1QFEA

The structure of type i 3-dehydroquinate dehydratase from salmonella typhi
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
252
structure length
252
Chain Sequence
b'MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHNVYVVMSNHDFHQTPSAEEMVSRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILHNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (3-DEHYDROQUINATE DEHYDRATASE)
publication title The two types of 3-dehydroquinase have distinct structures but catalyze the same overall reaction.
pubmed doi rcsb
molecule tags Lyase
total genus 89
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 1999-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1qfeA00
3K30A 1T96A 4JXCA 1I2QA 1ICPA 4MJMA 3W1UA 1G6CA 1OG0A 1Q6LA 3DZ1A 4NX5A 3C52A 4WOQA 4WY0B 1NF0A 2ATMA 3QQ0A 5LNUA 5DN1A 2YGYA 3EXTA 3UYCA 3GVGA 2QR6A 2YW4A 3PBWA 5K7JA 5HUOA 4MOZA 2FJKA 4Q33A 1QDSA 1TREA 4TIMA 2W6RA 4Y96A 4UFHA 1SU5A 2P0OA 4N2YA 5U7SA 1KBJA 2ZZ4A 3STFA 2DZWA 3V75A 1IGSA 3IGUA 2YDAA 1M7PA 3LHTA 2C15A 3HG3A 4HHPA 3CEUA 5F1UA 3RK8A 3DFSA 3SFKA 4Y9AA 2ZRZA 2O7QA 1YPIA 3FFSA 2Q8ZA 3ABOA 2FB2A 1IIGA 2QJGA 2QCHA 4OV9A 3S1XA 4MFDA 3R5EA 3GLCA 3LRKA 1YTKA 3BARA 3N14A 4AAJA 1VHCA 3USBA 3P60A 3TCEA 1X1ZA 4POCA 2GVGA 3VE7A 3G22A 2J9XA 3DFPA 3LCLA 3NYZA 4XKYA 3S9YA 3O16A 4EOUA 3JR2A 3G8EA 1YYAA 1SSGA 3L0KA 4XKYB 1ME8A 1ZENA 1EUAA 2PRHA 3C8FA 4LWWA 5FEXA 3THAA 2ZQ0A 2NUWA 4O53A 4FNUA 2E5CA 1Q45A 3DH7A 1SO4A 3O6YX 4HPJA 3KVLA 3IIXA 3I7RA 2QAFA 1H7XA 5LNWA 2HTMA 3LRMA 5I3FA 5HR7A 3EX2A 4LV4A 2YX0A 1TTQA 2E6FA 3IGSA 1TPWA 4UFMA 1JR1A 3TJLA 5AFDA 2A7NA 3KOFA 1KBIA 4LC6A 1SZEA 3W7QA 1HL2A 4O12A 5AHEA 3TU9A 3LB0A 4R7JA 5D30A 3STCA 1GPWA 3QPYA 5TIMA 5CG7A 3SY5A 1CI1A 4UIOA 3W7JA 3UQNA 1W56A 3KFTA 1X8FA 5ABTA 2VENA 3LHUA 4N9BA 4O16A 4NNBA 4AHOA 1JCLA 1G4SA 1IXNA 3G1SA 3N3MA 4K38A 1UUOA 2QUTA 2ZA3A 4A3UA 4O4WA 5H91A 2I1OA 3TW6A 2NX1A 3L5LA 3LTYA 3NZRA 4MLRA 4DPQA 1QO5A 3S1WA 1VZWA 3DHDA 4O54A 2ZRWA 3TE9A 3U8GA 2YSWA 1ICSA 2A2IA 3W07A 1WQ5A 4NVTA 2YPIA 5LKYA 3OVQA 1XBYA 4ZQMA 1SSDA 2YYUA 3P80A 1THFD 1KTCA 1ONRA 4UTTC 2IQTA 1H1ZA 3W3OA 1EWEA 1HFBA 2Q3OA 4O17A 3GKFA 1VRDA 1IXQA 1L6WA 2ALDA 4NJIA 5KINA 1AW5A 4PEKA 1S5WA 2QF7A 3NQVA 4JY9A 2RKXA 4HT3A 1Q3NA 5EL1A 1N55A 4RCXA 2Y70A 3NVTA 2VOMA 1LZOA 3GAYA 1JULA 4AWUA 3MI3A 1F73A 1QMLA 3DKLA 4O28A 2DP3A 3G1DA 1QOQA 1OX4A 2Y7DA 1TRIA 1S5VA 4FXSA 1K8YA 1VYPX 4DO6A 4LVGA 2FIQA 3OEXA 5HUPA 3LRLA 1OX4B 2JK2A 3MWAA 4CQ9A 4CNOA 2B7OA 3BGJA 4IJBA 3GDTA 1FDZA 4UC5A 1OHLA 4FO4A 2CLLA 3GNNA 3TNOA 3HGRA 4CCEA 2Y7FA 2HSAA 1JCNA 4ONVA 2QAPA 3EWUA 5EA9A 3TW7A 1QNVA 3TXZA 2QCDA 1OVDA 1YXYA 2ZZ5A 2OT1A 3QC3A 3C2VA 4MUZA 3FJLA 1EP1A 1H51A 5EKYA 1B9BA 3L21A 4KWWA 2QCDB 3BW4A 1ZJIA 3B4UA 3GXNA 3CEPA 1F05A 3NEVA 2PCQA 1PCKA 3B06A 1R2RA 3CIWA 2OT0A 3CC1A 2Z1BA 3W84A 5AC6A 3W70A 3FEMA 1LBLA 3C3NA 3TQVA 1EEPA 3CQ0A 1YTEA 4CNPA 3TR2A 1XUZA 3TFCA 5DXYA 4EF8A 4UXDA 1EP2A 1UBSA 2Y85A 3PUDA 4M6VA 2VEMA 1Y0EA 2GQ9A 3EX4A 2DZUA 2QUVA 3PS7A 1I2PA 1VYRA 4UUIA 5LNRA 3PWAA 1UJPA 2ZRUA 4NQ1A 5F4WA 2ZTJA 3BO9A 4IQLA 1HG3A 2ZZ6A 4Z1AA 1JRCA 1AW2A 2B0MA 3NQDA 1CW2A 3Q2DA 3T78A 6TIMA 2H8XA 1GVSA 3STGA 1K3UA 3PF3A 1GT8A 1PHQA 4R33A 2J88A 3SGUA 4P61A 3C6CA 4LY8A 3W7GA 2F84A 8TIMA 3SI9A 1N7KA 1FWRA 4FB7A 4YCOA 4X3ZA 2ATSA 1SO6A 3HPXA 3BGGA 4JX5A 3S1UA 3NOEA 3H54A 3QM3A 4FX6M 3UXDA 3M44A 3UZJA 4JS3A 4J9JA 3HPZA 3F1QA 3LI1A 1TO3A 3CWNA 4AXKA 2OJPA 1V5XA 1R46A 4XTIA 3FLUA 3IEBA 3GX9A 4XBSA 3N2XA 3WJXA 3I7QA 4H4IA 1H61A 3DFQA 1K7XA 1X7FA 2GOUA 2O7SA 4GXMA 1YADA 2Z6JA 3FYOA 1WDWA 5FF4A 1FCUA 4PH6A 1TRDA 1K8XA 3LXAA 4YLWA 3W75A 2G97A 3Q37A 1WOAA 2V8ZA 4N6FA 2AAMA 3NQFA 4AF0A 4RZ5A 3YPIA 4B5NA 3P8IA 2JKAA 2A6LA 2V9DA 4HNVA 3W85A 5L9FA 4AF0B 3W1LA 3EB2A 5L6UA 1Z48A 4UTLA 3MHFA 3B0UX 1XDMA 1VLWA 3GR8A 2EAWA 3LERA 3FIGA 5CGQA 3MO7A 1JRBA 1FBAA 2Y62A 5D2XA 2RDWA 3B0PA 5DLCA 2OZ0A 1RD5A 2V5BA 4WOZA 2V2HA 3W6YA 4GBUA 3T55A 5D33A 3PG9A 4XQ6A 3R13A 1BTMA 4JTLA 4U28A 3NZ1A 1ZHAA 5KZEA 3P74A 2X2GA 5F2IA 1L6SA 3PSWA 4GNJA 3STEA 3IVSA 3KX6A 4RZ4A 1ZAHA 1G4TA 3FS2A 4FEZA 3DFNA 3DU0A 1SO3A 4RLIA 3NPUA 3PB0A 3GKAA 1HO4A 1OYCA 3IIVA 3QH2A 3E9AA 4O4VA 1TPEA 3SECA 2C6QA 1SFJA 5E93A 1OYAA 2RH9A 4QNEA 3BK0A 1OYBA 5CSSA 1W5MA 3ANYA 4PODA 1PE1A 4PL2A 5IBXA 2Y7GA 2VEIA 3FKKA 3O6CA 3PR2A 1A50A 2WNNA 3S6DA 2NUXA 2RDUA 2HMCA 4OWGA 3W7MA 2X30A 1W54A 5HQEA 3EWWA 3NL3A 3WK1A 4GC4A 4BF9A 3N34A 3QRHA 4QM1A 3W83A 5LNVA 3C0JA 2J24A 4EIVA 1LRQA 3HPSA 4LUJA 1R30A 3UY7A 3EWXA 1L9WA 4Y6GA 1GG0A 3O07A 4FNTA 4MKNA 5DBTA 3BW3A 4RX0A 2FB3A 4QSHA 1TPB1 5LSMA 2QCFA 4GUHA 1YDVA 3LV6A 1NEYA 3T44A 2NLIA 2H6RA 2WJZA 5IM51 3PM6A 1JVNA 3CTLA 1QCWA 2E5BA 3HG2A 1GOXA 3M5XA 1B3OA 5F2GA 4K8EA 2V2DA 1VC4A 4RZ6A 1H7OA 1MZHA 5AHLA 1Q6OA 3DHFA 3W88A 4QNWA 2C14A 1ME9A 1TPUA 5G5IA 2Y6ZA 5D2TA 4M7SA 1B4KA 4O1AA 4P2VA 1TIMA 4NXKA 4O15A 5HULA 4NJHA 3O15A 1OF8A 3W1TA 3LLDA 1YPFA 3PUEA 4JDBA 1D3GA 4LVFA 4A2SA 2YYTA 3G1FA 3KRSA 2ISSA 4KKXA 4Z1DA 3M9YA 2FTPA 3W74A 4IX0A 3C2FA 3G1VA 4ZQCA 1TJRA 1K7EA 1LBFA 1BWKA 4GJ1A 5T26A 3GDMA 1W5QA 4BR1A 3QFEA 3PY2A 1W5PA 1KTBA 1U5JA 3M5VA 2A85A 3VNDA 1SFLA 3TIMA 5U4NA 4UR7A 3TAOA 3M5YA 1DOSA 3O63A 3M1ZA 1UB3A 3NQ7A 3NXFA 4OE7A 1F6KA 4O10A 2P1FA 4UMCA 1TPC1 2X1UA 2XN0A 2P10A 1EX5A 1GVOA 4O0ZA 4FX7A 2GVJA 1F76A 3DGRA 4TO8A 5F2MA 5C2XA 2WPBA 2C0AA 3EX3A 4E38A 3W7HA 3W7RA 1GTEA 1H7RA 3CB8A 1WBHA 4NU7A 5K9DA 2BZNA 2A0NA 4K36A 1A53A 4MY8A 4Z1CA 3NM1A 3RLUA 3PVFA 5BOOA 2X16A 4I7WA 2OX1A 1ZCOA 1JUBA 3WJZA 1H7PA 5K4ZA 4D2JA 4ZVJA 1C8VA 3B04A 3N2MA 2YCEA 4LRSA 4LV9A 1VS1A 4GUGA 4GWEA 1XBZA 4NJKA 3ZWSA 2TSYA 5DCDA 5G1YA 4QQ3A 1JQXA 1PS9A 1AMKA 2A4AA 1MO0A 3L67A 5I3KA 6ALDA 2KZHA 2TRSA 1ME7A 2QEZA 4N9DA 3G0UA 3HG5A 4AHPA 1AL7A 2PC4A 1TPH1 1WX0A 3S42A 3W7KA 3P62A 1ZNNA 3GDLA 1VGAA 1LM1A 3TKFA 4TR9A 1W0MA 3TX9A 4DBDA 1O5KA 3R89A 3W2UA 3QW3A 4WJEA 3GXTA 3WK3A 2BLEA 2X1TA 1I8JA 3QMRA 5AC7A 1FXPA 3MBFA 5G2WA 3SIZA 2DJLA 2CWNA 3BLFA 3B03A 3KVKA 2D73A 3ABRA 1LYXA 5FEZA 4GUJA 1D3HA 2LLEA 1A5BA 2C3ZA 3W2KA 3O06A 4MZ8A 2TPSA 4JTSA 4UCGA 1XM3A 3W9ZA 4UNLA 3JRKA 3W7CA 3W7OA 3LV5A 3B05A 3GDKA 3TSMA 2CLEA 3W7EA 4Y8FA 3VCRA 4A21A 4JN6A 2CLIA 2GQAA 2YW3A 3FKRA 4TU1A 7TIMA 3FJ6A 4UR8A 1LCOA 4GE8A 3H55A 3TMLA 4N4PA 4Z08A 1C9DA 2NV2A 1JUEA 4G1KA 4MPQA 5F4XA 4ZL1A 3CM4A 3HBLA 2H3BA 4QITA 2ZRXA 4DF2A 1XFBA 3W7PA 2PE4A 2Z2UA 4DXVA 3ABSA 5I3HA 3NL2A 1PIIA 4XTDA 2WSRA 1T99A 3S5OA 3ELFA 4OV4A 5D04C 1DHPA 3NR0A 3TDFA 3LHWA 1I2NA 1KLZA 1F2JA 4OU1A 1MEHA 2BWGA 3GIYA 4LVBA 2QCEA 4K37A 2ZRVA 4H3DA 4OGZA 1WXJA 1QWGA 4CCDA 1T8XA 3NGJA 4HIBA 3WJSA 1OF6A 1VJIA 2I9EA 4JYEA 3THQA 5F4SA 3I65A 1XI3A 4S2BA 2B7PA 3QQ1A 1LDCA 4JIQA 1S3HA 1HUVA 2ABBA 4N9CA 1RZMA 2NX3A 2QCCA 2VXNA 4CCCA 1C29A 2WNZA 3S8HA 1EPXA 2NXIA 3NAVA 3OBKA 4CLMA 2C13A 3MBDA 3NPVA 1UCWA 2BSLA 5DBUA 3KRUA 4M7TA 1XCFA 4UFIA 4LNYA 2PRMA 2NXGA 1VCGA 3TK7A 1EWDA 4BK9A 1U83A 3DBPA 4JTIA 4N6EA 3UWWA 3EKLA 5K2ZA 3A24A 3UWVA 4JIPA 1BEUA 1QAPA 3GNDA 3MP4A 4UTWC 2FPTA 4QIUA 3OHIA 2E5DA 3LCXA 5IBXC 3IV3A 2EKCA 2A21A 1FCBA 1DL3A 1F5ZA 4CNNA 2VFIA 3UPBA 1WBJA 1FUYA 3TMQA 1FDJA 1KFJA 3LBMA 3P67A 1IXPA 4HNTA 1TPFA 4MY9A 3W2LA 3P82A 4I7VA 5I3GA 3CHVA 5C54A 3CU2A 1GZGA 5TQLA 1FWTA 3W23A 2E1DA 1CX9A 2EGZA 1EIXA 3P61A 3QMTA 3BG9A 4JYDA 2NZLA 1D9EA 1TQXA 2H3DA 2ZTKA 4JTJA 4BWLA 2A1YA 1A5SA 1FX6A 2W0UA 5CSRA 3DI0A 1OJXA 3L0GA 4HNNA 2CLFA 3L5AA 1G4EA 1RVGA 1M6JA 1OFOA 2E68A 4FNSA 3CLMA 3MI6A 4DBEA 1WOBA 5DY3A 3HF3A 2RFGA 2DZSA 1X6UA 4NZFA 2J6XA 2GJNA 3GB6A 3PBUA 3VI2A 4IWWA 4EWND 4Q32A 4O13A 4PTNA 3GYEA 1PL9A 1PHWA 2AGKA 3HB9A 3W87A 1O5XA 4AEOA 4Z0SA 3E96A 2CW6A 1QPQA 2QCNA 1PVNA 1IIHA 4PC8A 2CLMA 3MP5A 4KFOA 3W2NA 2DZXA 2FFCA 4LW7A 4GRSA 4FNRA 5LNSA 5AYYA 1J4EA 4ICNA 2F7FA 2ZRYA 4LVAA 3W7NA 2CLHA 3P8JA 1SUXA 5HWMA 3KXQA 3Q94A 5AHFA 3GAKA 4TX9A 1WAUA 1YXCA 2TYSA 2X1SA 4NUWA 1LP6A 3QSTA 1OFEA 1XXXA 4UTJA 1W31A 3DFTA 5KSWA 4UFLA 3NQEA 4LUIA 3EX6A 3O6DA 5K9CA 5AHNA 2A5HA 4Z1BA 1K7FA 4UTKA 1YTDA 1B4EA 4JGDA 3M16A 4JYFA 4ZQRA 4HSNA 4QAIA 1TTIA 4AMAA 1H1YA 3A5FA 2YFNA 3UNDA 1H7NA 1I45A 2WNQA 4L4MA 2VFDA 1JCXA 2ZYFA 2V2CA 4JD4A 1LRNA 1FXQA 4H6KA 1WYIA 1YDOA 3B8DA 4O8RA 2GPTA 1OFDA 4GUIA 2DZPA 3RLVA 3TC6A 1JJKA 4UFKA 3TSBA 5LGXA 5C5YA 4ORMA 1RPXA 5D2VA 3W1MA 4AWTA 4ORIA 1YLVA 3L68A 3PBVA 1QO2A 3MW7A 4HKPA 1O95A 4WXZA 1F7BA 4YWIA 3TQKA 2Z0IA 1FCQA 1VHNA 4MYAA 4IUOA 3W7DA 4NT0A 4UTUA 3LHZA 1G67A 3UWZA 3TC7A 5AC8A 1XBXA 3V1PA 1NAL1 3G0XA 4IX2A 3NL5A 1GQNA 2ZDRA 4YMZA 5FESA 3ZS4A 2OMAA 2J9YA 4OT7A 4UTMA 3BPWA 3S5YA 1P5BA 4UMAA 4TMBA 3OIXA 5BMXA 1F74A 1AK5A 3NQGA 1JQVA 4AVFA 1HO1A 4E2DA 3W7IA 1W5NA 1RQEA 4KFPA 4UTHA 3QW4B 3C2OA 3Q58A 2DORA 1VCVA 1W5OA 5D2YA 1F6PA 1QR7A 1MSSA 3P81A 4WZHA 1VQTA 3S1VA 3F4WA 5E0KA 4IMFA 1DKWA 3LX9A 2Z6IA 4BI5A 5AYXA 4O0KA 3EKZA 1ZALA 1DORA 3PC0A 1ML1A 4LTSA 4FNPA 5CZ0A 3WJWA 3UPWA 4FF7A 3EXSA 3W7LA 1H5YA 2VKZG 5EPDA 3SZ8A 1PCWA 2VELA 3A21A 1L6YA 5CPLA 2E6DA 5DXXA 2R94A 5A5WA 1GG1A 3VE9A 4NJJA 4ZZ9A 2FPVA 5BRBA 4ML9A 5D05A 4WQ6A 1Q6QA 4OQVA 5G2HA 4O14A 4K8HA 4X2RA 3BG5A 1OK4A 1LOQA 1OFQA 2NXHA 3OVRA 4MZ1A 2CZEA 4O1BA 4JTHA 2JKEA 4JX4A 4DEFA 4R34A 1L2UA 1K03A 3EWZA 1VLIA 3RFAA 1KW1A 1X1OA 4JTEA 5EBUA 2WOQA 4MYXA 5SWUA 4RR4A 1WA3A 2I14A 2CU0A 4E0CA 1H62A 5D03A 1VYSX 3LTPA 3TXVA 3DFOA 2QDGA 3MHGA 2WO5A 1BKSA 3T7VA 4A2RA 2V5LA 2ZA2A 3S0CA 1LTDA 1SPQA 3RMJA 2DZTA 4JTGA 3G1AA 1BWLA 3ZR4A 3HGSA 3HIJA 3G18A 3A22A 4X9SA 3KVMA 5FI8A 1GVRA 1K8ZA 4ALDA 3O1NA 3EXRA 5F2LA 4N4QA 3W76A 4XUGA 4PCFA 1FWNA 4IXHA 3M7WA 5LHEA 4MLJA 3IVTA 3ZFHA 1Z41A 5DCEA 3TSDA 3UWUA 1KM0A 2NV1A 3LHYA 3ABQA 4RJEA 3UWQA 3NQ2A 3LTSA 5K9XA 5CKSA 1KM6A 4JEQA 5E1QA 1SZFA 1DQWA 3MI2A 3M0ZA 3I7SA 2ZCGA 5LZLA 4LS2A 2R91A 2ZFAA 3CWOX 3TFXA 1P4CA 5C55A 3UZ5A 4C1KA 5BW6A 2R14A 5HINA 3UWYA 1KFKA 1KM3A 3MYPA 3N19B 1MXSA 4GUFA 4S1FA 3B0VC 5D02A 3W2MA 5MHBA 5CPOA 4IXXA 4RKAA 1XC4A 1GWJA 4M6QA 1TCDA 5CPNA 3HGOA 3ATYA 1XBVA 4BWLC 5CZSA 1FY6A 3M43A 1O4UA 3HGJA 4DF0A 1I2OA 3G3DA 1TV5A 4K39A 3C61A 4L4LA 4DO4A 2Q3RA 5EYWA 1FWWA 1W3TA 5AYZA 1QPRA 4JDYA 2PURA 2EHHA 2VFFA 2ISVA 3W71A 1A5AA 2BX7A 2WKJA 1KLYA 3A23A 1KA9F 1KTNA 2V30A 5G1TA 2VC6A 2XN1A 4YCPA 1G69A 2NWSA 4Y90A 1QOPA 1AW1A 4A22A 4DF1A 3HOJA 3KVJA 1GYNA 3MYOA 1GEQA 4LS0A 1LBMA 2AQWA 3FYPA 4NNCA 4ZQNA 4O1CA 5K3VA 2V81A 3W1QA 1MEIA 2OCZA 1TQJA 4OBTA 3WK0A 1TJPA 4HPXA 1TV8A 3W86A 4NNAA 5D32A 4NZJA 3R12A 4LVDA 4LC8A 1W37A 1TTJA 4IMEA 2YR1A 4PA8A 2Y63A 2NUYA 2CZFA 3M47A 1FDYA 3BG3A 4UMBA 3ATZA 5CZJA 2ISWA 3PG8A 1P0KA 2WQPA 1AG1O 3DI1A 1W3NA 1XL9A 4JR5A 4XWUA 3I6RA 3OA3A 1OK6A 2FPYA 1RQBA 3LHVA 1W1ZA 3PAJA 3AO0A 3EX1A 1OFPA 1KFLA 4EVZA 3H53A 2ZZ2A 1EUNA 2E09A 3QJAA 1ZAJA 2A6NA 3DAQA 1FWSA 3KRZA 5G2IA 4AHQA 2A7RA 3LM7A 4JX6A 2QCGA 4QJ1A 1SW7A 1UASA 2JGYA 1GVFA 4BI7A 1FCVA 3RU6A 3TV8A 1ICQA 4I9AA 3N9RA 1WV2A 4UTIA 1TSIA 5AN7A 3BLEA 1HTIA 1TPDA 3W1XA 3MMTA 1SZGA 1XKYA 5C6MA 5AHIA 3HJZA 4CQAA 2YFOA 3C2EA 3INPA 2B7NA 2CZ5A 1LLWA 2BTMA 3DKJA 2CLOA 1TYGA 2CLKA 1I4NA 3LXBA 2TMDA 1JUKA 1OFAA 3SSJA 3SGZA 1M5WA 5KITA 1B57A 3NNTA 5HJLA 3L0NA 1KFEA 2J27A 5AHMA 2CFFA 4PFMA 1ZAIA 3E12A 5FF7A 3F03K 5G4WA 5LHFA 2J9ZA 1XDLA 3G3MA 3FOKA 4JTKA 3W73A 1UUMA 2H90A 2B4GA 5KTLA 3QF0A 1EA0A 2G95A 3O05A 3LI0A 4LOCA 5H2ZA 2VEKA 1TPVA 3S5ZA 3TJXA 2JGQA 1DJNA 1R2SA 4PL1A 3W2JA 5GVJA 3GXPA 3NQAA 3U6WA 2FLIA 1H63A 1KV8A 2CZDA 2WV8A 3N73A 3P5YA 1KM2A 1JCYA 1FQ0A 1GVQA 4MFEA 4O57A 3S5NA 3LCIA 4FXRA 3W72A 4RXGA 1LORA 3A9IA 3FA5A 1SW3A 3W1RA 3L66A 4X22A 2Y89A 3L2IA 3CIXA 1YXDA 3LCGA 1RQHA 3OVPA 3SR7A 1OX5A 3C2RA 1KM4A 3LLFA 3O8AA 2VEPA 3QZEA 5EMUA 2ABAA 4DQWA 1RR2A 2B7QA 5D2WA 3T40A 3MUXA 2WSQA 3IIPA 2BXVA 4ZQPA 4CQ8A 1O60A 1A5CA 2GVLA 3G1HA 3LGEA 4LT9A 2H8ZA 1S5TA 4WUIA 5FF2A 3LCWA 4IMDA 3EWYA 1JCMP 3KAOA 1E51A 5D37A 2FQIA 3UXAA 3ZWTA 1H60A 5FF0A 2QUUA 4O11A 1VR6A 4A29A 2QCLA 3EEGA 1OFBA 4S2CA 1DVJA 4UNKA 3NPXA 5J5DA 1V7YA 2V82A 2DU2A 3G8RA 2VFEA 4I7UA 4XBKA 1O94A 4GFSA 1K02A 3T4CA 3P7YA 1ADOA 4M6PA 5FF3A 1KM1A 3C56A 2GQ8A 3SJ3A 4WD0A 3E49A 1VH7A 2DJXA 1EP3A 4JICA 1KFCA 4W9TA 3NA8A 5EY5A 2Y61A 4U4MA 5LGZA 4ADSA 5HNRA 4JNMA 4O19A 3RNDA 3BV4A 1ZY9A 1DV7A 3JS3A 3GZ3A 1NSJA 3QSRA 1SQ7A 4K7YA 4YL2A 5DCBA 3HG4A 1VCFA 2ZZ3A 4JTUA 3NQMA 2PRLA 4MY1A 2QDHA 2Q8LA 3KHJA 4AH7A 4JY8A 3A5VA 4IGHA 4FHAA 1KM5A 2YXGA 5CPMA 5G4EA 3W1PA 3C4UA 3P84A 2V0TA 4FNQA 3MHUA 2YZRA 4BI6A 1QPOA 3LCFA 4O50A 1P1XA 4HN4A 1DJQA 4NX0A 1NVMA 2A7PA 3HMJG 2QCMA 3M41A 3PBYA 2EPHA 2RHGA 4O18A 3AJXA 2E6YA 1TMHA 4LU0A 3PSVA 1T0OA 2X1RA 4Z0JA 3DXIA 1DBTA 1G7UA 2GUUA 5CZTA 3QEZA 4C1LA 4M5PA 1TB3A 3W1AA 5AOUA 2QKFA 3LCHA 2R8WA 2G5WA 2JKPA 5FEWA 5F1VA 4JTFA 4XZ9A 1W8SA 3BW2A 1SW0A 4ZQOA 4WXYA 2Y7EA 1Q6RA 3WK2A 3G1YA 3L9CA 4MZYA 3G24A 1J5TA 3IIOA 3RF9A 4UTTA 3L5MA 4LS1A 2NX9A 3PULA 3QPZA 4LRTA 4WY0F 3LBCA 1QPNA 1KV5A 4N02A 4QISA 5BMWA 1IXOA 4EF9A 2ZA1A 3PB2A 1LOLA 3R2GA 4MJZA 5D09A 3VFLA 4NXSA 3OG3A 3GR7A 4FIRA 3MP3A 1XUUA 3QYQA 3TA6A 1ALDA 4ADUA 3UD6A 4K7VA 2QJHA 1EB3A 3DENA 4RK8A 4K6AA 4AWSA 4HNUA 5HR6A 3WJYA 5KZDA 3P5ZA 4DELA 2C18A 3MJYA 4IOTA 4MIMA 3SW6A 1I2RA 3R8RA 4YXGA 1SR9A 1P0NA 1NF7A 3U2OA 1OFRA 3N9SA 4ZMGA 2G96A 5DY2A 4WX2A 2ZZ1A 3QMSA 1DQXA 2EF9A 3CT7A 1NFBA 4O52A 2VFGA 3GK0A 5J5RA 2QJIA 2UV8G 1R2TA 1G7VA 2NWRA 1ZFJA 3E0IA 1H50A 3NDOA 1TTPA 1R47A 1YDNA 2HS6A 1LRTA 4UFJA 2E77A 1Z44A 3IGXA 1RV8A 2WSYA 1J2WA 4UTWA 3IVUA 3TH6A 2XN2A 4E2BA 3VKJA 5HWJA 1GYLA 2XFWA 4DPPA 2HS8A 4N9EA 3WFAA 1N8FA 4RXFA 1LLZA 4BFAA 4AB4A 3EWBX 2VFHA 4TMCA 2ZBTA 3TUUA 4R53A 2FDSA 3NQCA 4IMCA 3NQ6A 3PUOA 1MEWA 3BLIA 5A8GA 1AL8A 4RV8A 2C16A 1TV7A 3G0SA 3I68A 4KFNA 4Q4KA 2C1HA 1IF2A 5HMSA 3NPWA 4IMGA 4OHQA 3W22A 3UY8A 3TROA 5FEPA 1KFBA 2ZZ7A 4DO5A 3IIZA 1M7OA 1GJPA 1LOSA 3D0CA 3LOTA 1PV8A 4ADTA 3BVJA 2C19A 4O1DA 3LDVA 1VPXA 4HSOA 4IPIA 1G4PA 4MVAA 5HWNA 2W79A 4M19A 5I3JA 4JTTA 2JBMA 3NO5A 1SZNA 3TQ0A 1QFEA 5KZMA 3LXCA 3TAKA 3E02A 5AB3A 1JCJA 1OX6A 2E6AA 1OABA 3NM3A 4KWVA 1H7WA 5KMYA 3GDRA 1GTHA 2DZVA 5D38A 3W1NA 3NG3A 4IPJA 1Z42A 3L65A 3F4NA 1SO5A 2GJLA 3G1XA 5TBOA 4NJGA 5BNKA 2Y88A 3HO8A 3M5ZA 3CPRA 3HQ1A 5I3IA 3IRDA 4FX8A 1LROA 3M6YA 5DELA 3NL6A 3NQ8A 2RDTA 5K4XA 4FIQA 1W3IA 4WY0A
chains in the Genus database with same CATH superfamily
4MJMA 2VVSA 4GGHA 5FOOA 1Q6LA 4J3VA 1FWHC 4NX5A 3C52A 3WMCA 5JU6A 2VUYA 5LNUA 5DN1A 2YGYA 4ROPA 2YW4A 5AECA 4GC3A 5K7JA 4L9XA 5HUOA 1P7TB 4MOZA 2J79A 2W6RA 4L61A 1DIEA 4Y96A 3GTXA 3VNJA 2P0OA 4N2YA 3C2YA 2ZZ4A 4FLRA 4TX8A 3V18A 1IGSA 4DM1A 1J10A 3EPMA 2YDAA 3VC5A 3WMSA 2C15A 1V79A 4HHPA 5DMYA 2YCIX 4LALA 3CH0A 4DJED 2ZRZA 3AS0A 2GUBA 1YPIA 3T6CA 4YVVA 3LMZA 4F40A 3HU7A 1IIGA 1RXOB 4PUMA 3V36A 4OV9A 3S1XA 1YTKA 2I56A 3N14A 3GXMA 1VHCA 4DJFC 1MDLA 1RK5A 1UKPA 3TCEA 1JPIA 3NTYA 3G22A 3URBA 2J9XA 3CUXA 4AD1A 1HVQA 3DFPA 1UPPA 3NYZA 4XKYA 3S9YA 4GVHA 1PZ0A 3JR2A 1R3RA 1WDPA 1ZENA 3T0TA 1XLEA 1XHGA 4E4PA 3TNBA 4BKNA 1YDYA 3REQB 3IJDA 4O53A 4FNUA 4HPJA 4ZA0A 2F8QA 5LNWA 2Z28A 1NELA 4Q4PA 4GH3A 1RLCL 1TTQA 3WLRA 1JR1A 5HXMA 2A7NA 1AH4A 1KBIA 4LC6A 1SZEA 2J77A 4FLQA 2NSOA 5AHEA 4W4QA 2BFGA 4LXFA 3PZIA 3MT1A 4PULA 3BH4A 1UKSA 2PLJA 3UR5A 3VAVA 4EXAA 3BJFA 1BTCA 3KFTA 2GJXB 3CAVA 1X8FA 3WNLA 5ABTA 3RR4A 3W02A 4N9BA 2MNRA 2AGTA 4AHOA 1JCLA 1YNYA 4NYYA 3K1DA 3G1SA 2PFHA 1UUOA 3DG6A 4JZ5A 5H91A 4S3DA 1VFFA 3TW6A 3OU8A 1Z3NA 3CAKA 1MRAA 3V5CA 4JHMA 3LTYA 3NZRA 4MLRA 1VBGA 4C6BA 1FH8A 3B97A 5XINA 1VZWA 4NVTA 2PLMA 1AQFA 3OVQA 1OCQA 1XBYA 4LCSA 1H1ZA 1AODA 1EWEA 5CEWA 1HFBA 2Q3OA 4O17A 3NYDA 4ZB2A 1X97A 1L6WA 1VENA 2ALDA 4NZCA 5FACA 2R9RA 4GYPC 4W84A 1EQCA 4ZO7A 2RKXA 3V0UA 5HJYA 2XSBA 2Y70A 8CGTA 4AD5A 2VOMA 1LZOA 4F0HA 4CNTA 4AWUA 1IEIA 1QMLA 1JF6A 1W9BM 4EXBA 4O28A 5IHRA 1ELSA 1NFPA 1PKNA 4FXSA 1K8YA 3CXOA 2VD9A 2P5NA 3OEXA 1XLDA 1HIZA 1EYEA 2PD9A 4CQ9A 1FHUA 4IJBA 4Q6XA 1HP4A 4UC5A 4S3JA 5D8ZA 1YRRA 1BYAA 4EAMA 2CLLA 4I8DA 4R27A 3TNOA 3HGRA 1UOKA 1JCNA 4Y8EA 2QAPA 3VIFA 3EWUA 4XIMA 3BC9A 1XLFA 2W66A 4W8LA 4LH8A 4GXPA 2ZZ5A 3AFBA 1I1WA 3HQNA 1EP1A 1H51A 2RGMA 3QV6A 2WJDA 4KWWA 5ABFB 5FL1A 4AC1X 3TQPA 3B4UA 1F05A 3NEVA 2PCQA 3B06A 4J3XA 3CIWA 3M0KA 4WR3A 5FIPA 3W84A 2W91A 2BGSA 1OWQA 4I9JA 4E2OA 4KEVA 3WFZA 1LBLA 2E40A 1EEPA 3JZEA 2OPJA 2ISFA 3WQEA 2VTFA 3VM7A 1UWIA 1V6XA 3VMOA 2PBOA 4J3TA 4EK7A 2BGNE 1CGVA 1RA0A 4NAFA 4NQ1A 5F4WA 2ZTJA 3BO9A 1KFWA 1HJVA 4IQLA 5EB8A 3NQDA 4PB5A 3T78A 3F4DA 1E9YB 1Q2RA 3PF3A 2GVEA 2OEKA 3QY6A 2Z4GA 1PHQA 4R33A 2R1MA 4LY8A 8TIMA 3VO0A 1R9XA 4X0VA 1FWRA 1SO6A 3CZJA 2EJAA 4FA3A 3NOEA 5FJIA 4HYRA 2PWFA 1NWUA 3UXDA 1SMAA 1JPMA 4E6MA 4QSFA 2WMGA 3UZJA 4J9JA 3HPZA 1JAKA 1E6XM 3LI1A 3ZSTA 3SRKA 1QRQA 3PK7A 1JYNA 1V6VA 1WO2A 3N25A 2ZX9A 3GX9A 7REQA 3N2XA 1W1IE 1H61A 3DFQA 1K7XA 1X7FA 3APYA 3EMQA 1YADA 3FYOA 3ARSA 1WDWA 4JAWA 5FF4A 3LXAA 4YLWA 2G97A 1WOAA 2V8ZA 1RCQA 3UVAA 4RZ5A 2JKAA 3WIJA 4HNVA 2QDEA 4ZTXA 1TELA 1UA3A 4D6CA 5D9OA 5L6UA 3ZQ9A 1YIXA 3MHFA 4PTDA 2XH0A 4X9YA 3IPWA 5JBFA 3GR8A 1GORA 3H4XA 5CGQA 1JRBA 2VI0A 2Y62A 2RDWA 4C7FA 1TVNA 3TWAA 1JZ7A 1EGZA 2OZ0A 4IG2B 1NARA 2V5BA 3WD2A 5G4HC 3CHCA 1TUFA 4JTLA 4W8AA 3CL7A 4U28A 4RNFA 2I7GA 3HV8A 5KZEA 1O1ZA 1ISZA 2X2GA 3NDYA 4HMNA 3H4WA 4IIHA 4AX6A 1BYBA 3FS2A 3DFNA 1BKHA 3PB0A 3HJEA 3GKAA 4K1GA 1SFJA 4CEUC 5I77A 5HQLA 1EQPA 4PODA 1PE1A 4US6A 4NL1A 3SO7A 3PR2A 3O6CA 2ZWYA 1PDZA 3JVAA 1CB2A 4DJDA 3W7MA 1QT1A 1OD0A 2X30A 1CXHA 1KB3A 3PFRA 2HQAA 3T9PA 4QM1A 3T8LA 3U4AA 4EIVA 4LUJA 2FHFA 1PBGA 1LJYA 3R43A 4Y6GA 1RJPA 3FGCA 2IPWA 4AZGA 4FNTA 3ZLGA 4JQ2A 3AZRA 3AU6A 3QGKC 7ODCA 3T44A 1CENA 1VP5A 5T8GA 1CWYA 3AJ7A 2H6RA 2DQWA 5IM51 3PM6A 3ITLA 3CTLA 5LXEA 3GH7A 3IJIA 2BOFX 3W6LA 4AIOA 1XIFA 3ERPA 1B3OA 5F2GA 4K8EA 4IISA 1LUCA 1Q6OA 1JF5A 2YOCA 5I2UA 4CQCA 3VGGA 3TR9A 1HZYA 9CGTA 1JNEA 4P2VA 2V68A 1WUEA 3LSBA 1UR4A 4B5WA 1CECA 2IQ0A 1IEXA 3DEQA 4JDBA 1D3GA 1R7OA 3MWCA 5CH9A 3V3WA 1DEDA 2FTWA 1Q6GA 4IX0A 3KM8A 2X09A 4J1OA 1X1NA 2O9TA 3GDMA 4G7FA 4BR1A 2RAGA 3QFEA 4IPPA 1WDSA 1W5PA 1KTBA 1U5JA 4W7WA 3M5VA 2W9MA 1IWBA 5GNZA 4HPNA 1DOSA 1J12A 3FN9A 3M1ZA 2VZOA 4B5XA 1F6KA 3BLLA 3WY1A 1ODUA 2QJJA 1K9FA 1M3UA 4GY0A 4DBUA 4FX7A 4TO8A 2YA2A 4E38A 1W32A 3VMNA 3W7HA 2UY2A 1H7RA 4PCPA 1EJTC 5K9DA 3T08A 4MY8A 1A53A 1U5HA 4Z1CA 5J04A 5BOOA 1KGWA 3PVFA 4OZOA 1ZCOA 4WCJA 2FMNA 1JUBA 3WJZA 3T4WA 1FWDC 5K4ZA 2J66A 1C8VA 3B04A 4L1WA 3QY7A 1H0GA 2TSYA 5JQ9A 4U3CA 4KPLA 3GDBA 3WH8A 4AY8A 1MO0A 3CS2A 4DJEA 2ZE0A 6ALDA 2KZHA 3VIMA 4H8UA 2XGZA 1CLXA 1AL7A 3WLNA 1TPH1 3VA8A 3GDLA 2Z7GA 2J74A 4IH3A 1VGAA 3CV6A 1LM1A 1Q8AA 2VR2A 3VDBA 4DBDA 3BDKA 3MVTA 3T0BA 1NQKA 1JPHA 3Q4DA 2POTA 4WJ8A 4C6IA 2PAJA 2DJLA 5D9NA 2CWNA 3SIZA 3BLFA 3KVKA 3ABRA 4KF1A 4GUJA 1D3HA 1O66A 4I6KA 4B90A 1B0IA 4UCGA 4CNUA 1XM3A 3W9ZA 5HDRA 3JRKA 1BGGA 1XJBA 3BZJA 1ZB5A 3ITGA 4QRNA 1UWRA 3W7EA 4Y8FA 1R3TA 2CLIA 3APTA 4IF2A 2XSXA 7TIMA 4UR8A 1LCOA 2XVGA 5I07A 5BXSA 4BEUA 1C9DA 2VOTA 5F4XA 5LIXX 1LWJA 3U3HA 4HNOA 5RUBA 3W7PA 2PE4A 1QI2A 2WNWA 2Z2UA 2XIOA 3CMJA 3ARZA 5I3HA 1Q13A 1U2YA 5CC3A 1VRXA 4L56A 2DSWA 3TDFA 4Z2JA 1DTNA 3T0AA 1I2NA 1MEHA 2BWGA 4LVBA 2QCEA 2PWHA 2ZRVA 5I00A 2GGIA 4RNHA 3RX3A 1T8XA 1ZJAA 3NGJA 4GNKB 2I9EA 1VJIA 4QEEA 3WLOA 4C1NA 4GI4A 4S2BA 1BVZA 3EBVA 2TAAA 1LDCA 4JIQA 4H00A 2QCCA 4M80A 2NXIA 4KEUA 4LGXA 3PN8A 4GHRA 3MBDA 4UFIA 3D46A 4LNYA 1W1YA 4HN8A 4H41A 1EWDA 4BK9A 1U83A 4JTIA 3VIKA 2VC7A 3WO8A 4FPSA 1BYDA 3IGHX 1OM0A 1S2UA 4RE4A 5K2ZA 2F9RA 1QAPA 4TQTA 3VFCA 4GD0A 4H8HA 2E5DA 4DYEA 3IV3A 2VDGA 1UD8A 1OZMA 4GFIA 3P0XA 1DL3A 3UPBA 1KFJA 4HNTA 1V0LA 3GFYA 2AL2A 2EO7A 3F4VA 3P82A 3KWSA 3CU2A 4W5UA 2EGZA 4GK8A 1QASA 4DUXA 4JYDA 2H3DA 2W92A 3N12A 1S1RA 1VIWA 3IARA 1GHRA 1A5SA 4NG3A 3KZSA 3DI0A 4L4PA 3KEHA 3RM8A 3L0GA 4HNNA 4FNSA 1G4EA 1A3XA 1T8QA 2E68A 3BJSA 3TONA 3CLMA 4F0KA 2RFGA 1A4MA 3EMZA 1I9CB 3GB6A 1MI3A 1PL9A 3ABXA 1MXDA 1ZBWA 1ZTVA 3WEMA 3HB9A 3AIEA 2DQXA 1O5XA 2PODA 1XKJA 2QCNA 2QW5A 1IIHA 3H70A 4KGLA 2CLMA 4XAYA 1I0DA 4PTWA 1E6PA 2VZSA 3K4WA 1C8QA 4R9OA 2BY3A 1WZLA 1J4EA 3PTQA 4ICNA 4E3TA 1FTXA 3PJTA 3FW6A 4LBRA 3VILA 3HM7A 4XAFA 2E9LA 1SUXA 1HKJA 1UHVA 3LMYA 3KXQA 2PLKA 3Q94A 4I5XA 5FAJA 4H6RA 5I78A 3VM5A 4HPGA 4TX9A 1YXCA 2Q02A 2OU4A 1LP6A 3QLDA 2I57A 3CASA 4UTJA 1I0BA 4H2CA 1E0WA 3LPOA 4UFLA 1JPDX 4LYRA 5CAKA 3EX6A 2HE5A 1YTDA 1LT7A 4JGDA 4FMVA 4RDWA 4ZQRA 4D6DA 4O1FA 2PDLA 4GYJA 1WUFA 1SYTA 2BY0A 4TOQA 1XINA 2Z1VA 1I45A 1T41A 1XPGA 4D71A 3TA9A 1JCXA 1FXQA 4H6KA 4HZ8A 4MWAA 1YDOA 5A8QA 2HXTA 4GUIA 3RLVA 4FI4A 4QHRA 1RALA 3O3RA 4H2HA 1EGMA 1R86A 4OIFA 5LGXA 3AWOA 3R79A 3PBVA 3QTPA 1O95A 2WVVB 2IW0A 1X7IA 2PWVA 1BVWA 3AMKA 4IICA 2Z0IA 3OLGA 1FWAC 4IUOA 4NT0A 1G67A 1QK2A 4PMDA 4QJ5B 3WQCA 3NSMA 3NL5A 2ZDRA 3ZS4A 1SVDA 2XIQA 1A4LA 2J9YA 3GW3A 3DC8A 2PF8A 4QDPA 3ZVIA 1M01A 5EMYA 5BMXA 4GKLA 3E6EA 3NQGA 1GQIA 4B2DA 3W7IA 1QNSA 2DIJA 4UTHA 2WC4A 3DHPA 3Q58A 4A8IA 2QPXA 1QR7A 4ZTYA 1GOWA 3NCOA 3S1VA 3F4WA 1A5UA 2FHCA 4BI5A 5AYXA 2FGBA 3H2MA 1VFHA 3FXYA 2NLYA 2I16A 2WK2A 4ZENA 1O6IA 1G1YA 3W7LA 1PCWA 2J8GA 2P50A 3GH4A 2HCVA 1UZDA 3H2AA 4NJJA 5D05A 4WQ6A 4S23A 2E67A 4OQVA 4FOJA 4H8VA 1LOQA 1OFQA 3OVRA 1A47A 2XUCA 1RPKA 1OEPA 2ODOA 4ACZA 2XH4A 2BASA 1X1OA 3IJQA 3SY1A 4MYXA 4W7UA 3FV9A 1H62A 5D03A 1S2WA 3LTPA 3GYCA 2WO5A 2VGFA 1MW1A 7ENLA 3T7VA 2WHMA 4CCZA 3ID7A 3S0CA 2WM0A 1LTDA 5GJPA 3EWCA 3LLXA 2QNEA 1BWLA 3VNLA 1TWIA 3HIJA 2POZA 5FI8A 5F2LA 3TYEA 2QDDA 3AIVA 5LHEA 4JL1A 5JUVA 4W7VA 3UFYA 4EWJA 2XINA 2VC5A 1RBAA 3NQ2A 4DO7A 3LTSA 5CC5A 4C6KA 3LZ5A 5E1QA 1SZFA 2SFPA 4AG0A 4J28A 3CWOX 1ODZA 1P4CA 4MNMA 1ZGDA 3E0VA 2AQVA 4YYCA 4C1KA 4AVOA 2E9BA 4EE9A 3MYPA 3N19B 4Q8MA 2J8TA 4GUFA 3WBEA 3IWPA 2C91A 5D02A 1TE1A 4KCTA 4UWMA 1OD8A 4M3PA 3ATYA 4BWLC 2WKGA 3M0MA 3TTSA 1FY6A 4QLJA 3M43A 3FDKA 4Y9NA 3P14A 3ONCA 1I2OA 4K39A 3IRSA 1X8CA 2Q3RA 3AXMA 5EYWA 3WLKX 1FWWA 3GD6A 1W3TA 5AYZA 4DZIA 1QPRA 3GVVA 1UWSA 1XG3A 3TZNA 1A5AA 5CJ5A 1X96A 2W5FA 3A23A 1KTNA 5I02A 5G1TA 2VC6A 4ZOBA 3AZTA 1AW1A 2E0PA 6CGTA 2J7HA 4LS0A 1LBMA 3FYPA 3PBMA 4KCWA 3GG1A 4QX4A 3WH6A 3G2GA 3FDGA 3OLDA 4M24A 4AD2A 1DIDA 1E40A 3QFWA 5D32A 3UYIA 4LVDA 2OVLA 1TTJA 4PA8A 2YR1A 3UZXA 4ACYA 4GIEA 4DLMA 2NUYA 1FDYA 3OJGA 2ISWA 1AG1O 1V02E 3DI1A 4JR5A 3H21A 3T81A 3WBYA 3QKEA 3UP8A 3TN5A 1JFHA 1AQMA 1XLMA 3FEQA 4H7VA 1HKMA 3UG4A 1KBLA 5GJNA 2FPYA 5C70A 4WEVX 1W1ZA 1ONEA 3SCPA 1E9IA 3AIUA 3TJ4A 3H53A 1V6WA 3C3UA 4B9ZA 3G6MA 4KIRA 4IIFA 3LM7A 4JX6A 3ZVHA 1P0BA 3TN4A 4QJ1A 1UASA 1GVFA 4OOZA 4EANA 3RU6A 2AKZA 3OLIA 2EBNA 3PZQA 5AN7A 2XZ9A 3H2NA 3W37A 3ZXWA 1SZGA 5HAOA 3HJZA 4CQAA 2YFOA 2IQDA 3C2EA 4Q4MA 5ECUA 4G8TA 4AY1A 5I7GA 3DKJA 2CLOA 1E6ZA 2WMHA 1I4NA 2F2HA 2WCGA 3LXBA 3WH5A 3S4TA 1CGUA 2WLZA 3LD5A 5A2CA 5KITA 3VDCA 3NNTA 4TTUA 2VRKA 2NV9A 4PFMA 4DZAA 1ZAIA 3F03K 5G4WA 4JTKA 2I5GA 2B4GA 2C71A 2G95A 2WM1A 3AWNA 4PL1A 1Q4NX 3W2JA 3GXPA 3RILA 1H63A 2DUXA 2CZDA 2BV9A 3CK5A 3U4FA 5HMFA 1FQ0A 2JE8A 1W1VA 3S5NA 3U2CA 4FXRA 4RXGA 3A9IA 2DIEA 2Z29A 1RA5A 3L66A 3SCSA 3GNPA 3VOJA 1KCKA 4KBXA 1KBBA 3UZWA 1QBBA 3QZEA 2XIJA 2X8RA 5MKGB 1C93A 1GCYA 2J4GA 1RR2A 1Q65A 3MUXA 2CPUA 1UUQA 2UBPC 2WSQA 4P8XA 1AFSA 1TE6A 3N3TA 4Y9MA 4B4HA 4LT9A 2H8ZA 1CGYA 1S5TA 4WUIA 5CAHA 3LCWA 3UW6A 3SN1A 4UB9A 3CQHA 2FQIA 3UXAA 1H60A 3BSGA 5FF0A 4NILA 4BQ4A 4PZVA 1VBJA 4HMCA 4S2CA 1EC8A 2GZXA 1V7YA 3G8RA 4B5VA 2VX7A 4I7UA 1O94A 1F3XA 4M6PA 2OEJA 3DIPA 3NSXA 4JQ1A 3ARXA 4JFWA 4WD0A 4JQ3A 3APGA 2XM2A 1DHKA 1KFCA 3F2CA 4GZEA 2WB5A 3VZZA 3URAA 4ADSA 3ANUA 1B3VA 3RNDA 3B8TA 1DV7A 1A3HA 5E5CA 1UZHA 4S3KA 1JPKA 4AYGA 1HJWA 1R85A 1VCFA 1DIOA 3VIJA 1WDDA 3N1AA 2A79A 1MW0A 2DT1A 1HN1A 5CPMA 3P84A 2V0TA 3I6TA 4BI6A 3LCFA 4O50A 4HN4A 1YNQA 3ITXA 4NX0A 1NVMA 4HGXA 3M41A 3PBYA 2PGFA 3ZJ7A 4DWDA 4QE4A 1E73M 4GPNA 1UWQA 2E6YA 5REQA 4HOWA 1LL6A 1G7UA 3H8AA 4S3AA 2XGBA 4A4AA 3CV2A 4ASTA 1TB3A 4ZE4A 2VGIA 4P8VA 4ILSA 2FZNA 4YWSA 3IUHA 2G5WA 2JKPA 3ZMRA 4FZIA 2V3DA 2WJEA 3IJ7A 1J5TA 1ZBVA 2W61A 3IIOA 1XG4A 2G41A 3QPZA 3EGJA 1E3XA 3LBCA 5ENLA 1KV5A 5BMWA 4HK5A 2QJNA 5I24A 4EF9A 2FVLA 1S38A 1JZ8A 3R2GA 4GQRA 3WELA 1KD0A 4MJZA 4GYPA 1JYVA 1PX4A 4ATWA 4GI6A 3GVWA 3UU0A 2E7FA 4W93A 2QJHA 2WBKA 4GCXA 3DENA 2WVSA 4K6AA 4PEEA 3MJYA 3F5KA 1I2RA 2BG5A 4KCUA 2GSJA 1JZ5A 3U2OA 1OFRA 3N9SA 3ZLFA 2ZZ1A 1V3LA 3QMSA 3CT7A 2REQA 4X63A 5B7YA 2VFGA 3GK0A 2PDHA 5BZAA 1G7VA 5AC4A 3E0IA 1H50A 5HANA 1TTPA 1YMYA 2ZX7A 1BFNA 1R47A 1YDNA 4HYWA 1BF6A 4LY4A 1PX3A 2PTWA 4WRHA 1PKMA 1K6AA 1S2TA 3TH6A 4I3GA 3VUSA 1H09A 2D3LA 3DUGA 4I5UA 2HS8A 4BHYA 2HVMA 4RXFA 1LLZA 2ZX6A 2VFHA 3OZMA 3Q45A 4DAFA 3UG8A 4ZGYA 1XGEA 1TV7A 5DX7A 3G0SA 1GOOA 2C1HA 2WSPA 2H9AB 1TX0A 5FL0A 5HMSA 3A4JA 4HCHA 3F5JA 1VJSA 2JEQA 3R7MA 2CZVA 4KERA 1GJPA 4IFKA 4ADTA 1PV8A 4O1DA 4HSOA 3ZR5A 1G4PA 4MVAA 5HWNA 3U2ZA 3O9NA 2W79A 2CEQA 3IANA 1SZNA 5KZMA 2P3EA 3H12A 3TAKA 4M8UA 4WDWA 1OABA 2BY1A 3NM3A 1AD1A 4TVUA 3BLPX 3TWBA 3V1HA 1E4IA 2DZVA 3W1NA 3NG3A 3PAOA 9XIAA 2PP1A 2GJLA 2VX6A 3SUWA 3W24A 2VM8A 5BNKA 4MAVA 5JBDA 1R8LA 1US3A 3TW9A 5DELA 3NL6A 1UD3A 4JQ4A 1BRLB 5C9ZA 4IHCA 4AD4A 1T7LA 3K30A 1I2QA 1ICPA 4OBSA 1OG0A 4MJ2A 4WY0B 2XH2A 4E8GA 2YDSA 4U10A 3WDHA 3GVGA 3PBWA 2FJKA 4Q33A 3ALGA 4QBXA 3VIOA 4LAUA 4UFHA 4HJFA 3BV7A 3PNUA 2DZWA 3LQGA 4RE0A 1M7PA 1NIUA 4KMQA 1GYMA 3HA1A 1CNVA 1E4MM 1DJXA 3CEUA 3MZNA 3T07A 4HZ6A 4CNSA 2NQLA 2O7QA 4P7LA 3FFSA 2FFIA 4Q8NA 3KBVA 5T9BG 3FSTA 3VIIA 4LUTA 3R5EA 4WKHA 3GLCA 2WWCA 4FXJA 3S9IA 3USBA 4C6CA 1Y5WA 4MG4A 5FJUA 3LCLA 4EOUA 3UCDA 3H2EA 2I17A 4C6FA 5JVLA 4XKYB 2OYKA 1E1CA 2QIWA 1BYCA 2PRHA 4MKSA 1VFUA 2NUWA 3N18A 1M7XA 3XISA 3BAKA 2E5CA 3AISA 4C6LA 2FVMA 4Q4QA 3DH7A 4CD4A 3O6YX 3SUTA 3ECQA 3IIXA 4NZ1A 4XAZA 4F2TA 4Z2LA 4C5YA 3EX2A 2FTYA 1XLBA 2J78A 4LV4A 2YX0A 3IGSA 1PPIA 2Z1KA 1H49A 4UFMA 1J0IA 2DH2A 3KOFA 4W88A 1CXEA 1XWYA 4MB1A 4GJIA 4XX6A 1GPWA 3QPYA 3MANA 5FKYA 1Q8JA 3N9KA 5CG7A 3SY5A 1CI1A 1M41A 4UIOA 2JEPA 2J25A 5GNYA 3UQNA 1W56A 1XSJA 3G1RA 1FFQA 1EKOA 4NNBA 3AALA 2ADAA 3BMXA 1G4SA 1IXNA 2HK1A 3SN0A 4K38A 1RCOB 2QUTA 3AQUA 3M64A 3VIHA 1WXYA 4GZ7A 2PDUA 3QHMA 4LAOA 3RLHA 3DHDA 4O54A 3U8GA 2ZRWA 3A3HA 3ENLA 1ICSA 2YPIA 2V3GA 5LKYA 4ZQMA 5AYIA 3P80A 1RLDA 4UTTC 2IQTA 4V27A 3H7RA 1VRDA 5A6SA 2OQYA 3ARWA 5M17A 4DM2A 1PSCA 3MMWA 3OOQA 3EDDA 2DH3A 2WVUA 4PRTA 4JY9A 4HT3A 4TV5A 3DCPA 1N55A 2XISA 3NVTA 3FYYA 3I10A 1DWHM 3GAYA 3VCCA 3CL8A 2XYLA 4Q4OA 3MI3A 3FXGA 1VIZA 3CUFA 2D0GA 3KTSA 3LU2A 2DP3A 3G1DA 3U5YA 1XSKA 4PTVA 1S5VA 1YBQA 4LVGA 2FIQA 4XZMX 3S3GA 3MWAA 3TTOA 4CNOA 2B7OA 3GDTA 3LYEA 1VFMA 5ABHA 4IP7A 1TZ7A 2Y7FA 2HSAA 4ONVA 3M0VA 1EDQA 3HTWA 4AZ6A 1AQ0A 4Q8PA 2V63A 1XGDA 3C2VA 4L6OA 3WF1A 1B9BA 3L21A 1Z8AA 3URQA 4K2SA 1ZJIA 1Q7MA 2FGZA 4I5RA 2WPGA 3GXNA 3L2MA 2F2KA 1PCKA 2XVNA 1EH9A 2OT0A 1EJUC 2Z1BA 1W3LA 3FEMA 1E72M 3B9AA 1BQCA 3VINA 2NT1A 3W29A 3CQ0A 1YTEA 4MDPA 1H3GA 1XUZA 1EJ7L 3ZT5A 4UXDA 4QDMA 2Y85A 3PUDA 4M6VA 4PMQA 2VEMA 3UETA 4F2UA 4P5UA 1GVYA 3EX4A 2QUVA 2XIBA 3PS7A 3H23A 4CQBA 1UJPA 3R25A 2ZRUA 5JH2A 3IS4A 1JRCA 3CZEA 4FR6A 4NAFB 7XIMA 2WHJA 2HROA 4JFUA 3HFTA 1GT8A 2OZTA 2XM1A 3LG3A 1RJRA 4JCLA 4ZB0A 2QZRA 1N7KA 2O55A 3UXKA 1QWKA 3VX1A 2ATSA 3RGTA 3S1UA 2Z2BA 3WNMA 3QM3A 3V35A 4FX6M 3UGRA 1F9CA 1RHCA 3OIHA 3M44A 6A3HA 4JS3A 4H7ZA 1T5AA 2ZADA 2X05A 5A6LA 4DVOA 1UMLA 2ZVIA 4F79A 2AQOA 4AZ5A 4PR4A 2G3MA 3PJXA 1R46A 3WJXA 3THDA 4QAWA 3QGAC 2GOUA 4GXMA 5A8PA 1KGXA 4J2PA 2Z6JA 1XH2A 3VOFA 1FCUA 7REQB 3W75A 3URNA 1ZP4A 2PD5A 2AAMA 4JPGA 3N2BA 3NQFA 1YX1A 4AF0A 3HZ3A 2VCAA 4DNHA 3LBOA 4H9VA 3VMPA 2V9DA 1MXGA 1QATA 3OZPA 3EB2A 1IR1A 5E09A 2O92A 2FZ8A 2QV4A 3FIGA 1OCBA 3VUPA 2GJRA 1HX0A 4CVWA 1HNYA 2JALA 3NVDA 5IFPA 2O9OA 4GACA 3S2NA 3WDQA 3VD5A 4BZYA 4G1NA 5D33A 3PG9A 3COTA 3CLWA 1RP8A 1EZWA 3VGFA 1ZHAA 3NZ1A 4GVIA 4IUGA 3W27A 3EOOA 3TZFA 1TZ9A 2DIKA 5F2IA 1L6SA 3PSWA 4GNJA 3STEA 3IVSA 3GFZA 3VKAA 1JYWA 4RZ4A 1ZAHA 1QNRA 2IXVA 3VXGA 1NU5A 4RLIA 3S6OA 3NPUA 3QR0A 4XVDA 3TOYA 2INZA 1HJXA 1HT6A 3E3HA 1WNOA 4KW2A 3QH2A 1AD4A 3SECA 3TYUA 3FVMA 2QGYA 4AW7A 1WAWA 4QP0A 1DWFM 3SCTA 4WLCA 5ECVA 1MZRA 3VVGA 2Y7GA 2VEIA 4GYKA 6TAAA 3UA3A 1L8NA 2WMKA 2RGLA 4WK9A 2QJMA 4AFYA 4DI9A 2PI6A 3WK1A 3KBSA 1DYSA 3C0JA 1C7SA 1V0MA 1LRQA 3HPSA 4REQA 1XD0A 2E25A 4DI8A 1XF0A 1ZU8A 3L4XA 1R3YA 3GH5A 2WW5A 3N4FA 3O07A 5DBTA 4RX0A 5D9PA 2Q71A 2QMJA 4GO9A 4QSHA 2CYGA 1TPB1 5TF0A 2QCFA 4GUHA 5LSMA 4HJWA 4FK9A 4J5NA 4MADA 3FGCB 1YDVA 3LV6A 1W1B1 3N17A 1YKWA 1Z32X 2RJGA 2OB3A 1UZ1A 4O1EA 3HMCA 2Z00A 1KRAC 3M5XA 1V0NA 4RDYA 1LWIA 1H7OA 1MZHA 4GXWA 3KOXA 2C14A 2WHKA 5G5IA 1LUCB 4M7SA 1TIMA 2OYLA 4O15A 2TODA 4U5IA 4G6CA 5HULA 4NJHA 3O15A 3G77A 2IPGA 3LLDA 1KXHA 1UROA 4E4FA 4M1BA 3G1FA 4GABA 4KKXA 3M9YA 2C7FA 2FTPA 3W74A 3C2FA 3G1VA 2HNHA 3QOKA 5H8PA 1YEYA 4C7DA 1JIBA 1BWKA 1WXZA 1H11A 2J62A 1W5QA 2V67A 4B3LA 2CBJA 3DG7A 3DYMA 2VYOA 4FLSA 4PCTA 1E15A 1OGSA 5U4NA 4UR7A 2J8FA 3ISIX 2HE8A 2XIIA 3RCYA 4CN6A 1UB3A 4OE7A 2P1FA 1PB0A 2PTXA 1E6SM 4O0ZA 3WQGA 1BSIA 4DX3A 3M0XA 4ZOEA 1F76A 3KDOA 5ABGA 4XZNX 3EX3A 1VD6A 4F0MA 3B0YA 3FSUA 3CB8A 1BG4A 1C90A 3O6AA 4K36A 3E2QA 1F8MA 3II1A 4DYJA 4ZO6A 3AMLA 2X16A 4I7WA 3EPNA 1H7PA 3MSYA 4NRRA 1XH1A 2VWSA 2BDQA 4ZVJA 2CCRA 4H9YA 5D8WA 3S1GA 2Z26A 3N2MA 5A3HA 4LRSA 4HK7A 4MAZA 4HHMA 4GUGA 1XBZA 3ZWSA 5G1YA 3NGFA 3W82A 4IFOA 2A4AA 2RUSA 3L67A 4FLOA 5I3KA 2BY2A 3GSMA 1BSLA 2IKIA 5D4YA 1ME7A 2QEZA 1TR9A 3S42A 3ARPA 2PPGA 4PMRA 3MCMA 1ZNNA 3BURA 3HQPA 4Q8WA 4TR9A 1W0MA 2ZKMX 4XKMA 3TX9A 1O5KA 1I60A 3MKCA 2DVTA 4R9XA 5FJPA 1UWAA 2X1TA 1BVNP 5AC7A 2XTKA 1FXPA 5G2WA 2V5DA 3PPFA 3VGDA 1NWTA 4L5ZA 4J4KA 3W00A 5FEZA 4WF7A 5A94A 1FWJC 2C3ZA 2TPSA 3EEZA 3GR4A 2VHLA 2J6VA 4KRTA 1Q6EA 3VDHA 2W67A 3IUIA 3CZ8A 1EF3A 1U1HA 4HVXA 3CTTA 3W7OA 1IGWA 1VKFA 3KBNA 4PMUA 3VCRA 4JN6A 1A3WA 4ZCWA 3TTEA 3GNOA 4D6GA 4GE8A 4CN4A 4F9JA 1KGUA 4BF7A 5I3DA 4G1KA 4ZL1A 3SCUA 2NQ9A 1MQQA 1BXBA 3NFUA 4DXVA 2I5IA 5HATA 3NL2A 1T99A 3ELFA 4JIRA 1F2JA 4LUYA 2G4JA 3GIYA 1WXJA 3VGHA 4CCDA 3N29A 2FZMA 3PZTA 4PUDA 2Y5SA 4IQDA 4JYEA 3IUDA 4J3ZA 1NDZA 3THQA 2FJUB 4LYPA 1EDGA 3VD9A 1LL4A 4C1NB 4CCCA 2R82A 3B9DA 1C29A 1PZ1A 2P8BA 5HMEA 3KLKA 3NAVA 3OBKA 2C13A 1H0IA 4HP5A 2VP8A 1ZPTA 3KRUA 4M7TA 3BCFA 3AOFA 2PRMA 2NXGA 3ARYA 4QS5A 1D2KA 2PDIA 1VCGA 2F6XA 4DHGA 1E6NA 2PTYA 3DBPA 1IR2A 4X61A 6PTDA 2HBVA 1UR9A 1R38A 3EKLA 4Q4RA 3A24A 4JIPA 1BEUA 3GRIA 1TVLA 4PBEA 4UTWC 4QFUA 1XLJA 3OHIA 1POKA 3AHZA 3LCXA 2VRQA 4DXXA 1O68A 2VR4A 4CNNA 2VFIA 1WBJA 2EJ1A 1FDJA 2CWXA 3EDFA 3H7UA 1B54A 2PWEA 2R1PA 4PUEA 5FJRA 5TQLA 4KEZA 4RNIA 3P61A 5M3WA 2NZLA 2AL2B 4C5ZA 1D9EA 2CC0A 2ZTKA 4JTJA 4BWLA 1JZ4A 3D3FA 5A6BD 1GONA 2CHRA 3GC4A 1XIDA 2W0UA 3OZOA 1Q7QA 2YB1A 3SCOA 1OJXA 2DGAA 2CLFA 1RVGA 4B15A 1J0ZA 3UJRA 1O7AA 1WOBA 5DY3A 2DZSA 1X6UA 1E0TA 5C9WA 2J6XA 3VI2A 3MV01 4Q32A 1CXKA 1OCNA 5EFFA 2AGKA 4E8CA 4QJ4B 4DLFA 2XVPA 4JNYA 4Z0SA 2CW6A 3N13A 4G2DA 3D5HA 2QUNA 4ZODA 2DZXA 4LW7A 3WD3A 5LNSA 5AYYA 3FX4A 4MHBA 2F7FA 1XYBA 2CLHA 3BMVA 1E9LA 5HWMA 2YB4A 4YVPA 3U7VA 3BTNA 1QW8A 2ZX5A 3TCSA 1XYFA 3RN6A 1ZUAX 4PSPA 5BCAA 1W31A 3DFTA 5KSWA 1D8WA 4HA1A 3O6DA 4Z1BA 2DPEA 5DRCA 1QHZA 1W2VA 3GIQA 1TUXA 3M16A 3GVQA 4ECLA 1LQ0A 1TTIA 3AXIA 5EMJA 2YFNA 5BOEA 3UNDA 5EU9A 2I5QA 6ENLA 3U48A 2V2CA 4JD4A 3XINA 5FCZA 3B8DA 4XK2A 4D1IA 2DZPA 1R0MA 1WZMA 2G4FA 3FK4A 3ZJ6A 3ARVA 4MWAB 3W01A 3GG0A 1C9WA 3CUJA 4WDTA 4AVNA 3CB3A 5D2VA 2J7BA 2FZDA 1YLVA 1BXNA 1QO2A 4CU6A 1S1PA 3MW7A 3TQKA 3GE7A 1FCQA 4YHEA 5DT5A 4MYAA 3SADA 1VPQA 3GW0A 3W7DA 4UTUA 3LHZA 5LIYX 3ZR6A 5AC8A 4B5TA 1FVPA 1KQYA 1XIHA 4DJDD 1PWMA 2OFJA 3WMLA 1GQNA 4YMZA 5FESA 3BQ6A 1IQ8A 3KBJA 4MWAE 2ZUNA 4OT7A 4AD3A 3DN5A 3WD1A 2PC8A 3KL0A 1M7JA 1JZ2A 5IDZA 2PDKA 3WCZA 4AU0A 1C8XA 1W5NA 5E9XA 3OG2A 2GDVA 3C2OA 2G3JA 1GGOA 2WZHA 4AWEA 1EGVA 3AZSA 4RW5A 3TTQA 1EJVC 2QS8A 3P81A 3M0LA 4UQ9A 1VQTA 1D8CA 3IJ6A 1M04A 4IMFA 3LX9A 4H1ZA 1DXIA 2BVDA 1W3JA 4O0KA 3ZM8A 3EKZA 4C7GA 4DRSA 4UQBA 3E1F1 3MS8A 1DORA 2KX9A 4OOUA 3JZUA 5CZ0A 4NRSA 3UPWA 5EPDA 3SZ8A 4EPDC 2VELA 1V77A 4D6IA 1IZCA 4IT1A 4PUNA 4F2BA 1TJ1A 2FPVA 5LXXA 5BRBA 2CESA 1FOBA 1O5RA 2XIMA 5TNVA 4K8HA 3BG5A 2WQDA 3TYBA 4C65A 3MUAA 2CZEA 2JKEA 3H22A 4JX4A 1Y5VA 3ZLHA 1L2UA 1UP2A 2WHLA 1J2BA 4QR6A 3U0HA 4RR4A 4HB7A 2I14A 3VU2A 3QPEA 1FH9A 3A6OA 4G9PA 4E0CA 4RL3A 4F3HA 5BRPA 3MHGA 1BKSA 4GMEA 1EO7A 1FHVA 4DY1A 4Q3MA 1QU4A 4KEMA 4UOQA 1REQA 3AHXA 5C8BB 2DZTA 4JTGA 2JIEA 1U33A 4X9SA 3KVMA 3QQWA 1GVRA 3IV8A 4U33A 1OT1A 1G5AA 3EXRA 5CBJA 4XUGA 1O1HA 4DBSA 4R7WA 4MLJA 3IVTA 3ZFHA 3AHVA 4UZSA 3UWUA 1KM0A 5IOBA 3UWQA 4BQ3A 3TC3A 3GTNA 4CD5A 5K9XA 3PHAA 3A4AA 4HZMA 3VKBA 2BVTA 1DQWA 3L2LA 2WC7A 4A6GA 2VVNA 1XIEA 3CHDA 1RUSA 1MFUA 3TFXA 5C55A 1IZJA 5BW6A 2R14A 5HINA 3KE0A 3IACA 4TX6A 1GJWA 1MXSA 2VCCA 5MHBA 2D0FA 4GQBA 1ISWA 1TCDA 3HGOA 4HYVA 2BXZA 4XAPA 1N8IA 4NI8A 3WLQA 1VFOA 1RY8A 3I3EA 3G3DA 2GUYA 4TV6A 3A3WA 3PZNA 4DO4A 1TA3A 2PURA 3ARTA 3BAIA 1KA9F 2D1ZA 2EPNA 2WCSA 4YCPA 4Y90A 3RX4A 4A22A 3MYOA 1JNDA 2AQWA 3KL3A 5E0CA 4LB4A 1OB0A 1UD4A 4EXQA 1MWOA 1CYGA 2FH6A 4HPXA 1BG9A 4P7QA 2PDXA 1W37A 2CETA 2Y63A 2GK1A 2O0TA 4PE8A 1WDRA 2OLSA 2X42A 3ATZA 2DSUA 1KO0A 2WQPA 1X6NA 1XL9A 3GXIA 3DC0A 3E2VA 3SGGA 3I6RA 4XSMA 4V15A 1RQBA 4PBFA 3LHVA 1F4HA 4YNGA 3QJAA 2A6NA 3DAQA 5G2IA 5A6KA 2A7RA 2QCGA 1SW7A 4OUEA 1V4YA 4I9AA 1AA1B 1TSIA 3NO1A 2OYMA 3BLEA 3ZVHB 1TPDA 4Q7IA 1PX8A 3INPA 2B7NA 2IS7A 2CZ5A 1LLWA 2DW6A 1TYGA 3F4CA 2X7WA 3SSJA 3SGZA 3I3BA 1NOUA 1B57A 3LN3A 1TFVA 3BCDA 3PZ9A 5HJLA 2BODX 4KWOA 2F6UA 2AKMA 3L0NA 3BLOA 2UY3A 5AHMA 7TAAA 3E12A 3GQYA 4B16A 4MF4A 1XDLA 3G3MA 1OC7A 2H90A 3QF0A 4UQEA 4E2VA 3O05A 1QXLA 4B9YA 3CUIA 2ZXDA 1BXCA 3LI0A 1A5LC 1FKXA 1TPVA 3SSZA 3QKZA 2WZIA 6REQA 3BICA 3U6WA 1TWDA 4GQQA 1KV8A 3V16A 1F3WA 3EA3A 3M07A 1JCYA 2WJFA 2QGHA 1GVQA 3C86A 4O57A 3AHTA 3NEHA 3W72A 3JU2A 3FA5A 3VC6A 4X22A 4QDWA 3L2IA 3MPGA 3SR7A 1OX5A 4IL2A 3WLPA 2XSAA 3PUGA 4AQLA 1ITXA 5D2WA 2PDYA 4OKDA 1JG9A 4HCLA 4YYFA 2D22A 1OGBA 1CB7B 2BXVA 4ZQPA 3QBUA 1A5CA 2IPFA 5FF2A 2DVXA 1RJQA 1XH0A 4XG1A 3KAOA 5D37A 5EFDA 3ZWTA 1U30A 4UQDA 5I03A 1PDYA 3R94A 2QCLA 3EEGA 4DWSC 1J93A 4AZHA 3KL5A 3KCOA 1KXQA 5LIKX 1BLIA 2OZ8A 2VFEA 2AL1A 3C8NA 3NO3A 2PU0A 3BAYA 4QCEA 4GFSA 3B9NA 3S83A 2G8ZA 3T05A 5A95A 1KM1A 1JL8A 2GQ8A 2YA1A 3GUGA 5HNTA 1HW6A 3OYZA 4JHOA 1JDDA 3ZIZA 5A6JA 1EP3A 4JICA 5A6BA 4WGHA 1JI2A 3CQKA 3BV4A 1ZY9A 1NSJA 4K7YA 3MUCA 2WVTA 5TD4A 3GXDA 1B3YA 5DCBA 1CLVA 4M6UA 5DT7A 4JTUA 5LA0A 4MY1A 5AVNA 2QDHA 3OVGA 5CZKA 3KHJA 2NSXA 4JY8A 1PYMA 2ZVRA 3EOSA 3C4UA 4D6JA 4P8WA 3CYJA 5C2GA 1S5NA 3ARRA 2A7PA 4NAEA 3VABA 1DWJM 3WLJA 4RV3A 2EPHA 3WD4A 2JF7A 2RHGA 4O18A 5A1AA 3UG5A 4GYFA 1TMHA 1M65A 3PSVA 5JIWA 3QV8A 5I09A 5M2FX 3A13A 3BOLA 4JFTA 3WNNA 3GIPA 2EPMX 3RU8X 3NZPA 4MWAD 1PTAA 4M5PA 5REQB 1HGWA 3I4KA 1F3TA 4ICCX 3D3AA 5AOUA 1HL9A 1DXEA 2QKFA 4H9TA 1CTNA 4JTFA 4Y9OA 1W8SA 1SW0A 4WXYA 2Y7EA 3WK2A 3L9CA 2X0YA 3G24A 4XZLX 4UTTA 3O7UA 3BLDA 4R88A 1EJRC 5IXEA 1NH6A 4ZBCA 4WY0F 3SB0A 4E5TA 4N02A 3O0KA 4QISA 3O2LA 1IXOA 1OC6A 3TLQA 3M4HA 1JI1A 1J8VA 2BOEX 1FRBA 3VFLA 3L4UA 3PZVA 4FIRA 8XIMA 2PEVA 3TA6A 1ALDA 4FS9A 1UOZA 4H19A 1XP3A 2BXYA 5HR6A 5KZDA 4I8YA 5DQPA 2C18A 4MIMA 3WQOA 4UZUA 5EGRA 4AEEA 3FA3A 2YCLA 2EKGA 4UTFA 4DJEC 1SR9A 4Z17A 1EDTA 2ZUTA 3R8GA 4B2DD 1X39A 1NFBA 3UCCA 4PCNA 3WH7A 2PU1A 5J5RA 2UV8G 1R2TA 3GG8A 2UY4A 1ZFJA 1UH4A 4JNZA 2REQB 1Z89A 2VGBA 3QR3A 5CG0A 2HS6A 3SCVA 1LWHA 1EL3A 3MTWA 1LRTA 3A3XA 2E77A 1Z44A 1RV8A 3ABZA 4RZBA 2Q8XA 3IVUA 4A8NA 3GM8A 4E2BA 1RSCA 3F2BA 2W3ZA 4DPPA 4N9EA 3BAXA 3AXXA 4AB4A 2GL5A 1ZCCA 3TUUA 2FDSA 2OKTA 1H4PA 1MEWA 3CO4A 1FWIC 3H24A 2C16A 3LNMA 1HGYA 4KGJA 4KFNA 5IDIA 3SRDA 3M0YA 4P8UA 1YHTA 2QVHA 3RO8A 4IMGA 4OHQA 1UQYA 3W22A 3TROA 1KFBA 2ZZ7A 2XFRA 3IIZA 3D0CA 2QMKA 2OGJA 2F61A 3RCMA 1J0HA 3VGEA 3FJNA 2P88A 4IFKB 2PDPA 4M19A 1TWSA 2IUZA 1CEOA 4MNJA 5I3JA 1QFEA 1K77A 4G7EA 4YTQA 4H8NA 1UR8A 1JCJA 1OX6A 2DUZA 3GC5A 4HOXA 1IV8A 5KMYA 3WLMA 4FSAA 4J2MA 2RDXA 4PMVA 1GOIA 4YS1A 1TR1A 4YTUA 4JOMA 3JW7A 1CT5A 4IPJA 2PMQA 1KR1A 3F4NA 1ZLPA 1LT8A 5TBOA 3SY8A 1E71M 4NJGA 3RX2A 2Y88A 3M5ZA 5FSDC 5IHSA 4O8AA 3HQ1A 1OG6A 3M6YA 3F5LA 1BQGA 4FIQA 2BNJA 1KWKA 1T96A 1G6CA 3NIYA 4BY3A 3MY9A 3WDJA 3FJ4A 3CV1A 3WZ0E 3BANA 3M7SA 1NFGA 2QR6A 1IT7A 2CXEA 1QDSA 1TREA 2FVKA 3MCOA 3WQDA 4FR1A 3GNXA 2NQ5A 1EYWA 3RJXA 2OXNA 1EIBA 3LQLA 3KP1A 1KBJA 3WUBA 5HBFA 3STFA 1W1TA 3V75A 2XJ7A 3IGUA 3LHTA 4MM1A 2DZBA 3RK8A 3SFKA 1FWGC 3AS1A 2Q8ZA 4UQCA 3ABOA 3L4TA 3ES7A 3MU7A 4X60A 4C6PA 5B7ZA 4MFDA 1QBAA 3LRKA 3E38A 1FA2A 1X1ZA 3VD7A 2GVGA 3VE7A 4LUTB 1JDEA 2ACRA 2WYSA 3PTDA 1U5VA 4HA3A 3VDGA 2J7CA 4PCSA 4Z2KA 5F7UA 1SSGA 1W9PA 4OFCA 1EUAA 5FEXA 4LWWA 3VIPA 1DJYA 4QXIA 3THAA 3NJ3A 4LQ1A 4ZEPA 2BVYA 4JTDA 5AKQA 1Q6CA 4XUYA 1E1CB 1TMQA 2B31A 3KVLA 4PMYA 3IJ8A 3I7RA 2QAFA 4NASA 2YL9A 2EEXA 4PB3A 3LRMA 1J0YA 5I3FA 3WLIA 5AFDA 1HL2A 4RPPA 4O12A 3TU9A 3SIMA 4R7OA 4KWSA 3ARUA 1XW8A 4HU4A 5D30A 5TIMA 1XSIA 1CGWA 2D24A 1LLOA 3K8KA 1XPYA 3BAWA 4RUBA 1I75A 2QLYA 4WSJA 3CWHA 2PWGA 2YL5A 1NWSA 3N2OA 3DERA 2VENA 3LHUA 1HKWA 1UJQA 1QUMA 3MO4A 3N3MA 1PUDA 1S46A 2ZA3A 4A3UA 4O4WA 2L5HA 2NX1A 4XD5A 2R1LA 4NP7A 3TE9A 3ITTA 4IIBA 3D47A 1YE6A 1LG2A 3W07A 1CZ1A 3B8IA 3ALFA 3DYPA 3WDIA 1THFD 1TMLA 1ONRA 4HA4A 4PMXA 2J7EA 3W53A 1LG1A 4GX8A 3GKFA 4WIWA 3DECA 3QTGA 4Q6JA 3POCA 1XLHA 4US5D 1R5YA 5KINA 2ZC8A 1UKQA 4PEKA 1S5WA 3W26A 3NQVA 1Q3NA 5EL1A 4G56A 4CQDA 2AMGA 2C0HA 3RLGA 1JULA 1F73A 4Z42C 3CHFA 1FHDA 3KP0A 1E5JA 1GKPA 1QOQA 5JH1A 1OX4A 2EXOA 4C60A 3E74A 4HTYA 1VYPX 1K70A 2OWXA 5HUPA 3L4WA 2OWCA 1E6RA 3PZUA 1FDZA 3W81A 1OHLA 4FO4A 3VGBA 3GNNA 1JDCA 3NURA 1M68A 4DJFD 1QNVA 5CJNA 2QCDA 5A2BA 3GFXA 4OECA 4WVXA 2CNCA 3BW4A 3SURA 3ITYA 3WDPP 3VNZA 2OOFA 5M5DA 1MMFA 3ITCA 5GJMA 1XYZA 5C9UA 3B8SA 4LX4A 3CC1A 3SM0A 3QY8A 5AC6A 3C3NA 1UZ4A 3GS6A 2YIHA 1W1A1 3AMGA 4CNPA 3TR2A 3MKKA 3EWDA 2HZGA 1UR1A 4URIA 4EF8A 2A3EA 1ENUA 5HJXA 2GQ9A 2DZUA 4A3YA 1I2PA 1VYRA 2VQTA 3MVIA 4IPLA 5AZ0A 4H83A 1D3CA 2ZZ6A 1AW2A 3EDKA 4M82A 2B0MA 4I90A 1CW2A 3Q2DA 4RE2A 2H8XA 1GVSA 4HZ7A 3STGA 4LAZA 3MSRA 2OELA 2ZIDA 3C6CA 4FB7A 4PTXA 3HPXA 3BGGA 4JX5A 3ITOA 2QHAA 4ML4A 3SBFA 2YBUA 4XB3A 3F1QA 3CWNA 1G01A 2PDCA 5KETA 3SN4A 4H7CA 4LSBA 2OJPA 3C5QA 3FLUA 1GOMA 1U22A 2OEMA 1SZRA 3I7QA 4JTAA 4PMOA 1P0EA 2O7SA 4L64A 5FD0A 3EZ4A 5MF5A 4D1JA 4PH6A 1K8XA 2FYMA 2CKRA 3MKVA 4DN1A 4DZHA 1UKTA 3AS2A 3PPGA 3YPIA 4B5NA 3P8IA 1GQJA 4AF0B 5L9FA 3W1LA 4K1WA 3B0UX 1XDMA 2BMBA 1PIFA 3EA1A 3SJNA 1GW1A 2ZX8A 1IEVA 1XS2A 3E5BA 3MMUA 3T2PA 3MO7A 1LL7A 3VDAA 1FBAA 2XZ7A 1LF1A 5D2XA 3B0PA 4HBKA 2DW7A 5DLCA 1RD5A 4WOZA 2V38A 2HDJA 4A35A 4GBUA 1K9DA 3KWXA 1KRCC 3S5SA 3R13A 1BTMA 2FZ9A 1Q66A 3P74A 4GQGA 4W85A 2YBTA 1B30A 2CIPA 1E56A 2VL4A 1G4TA 3AIRA 5FAGA 4W8BA 1US2A 4DXKA 1HO4A 1OYCA 1WZAA 4YVXA 1TPEA 5E93A 2XDFA 3WQVA 1OYAA 2RH9A 4QNEA 1OYBA 5CSSA 1W5MA 3ANYA 3G5EA 3QV9A 4CGTA 5A6TC 1RP9A 3FKKA 2ZC1A 2YKKA 1WKFA 2HMCA 4XIAA 4OWGA 4EKJA 4XD4A 1NOFA 1W54A 3MSDA 2Z1SA 5HQEA 3SFWA 3NL3A 1PZ3A 4HPHA 4BF9A 5AVHA 3N34A 3HURA 3QRHA 3W83A 3QC0A 1Q6FA 2ZUSA 3TTYA 2J24A 2WSKA 2YXXA 5BOFA 1XRVA 1R30A 3UY7A 4MMWA 1L9WA 2O56A 3R10A 2A3HA 1GG0A 1B90A 1P48A 1ECQA 1XX1A 4REQB 4JKMA 3U2EA 2INEA 3AROA 2QPUA 4XISA 4MTVA 4QEHA 5HK4A 1QTWA 1UKOA 3SQMA 1W8GA 2RJHA 1XLIA 1TVPA 1W9VA 1TWZA 2PDJA 4AC7C 2V5CA 4HU3A 1H2JA 4DYKA 1GOXA 2W4XA 5BROA 5BU6A 2V2DA 1VC4A 4RZ6A 1KNWA 1UIPA 1Q85A 5AHLA 4GA8A 3P6LA 4QNWA 2YDQA 4Q4SA 5A8OA 1B4KA 1F8IA 4NXKA 1W2PA 3B8WA 5CQ1A 2ISDA 3LY0A 4JCMA 3W1TA 4LNCA 1YPFA 3PUEA 3M46A 1EF2A 2DY3A 1V7AA 4A2SA 2YYTA 3D6NA 4B92A 3AS3A 1ONXA 2VD8A 1E43A 3AYRA 4ZQCA 2ZUWA 1K7EA 1LBFA 1X38A 1XIJA 1QI3A 1XRTA 2BB0A 3VNDA 3S9ZA 3RO6A 3WDRA 3M5YA 2V6AA 4W86A 1YNPA 2GDQA 4QJ3B 3NXFA 1EA9C 2Z24A 4K8GA 3LS9A 4ZSUA 4O10A 4UMCA 2XN0A 1S3TC 1GVOA 4Z2HA 4S3BA 3E0LA 2GVJA 4INFA 3DGRA 2WPBA 1AQHA 3RCNA 4PUKA 1AH3A 3R0UA 2F38A 2BZNA 1C91A 4AEFA 3U5UA 3IAQA 3NM1A 1QW7A 2DT2A 3WF0A 2OX1A 4PRRA 3I6EA 4PMNA 3MUY1 3S6TA 1M03A 3LEPA 1IWAA 5HQMA 3WQFA 1M53A 1HVXA 1R3WA 4LV9A 4S3GA 2G3NA 4NJKA 4GCAA 2A3CA 1CIUA 5DCDA 1XLAA 4H6EA 3BL3A 1PS9A 4HSHA 3EYPA 4LF2A 3DFYA 5C2CA 5E0FA 4D72A 3G0UA 1VBUA 3V7PA 3QHOA 4AHPA 5BXPA 2PC4A 4F66A 3AAMA 1WX0A 4J3UA 3P62A 1B9ZA 4IP4A 3RM4A 5TAOA 3TKFA 1QW9A 2O9RA 3OA5A 3CZGA 3AUJA 3R89A 3W2UA 4YIWA 3GXFA 3DOPA 3GXTA 4WJEA 3WK3A 2BLEA 4AZCA 2YL8A 3CBWA 3QMRA 4I9MA 4OBRA 3MBFA 1DJZA 3B03A 2D73A 3R8HA 1V3MA 2YLAA 3SCQA 2LLEA 1A5BA 3W2KA 1KR0A 2O9PA 3IAPA 2DDXA 4UNLA 1POJA 3W7CA 5DO8A 4C6JA 3LV5A 3Q65A 5CBBA 2D2OA 3TSMA 1MDRA 4A8RA 4ZO9A 3VOCA 4GIRA 2EG8A 4A21A 3VOGA 2GQAA 4JIIX 3FKRA 4TU1A 1HKIA 1ITUA 1WP6A 3H2CA 2ZUMA 3FJ6A 3CPUA 3H55A 2BOGX 2ANUA 4GZIA 3TMLA 5FSEC 2H3BA 4QITA 4DF2A 3HPAA 2BS9A 4RW3A 4UBPC 5BYWA 3H4GA 3BOXA 2WCAA 1NM9A 2E8ZA 1PIIA 3SRHA 2XVKA 1RBLA 2WSRA 4ERAA 5D04C 3KBWA 1DHPA 4GOAA 3NR0A 3KTCA 2XFYA 2YA0A 1KLZA 5DANA 2WLYA 3QOMA 1B3WA 4H3DA 4MB5A 4OGZA 4ZSTA 4J7RA 4K3ZA 2XWDA 3QVQA 3WJSA 1OF6A 1DXFA 4DBWA 1QOXA 3RHGA 3I65A 3M0JA 4NF7A 1K4GA 1S3HA 1HUVA 1GOQA 3L4VA 4FOKA 1RZMA 3GHTA 3BZGA 2WNZA 4IGMA 3TYDA 1EPXA 1T6MA 4V1XA 1JXKA 4KETA