH7A 1VHNA 3ARYA 1QK2A 1F4AA 2ZXDA 4JTJA 1JI2A 4E2BA 1YE4A 3DENA 2OZTA 1X8FA 3WBWA 3QMRA 2FZMA 4WEVX 2RKXA 4H9MA 4Q8VA 3RAOA 1MUMA 3SQSA 3N3TA 3NO1A 1UYQA 5GJPA 2X2GA 4IZGA 4ZSTA 1GVFA 4AAJA 3B40A 5IBXC 1OVDA 3UA4A 3BLPX 1QPOA 4BKNA 1R38A 2Z1KA 1I0DA 2XU2A 3DZ1A 4PMNA 4ATDA 1NP2A 3K2GA 2VYOA 3BAKA 1DWAM 1M5WA 1XIMA 3EOEA 2D23A 1GEQA 2R24A 5D8ZA 3W37A 1QW7A 3CT2A 2QGYA 4LF2A 1PZ0A 1CWYA 5A6BA 1IR2A 1FQ0A 4JYDA 3SW6A 2DVTA 4H9YA 3CL6A 2AQWA 3BGAA 2Q3RA 3OZPA 1VFSA 1US2A 3ARTA 4R9XA 4A05A 3WENA 3E0WA 3QC0A 1J0ZA 3NM3A 3WQPA 3K13A 3HV8A 3PULA 4FXRA 5D8WA 2IPGA 3O3RA 2ACUA 1B4EA 1ICPA 1OK4A 4GZ7A 2WLYA 1D3HA 4IIEA 3F4WA 3LCIA 4GACA 3GXDA 2YYTA 8XIMA 1R3TA 3CTTA 3D47A 4FOKA 3GDMA 2E40A 4PUJA 3MMDA 5D04C 4K6AA 3W24A 4BY3A 4W84A 1GQLA 1W54A 4A2RA 4S3JA 1LRQA 2XN0A 2DVUA 4LY8A 4WJEA 3U4AA 1A47A 1VFTA 2HS8A 2W9MA 2FZBA 3CL8A 1EA9C 3OBEA 1L2UA 1TWWA 3TTEA 2FZDA 1MI3A 2XVGA 3AZTA 4AZIA 2QPSA 4FOUA 1K8XA 4I5UA 4JD4A 3TONA 4JIIX 4R85A 1OC6A 2VEFA 3GHTA 3RPMA 3UCQA 1KTCA 4O14A 2MNRA 3VDAA 4M1BA 3KCLA 4QQ3A 4AC1X 2OTDA 4XO6A 2Z27A 3DFPA 1DE6A 1OF6A 3S0CA 2QVHA 4S39A 3CAVA 3VD3A 5LIUX 3RPTA 2Y7DA 1I9CB 1PDYA 4E6MA 3MY9A 4PMDA 1NSJA 3FSTA 2CETA 3NOYA 2IPFA 4J3ZA 4H6EA 2GGIA 1QJWA 1LWHA 4UQCA 1V93A 5HNRA 2P5NA 3TMQA 4ML9A 4YHGA 2WB5A 3ZZ1A 3BG3A 1RA0A 4L6DA 2GQ8A 1NEYA 1G1YA 2QDEA 4URIA 3L12A 3UGVA 4UTWC 2WO5A 1P6WA 4GVHA 2QXWA 4QG6A 4J4KA 5CSYA 4JPGA 1PZ2A 1BG9A 4NHVA 1IHIA 4QCEA 4NG3A 4QROA 1R46A 1H1YA 3THQA 1O5XA 4JN8A 1BGGA 3IUDA 3T2OA 1JF6A 2R94A 3A4XA 3UJ2A 2QPUA 3L2IA 1N8IA 4PBFA 3DIPA 1GVIA 4F2TA 1K6WA 5H1WA 2OO0A 3POHA 2WMHA 1TMQA 1F6YA 3QH2A 1FH9A 2NUXA 4KETA 3GWQA 1XLBA 1F6KA 1QAPA 3WK2A 2OKOA 5HAOA 1OABA 4FX7A 1LG1A 1C8VA 1HF6A 3HU7A 1XJBA 2F9RA 3ZT7A 2RJHA 2POZA 1PIIA 1HKVA 2OGYA 3RF9A 3LPOA 2WSKA 2ZRUA 2J4GA 4ZQRA 1YPIA 2ZC8A 2XSXA 3EDJA 1VD6A 3W85A 1EP1A 2QCDA 2G3IA 3CQIA 1F9CA 5LIYX 1J6OA 2E5BA 1DORA 3VNLA 1PS9A 2E6YA 1PVNA 3NQGA 4N9BA 5KETA 3ITYA 3NA8A 4IH3A 1RZMA 3K4DA 4ERIA 2X42A 5BNKA 3R5EA 5HXMA 5EA9A 3AISA 3N4EA 5EY5A 1P0BA 1D7KA 2ZWYA 3VXGA 1BYBA 3DDMA 3UVIA 4ZODA 3IRSA 2BNJA 2DZAA 3DFTA 2KX9A 2JKAA 1U2YA 1TJRA 2PWFA 1BAGA 4H2HA 1JUEA 4Q4SA 5TNVA 2X1UA 3EMZA 3LYEA 3H53A 3M4HA 3RPDA 1XISA 2WZMA 3TYZA 4UTLA 4HA4A 1AUSL 2W79A 2Y7EA 3VGEA 1P0NA 3H8AA 3OZOA 4ZQNA 4NRSA 1IWAA 1M9HA 3UG5A 2Z6JA 3I68A 2E7FA 4I9TA 1ENUA 4O0QA 1RVKA 3MUIA 2JBMA 1MVYA 3VCNA 4XAGA 1MEHA 2C1GA 4V27A 3W74A 1VJIA 1VH7A 1QNRA 3NXLA 1MQQA 2ON3A 1W8SA 1A0EA 3FYYA 1ZLPA 3VNIA 4UTFA 1BG4A 3TIMA 1LOLA 1XIJA 3URAA 3FSUA 4ZE4A 2WCSA 3DOPA 3W7HA 4AU0A 5C8BB 3KOWA 3DG7A 4M3PA 4ADSA 3LGDA 4NU7A 3GK0A 2J6XA 3H26A 1XCWA 4US5A 1J12A 3WF3A 5I00A 1F8IA 1NDYA 4B2DD 3UJRA 2YJQA 1CGTA 2X0HA 1YADA 2PP3A 1VFUA 1C91A 4W7VA 3SRHA 3UCDA 1K8CA 1IXNA 4WXZA 2I16A 5GPRA 3WDIA 3S1UA 3OLEA 3P62A 2CBJA 2J75A 4AUBA 3TEVA 4QM1A 3SY8A 5FEWA 4GUFA 1HN1A 3KWXA 3DUGA 1WQ5A 3NR0A 3GX9A 5LGZA 3EA3A 3S2NA 3OIHA 2I5IA 2O9TA 1TUFA 4Y9MA 1XLDA 1UZ1A 5BCAA 3LM3A 1D3GA 4IPIA 2Y0FA 2BY0A 3PPFA 4QG8A 5I09A 4IJRA 3I6EA 1JDEA 3LGGA 3UY8A 3ONCA 5FJRA 4BQ2A 3QJAA 1PWLA 1UR9A 5U7SA 3G8EA 1ISWA 2PD9A 2FKPA 3U5YA 3EXTA 3L23A 5LGXA 5EMMA 1D7FA 4GJ1A 3ISIX 3GXPA 3GFXA 1ZP3A 4CKQA 2V5CA 4AISA 3A3HA 4LNYA 2ADAA 2XN1A 2J7GA 2QIIA 2P3EA 1JPIA 4Z0JA 4NJKA 3MUXA 2PTZA 2VEGA 2C8NA 5JH1A 4FXSA 3SCUA 1M53A 1Z9AA 3IIXA 5HOSA 3FYPA 2BGSA 1U5JA 2WKJA 1V3LA 2IPJA 4J3UA 4CQAA 1KFWA 1WXJA 3TN3A 2ZC1A 1DJXA 1A80A 5C7HA 3T7VA 3GIPA 3SI9A 4QHRA 1WAWA 1JCMP 4MAZA 5BRQA 2ZWZA 3OZMA 2HVOA 2PLJA 4Q8NA 1TZZA 3JUGA 4B90A 5D9NA 2C14A 4BWLC 2E77A 3KS6A 4IMEA 4UWMA 3RITA 3CYJA 4S3FA 3B9DA 3SCPA 1ME8A 1O1ZA 4DBUA 3LPGA 4AWSA 2PCQA 1T40A 1VF8A 2DFAA 4QG9A 1DJQA 4YVVA 3CWHA 2BTMA 4W86A 3W82A 1CGUA 2YKKA 5IDIA 3UG3A 4ZBCA 3DHUA 3KOZA 4M6PA 3ARVA 5AHIA 1QPKA 3AHXA 5C9WA 4HNNA 3IACA 1A5UA 3MZNA 3QY7A 6PTDA 1LDCA 3FAWA 4RZBA 3FYOA 4ZA0A 3H7RA 3J7HA 4AZGA 1J5TA 3PNZA 4JX5A 2CU0A 2Z1SA 4MNMA 4XTDA 2HMCA 2GVJA 1LT7A 1I6NA 2HK0A 1WKFA 2E9LA 4NAFA 4UFJA 4WGXA 1KKOA 1I2NA 5HQEA 3A6OA 4RDWA 1REQA 3VM7A 2GGJA 1M7XA 1RP8A 1E72M 1WO2A 4XV0A 1TFVA 5HJYA 1SFTA 3CMFA 1A5NC 3LXAA 2IKGA 4WOQA 3S1WA 4G8TA 2ZZ1A 2YL9A 4DYKA 3UVAA 2BP1A 4FI4A 2WC4A 3MB9A 1GTHA 1QWGA 3OHMB 4YTRA 1ITXA 3IIZA 1H62A 2JEQA 4FB7A 4Z1AA 1NWTA 2GJLA 2OEMA 2OO6A 2WLZA 2YDAA 3MPGA 2FDMA 1JPHA 4WY0F 4PSRA 3MYOA 5I7GA 4AQLA 1ZJHA 2VWTA 3N9KA 3WX7A 1V3HA 4IQJA 4IUOA 3QQ1A 3UERA 4JIEA 4FMVA 1Q8AA 1EH9A 5J5DA 2FJUB 3SRKA 4OECA 1K4GA 1HL9A 3UESA 3TXZA 4E3VA 2XYLA 1D9EA 5DT5A 2B7PA 2J9XA 4WDUA 3PK7A 2ZBTA 2V30A 1AFSA 1DTUA 2VC7A 4E2VA 1P1XA 4Q32A 1DQUA 1S2TA 3N2BA 3UZZA 4LC6A 1EWEA 1UD4A 1RK6A 4KEVA 3QV6A 4WDWA 1JDDA 3H4WA 3T40A 4LVFA 3K4WA 3Q58A 2PF8A 4H83A 4G7FA 5LKYA 3CIVA 1QOXA 4UTJA 3LXBA 3FA3A 2O9OA 1XRTA 3O07A 4FX8A 1UB3A 3ICJA 3OOQA 4GVGA 4A2SA 3G2GA 1W3KA 2DZPA 3ZVIA 2G5WA 1CI1A 2ZX8A 1O4UA 3V75A 3N04A 4F0RA 5FJTA 2ZXQA 1O60A 5AVHA 3R11A 3WD2A 2F38A 4FLQA 2WHJA 5GJNA 2ZZ2A 5D4YA 4JIRA 1C8XA 4R34A 3UR2A 1HQTA 3GAYA 2WVUA 1Q65A 3TNBA 3JVAA 4S3BA 2NUWA 4AMAA 3O6YX 4FXJA 4NZ4A 3NZRA 3LV5A 4HHMA 4F2UA 2WM0A 2RFGA 1OEPA 4KBXA 4U5KA 4ZR8A 5A2CA 4AD0A 1EC7A 3M6DA 1DJIA 2DH3A 4O15A 4CCCA 4KPLA 3L4WA 4BI6A 1AW1A 4CD4A 4B5TA 3V35A 2I56A 2PDWA 3G0UA 4YTTA 3G3MA 1JZ8A 1CXLA 4MY8A 2HROA 1EC8A 3CU2A 3G8RA 3RN6A 3TUUA 3SFWA 3BV4A 3DGRA 3W26A 4RKAA 4DPPA 3CMJA 1HJUA 4CNPA 3OEXA 3WK1A 1K7FA 1MXSA 1O95A 2CWXA 1BYDA 5XIAA 2HXUA 2WK2A 2G0WA 5E09A 3ZWSA 4F0MA 4I8DA 3URBA 4C6KA 4JTGA 1PBGA 4XZLX 3ABZA 3PJXA 3WK0A 1W3TA 2G8ZA 4K39A 3RLVA 4RR4A 4BWLA 4GABA 2C0HA 2ZUTA 5KZMA 2R82A 4HSNA 4PCTA 1NU5A 5FESA 3VKDA 2C13A 1CXIA 4UTMA 4BA0A 3LHTA 1TG7A 3GXTA 1CLKA 1XDJA 3H2MA 4QGCA 1R7OA 4LUJA 5IM51 3W76A 3WQ8A 1TPEA 1XG3A 3EDFA 3MI6A 4MY1A 2Z7KA 1AQHA 3ABSA 5IBXA 1VBGA 3L4ZA 1GTEA 4QJ5B 3U2EA 4PZVA 3WNKA 3G1YA 3W7QA 3GIQA 3AHVA 5EGRA 1Q6CA 1EF3A 1NFGA 3UNTA 3R1ZA 1JYWA 2P3ZA 1W6TA 4Q8OA 4GQBA 3QPEA 4D71A 2EPMX 3UCCA 4ZXOA 3LTSA 3UWUA 4UQAA 3UWEA 3QR3A 3AIRA 3ATZA 4QITA 3SN1A 3MCOA 1OK6A 4CVUA 4HNOA 3W6MA 3KE0A 5BOFA 1SW0A 4OUIA 1WXYA 1OGGA 4KMQA 4S3AA 2E09A 4HYRA 3TQPA 3S1XA 1JULA 1V3MA 5BOOA 2DZWA 1HIZA 2OGJA 5D32A 4GXPA 3CUFA 2QQ6A 3A9IA 3NPUA 4GA8A 3USBA 7TAAA 3FA5A 5FJOA 2E5DA 1RK5A 1JIBA 3H55A 3U8GA 4FOJA 2PDPA 2YCKX 3M7SA 1OFBA 3ABOA 4RV8A 4AZ7A 2XSBA 3EWUA 3GS6A 4M29A 1MDRA 4O0ZA 2R6OA 3STGA 2OOGA 4XAYA 1J0YA 3R58A 3DC0A 3RG6A 3CZKA 3DG6A 5HJLA 1C9DA 4JTDA 4IQDA 1FUYA 5DX7A 3BSMA 2H9AA 5FJJA 1E9ZB 3T8LA 2GOKA 1YXYA 3F5JA 1VP5A 4MYXA 2Q8ZA 2QVNA 4M5PA 2INEA 4NUWA 2VT0A 3FOKA 4JFWA 1LOQA 1OY0A 1XQKA 4L4PA 3B8IA 1ZBWA 4W5UA 5G2WA 4CN4A 1KWKA 2XINA 1UPPA 1NQ6A 2V5LA 3DX5A 2Y6ZA 4OTKA 3WD4A 1AD4A 2AMXA 2FZ8A 1ME7A 4DELA 4RW5A 1GOXA 1BKHA 3WLPA 2BGQA 4RXGA 3UBPC 2E6FA 1MRQA 2JIEA 5D30A 3IGSA 4C6MA 1XYCA 5A8QA 1TSIA 4IGSA 3FJLA 1B30A 2X30A 4WSJA 3NDOA 1V51A 3GDKA 1LROA 4NY2A 2I7GA 1WDWA 4C7FA 1Q2RA 3T05A 1MFUA 1XR2A 3AHTA 4JEQA 1VEMA 1OFPA 3L4YA 1POJA 3MCNA 2ISFA 3GNNA 3KOFA 4XWUA 4AIUA 2BHZA 1F5ZA 4Q7IA 2ZA2A 4BR1A 3U2CA 2FH8A 2I9EA 3LV6A 1MXDA 1RQBA 3VTRA 2J88A 3W9ZA 4R88A 5IHRA 2GJXB 1ZJBA 1QNOA 2ZVIA 5FL1A 3K30A 1KM6A 1K70A 4M6QA 3CAKA 4GQRA 5HBFA 5HWNA 1OFAA 1Q4NX 1E70M 1B54A 1O7AA 1R5YA 2GQ3A 1H63A 3APGA 1GZGA 3VOHA 2J7HA 1EJVC 2J7CA 3LB0A 3MW7A 4IGHA 4UCFA 2BOGX 5GVJA 1H7NA 3NL6A 2DZSA 1OT2A 3WFAA 1S1PA 3EWBX 1DIKA 1KM1A 4CNTA 3V18A 3VD7A 3ARQA 4Z42C 3IK4A 1IZJA 3N14A 1DJGA 4O1DA 5LSMA 4U5IA 3F5KA 5ABGA 1PXGA 3BW2A 3UY7A 2CNCA 3WF0A 5CLWA 2DUAA 4WF7A 1PTAA 5H8PA 4IGNA 3L4UA 3G1DA 4O1BA 2HBXA 4OKDA 2ZZ4A 2EQDA 3LMYA 3W6YA 2QIWA 4GUIA 3SQMA 1UUMA 3T4CA 4GQGA 3VOFA 2LLEA 2WJDA 1KWGA 4QBXA 1JEZA 1NTHA 5FF7A 1V08A 5A6SA 3F5LA 2F2KA 1HP4A 3STEA 2CCRA 3OG3A 4ZEPA 3NM1A 1W37A 3ENLA 3P0WA 2WBKA 3H7VA 3T44A 4M7SA 3HQNA 3QYQA 2J27A 1KLZA 3QTGA 3DYMA 1HZYA 5IXEA 2CZEA 4FXFA 4AXNA 3C5QA 1N2VA 2VI0A 5REQA 1G69A 2OPJA 1VRDA 1XSJA 1RP9A 1U1JA 4HK7A 2E25A 4AEFA 1LBFA 4H9XA 3E38A 4I3GA 3CXOA 1ADOA 4LS2A 3N13A 1EJSC 3MVIA 1SFSA 4N9CA 4X22A 4AHOA 1E4LA 1WV2A 1MSSA 4NNBA 4HOWA 4PUKA 1O5RA 5K2ZA 1I45A 2QS8A 1YPFA 4MWAD 4ZENA 2QUUA 3SN4A 3PAOA 4QSHA 4XTIA 3UWYA 3SRDA 4LOCA 4JKKA 3RMJA 3OP2A 2HNHA 4HMEA 3TTSA 2DSUA 3WJSA 5DANA 1Q13A 1UROA 1H5YA 2WANA 2PTWA 3H6OA 1VCVA 5LXEA 1GJWA 4LXFA 4H19A 2Z1BA 1NDZA 1E5JA 3UJEA 2V81A 2WV8A 4H8VA 1XLHA 1NDWA 3Q2DA 4AD5A 1KXHA 4HPHA 3N3MA 3PPGA 5CJNA 3ABQA 3PNUA 4IISA 5AHNA 5CGMA 4CU6A 3P80A 5BMWA 4LBRA 5DCDA 3PC0A 3UG4A 3GLCA 1HKMA 1PHWA 1IF2A 3RFAA 2XPKA 3D46A 3EPOA 1R3QA 4YVPA 4MDPA 2V2CA 2JIWA 5KMYA 5DRCA 1ISXA 4LUIA 4RZ5A 3RM8A 2P8BA 3BK0A 2GVYA 4TOQA 7REQA 3KRSA 4P61A 2QEZA 3TYBA 1R87A 5D37A 1ZENA 5HUOA 1VBJA 4J40A 4I7VA 2DVXA 4JYEA 2PEVA 3HO8A 4JDBA 1BVZA 1CXFA 3QGVA 4XZBA 3HGJA 1WP6A 4M80A 3HQ1A 1ZJAA 3RXZA 3BCDA 4D2JA 1PCWA 3GXFA 5BXTA 3W1LA 5A8GA 4QDPA 1VEOA 2E3ZA 2FFCA 1IZCA 3LEPA 2BVTA 3E5PA 3MKKA 3WFLA 4HNUA 3MKCA 3LNPA 4K37A 3AXIA 3E96A 2IPWA 3WNMA 4AF0B 4OV9A 3MI2A 4LYPA 2OWXA 7ODCA 2VTFA 3CM4A 2I1OA 2JGYA 4CD8A 1FH7A 2PAJA 4IFKA 2V82A 2CERA 2OMAA 4FNTA 2FB2A 1DWJM 4OIFA 1E6PA 3TA6A 1QU4A 3GU2A 4HIBA 3UR7A 2CZVA 4MF4A 3WH6A 5H6HA 4QEHA 2E9MA 5K9CA 1ZP4A 3AYRA 2WSQA 4O8AA 3CEPA 4J3XA 3HPXA 4JQ3A 3O0FA 2GQAA 4GUJA 1S38A 3RX2A 3T2PA 4IIHA 2WNQA 5HMEA 1ONRA 2OKTA 1M68A 4GBDA 3NQMA 1NF0A 4DXVA 6REQB 1F3XA 3QQWA 1QBBA 3IIOA 2VRQA 5D05A 2PA6A 2PGEA 2ZUMA 3R79A 1BVNP 1EKOA 2GGEA 2J9YA 1ITQA 4MGGA 1QHZA 4LPCA 2PTXA 1ZAHA 1XXXA 3FS2A 2WMIB 1EHAA 1QI0A 2HPMA 4UTUA 1JCXA 4EKJA 3AI0A 4AIOA 3LNMA 2ICSA 1KRBC 3WEZA 4XG1A 5FEXA 4GPNA 1R3YA 3AMDA 1DE5A 1PSCA 4EPBC 4Q4OA 1KXQA 1UR0A 3DFHA 4I9AA 4BK9A 2DQXA 1YXDA 5BROA 1ICSA 2XSAA 4MPKA 4GUHA 3C2VA 2CBVA 4MNJA 1EJTC 5J8LA 4B5XA 4RDYA 5F4WA 4MM1A 6ENLA 3PZUA 1XGDA 3A21A 2NXGA 4L6HA 4TX9A 4H01A 1J96A 5LA0A 2DT2A 2REQA 2YOCA 4GYFA 3WD0A 4MOZA 4P7QA 2HRWA 3TJIA 4IWWA 3M7WA 4MZYA 3U7VA 1L6FA 1LLZA 4IUGA 2C19A 3GHUA 1XICA 1Q6LA 2V69A 4GY0A 2FJKA 2Y2WA 5PTDA 2Y88A 4AVOA 2PTYA 4AH7A 4H9VA 3B8UA 1XLAA 3QQ0A 4OOZA 2D3LA 3M41A 4G7EA 4HU3A 2QJHA 1KRAC 4RE3A 4R7OA 2XISA 4EIVA 1FWNA 3PB2A 3KVLA 3U48A 3ITTA 3CUXA 1CXEA 3Q67A 1U22A 4QS5A 4Z2IA 2Z29A 3OBAA 3AYSA 3VUPA 3WUEA 3ORWA 4GC4A 2DUZA 1EOKA 3QFWA 5JXQA 3O05A 4F9JA 3NXFA 1IEXA 2VEKA 3FX4A 1RBAA 4HPNA 2JGQA 4UNKA 4D1IA 2JFEX 5D9OA 1FCUA 4UQ9A 4MB5A 4BF5A 3H2FA 4EK7A 1UD2A 2JALA 3W2NA 5JIPA 2H3DA 4K3ZA 4YYFA 2XM2A 2R1NA 4S1FA 3AALA 1S2UA 3EX1A 5I3GA 1XINA 3FJ4A 2J66A 1GW1A 3F4CA 4O50A 1US3A 4PTNA 1B4KA 1P0EA 4GX9A 3VNDA 1I2PA 4PN2A 4H41A 3LCHA 3MO7A 2YIHA 2PWHA 4FIQA 3QFEA 1GOKA 3LHUA 3LHWA 3SCSA 3TQ0A 3L2LA 3GBDA 2CFFA 2Y8UA 1JCYA 2BX7A 5LZLA 4CN1A 4E0CA 5T9BG 4UOQA 2QCFA 3FY1A 2PDQA 3OQEA 1XM3A 4IPNB 2J7FA 4PSPA 2FH6A 3GM8A 5A69A 1XLGA 2IQ0A 4J2PA 3OIXA 5AC8A 1F3TA 1Q6QA 5ABFA 3E0FA 2VX7A 1SSGA 4JTIA 3GBEA 1J10A 1AW2A 1LL7A 2QNEA 4G9PA 4REQB 1LORA 4V1XA 1UWTA 1EDGA 2PSNA 4WIWA 1GYLA 4HA3A 4GRSA 3IUIA 2EG7A 3PJUA 1KTBA 4AHQA 1XLLA 3QM3A 5K7JA 5FACA 4QLJA 3LU2A 3BCJA 4JR5A 2VEMA 3F2DA 1XIIA 3GW0A 1TTPA 1B2YA 1L0PA 3T0AA 4Z08A 2YXOA 3W87A 5JVLA 2FHBA 5EL1A 4J3SA 3W02A 3MP3A 4E2OA 1OX5A 3WQWA 3B03A 1FH8A 3E2VA 3A64A 5AC7A 4GG9A 1X6UA 1LRNA 4R33A 4RUBA 1VLIA 4PUWA 2P88A 1TRIA 1KGXA 3W7DA 1RV8A 4ZO7A 3HZ3A 1PHQA 1VFOA 3QY6A 4IFOA 1M1BA 2IUZA 3MMWA 1S5NA 5EPDA 3MSYA 5A6AA 4E3TA 1QOPA 1XBZA 2P53A 3SB0A 4WKFA 1XC6A 2XVLA 4H00A 2O4QA 2V5JA 4WDTA 1E51A 2DJLA 3WJZA 4D72A 2EAWA 2BMBA 1DPMA 4P8WA 1DKWA 4DUXA 2RDXA 1V6TA 4HJFA 3ZLGA 1BKSA 3ZJKA 4R3UA 1E55A 2BGNE 3IAPA 1Z42A 1CPUA 2PBOA 3I3EA 4GXWA 3F4NA 4CQDA 2VEPA 4DYEA 1PCKA 1GOIA 3NPXA 3DGBA 1KLYA 2PDCA 2HQAA 2P8CA 3O7UA 4WDXA 3GG8A 3WDPP 2CESA 2AMGA 4P7RA 1TPVA 4MB4A 2CZ5A 1JCLA 2W91A 3NQ7A 2ACRA 1E71M 3RR4A 3ZJ7A 2F7FA 1LOSA 2V0TA 3R4IA 5C2CA 3LI0A 6XIMA 5K9DA 4XKYA 3W7KA 1UZDA 3N9RA 1QDSA 3A24A 4AD3A 2PLCA 6A3HA 4U31A 3PTMA 3W7PA 3B06A 4WX2A 4DLFA 4HBKA 3GXIA 1B3ZA 2XZ9A 4LRSA 2QCCA 3S9ZA 1RAKA 3F1QA 3UZJA 6XIAA 4NJHA 1KRCC 4W9TA 4NZ5A 1W9VA 3NWRA 1J0HA 3A4AA 2VGIA 3SURA 3URNA 3HMCA 2NV9A 1T96A 3AS2A 4MAVA 2UBPC 1TZ9A 2OZ0A 2Y8KA 4L65A 3B0YA 3S5OA 3MUCA 4PUMA 3V7PA 1Z7AA 1R9YA 3UWZA 4TXEA 1GOOA 1REQB 2PC4A 2I17A 5DBUA 3W84A 2CZDA 4PUDA 4NQ1A 1AQMA 5EFFA 2DW6A 4TVDA 2XH4A 3BANA 1DJZA 2VM8A 5HA7A 2VFIA 5CJ5A 4B4HA 4J9JA 3N6QA 1VBHA 3VIMA 2ACSA 1XYMA 4BF9A 1S2AA 1E6NA 3GIYA 5CQ1A 1PL9A 1OQFA 1TELA 2G37A 5E93A 2J8GA 2VR2A 4KFNA 1C92A 3A12A 3AU6A 2H9AB 1DYSA 4PMZA 1FXQA 1IR1A 3P0XA 3CQKA 2GJXA 4IFRA 1RPXA 2CLFA 4IPJA 1K02A 1DVJA 1W0MA 2XM1A 3NL3A 4Z1BA 1RJRA 3QSTA 3PF3A 1M7JA 3ZYZA 1HJXA 1UWQA 3QPZA 3NVTA 2NX1A 1AODA 3M0IA 3TW7A 3IANA 1JGMA 1OFEA 1DXFA 3VGBA 3VKJA 5HK4A 3CB8A 3DYOA 3LRKA 4OFCA 1TV4A 1DJHA 3K1GA 3M5XA 3EEGA 4AXKA 3GG7A 1FDYA 2NVDA 3AMCA 3L4VA 4HA0A 4HNVA 1KM2A 1LUCB 1EC9A 3FKRA 5D03A 4QQUA 3CS2A 3EB4A 2Z25A 3LHVA 3IWPA 2VR4A 5DCEA 3ZT5A 3O16A 1PV8A 3W81A 5AKQA 5D2TA 4OUEA 1SUXA 2PI6A 1X1NA 1S3HA 2ZFAA 3EDDA 1S46A 2QCHA 3A47A 4DIAA 5C2GA 3SIZA 3W1PA 1XSIA 3B9NA 1CGXA 2OSXA 2A3EA 2NWRA 4MLRA 1JCTA 4AVFA 5C9UA 1T0OA 1HJSA 2UZ9A 1JDCA 3SCOA 2YGYA 3G1HA 1T8XA 4GE8A 1NY1A 3QZ6A 5I3KA 4FNQA 2V2DA 1HFBA 4IP5A 3LK6A 2ZZ7A 3S9YA 2BG5A 5JBEA 4W8BA 4JFTA 1XPGA 4HNCA 5D9MA 2IXVA 3DI0A 4JNMA 2Q6ZA 4GI8A 4LUTA 2X09A 1RJQA 4IIDA 3BLIA 4I9MA 4HMDA 3AIBA 4UMCA 4GI6A 3CBWA 1F76A 1XRVA 3R13A 3BJTA 3IJQA 3I65A 1TR1A 1CLXA 2WCAA 4FF5A 4QX4A 4E8DA 1FWSA 2XVKA 2ZTKA 3ITXA 4B2DA 1M65A 3KVMA 1Y5WA 1LBMA 4HCLA 5DBTA 1E6ZA 4G1KA 4RDZA 3VC6A 4GZJA 3BMVA 2VZUA 3FK4A 3VE9A 1UZ4A 2YR1A 3CPGA 1ZRQA 2ALDA 1T8QA 3AIUA 3VOCA 1R3RA 1XGZA 4DJDC 1R3WA 1VZWA 3BUVA 2OEKA 2TSYA 2Y24A 4KIEA 4CU8A 1K03A 5DY2A 4EXAA 4QE1A 3WJYA 5EB8A 5D2WA 3HBLA 3AICA 4LJ3A 4Q7BA 4K68A 3E2QA 3NAVA 1V79A 2OFJA 2INZA 4MFEA 2ZA1A 3VKCA 2SFPA 3PTKA 5AB3A 4QLKA 4JTTA 1O1HA 1L8PA 1DJWA 4IXXA 4RE0A 3BSGA 1A53A 2YB1A 2NQLA 5L9FA 1OZMA 3L5AA 3TU9A 1AJZA 4KCWA 1Y5XA 1W5MA 4IX2A 1OB0A 3ITCA 2OSYA 1UBPC 2YL6A 1FWTA 3IIPA 1VIZA 2VC9A 3OTRA 4GY1A 5A3HA 3G77A 4ZQOA 2MANA 5CC7A 3IJ6A 5EU9A 1B90A 2WJFA 5HNNA 1CX9A 5CPNA 5CSSA 1DOSA 4YXGA 4JTUA 1R0MA 3USZA 4RX0A 3BMWA 1IGSA 3CHDA 2ZA3A 3PTDA 4W85A 4HK6A 4LVBA 2ONEA 4DBWA 1H09A 1PDZA 4B5NA 3W7MA 2NX9A 3N4AA 3STCA 3VIGA 2WM1A 2CXEA 4LUSA 1M01A 3N6JA 3U57A 3GU9A 3LY0A 1YMYA 3D3AA 3N29A 1C90A 1KBLA 2ZX6A 3PPCA 4ZB0A 1NOWA 1H7RA 4XK2A 3IJLA 1OD0A 2F6UA 1UR1A 4C6JA 2GDUA 5M17A 1MEWA 2ABAA 2Y70A 1KCKA 1AQFA 3PN8A 4O1CA 1TPC1 4KRTA 3MWAA 3W0KA 4JGDA 4QJ4B 2E28A 3GFYA 4A3YA 2NWSA 1EX1A 3EKLA 3OODA 3S42A 7CGTA 3O63A 3LBMA 3WBYA 3PVFA 3M1ZA 2QMJA 1W31A 4RCXA 2OWWA 4DBEA 2FGZA 4DEFA 4NIRA 1W3JA 3NL2A 4S3GA 5A2BA 3NQFA 1JYVA 3GVWA 3WLNA 3B0VC 4ATWA 1R30A 2XUCA 1EJRC 4L56A 2QV4A 1N82A 3QTPA 2AKMA 4WY0A 1SZNA 5HQMA 4DZHA 1W5OA 1EA0A 1P0KA 2CW6A 1IXQA 3HA1A 4UOZA 2DU2A 4EWND 3MV01 2HTMA 2YBUA 1U5VA 1O5QA 4F2BA 5JMUA 4C6EA 1TV5A 2JE8A 2QYGA 4X63A 5C9RA 1DIDA 3A5VA 2ZADA 1JXKA 5T9CE 1B3XA 5KITA 1CGVA 4K8GA 4XBKA 5M1TA 3MT1A 1TV7A 1BEUA 3VKKA 3BZGA 4LBSA 4PMRA 2MUCA 1SW3A 1TMHA 5LNVA 4GNKB 4NZ1A 1R2TA 2VZOA 4ALDA 1KKRA 2D73A 3QEZA 3VGDA 3AUJA 4W4QA 4C6NA 4UTHA 8A3HA 1W9XA 2A21A 4Q8TA 1KXTA 5CEWA 1GGOA 3N73A 2DPEA 4WKAA 1SO5A 1LZOA 5K9XA 1LL6A 4AMCA 1C93A 5HPOA 3C56A 3O6DA 1ISVA 3HTWA 5H2ZA 4ASTA 4Y2WA 1EBHA 1QPNA 1DP0A 1EDTA 2YBTA 3B04A 1SVDA 3UJSA 4F9DA 4AZ5A 3SUSA 3WNOA 3FGCA 5EMJA 1TIWA 1GONA 2ISVA 1LQAA 2FFIA 1C8QA 3LGEA 1E6RA 4DF0A 1Z44A 2QHAA 1UBSA 4LVAA 3CQHA 4QJ3B 1UKQA 3NZGA 3FHQA 4IX0A 3QY8A 2X16A 4B91A 3MYPA 3ZT6A 2EPHA 2ZTJA 2AGKA 1E3XA 1AMKA 1TIMA 2FZ9A 3LBOA 1EPXA 2REQB 1BQGA 1Q6FA 3QKZA 3WQ4A 4E8CA 2OG9A 4XD4A 4J27A 4JQ1A 2WSYA 3UYIA 3HB9A 2W0UA 3WQVA 1I4NA 2BXVA 4Y90A 2PODA 4US6A 3UZYA 3C0QA 3N19B 4DO5A 3LI1A 3E0VA 3EKGA 3XISA 3N2TA 4E8GA 1ZS2A 4AB4A 4HZ6A 4XIMA 1S3TC 3M5YA 4GO8A 3TSDA 3LCLA 9RUBA 3SUVA 3EKZA 3O0KA 5I06A 1ESWA 1L6WA 3WEOA 4LCQA 3LXCA 4Q8QA 4EWJA 3NURA 3CASA 2JF7A 3MKVA 2GL5A 1H4PA 4NX0A 3RCYA 3R43A 4G56A 3BH4A 3LHZA 3DI1A 3CH0A 5CC3A 4N2YA 1YE6A 4LB3A 4NXKA 1NWRA 1EB3A 4S3KA 3VCRA 2NSOA 3BZJA 4AEOA 4MZ8A 4DXXA 4NJIA 2EXOA 3MSDA 1QT1A 3KBJA 3TDFA 1E1CB 3DFOA 3WQCA 3DHDA 2XIJA 3DN5A 1Y0EA 2UWFA 1UKTA 4AD4A 2EJ1A 2QW5A 3E6EA 1JQVA 1PKYA 4J2MA 3RMEA 4WHBA 4JX6A 4PODA 1Z32X 3TOPA 4H6RA 1YLVA 4IM4A 5FEPA 2GFTA 1OG6A 4POCA 4ZCWA 4Q4KA 1CW2A 1W5QA 2PDFA 1UMLA 2QCMA 1JFXA 3AIVA 4Y8EA 5AYYA 3H54A 1JCNA 3TX9A 3LPFA 4A3QA 5AYIA 3MS8A 1YPXA 4C6OA 2VCCA 4HNLA 1AQ0A 3OJGA 3OGRA 1LBLA 3WMBA 3WCZA 3ES7A 4MWAE 2QMKA 3ZXWA 4DLMA 5I02A 2C3ZA 5AHEA 2VJXA 4PCNA 4YCOA 1TX2A 1WDQA 3I3BA 4C1NB 4NILA 3C52A 3SO7A 3WYZA 1QW9A 3TK7A 1QPQA 4MNKA 2VMFA 4JTRA 4QNEA 2E68A 4WXYA 4HCHA 3TNOA 1BYAA 3HGOA 3QV7A 1P1MA 3TKFA 2VFHA 1FP9A 4GIEA 4QIUA 1VGAA 1JNDA 1ICQA 4PA8A 4UMBA 2R1KA 2XJ7A 4NZJA 1XYAA 4JS3A 5EMUA 1GVSA 5MKGA 1KXVA 3TYEA 1V6UA 1N8WA 3PB0A 4LCRA 4JTEA 3WL1A 3C2OA 4MNLA 5LNUA 3GXNA 4J3WA 3BMXA 3TSBA 4ZFMA 2CPUA 4HKPA 3WO8A 1OC7A 1VPQA 2NSXA 3WELA 3QSRA 3WDHA 3N1AA 3ZR5A 2PDKA 4Z0SA 5CAKA 4XVDA 2W27A 3HURA 3IEBA 4KH2A 3FFSA 1VRXA 4ICMA 1GKQA 3AWOA 3L65A 1H60A 3VKBA 3E9AA 4V33A 4AG0A 1FHDA 3NIYA 4ADTA 4GIRA 4GQQA 3OVQA 4KEZA 2WJEA 2A3LA 1GNXA 1X8CA 5I0DA 2FVKA 2YDQA 3UFYA 3NYDA 3G0SA 3CZJA 3B3DA 2CIPA 3NEVA 5KZDA 3TLLA 3W25A 1EUNA 3C2YA 5AN7A 4EVZA 3UEQA 1YYAA 2G96A 5E0CA 1OCQA 1M7OA 3EPNA 4C1NA 1YKWA 1XRSA 3GKAA 3SY1A 1UR2A 1VR6A 4H9UA 3LQLA 2ALRA 1OHLA 3LD5A 1QO5A 1TPB1 1UHVA 1HP5A 2Z7GA 5I6SA 1UZHA 3AXMA 1E0TA 5IDZA 1QI3A 1KFLA 3WLQA 1JPKA 2WZEA 4KT2A 4FHAA 4TX6A 2OXNA 2E67A 1D3CA 4D6HA 4QLLA 4DJED 3GFZA 3PP7A 4H04A 3DFYA 4L80A 1HJVA 1TJ0A 3NQ2A 4Z1CA 3U4FA 4DJEC 2V2HA 4B3LA 4LW7A 2PTDA 3TW9A 5DN1A 1H0IA 1UUOA 1EGVA 4ATLA 4LV4A 1QI5A 1NWUA 2Y5JA 1OFOA 4IQEA 1WOBA 4I90A 3KOYA 4GI9A 3QPYA 2Z1XA 1MW0A 4KERA 5AOUA 4MZ1A 3B9OA 3F03K 2R1MA 4AY7A 1GVYA 1W17A 1SZRA 2YX0A 1V4YA 3V4BA 4QSFA 3WLMA 1GORA 3IVTA 3BLOA 1RCQA 1XIFA 5I3DA 3W75A 3K8KA 3A13A 3GTXA 3O6CA 2C7FA 3FCPA 4L5ZA 1FHUA 4K38A 4GBUA 3DYPA 4HPJA 1DJNA 3MI3A 3UNDA 3I7QA 4H8HA 2DJXA 3N2CA 1FCBA 1W9DM 3W88A 3EX6A 2GVEA 3IJ7A 4WR3A 1UKPA 1HVXA 2VD8A 2XFWA 4P8XA 1DIEA 3CT7A 5CPOA 4LUSB 3VCCA 4FNRA 5JU6A 1TO3A 4Q8MA 4GINA 4C6PA 3ABRA 3PBWA 4DXKA 1ECEA 1UCWA 4A8RA 3SJ3A 1XD0A 4U3CA 3GC2A 3APYA 3SGUA 5HMSA 2HJPA 4M19A 4NNAA 4F79A 3V1PA 2WZTA 4R5EA 4LEQA 3KL3A 1CB2A 3GTFA 3BQ5A 1V0NA 4MKNA 2WC3A 2WBGA 3L0NA 3V5OA 1DV7A 2A1YA 2IQDA 2B7QA 4RJEA 1V03A 4NYUA 2J6VA 3WUGA 5FSEC 2WJZA 2QCNA 3IVUA 2VOTA 5C9ZA 5HINA 3EDKA 4DJFD 2PDHA 4AFYA 1P48A 1GW9A 3F2BA 1P7TB 1NVMA 4ACZB 3VAVA 1EXPA 2ZRZA 2PZNA 3EWWA 3G1SA 3IIVA 3VVGA 5EBUA 3N18A 3WLJA 1JPMA 2BXZA 3NQEA 4I9JA 4IPLA 1UWRA 2QUVA 3MJMA 4KKXA 4D1JA 1IWBA 3P5YA 4HZMA 3M5ZA 1DQWA 3H7UA 4LTSA 4R7JA 1QPRA 4A29A 1C7TA 4QISA 3JU2A 3HJZA 1PUDA 2XWDA 1G4TA 1GYNA 2DGAA 4ZOAA 4AF0A 1EHNA 5CCZA 2XFRA 1A5MC 2Q71A 4WSKA 5AHFA 4P7LA 1S5MA 2XGZA 4CNUA 1IEWA 4CCEA 1XWYA 5JQ9A 3AHYA 3DU0A 3AS3A 7PTDA 4XISA 1XDLA 5G4EA 1MFVA 1W9BM 3WFZA 2NQJA 2H8ZA 4HQVA 1EO5A 1HX0A 1OADA 2UY5A 3NJ3A 1Q5MA 4HOXA 1Y5VA 1TJ1A 5F2GA 1SW7A 1JFHA 4Z2HA 3P5ZA 7XIMA 3KHDA 4GJIA 4BJHA 4O16A 1OX4B 4PMXA 1TX0A 2D24A 4LVGA 3M47A 4N0RA 4H7ZA 4RNHA 4PFHA 4HSOA 3WNNA 3K8LA 2R1LA 3B9AA 1X6NA 4FNUA 5HR7A 2P76A 1FTXA 2WYSA 3GH5A 2EPLX 2F61A 4OV4A 3QMTA 1J8VA 3PZQA 1CLVA 3O6AA 1SR9A 4XO7A 3VE7A 3ZM8A 3GUGA 1F3WA 4JNYA 4YN5A 3IUHA 3WMSA 3EXRA 4XVEA 2A3BA 3MHUA 4FAMA 1A50A 4JXCA 4ZO9A 5DRIA 4JL1A 5IFTA 3BW4A 4DI9A 1VCGA 2NQ9A 1H7OA 4AWTA 4XZHA 1XCFA 1IYXA 3G0XA 3AMKA 3XINA 3ANVA 4YTUA 5G4HC 1DWGM 2OSWA 3IGUA 3FEQA 4MY9A 1S5VA 1K3UA 3PZGA 1RY0A 5I24A 2WHKA 1EO7A 4M7TA 2EGZA 2PWGA 3GHSA 2F84A 4DI8A 2VGGA 1FWDC 3ZJ8A 1WUEA 2IS7A 3R7MA 5CSRA 1TA3B 3BV7A 3S4TA 1KW1A 1KV5A 4YYCA 4IMDA 2CHRA 3ABXA 1AVAA 1LCOA 1BTCA 4Y9AA 1Y65A 2H90A 1WE5A 5FAGA 4IL2A 1X1ZA 1SQ7A 4QTGA 5AYXA 1ZNNA 3TVAA 1I2RA 3S9IA 2J74A 3UPWA 2YZRA 4XSLA 4AZ6A 1TQJA 4A8LA 4E2DA 3R0KA 4GUGA 2YSWA 3YPIA 2YDRA 2C0AA 1FKWA 3BLLA 5LNRA 3A3WA 1W1VA 1U1UA 3B4UA 1G6CA 4L1GA 3HOJA 1NOUA 2RDUA 3GUWA 3ATYA 3N15A 3LM7A 2HISA 2YCLA 2Y62A 2BODX 2V3DA 3MDWA 3HGSA 3P84A 3FGCB 1HW6A 2CLKA 1XCXA 3DAQA 4O8RA 3WLHA 1KM0A 2OQHA 2WVSA 1JQXA 4OOUA 2E9BA 4MADA 1AD1A 4H7VA 4JHOA 1WA3A 3MUAA 1TKKA 1H1NA 5XINA 5I2UA 1A0DA 3GR8A 1K1DA 4EP8C 3GYCA 2W67A 3UXKA 3CZGA 3KRBA 3ITVA