1QFOA

N-terminal domain of sialoadhesin (mouse) in complex with 3'sialyllactose
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
118
structure length
115
Chain Sequence
b'TWGVSSPKNVQGLSGSCLLIPCIFSYPADVPVGITAIWYYDYSGKRQVVIHSGDPKLVDKRFRGRAELMGNMDHKVCNLLLKDLKPEDSGTYNFRFEISSNRWLDVKGTTVTVTT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SIALOADHESIN)
publication title Crystal structure of the N-terminal domain of sialoadhesin in complex with 3' sialyllactose at 1.85 A resolution.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 24
structure length 115
sequence length 118
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1999-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qfoA00
4WW2C 3O6FD 5GRJH 4LAJH 4OZHF 3VDAA 5DYOB 2V5MA 1YNLH 1BP3B 2GW5A 1UCBH 3UBXA 2NXZD 4OI8A 4JEGB 3NFSH 3VFSB 3QNZB 1U58A 2YD3A 4HUKB 4DKAA 5BV7L 4RGNE 4BELD 5DD0H 2D7OA 5BVJB 4Q74A 3V8CA 2ZOKA 4L8DA 2VERN 1E6OL 4CADB 1Q8MA 5D96B 3O4OC 1AR2A 5FYJD 4OLZH 1A3RL 2GK0B 4KFZC 1U36A 4P4RA 1ZHLA 3KPLA 4UZGA 5CIPB 2QBWA 3BVNB 5IMKB 3FO0L 2MTPA 2EO1A 3T0BA 5ID1B 1KN4L 2IANA 3FFCD 1TTFA 2X7LB 4JHWH 4KY1L 1CZ8L 3P0VL 1FL6A 3SDAD 3FRPA 1N7MH 5CJQL 1GAFH 3S97C 1KC5L 1R6VA 2GUOA 1B88A 3KNBA 3ZYOA 1MHPL 3CFCH 4ELMB 5JIIA 2X9WA 4TULH 4V1DA 5FYLE 2WWKO 4M3KB 4PRPB 4I0PA 3QXUA 4FRWA 2XI9A 4GAFB 2JJWA 4GS7B 5EOTB 4EDXA 3LQMA 1OAYL 3MRGB 4P2CG 3RHWK 1GC1C 4G9FB 2F5AL 1CIUA 4PJGA 1GHFL 3EW3B 2YRPA 4WW1A 1MIMH 4YHZH 2WQRA 3CFJA 1JPST 1UM4L 4OBSA 5BZDB 5CIPH 1UKTA 4GAJH 1RY7B 1ZHBA 3DURB 2X70B 3T1FA 2YD9A 4NQED 4XRCA 4C57C 4HWNA 4NOFA 3QO1B 4AY0A 4M5YL 2WZPD 3MJ7B 1RURL 2L0DA 4PS4H 1RZGB 1FGNL 4WFGE 5M94B 2R2BB 1ADQA 1UC6A 4Y2DD 4FTVA 5DRNB 1IFHH 4HS8L 5IMLA 1BD2D 2Z35B 1J1XH 4RISL 3MGOB 2B1HL 3MJ8B 2AK1L 2K9UA 4YHIB 5EO0A 4EZMA 4ZOCA 1LO0L 5FO8B 1N3NA 1A3LH 3TO4C 1CGSL 4NO5B 4HIXH 3U0TA 2C3GA 4S2SB 3TPUA 4R26H 5EN2B 4LOUC 3VDCA 1XCTA 5C7XH 5IBTH 1X4XA 3VXUB 3U9UB 1OAUH 3EDFA 4Y2OA 1MCRA 4GQ9H 1FSKB 3KPQB 1YQVH 2N4IA 2BNQE 3AS0A 4G7YH 1V7ML 4XMPL 5JZ7D 4MNHB 3HZMB 1CWVA 3WN5B 1KACB 1XGRB 3T1WA 1NGQL 3D0VA 5EOCJ 4YX2H 2H8PA 5FECB 2CGRH 1L0XA 3K2UL 2IG2L 4YBQC 3CFBA 3Q6FA 4FA8A 1WISA 3MRRB 5DUMH 3UTTD 1VFUA 3FT2A 2EYRA 5DDHB 3WLWC 1FLRH 5JLZA 4HGWA 3Q5TA 4D0CA 1UB5B 1LNUA 2C3XA 3LEXB 1XH3A 1OP3H 1JGEB 4NN7C 4YEEA 3CH8A 1QVOA 1JPFA 4AMKL 4JPIA 4LIQL 4O58H 1ZA3A 1N0LA 3INUL 3M17A 1Y0LB 3K1DA 5IQ7H 1M6OB 1D9KD 2VLKE 5IBLD 4XP6L 3TYFB 2XY1A 3LEVL 2CUIA 5I1LB 3Q5OA 5GZNC 3IDMA 4YNYB 2NW3A 2APTA 4KQ4L 3E6FA 3O3EA 1FO0H 3LEYL 5E9DE 1CXEA 3FB8B 2NY5C 4KDVA 2DQHH 2VDQL 3D25A 5EBWA 2XIDA 1EEZB 5IHUL 4WEBL 3MJ9A 2GI7A 5DD6B 3BIKB 1B2WH 4LKCA 3LN4B 4M48L 3VRLE 2APFA 2ZCHL 2BHUA 2Q8AL 4NJ9H 1QSVA 5CJOL 4OCYH 1K3IA 5IV2A 3QWRD 3AS3A 3TBSB 2D0HA 4Z0BL 5ISZD 5FUCE 4ZPVB 1FFQA 4PJXE 8FABA 1JGVH 5I1DB 3WNMA 2Q3AA 3QCUL 4PJ9B 5LGJA 3V6OA 1MREH 3QUZB 2VC2H 1F4YL 2HVKA 4XWOD 1CL7H 2DQTL 2W92A 4R3SA 1QBLL 2L7UA 1A6WH 2JLLA 5E8NB 2KH2B 3NIFF 3QDGA 2AV1A 1NFDB 3V79C 1NCCL 4X7DC 4HJJL 2AP2A 3MMEA 4GRLB 3QPQD 4TRPL 2C5DC 1JYNA 2Y06L 5I74B 1QO3B 5MERA 2WWMC 1D5ZB 3REVA 3PGFL 1WWAX 2CXGA 5FDWA 1U8IB 2A2QT 3D3VA 3L3OA 3I2CH 2EIZA 3KHQA 3RU8L 5FCUH 2AJUH 5BRZB 3TNNA 3PWJA 5J1SC 1R0AH 2OCFD 1AGFB 2RR3A 5DMKB 1RUML 4WI8A 3GGWA 3T0ED 2G5RA 2C3VA 3E6HB 4ODWA 2P8PA 1XCQB 2AXGB 4LCWE 3RA7H 3GKWH 5MEND 1OL0A 4FP8L 3VI4F 4I4WA 4XNMA 4Z7UF 3NA9L 2PO6A 4ZFFB 1QSFE 2OZ4H 4DKEL 3IGAB 4NUGH 3SJVD 2VDRH 3VFPA 2ATPA 4UINH 3UTSB 3KXFB 3DX8B 1EAPB 2AQ1A 1YNTB 4OLXL 5HHOB 2VABB 2BRQA 4OCSL 5BS0D 5K9QG 1EHAA 5C0JA 1LP9E 5A2KH 4ONGH 2BXYA 3IDYB 4LSUL 3L3HA 4JHAL 3BKJL 4FS0A 5J6HB 3CPLB 3EYQD 3O6KH 4KDWA 1V7NL 5GGRB 4RAUA 2ZCLH 2EYTB 3QNXA 5TDNB 3FZUD 3O3AA 4NZTH 3CNKA 4WI9A 2HRPH 3B5HA 4OF0A 3KPRE 5B39G 1XIWA 1TZGL 2PW1B 4TUKH 3B2UD 3WFDH 2A0LD 3O0RH 3QEGL 5FXCH 3MBED 5ALCH 2QQQA 1NBQA 4FFZH 4HUXA 1OGAE 2X42A 1NCAL 4H20H 4KKAC 5E5UB 2A9NL 3CDCA 5C9JA 5IB1B 2GSGB 2RFXA 3L3IA 1A8JH 3SDXE 2VZTA 3L1OL 2GYSA 4U3XA 3NZHL 3B2VL 3TV3H 1AR1C 5D6DC 4TVPE 5C92A 1U6AH 5IF0B 3MLRL 3D2UB 4WWKB 1NGPL 1A7RL 2ZJSH 3T77B 3BH8A 1CDUA 2A83B 2FL5A 3BO8A 3ULUC 3HB3C 2DQDL 3BP7B 5L2JA 5BCAA 4NKOA 2E27H 1IRAY 1GGBH 5SWZE 3GNMH 1WZMA 3AAZA 1HHJB 5KS9B 3WKMH 4WUKL 5H35B 5IFHL 2FJHB 3BP5A 3PWUA 4C58B 2WW8A 1MCEA 5HHNB 3EZJB 4ZMAT 5TE4H 4QHKJ 1DBBL 1ED3A 1OP3K 4U6VL 4PYGA 2HT3C 1RZKH 4ZPTB 5EC2B 1CDYA 2I24N 5F70A 1RUAH 2DQFB 5CSZB 2PR4L 5INCA 3B6SB 5JHDA 1O7VA 1JF5A 3FT4B 5DJ2A 5HDBF 5ALBH 4ONFH 4JRYB 1NGYB 1QLRB 5CEXB 4LVHB 1A14H 3MRPA 3D18B 3SE3A 4Z7OE 4K9EC 5A3ID 4PRDB 5KBNC 4P5TB 3MPCA 3OKLA 4OTXH 3NFPB 4YO0B 4X4YB 5FYKE 4Y7MA 5ENWB 1HILA 4MQXC 4O4YH 2AEQL 2F53B 2X4PA 4WI5A 3VXMB 2ZUQC 2JCCB 2EE3A 3NCBB 1FH5H 1XT5A 3VFOB 3W5MA 1EBAA 1I1YB 3U7WL 1ZA6A 4LRIC 4FQXB 1J0JA 2CIKB 4MA3A 3EFDL 3ZHDA 1LD9A 3QIBD 4PPTA 4ONHA 3A6BH 4YC2B 5F21B 5CZVL 2IAMD 3MRNA 4AYFA 4K8RC 5MHSE 4C59B 5JW3L 3BQUD 4ZS6D 4PB9H 1RK1A 4Z7WE 3PDOB 1GZQB 3K4ZA 4XC1L 2FD6H 2JIXB 1O5DT 5J13C 5EA0H 3AB0B 3HRZA 1YYML 4WFHD 2GTWA 4CW1B 4QOKB 5HGHA 4LAQH 4L3EA 5L9DL 4JY5H 3BKYL 3GEWB 1ZGLB 4TNWF 5CLTA 1ZKAA 4R0LA 5DD1L 1HEZA 4YGVA 5CEZH 2YEZA 2YMXH 1IC1A 2BC4B 2R0LL 2X4UA 1CGUA 4BH8A 5AEAA 4KVNH 5D5ME 3QISA 3THMH 5I9QB 3PWPD 5E2VL 5C0CE 5EO9B 4GLRI 4UT6H 5B8CC 3O6LH 1BLNB 5B38B 2ED9A 4PB0H 1T6WA 5HVHB 3JWOL 1RZIB 1UA6L 5FOJA 1CLOL 2BCKB 2P47B 2DM4A 3NACH 4QXGH 3VWKD 4JZJC 3ROLB 3QXDA 3RPIA 5KSBE 5AZ2H 3UYOD 4OFIA 3FFCA 4M43L 1DQML 4HFWB 2EO9A 2FATH 5I0ZA 4R8WH 3VH8G 1T89A 3AC0A 3TIDB 3SDAA 5HYQA 2C3WA 1GSMA 5I71C 1A5FH 1WTLA 1O0VA 2VLJE 2YPVL 4G8GE 1CT8B 4F80A 3ARFB 1G7HB 4FQCH 1BFVH 4OM0H 3SO3B 5ADOH 3RJQB 3N1GC 3D9AH 5FHAH 1NMBH 1MFBH 4ZFOL 2IF7A 4KPHH 1XF3B 3IF1A 4FNLH 5IEHB 5KSAB 4HHAB 4NQEA 1K4CB 4EIZC 1V3JA 4YBHA 2ZSWB 1F4HA 1NPUA 1QRKA 3CFDA 3MR9B 3EZ8A 1IGCL 2X4OB 4KRPC 4NWTL 4XVSH 2COQA 4Y2DA 1FZKB 2DTMH 2F9BT 1SMOA 5DK0B 1UEMA 3HZYA 5ITBH 5CJBA 1BD2A 5DJDB 2OTUB 3H7BA 3D87B 1NUFA 4HFUL 3U4BH 1WF5A 4PG2C 1TJHH 4KKNA 5A2JH 1F3DJ 1RFDH 4JDVB 1JVKA 1RUQH 5I66A 4WGVB 4JG1L 2XZAL 2ZKHL 1T1YB 1MCWM 3DGGB 1ZVSA 2HT4C 4OZ4A 1M7XA 5HHMB 4HS6A 1OY3B 2DBLL 3TZVD 4YUEL 3UJJH 4GMTL 2NY1C 2B4CC 3BGAA 1WK0A 4C55A 1NGXA 3STZA 1V5JA 3F12A 3LD8C 4RZCA 3RDTC 2F54E 5GXBB 2RJMA 4Y4HC 5ETUB 2OSLB 4P46B 5ACZB 3MJ6A 1C5BH 3LKNB 4HS3A 1EUTA 1P9MC 4CGTA 3MRBB 3GMQB 1Q1JL 5C09E 1DN0B 3UTTA 5CJ8A 4D9LL 1UYWL 3ZDZE 5IOPB 4XPTL 1IMHC 2C1OA 4YHLL 4M7ZB 3LRSB 4PJBB 1X5LA 3EOAB 3OX8B 4XAKD 4F2MA 1DVFD 3RWDB 3HI5H 5EOQL 4LOUD 4NQCB 4YHKL 4NO2B 3B9KB 1D9KA 4TNVF 4U1IA 1WZ1H 5GZOD 4PJDA 2W9EL 5HXMA 3T09A 1ZOXA 4WO4B 1D5BA 3ZYJA 1KTLB 1ZEAL 4PUBL 3HLAB 2VXQL 1T5XB 1BVKB 4OGZA 1YPZA 2A1WL 4I9WE 3MRLA 4UQ3A 3UTQB 5I1KL 3NCFB 5EUOE 1UWEH 3STBA 2NY6C 1MEXL 4XPFH 1RV6X 4UQ2B 2ITCB 3G6AB 4N1EA 4RIRB 5GS1C 3WLWD 3ECBB 5EU6D 5F89A 5ICZB 4ZOBA 3VWJC 4RBPH 1Q9WB 4JZOA 1BQLL 2MQ0A 3QWRA 1D6VL 3JWDL 4YLQT 1HSAA 4L5FL 4P5KB 5ISZA 5J1AA 9CGTA 3G5VB 3DTXB 1B9ZA 4CMHB 1RZ7L 3U4EB 1JYVA 2P5EB 1WBYB 1QEWA 2G60L 5EFIB 1VB9A 2DQEH 2VAAA 1R24A 3C8HA 4EI6B 3OSKA 1IBGL 1KTDB 3KPTA 2X4TA 4M93C 3P30H 4KK5C 1HSBB 4TUOB 2FNBA 4WU7B 3D85D 4DGYL 1QLEH 1TZHB 3LSOA 3VXNA 5IUSA 4PP1C 5I8EA 3TYGL 5I76A 4P4KB 1MCBA 2ESVE 4OCRL 1NAMB 4ZAKB 2LQRA 2MKWA 3MV9E 1QOKA 3FQXA 1DE4A 1IEBB 1I7ZA 2K1MA 3C8KB 4GXUN 2PYED 4O2EA 4HPYH 2R1YB 1F8TL 5F7FA 5CMAA 4MNGA 3BKMH 4L8CA 1NQBA 3SCMB 3HS0A 2OQJA 3S35L 2HLFD 4U49A 4JFPB 1IAKA 2N7AA 1LGVA 2Z93B 4PJCA 4RMWA 3I6KA 5GISL 2WP3T 2R23A 1HI6B 4RFNB 5GSVA 4WFEE 2FWOA 3MZGB 3T0EA 2GTZB 5MENA 4QEGA 4F33A 2ORBL 1JV5B 2VZ1A 4Z7VE 2LTQB 3TP4A 5ANMA 4Y5XC 3O2DH 4P2RD 2YXFA 2DL9A 1WFTA 2J3SA 2PYFA 4JFXA 1FNGB 4UT7H 5ESVB 5DQ9B 3SJVA 4L4VD 5SX5H 4UV4L 4I8DA 3UMTA 3ALPA 1MRCL 4ORZC 1U8JB 1AD9B 1ZANH 4WI4A 3QFJE 5DC0A 2YD7A 5BS0A 3H9HB 4HAFA 4BZ2H 1IZJA 4HIHB 3ZHKA 3QI9C 4NQDE 3QHTC 1MJ8L 5IBTL 5C2BH 3HG1B 5SWSB 3VXRD 4MNQD 3GO1H 3P9MB 3TT3H 1WICA 3ARQA 1PY9A 4ZUWB 3VXOA 4OV6F 1ZS8A 4PJAA 5DR5L 4UNVA 1U8PB 4G7YL 1JNHA 1KT2B 4MD5B 2AQ3A 3MBEA 5D1QB 1BM3L 3EO1A 1D3CA 5T1DL 1CIDA 3H9SB 1G9EA 4NRZA 2EH7H 2BY1A 4KZDH 3VRLF 1CE6B 1JTPA 4KHXL 5T5NF 5LBSH 1NSNL 4ODTH 2Y1VA 5H37H 4PJGF 4D9QE 4P2OC 2E5EA 1FLRL 1HHGA 3S35X 1DSFL 1EBPA 5HI5D 1AGCA 3G9AB 4PJXF 4YBLB 1I9EA 1A6PA 1P4LB 5BOPA 4J1UB 4N8VA 4C83A 4OCXH 1J8HB 2DF3A 4ODVL 2QKIA 3QG6B 5GJSL 4NZUH 2BNRB 1KCVH 3G08B 4NZDA 4U7SA 4HUMB 1FZMA 1JGDA 1S7XA 1A4JB 2WUCH 3DIFA 4PTTB 3UJTL 4LPYA 4F15C 1B4JH 5JORB 1L0QA 1EGJL 1IEAA 5F88B 4YGAB 3L3KA 4KKAD 5D2NC 5I30L 3HKFA 1TCRA 2V6HA 5F6HI 2E6QA 1T20A 4M61A 4P2YA 1DQQB 3P11L 2NX5E 3O4LD 1XF2B 4P2QE 2WBJC 3U30C 4P9ML 4OUUA 4YDLC 1N6QL 3EKCA 2GJ6D 5C08D 5JMRA 1AR1D 1D7FA 2ZNWA 5L8JB 1MCDA 4MGXA 4E5XA 2D2OA 3GI9L 5KSVA 4NQVB 3HA0A 4MD0B 5J56B 3VXSE 4DWHA 5IW1B 5IR1A 2A6DB 2C4XA 4BFIA 4ZSOE 4P0DA 2PNDA 1S7VB 2YUWA 3ULUD 1OPGL 1IGTA 2UVEA 5MI0C 4RAVA 5C0BE 2VZOA 1C7TA 2VYRE 3ULVL 3SKMA 4XP1L 3DMMC 4QCIA 3SQBA 1F00I 1TPXC 32C2B 3IDUA 5I6XB 4CU6A 4LLWB 4NZRL 4DGIL 1TVHB 3QIBA 5IG7B 4RBPK 5HGDA 5IVXA 2IAMA 4JFFE 5H94A 3IXAA 1LP9F 4P3DA 3B8SA 2P4AB 3RKDC 3BQUA 1XF1A 3T04D 1AFVH 1RJZB 3WO4B 1U8KA 1CN4A 1FL5A 4PJFB 1JZ8A 2J8UE 3KR3H 1ZLSL 1I7RB 5IHLB 3KYAA 1TQCB 3IFOA 2R69H 4RFEA 4ZFGL 3EO0B 5FO7A 3PWLA 2BSSA 3DXAB 3DVGB 1L7IL 2ZOLA 3VMNA 1J8KA 4OZIE 1M05B 1MCIA 3BUYA 2D03L 5SX4I 4MB4A 3OR7B 4Q9CA 2JELH 1PZ5A 4FMFA 4MB3A 5C0IA 4UT9L 3PWPA 4F3FA 2F74B 4JFDB 1M7IB 4G3YL 5INDB 4KK9C 1Z3GL 3SDXF 3P77A 4NUGL 1ZLWK 3QUZC 3WSQL 4OBRA 3EDKA 1DL7L 5L0QC 3C5ZC 1J05A 4FFVC 3VWKA 4OFKA 3GSXA 3M8OL 4H25A 5BO1H 2ZUSA 3QEQB 2NTSP 3UO1L 1R3LA 4XPGH 1FNHA 3DUSA 5C0RH 4U6XA 4NHUA 5CP7A 5I74C 1L7TL 1CXFA 1NCWH 4AT6A 3VXTA 2HRPL 3SKOB 3MRHA 5DURB 4N0UB 2ICWJ 2YA2A 3KYMA 3K46A 5IMOA 3VE0A 1LK3H 3WFDL 4WHTB 1CFTA 3L3DA 1J5OL 4PRNA 1AIFB 4LARH 4U1KB 5DVOA 2CXKA 1MF2H 4HWEH 1UVQA 2APXA 1HOCB 1CK0L 3LAFA 2QEJA 2BNUA 4J7RA 3QCVL 2MPAH 5FOBA 1ACYL 2YUVA 3HMXL 3LV3A 5FUOL 2W65B 4Z7QE 2QSCL 5EC1A 2M1KA 2X05A 3BEWA 4R6UA 4H26A 2JK5A 4PJ7B 2Q3ZA 4YE4L 4D0DB 2HLAA 1A22B 5CGYC 3DNKA 4JRXD 2A6JB 5I1IH 3LS5L 1XR9A 4YHPB 4Z0XB 1MPAH 3DSFH 3VFWB 3W0WB 4K7PY 4H88L 3WHXA 2HJLA 5FGBA 4OGXH 3GMLB 4G6FB 1F58L 4HH8A 4M6OH 2MHAA 1CDGA 4HKXA 4FFYH 5ICYA 4YQXH 3GNML 1JHKL 3A6OA 4WEUD 5ICXB 3TBYB 5MEPA 3VFUA 3L9RA 2VDML 1WGOA 4N1HB 5KTEH 4FQLL 4KV5E 5GRZA 2NY2C 1ZTXH 4Z78A 1CTOA 4ZODA 1TJIH 1MLCA 2ZUUA 1MFCH 4QHNA 2UWEE 1CF8L 4Z7WF 2YZ1A 1IQDB 3DUUA 1X44A 5T33L 1LE9A 4ZUTB 3PNWB 4NNPL 4QRUA 4HX1B 3TZVA 5F1NA 4M6ML 1R5VB 1NDGA 4RGMB 1SEBA 4ZO7A 3H3KA 1T3FA 3H0TA 5DJ6A 1OW0C 5EBMA 1NUGA 2PCPA 4JPKL 5I8KL 3WFCH 1YY8A 4UTBH 2B39A 3SPVA 5I1CH 3KLAA 4OTXL 2DI9A 1IKFH 1BX2B 2IGFL 3AY4C 1YA5A 5FA4B 3PABB 5D5MF 4OGYL 4UU9B 1RZKC 1N4XL 4X9BA 1J9CT 4JCMA 1KPUB 4OKVA 1MI5D 1FIEA 1RZFL 5IHZA 2DMBA 5FKAB 1JRHH 5MP6L 1IE5A 5F9WC 5KANG 2BNQB 2GCYA 5CSBA 1MJJB 4R7NB 1EFXB 1GGIH 1FAIL 1DVFA 4HT1H 3UBXB 2EEBA 5D7SL 1KCSH 1OAQH 2HT4D 3DI3B 5LJYH 5KVGH 5EO1A 1QPXA 1U58B 2DLFH 5KSBF 1P53A 1E4WL 1MQ8A 4KJQC 4JN1H 1TXKA 3UZVB 4HKZB 1ZLVK 2YA1A 4ZUUB 2P49B 2ZOKB 2UVFA 3MLVL 4L8DB 4WUUE 4J8RB 1GGCL 3KVQA 4JQVC 3RDTD 4Y4HD 4P4RB 4HC1H 3VD7A 4XVTL 1YEHL 3NBNA 4NIKB 5JXAH 3RL1A 5EU6A 3SGJA 5TPWH 4YPGA 4K94H 1FL6B 2BVOA 2ADFL 5E9DB 4GW5A 3EDJA 5F7NC 4B41A 4HZAA 5BV7C 5HHQA 3FOMB 3FTGA 5J06A 2GUOB 3KNBB 4Y8AA 4V1DB 5JUEL 4Y88A 2VITA 4AG4L 1MHEA 4I0PB 4X6BA 4DAGL 4QXGL 1CXIA 5GS0H 2JB5H 5DI8A 4NP4L 4EDXB 1SJHB 2E9IA 4K3JH 3K4DA 4FQXC 3D85A 3GSWA 1LMKA 1IGIH 4PJGB 3N1MC 3BMWA 4Y4FB 3SGEI 1NANI 2DLHA 1EHNA 3CFJB 2H2PC 5KVEH 1UWXH 4P23A 5B39A 5HYIA 5F1SA 2VB5A 4NJAH 2PYEA 3RGVC 2P5WE 4NKDB 3DX7B 4XRCB 4QY8A 5FYKU 4K2UL 2GKIA 2CDEA 2VLRD 5KZCB 4RNRA 2FGZA 4LPVA 4X6CA 1HCVA 3GBNH 3QEUA 1U8MA 4FTVB 1NMBL 1J86A 4FQHA 1WBZA 3VJ6A 1QPPA 4HBCL 5IMLB 2YS4A 3IFPA 4X8XA 3ARDC 1C16A 3MRMA 1IAII 3VA6A 4Y4KD 5T3XE 5I9QC 5DA4A 4D8PA 1N3NB 1V3MA 2HTLD 4KK5D 2B2XH 1KXQE 4EDWH 1IQWH 2W0LA 3U0TB 3TPUB 3BPLC 5CBAB 1FIGH 1XCTB 4EQ2A 1S9YB 5HVHC 4P2RA 1KOAA 1YNKH 3ZDZF 1UKQA 2LU7A 4G6KH 4L4VA 3RNQA 4XVUD 1T1WB 2ITDA 1ADQH 4JO1L 3JV5A 1LVEA 3KYNA 4UIMA 3T0WA 1S8DA 2H8PB 5AYUH 3QH3A 3CFBB 3Q6FB 5ILTH 4CDHA 3TC9A 3GIZL 3FT2B 2EYRB 3VXRA 1H3UA 4MNQA 4X0KA 3SKJL 4PYHA 4DN3H 3LZFL 5JLZB 1QSED 2J6EH 3KHOA 4D0CB 5FCSH 2D31A 3UJJL 4PJ5D 1LNUB 1XH3B 3ARFC 4IDJH 5E4IA 1JPFB 2AXHA 4JPIB 3MUJA 1ZA3B 2FX8H 5EUOF 4IRJA 3WIHH 3MOQA 3M17B 2V5YA 3MV8E 4NO3A 3LKRA 4XGZA 5I8OL 4OLUH 5D7KE 2ARJQ 4FN0A 4LRNL 4PJEE 3NAAH 5E2UH 1DBAH 3IDMB 1I9IH 3SY0A 1KF9B 2NW3B 4FZEH 4DK3A 1CLYL 3E6FB 3O3EB 5A40E 1ZGLM 5TF1H 1KCKA 3D25B 2F58L 4JN2A 5F7DA 1JMXA 1QYGL 3DLQR 3V2AR 3O9WC 5KG9A 3C6LC 2NPLX 3AROA 1RIHL 4LKCB 3QBTB 2A9MH 5F1IA 2VZUA 1KNOA 4LKXA 4QRRE 4XCFH 3RVWD 1MFAL 3SDXB 3EJJX 3HNVH 3QXTA 1LO4L 5IV2B 5KJRL 3SDDC 4L4TE 1DN2A 5I15H 2KUTA 3P73A 2X4SA 1QUNA 3S8WA 8FABB 4JPWL 5DLMH 4ONOA 5LGJB 1XF4A 4ZDHA 1IGYA 1U3JA 1INDL 4XNZB 2HVKB 3O4LA 3Q48A 4G7VL 2DM7A 4R3SB 4NBXB 4P2OD 2GJ6A 2NY7L 5C0FA 2E6PA 5C08A 5SWZB 2RIKA 5D6DA 1RU9L 2AV1B 3MJ9H 4CVZA 2YD6A 5TQ0L 4K7PH 5GHWL 4BUHA 2CR6A 4P3CH 4P46C 4HUNB 5CZKA 5MERB 4ZOEA 1VEPA 5GGUB 3REVB 4LLQA 5FDWB 4D3CL 3GSVB 4Z7VF 2YN5A 3D3VB 1UENA 4G6MH 1JHLL 1WQVT 4M7ZC 2EIZB 1HH9B 1T0MA 1BREA 1B4RA 2D0FA 3QQ3A 3TNNB 4K7FA 2VMFA 3PWJB 1E28A 5FFLA 1DLFL 5E6IB 1A6TA 1OD7A 2XQBL 3B9KC 2J12B 3QHFH 2NZ9D 3GGWB 2XOTA 4XNYH 3QUXC 2WBJD 2C3VB 2W9DH 2EIEA 2NTFA 2XACC 2APVA 1GJIA 1KIRB 4JVUA 3H3PH 1IC5H 4I4WB 4XNMB 4G80A 3MV01 5MEQA 2PO6B 3EDEA 3DWTA 4GW1B 2A6IA 3ET9F 5IB4B 5HBBA 3QCTL 3LOWA 3VFPB 2ATPB 3BRFA 1EO8H 2E7LC 5D70L 3RPKA 1PW3A 4PJ8C 5D7LE 5FUZH 3MREA 1GOGA 3DRTB 5DJ0A 4OSUH 3D5OF 4GRWE 1PG7W 4LPTA 5C0JB 2P44B 1NAML 1UWXK 2MNUA 2VXUH 4JGMA 4Z7WB 4KHTL 5K59E 3JV6A 4RAUB 4XBEH 3QNXB 4LRIA 3T0AA 4IOSD 3O3AB 1INQA 4MCYA 4BQ8A 3QULA 1QRNE 1XIWB 1OWRM 3TA3D 4LLVA 3ARGC 5D6CA 4HUXB 4U1MA 4LSSL 3TEUA 3RNKA 2E7BA 1FDLL 1J18A 3S6CA 4ISVA 2V9TA 2XN9A 4DEPC 2RFXB 3L3IB 2FGWL 5C2BL 5FGSA 1KJ2A 4EOWL 4FXKA 7CGTA 2Y07L 5CHNA 4YHNA 2I9TA 4GKSA 3C60D 3HC4L 3UPRA 4AJ0A 1YEDB 1A6ZA 5C0DA 2EECA 3JTSB 4NKIH 4F7MA 2FL5B 1RVFH 5DHVA 4KK9D 4J2XA 5E7BA 5L2JB 4YHOL 3QXAB 3MRCA 2ZPKL 4S1QL 1VACB 1WCBB 4RGOH 3C5ZD 1I3VA 4FFVD 3UJIL 3WEXB 1DEDA 4JZJA 4LLUB 1T0PB 3BP5B 3OKYA 3PWUB 4JRXA 5E4EB 2YUXA 3U36A 1MFDL 4LSPH 4PJIE 4FZ8H 4NZUL 1I9JL 5ACLA 4WI6A 3RY6C 1UJ3C 3QWOB 5INCB 5JHDB 1XGPA 3DVNA 4CUCA 1YECL 3FT3A 2EKJA 3MRPB 2FLRT 1OTUC 3U1SH 3RFZC 1LEGA 2CK0H 3OKLB 1NBYA 1ORSA 1QFOA 4MJID 4HIJA 3C5JA 2X4PB 5IK3A 5IEKA 1KN2L 3C8DA 2J8UF 1A6VL 4LP4A 3BSZH 3UXFA 3NABL 5TQ2H 3QFDA 2DWEA 1ZA6B 2VN4A 1NJ9A 2B0SH 4PJAF 5E2JA 4F57H 4MA3B 4ZUVA 5IESL 1RJLB 4P3WA 4OZIF 5C0AD 3PJSB 3MRNB 4W4OC 5JA8B 2HWZH 3KPOA 1CLZL 4K3DL 4OM1L 3I75A 4U1GC 3LKPB 4DTGL 2AJSL 1YEKL 1MI5A 2QJDA 2X4NA 3HRZB 5EZLA 4F37K 2WBKA 3L7EA 5HGHB 2GJZA 2I60H 2NY2D 1OM3L 3G6JA 3O6FB 3UDWC 3SGDI 1S3KH 5CKAA 1HEZB 1KG0A 4YGVB 2YEZB 3SEPA 1PDKA 3WNKA 2NXZB 4HLJA 4BH8B 3BDXA 5J6GA 3DV6A 4AQOA 3CIQA 1BBDL 5F9JA 1RD6A 3I6LE 5DVKA 3TCXA 4W6YB 5DHYB 3CH1A 4JM4H 3RDTA 2VWEC 4Y4HA 4JM2D 3Q1SL 3OKOA 1K6QH 4LEOB 1P9MA 4GXUM 4X80L 5GRWA 4O2FA 3QXDB 3OF6D 4G9DB 4U0QB 3WFBL 2J4WL 1I4FA 3FFCB 5GIRB 5F9OL 3Q5YA 4C56E 4GRMA 2EDXA 2IADA 4QTHA 4U6YA 3SDAB 5DXWA 2DDQH 5HYQB 2HT2C 4LSTL 4Z7QF 1AGBB 3GIVB 5E2TL 4I77L 4JFED 1E4XH 5AZEL 4FOMA 3QQNA 4KI1A 2Z92A 1PX4A 1NEUA 1BOGA 2G5BB 5CKGA 2DN7A 3DRQB 5FYJH 4M1CC 2LAAA 4QTIH 1RZ8A 4LLDA 3TWCH 4OZGA 1KB5A 3IF1B 4ZTPH 1G9MH 4JQIH 5TE7H 4NQEB 1OP9A 5LCVL 1UB6A 3CMGA 4WU5A 2VLRA 5JOPE 3PIQB 5GS1A 3V6BR 4AEHL 1RZJL 3CFDB 4MAUH 3L5XH 1M7DA 5C70A 2UWEF 1VPOH 4TTGA 1S7RA 3RWHB 3BE1H 3GB7B 3UZQA 5T1LD 3V0WH 2H2SC 4JFYA 3MV9B 1V05A 4GOSA 1BD2B 4LCUA 3H7BB 1N64H 4KXZI 1BF2A 4Q9QL 1PEZA 2VE6A 4Y4KA 3KPSD 1I9RL 3X3FH 4YPJA 2ICEA 2RQ8A 3KPNA 5I66B 1XGUA 2W38A 4R9HA 4JREC 2ZUVA 3BHBB 4PV8B 1ZVSB 2H2PD 3MBXL 4R90H 4OZ4B 5J9PA 1WC7A 1AXSA 1NCBL 4HS6B 3LMJH 12E8L 3NCYP 1XGYL 4NHCL 3VMOA 1FL3A 3S88L 3MLSL 2HG5A 3SDCC 4PJHE 5EWIH 1MCWW 4HUUA 4PRAA 1NGXB 2JKXA 4XPBL 3STZB 4PY7A 4DGVH 3F12B 4RZCB 1ZVHA 3FHQA 3FO9A 1TJIL 4NRYA 3CZJA 4FXGA 2B5IB 1MFCL 4MA1B 4Z7VB 2DTSA 4BQ9A 4HS3B 2QQNL 3UTTB 5L2KE 3P4MB 5FYLL 1QFPA 4BM7A 1BIIA 3KLHC 1G7PA 2ZG3A 3ARDD 5GGTA 4JO3H 1QSEA 4WW2F 2C1OB 4AK1A 4LVNB 4PJ5A 3CFEA 4TOYH 5IWLC 2FEEI 3IFLH 3UEZA 2AJ3B 3BI9X 1KULA 4F2MB 5I1HH 3HMWL 3U7YL 1E4KA 1FYTE 3QHZH 4M5ZH 1D9KB 4U1IB 2OMBA 4PJDB 4AH2A 3X3GH 1UM6H 4WI2A 5HYFA 2VH5H 4M7JH 4G8FB 4N8CH 3BAEH 1D5BB 3CUPA 4MA7H 4L8SC 5IB3A 4QRQA 3CK0L 3C5SA 1W0VB 2WUBH 4WCYL 5C07D 1EDQA 1YPZB 4UQ3B 3MRLB 2VXVH 4XWGH 4MJ2A 5FM4A 5HDOA 4RMVA 4NQXA 1ZHNA 3Q6GH 1G7QA 3HR5B 3C6SA 4Z8FH 3I6GA 3C09B 4D9RD 5I1GH 3R8BB 5F89B 4NN5B 4JZOB 3NIGE 3G6DL 1HSAB 5ISZB 4JANA 3OXRA 3U0PB 5C6TL 1TLKA 4UMGA 1QEWB 1C1EH 1HHIA 3QZWA 2VAAB 1R24B 1NMCC 3ALWA 1WUNT 4I2XE 2X4TB 5DUPL 3KJ4C 1JNNH 4JDTL 4P2OA 3ZLQC 2F19L 3LSOB 4RGMC 5I8EB 4U1HA 5I76B 3HCVA 4JGUA 4N0YH 3RVUC 5BVPH 3FQXB 4YIQB 1HN1A 1I7ZB 3O9WD 1HNFA 1JFQL 3C6LD 4O2EB 1GZPB 2ICWA 2Q8BH 5CMAB 3NH7L 4MNGB 5HPOA 5GS0L 1T0NA 4L8CB 1SJEA 4MHHG 5I1JH 1OCWL 1T5WA 2OQJB 3KWWA 4K3JL 3VG9C 3BGFC 3SDDD 5IMMA 1IAKB 4GSDH 4LQ1A 1WAAE 2H1PH 3RUGA 3CFKA 4PJCB 4K94C 4NM4H 4OV5A 3I6KB 4JFZL 1KGCE 5AWNH 5DZNA 2R23B 1J1PH 3VXSB 5C3LD 4NJAL 4WHDA 1T80A 3NMEA 1GGUA 3T0EB 1DQDL 4O9HH 1AO7D 2N56A 2WBJA 4LHUB 4WEMB 4KH2A 5C0BB 1DLHA 5MENB 3BN9C 3BFOA 4F33B 5DJCA 4QHMA 1SEQH 3SDYL 4NUJA 2R2HA 4GUPA 4IIQC 4PR5B 1Z5LA 5ANMB 4GKNA 2Z0BA 1GH7A 2YRLA 4Y19D 5F9AC 2AABH 1FO0A 3SJVB 1BFSA 3NCJL 1FLTX 1DCLA 5SWQA 1I1FA 4LU5H 3TJHC 3F5WA 2AXFA 3UYPA 3V6ZB 5BS0B 2R4SH 2Y72A 2VZ3A 5IVNA 4IRZH 1P5UA 1YC8A 5JDSB 4XP5H 1OHQA 5TDPB 4KRLB 1KJVA 1N0XL 5DSCA 1ZS8B 4PG9A 4PJAB 1JJUA 3FMGH 4UTAL 3RWFB 3QUXD 1UGNA 1CYGA 2VDLL 3TA3A 4OZIB 4B7IA 5E8PA 3EO1B 2WBWB 1ZT1B 4OIBA 1NLDL 1AKJD 5AYUL 2B1AH 4ELME 4UNTA 1QFUH 4PRPE 2LU3A 1HHGB 1KYOJ 2IMNA 4PJ8D 4KKLC 3FQTA 2YWYA 4X98A 1UZ8B 3C60A 2R0ZL 3MODH 1GXEA 4DN4L 5DT1L 4N8VB 4C83B 4M1DL 1SQ2N 1BMGA 1F4XH 4TSCH 5E1AA 2QKIB 5JPMA 1VA9A 2JJTC 3C2AH 4HQQH 2ARJB 1FE8H 4ZNCD 3CFIC 1DQLH 1K2DA 1FZMB 4P9HH 4U7KA 2CH8A 1JGDB 5E2UL 5IVZA 4OIIL 3DIFB 3ARGD 2VQTA 3C5ZA 2W07A 4OFVA 1IEAB 2DM3A 3HI1A 4YFDB 1VEOA 3L3KB 1TCRB 4XB7A 4XXCC 1Q0XH 1T20B 4MJ6A 2DQGH 4M61B 2AI0H 4I3RL 5TJWK 4OUUB 2OR9H 4QHKI 3V6FB 4QRPE 3HNVL 1EV2E 4E5XB 2XTJD 5KSVB 5D2NE 5I15L 4YFEA 3VXUE 4NDMB 3ALXA 5IR1B 3MOAL 4ORGA 4OGAC 5T3ZH 1FJ1A 1Q9OB 2VLME 1IGTB 4W6XB 4RAVB 3X13A 1G9NL 1LDPH 3TT1L 1CLCA 4XP9H 2BMKA 4MJIA 3WJLA 2WIIA 1NBZA 3SKMB 2EXYC 3GFUA 4QCIB 3G04A 3QEHA 2VDNL 4WWID 3LDBC 2X6MA 3CXDH 1WEJL 1K8DB 2V7HA 1JWUA 5FM5M 3QIBB 1NGZA 4BK4A 2GQHA 5HGDB 3PXHA 5C0AA 4OD2A 5IVXB 2GK2A 2IAMB 5IVOA 4FQ2H 5H94B 1OT2A 3HI6H 4QF1A 4MVBD 4P3DB 2AGJH 3BQUB 2UWEB 4M62H 4NYLA 4TVPL 3MXVL 1U8KB 5K59F 3W9EA 5I75C 5IT2L 5IFJB 3BDYH 4HCRH 4DW2H 2IEPA 4U1SB 1OTUD 3EHBD 4N5UA 2HFTA 3PWLB 3S96B 5EU4A 3GSUA 3V52H 4NCC1 3VRJA 3HAEG 3I3BA 1CFSA 3BUYB 1SM3L 3VW3L 2ED7A 1PZ5B 3G9VA 5C0IB 3PWPB 4F3FB 3S7GA 4NPYA 5F7HA 3OAUL 3MA9L 4X6EA 4UV7H 1NL0H 5IW6A 3P77B 2DBJA 4JKPL 5EUKA 2QQLH 2VXSL 4WJ5A 4P99A 4XB8A 4CN1A 5I0DA 3MNWA 1S9XA 2J1KA 2BSED 2JJSC 4JM2A 1J05B 5JOFA 4I18A 3AY4A 3GSXB 3BP4A 1ZLUK 5L7XL 3OF6A 5CILL 1IGJA 4K23H 1R3LB 2AJVL 3H9ZA 1GPOL 3OKKB 2ERJC 5I1EH 3DUSB 4U6XB 5F1KC 4NHUB 5CP7B 4WW2B 5IBUG 2LABA 1LILA 4AT6B 3U83A 3MRHB 3CVHA 3VXPA 1YEJH 3LKSA 4Z95H 1HQRA 2EDHA 3KYMB 5FYKL 1CD0A 1PKQA 4HWBA 5IMOB 3VE0B 1LO2L 4JFEA 1JTTA 2Q20A 4ZTOL 1CFTB 5T1MA 1HHHA 4PRNB 4N0CC 2DWDA 4JRWA 5HHXL 2DLTA 4PJIF 3VGFA 4X9GA 3BYTA 2F5BL 4QKXB 1FHGA 3RRQA 3BDBA 3RBSA 1BQUA 2FB4L 1FCCA 3L3GA 3LV3B 5DJYA 4AM0B 5EC1B 3BEWB 4H26B 4C4KO 4LLMB 4OB5H 4MQSB 3BZFA 3LIZH 4X4XA 4NGHL 5DD5L 2HLAB 4I0CC 4X8JA 5BRZE 1MCCA 2PO6C 1R3IL 1XR9B 2ADGA 1CDHA 2OM5A 2EYSA 3OAZH 4G8IA 5T1LA 5ICYB 2MHAB 5CFHA 4HKXB 2AK4D 2V17L 1U92B 3VFNA 4CJ1A 1Z2KA 2MQ3A 2P5WB 3RWEA 3B5TA 5MEPB 3VFUB 3L9RB 3KPSA 2LE9A 1JI1A 1B0WA 2HFGL 4Z78B 5GGVL 3W9DA 3UTSE 2X1XR 4M1CD 1MLCB 3KXFE 4QHNB 3FN3A 1LO5A 2A38A 3IU4H 5GGQH 2ED8A 5HHOE 5E00A 1OGTA 1RUPL 3DUUB 3BXNA 1LE9B 4QRUB 4CVXA 5SV3A 1UXSA 2XZQH 3TZVB 4JPVH 4W68A 1A1NB 5F1NB 2F8VA 3T3ME 2ZUYA 4RA3A 1NDGB 4XC3H 5M7QA 2P45B 1VEMA 1SEBB 5DMGC 3H0TB 5DJ6B 5EBMB 2PCPB 3O6MH 3I9GH 1C08A 1YY8B 4XH2B 4Z77A 3SPVB 3O11A 3LPGA 2Y36H 2H2SD 4OF5A 4O5LL 4I3SL 1G7MB 4JFHE 4N0FA 4OKVB 2X10A 4LSVH 3ARDA 5J12C 2J7LA 2CRYA 5IHZB 3ZO0A 2GCYB 1U8HA 2YPLE 1AXIB 5LXGH 5LWYH 1AI1L 4MSWA 5F96L 5DGRA 3TJEH 4ALAH 1DVFB 3PHSA 3RQ3A 1KJ3H 1BAFH 4RWYH 1G6VK 5EO1B 2E9JA 3GRWL 3IFNL 3OJDB 1ZHKA 3S36H 3SKUD 1M1SA 4Q7DA 1HKLH 1HK6A 3SDCD 5AG9A 5DWUL 1U95A 2HH0H 4HGKC 5DFVC 4MAYD 5C07A 1H3PH 1YJDH 1OAKL 3MV8B 5KS9E 1Z9SA 2NCMA 3RL1B 1QLFA 5EU6B 4YPGB 5FGRA 5IQ9A 3WLBA 4W70A 2EE6A 3SQOH 2BVOB 1S9KC 3RHWF 5HGAA 7FABL 5HHQB 5F6IC 3FTGB 1A02N 4JM4L 1AXTL 2VITB 2DKMA 5ACMA 2ZCKL 4X6BB 4F58H 1VENA 3G5XA 1D5MA 1FCGA 4NWUL 1CQKA 3ZYZA 3QRGH 4JRYE 3EYVA 5SV4A 3RWGA 5CLWA 1UT9A 3B8YA 1LEIA 3D85B 1J1OL 3GSWB 2HKHH 2V2XA 1NC4D 1IAIL 2EDEA 4NOBA 3FQNB 1BVLA 4ODSL 5B39B 2F53E 3MNZA 3O9WA 5FF6A 1I7UA 3LB6C 3C6LA 1EEYA 5CEZE 4KMTH 4QY8B 4BJLA 2JCCE 4KQ3H 2CDEB 4RNRB 2XA8H 5K33A 5DFWH 4KUZL 1JF1B 3SO5A 5D4QA 1MH5A 1U8MB 3FN0H 5I18H 3SDDA 1MCOH 1F11A 1P1ZA 1WBZB 4PGCA 4R0LC 3VJ6B 5GRXG 3HC0B 1YZZA 1BF8A 3IFPB 2Q6WA 4PJHF 3MRMB 1AO7A 4M8QA 4D8PB 3OMZA 5E08L 2NY5H 4QOKE 2DQCH 4NT6A 2XWBA 4ODUA 8CGTA 4GG6E 2BJML 1EFQA 4TPRL 1VPOL 1X7QA 3RZCD 4P2RB 3N1FC 4U3CA 4Y19A 5E5MA 3T2NL 5BQ7A 3WS6C 5D8JH 3RNQB 1AY1L 1MJ7L 1G9MC 1SJXA 2ITDB 3PWVA 4DQOH 3KYNB 4UIMB 3VFGH 1S8DB 1DQJA 2V5SA 4UB0H 3E8UH 3QH3B 1BBJA 1T89C 4XNXH 2HP4A 3O3BA 3V4VH 1J0IA 1RULH 1MJUL 4MNQB 3QUYC 4X0KB 3IB4A 3O2WH 4WY7H 4BSWA 1UM5L 1JPGA 5IGXH 2D31B 4AZ8A 1XF5A 2AJXL 4EI5C 4O51A 3QUXA 1QBML 4GAGL 2VDKL 1MRDH 3BN9D 4OZFG 3EJZC 3ZL4H 1BEYL 2XPGA 2YKLH 3SE8L 1S7WB 2GY5A 4NO3B 3V4UH 4OD3L 2H3NB 3RX5A 1AKJA 4XGZB 3CSYB 1BJ1H 1HZHL 3PGDA 3DETD 2VRAA 5BMFL 4OAWA 3V7MA 2EDYA 2D7MA 2E7LA 4TNVK 1FGVH 3SY0B 3NIGF 4DOHB 1AHWC 4PJ8A 4BSVB 5E24E 3TJHD 3WYRA 3TVMD 1C5CL 2DICA 5F7DB 3TO2A 3ARUA 4MA8L 3QPXH 3ZKNC 5EZIL 4Y2DC 2UV3A 4Y16C 2BDNL 4HGMA 5F1IB 1L6ZA 1KNOB 4LKXB 1YEEH 2VH5L 1OF2A 1VFBA 1A4KA 4JFQA 4F7TA 3V7AG 3ARGA 3P73B 2X4SB 1NC2B 3HNSL 4KMQA 2DQUH 4AIXA 1DBJH 5EU3A 2IBGA 2P48B 1FQ9C 1IM3A 1NEZG 1QD0A 1PBYA 1YMMD 4HAGA 1WFOA 1W72H 2K3TA 3PHOA 4G9FD 1FVDA 3V0AC 1VGKA 4NKQB 3O4LB 2VXTL 1FNFA 3O2DA 1H8NA 3EYUH 1MCPH 4FQQA 3JUZA 2GJ6B 5C0FB 2I5YH 5FK9A 4LHJB 5C08B 4E42A 4KKLD 1WAAF 4WFFE 1ZAGA 4CVZB 2IPKB 5DO2C 1CVRA 4A6YL 5BJTA 2BVQA 5HHME 3D39D 3I50H 2EDQA 1WSST 2WIMA 3RWIA 3S3PA 3OPZH 3WNPA 4LLQB 2DI8A 2VL4A 4DUWA 4L9LC 3BD5A 2D7QA 4FFWC 2C9AA 1D5XA 1T0MB 3QUKA 3VH8B 3QQ3B 2Y6SD 4K7FB 5FM5O 3WDIA 1E28B 5JR1H 3GBMH 3WJJC 1A6TB 2H6PB 1D9KC 3IU3A 3PV7A 1G0DA 2FHFA 1HXYA 5IBLC 1CFNA 2Q8BL 5T5FL 2OL3A 2NTFB 2NYYC 1T66D 3RTQC 4PJBE 1W8NA 2AV7A 4XPHL 2VUYA 1UJ3A 4G80B 2AAVA 5MEQB 4LVEA 4O02H 1BECA 4EVNA 4NQCE 2WINB 2A6IB 1EMTH 2HJFA 1N6VA 2O93L 4WHCA 2VZVA 5GGSA 5IFAH 4LGRB 1F6LL 2X1PA 2CRMA 3G5ZA 3WMSA 2Y4SA 3MREB 3K1KC 5DJ0B 2RAMA 5KVDL 1R3JA 4NN5C 2NXYC 1D5IL 1OQXA 3PL6D 3AU1B 1MNUL 3F62A 2ZUQB 4N0RA 3VFMB 1U8LA 4OD1H 3VI3E 3VGHA 4ELMF 3OZ9H 3IETA 3JV6B 1YEGH 4MDIA 3RWJA 4L9DA 1NCDH 1JNJA 2O5ZH 2ATKA 1CBVH 4QXTA 1MJJA 4MCYB 1RMFL 1OWWA 4PGDA 4KI5E 3QULB 4NO0D 4D94A 3UTZA 4W4OA 4LLVB 2QADC 5D6CB 3PP4L 2CJUL 3H8NA 3WBDA 1TQBB 4U1MB 4AEIH 1A9BA 3UYRH 3K3QA 3UPCA 1T1XB 4LLYA 2CKBB 3RI5F 3WIFB 5J13B 2P5EE 4PGBA 3ULVD 3JWNC 1KPRA 2MWCA 5HHVL 1KJ2B 3QPQC 1T1ZB 4QRTA 1MAKA 4FXKB 1OQOA 1FBIH 5HTSA 5CWSA 3V5KA 1QSZA 4YHNB 2I9TB 1URLA 4X6DA 4GKSB 1QHPA 3UPRB 4I5BA 3CX5K 4JGJA 3CMOL 2ICWI 2XXMB 2DQIH 4NC1C 1YEIL 4EIGB 4XCYA 1A6ZB 5C0DB 3K0WA 1ZMYA 1AJ7H 4YJZL 3FO1B 5B8CB 3QDJD 1JNLH 3MRCB 3T0EC 4BKLA 4NN6C 5HI4C 3QDMD 3NZ8A 3UTPD 4JZJB 4X9IA 1TNMA 1I75A 3KYKL 4M9OA 4JRXB 3AREC 1KJ2H 1FNSL 4YDKL 2AW2A 4X5LA 3U36B 1T7YA 4L8BA 2WWKT 1L4IA 2A73A 5AUMA 5GRUL 5J8OA 1PLGL 4KAQL 3NTCH 2O5YL 2AK4A 5E94A 4BFBD 2OP4H 1K4DA 5DHVH 3DVNB 5DD3H 3WD5H 4N0CD 3FT3B 2I07A 1Y6MR 4YDIL 1K8IA 1LEGB 1JPTL 4OFYD 5DQDH 3GKZA 1NBYB 3P2TA 2X40A 1ORSB 3FZUC 4LDLB 5HJ3B 1T7WA 3L3JA 5DA0B 4BA8A 4HIJB 4OCWL 3C5JB 1IGML 5IEKB 3O45A 3MBEC 1MHHA 3QFDB 3C2SA 2DWEB 1NJ9B 1CG9B 2AEPH 1DUZA 1Q9LA 4KJPC 1NKOA 4ZUVB 1MHCB 3HG1E 3BT2L 3F58L 1CL7I 4KRPB 4LCCA 1YMHB 4ZD3L 2XXCB 1R5WA 3KPOB 3H42L 4XP9L 1Q9KA 3I75B 5D93C 2ENSA 5EZOH 3H9SE 3V4PL 3V95A 1MI5B 4JE4B 5EZLB 4JO4H 4PRBB 4ZFOA 3H3BC 3L7EB 3RGHA 4PJHB 1FNLA 3G6JB 4LPCA 5JOEA 4KVCH 1OARH 1KG0B 4B53A 2BRRL 4TQEL 1EA9C 4LPXA 1EJOL 5J6GB 3DV6B 3HI6L 4G5ZH 1QTYT 4O00A 3U9PL 3T8XA 4JQXA 1ZSDA 4FQPA 4J6RL 1CE1L 3ZT6A 4LASL 3SDCA 3WUWG 4MLIA 2NY1B 4M9PA 3CDFA 3DHMA 1LDSA 4O2CA 3PV6A 5KANI 5DMGD 4S11A 2BNRE 4MAYA 3CH1B 2OR7A 4KZEL 1QZ1A 2HKFL 3LD8B 4D0BB 5D2LE 3RDTB 3VXQA 2YBRA 4Y4HB 4MS8C 1WFUA 1KBGH 3OKOB 3D0LA 4XZUA 5IIEA 3CLEH 3WXWL 5ITFA 5FKPA 1KJMA 1I4FB 3W2DH 2XKNB 4HF5L 1C5DB 5GRVK 4GRMB 2W1NA 4YHML 4QTHB 4WWKD 5E6ZA 4U6YB 3QIWD 5A3IC 1KEGL 1T21B 4WIQA 1J87A 4TSBL 3N50A 1KEMH 2CDFA 5CCKL 5ID0A 4GJTB 1J0HA 4Y89A 2Z92B 5FAAA 1DTUA 4LCIL 1JGUL 4K23L 2OJZL 1QKZH 3HC3L 4L8SA 4YR6B 4KROC 1A7NL 5DFVD 4CVWA 3MLUL 1NC4A 1RZ8B 5DUBB 4LLDB 1U8OA 5K9OA 1KB5B 3K2MC 1MAML 2LV4A 3WNLA 2R4RH 2MFNA 1X9QA 3ZE0E 3SE9L 15C8L 2NY6B 1NMAL 4N8PA 3WNNA 3GHBH 1UZ6E 1UB6B 4WU5B 4JG0H 2VLRB 2R9HC 2UZYB 1FN4A 5JHLL 5GS1B 1A1OA 5FEBA 1M7DB 2R56H 3VWJB 3HFML 1BGXL 3LPFA 4ZOAA 1TVDA 1F42A 1KCRH 4FQJH 4XMLL 5DMIL 3LH2L 4Q6YA 2CMRH 3FB7A 4JFYB 4HPOH 4LCUB 3T3MF 25C8L 4FABL 1I8MA 4PJFE 2VE6B 1DBMH 4R4BA 2DMKA 3O41A 5EOCL 2DB8A 4M1GL 4HG4K 2ICEB 5A16A 1A6UL 4MDJA 1F4WH 2MJWA 3KPNB 3MA7A 4GW4A 3I3DA 1XGUB 3VXMD 2QHRL 2Y9RT 3OKNB 3DXAE 3VU2A 3ZZ1A 4F9PC 2FEEL 2HA1A 3SOBH 3RZCA 1U91B 5J9PB 5CUSH 4HXBH 1WC7B 1AXSB 3QG7H 3LB6D 4RFOL 4Q97A 2NW2A 3L5HA 4UDUA 2GFBA 3FO2A 5IB2B 3VWKC 1FL3B 4R4FL 4JFDE 4PRAB 5L8KB 3FCTA 2EDFA 4M7LH 4PY7B 2VQ1A 3MO1B 5DVNA 3TF7C 3FO9B 1IT9L 4HLZG 2Y25A 2DJ4A 4FXGB 1VCAA 3MUGA 1MWAA 4RGNC 3X12A 1BIIB 5AAWA 3LVEA 3VD5A 5C9KA 2XZQL 1QSEB 2DS4A 5FO9B 2EDWA 35C8H 5JNYA 2YPKB 3QEQE 4PJ5B 3CFEB 2PTTA 2X1QA 1BWMA 3VFSA 4Y1AD 3HZKA 2HFFA 3QNZA 2C7UB 1RIVH 1KIQA 3E0GA 4A2LA 4IIQA 4N0UE 4WHYG 4Y5XB 4FQ1H 3WIIH 5KS9F 4ESKA 1OAZH 1I8KA 4U0RB 3BYYA 4XCCL 1E6JL 4FQIL 4AH2B 2O5XL 3RIAK 5BVJA 4U4BA 2E3VA 5BZWA 3TM6A 2V9QA 3A67L 1ACZA 4QRQB 1GC1L 3C5SB 2DLGA 1RPQA 4OLVH 3TVMA 4U31A 4DFIA 5LWYL 5J0BA 1PD6A 4NQXB 1ZHNB 3QI9B 1AC6A 1G7QB 5FGBC 5GGTH 1UWGH 3I6GB 4OF7A 1Q72L 4PJ7E 3QUYD 4NRXA 2Y7QA 5E99H 4EBQL 4GMSL 5EIVA 1IM9D 5EB9A 5T3XL 4EI5D 3ULSA 1S9WA 1EZVX 1F90L 2OTPA 4LEXH 3HRPA 4JANB 3W0WE 3EJZD 1FNAA 3OXRB 1H8SA 1LEKA 3HAEA 1AQKH 5JW4R 1YMMA 2CDGA 1IC4H 2JCCF 1DZBA 1RHHA 5BXFA 4G9FA 3TZVC 3HUJE 2A77H 1NBVH 1FPTL 2MCG1 4P2OB 3CVIL 2EH8L 2J8OA 3HCVB 2R0WH 4LHQB 3VCLA 3MCLH 1NLBH 4XPAH 3ZKND 5D7JD 5E8DL 2J88H 3NIDE 4Y16D 5DEZA 5K93A 4BSJA 1F5WA 5JMOC 3D39A 2ICWB 3OHXB 3U48A 1TENA 2X44D 2JJTA 1YJDC 2WANA 5HYSG 1T0NB 3DJ9A 4UUJB 2GAZA 4XVJH 4IS6A 3QRFM 4GG6F 1T5WB 1HINL 1MQKH 2FIRT 2Z35A 4QRPB 5IMMB 1CDCA 2YK1L 3RUGB 2UUDH 3CFKB 4KWUA 3NCEB 4F15B 4POZD 5KVFH 1DVFC 5C0GA 3VG0L 1S7TB 5D2NB 2O61A 1AE6L 2FHBA 2HYMA 4XXCA 5FO8A 2Z4QB 3WIHA 5GZOC 3WXVL 1B0RA 3W82A 2WBJB 3U30B 4E41D 2XA8L 3MLWH 1DLHB 4YDLB 4NCDA 3U0WH 5DJCB 3SGKC 4QHMB 4NUJB 2R2HB 1N5AA 4GUPB 2FSEA 2NY3C 5CD3B 1Z5LB 3KPQA 3V5DA 3C87A 5FDYA 5DO2D 1AD0A 2PW2A 3IDXH 2EDTA 2QL1A 3DX9A 1FO0B 2P43B 4MNHA 2VLLA 4N90E 2G9HB 3CZFA 2Z91B 2OK0L 1XGRA 2HJKA 5SWQB 1I1FB 1GL4B 5MI0B 1U3YA 4YXKL 4AQ1B 1MUJA 4OLYL 3F5WB 3SGJC 2AXFB 2B8OT 4Y0GA 2KZWA 1ETZA 2NY5L 3PL6A 2OXHA 4FFWD 2VJXA 3DMMB 4TTDD 1FC1A 1TPXB 3N9GH 4JO2L 2EIDA 2ZP0T 1GYAA 3CCHA 1KJVB 3GK8H 1PG7L 3T4YB 4Q0XL 3AVEA 5D8JL 4RAHA 2IANE 4IMKC 4NO0A 1I7TA 3MRIA 2NYYD 1P5VA 3RTQD 4CJ0A 1I85A 3KDMA 1RUKL 3TYFA 2R8SL 4WO4D 2EXWC 1FFOA 3MV7D 4CKVX 5EIIA 2UY6A 5H2BB 4P23C 1T04A 4Z9KB 4LVOB 4V1DE 1CXLA 2FX9H 4YWGH 1INEH 1Q0YH 3BKCH 4KTEH 4WY7L 2E7CA 5FUCC 2F8XC 1HDMB 3QAZC 3FQTB 4X98B 1KFAH 3ZTNH 1QA9A 4PJGE 2FX7H 3MACL 2NXYD 4MWFA 2HLFC 1CXHA 1CR9H 5E1AB 1KENH 4XX1G 5JPMB 1JPSH 4K71C 4ZS7H 2W60A 1FORL 2X4QB 3QDJA 5F8RC 3HE7C 3BRGC 3S3SA 1P4IH 1IL1B 4EXKA 5IVZB 5DRXA 2QADD 1GIGH 5L0QB 2JJSA 3C5ZB 1KSRA 3QDMA 2QQKH 4FTVE 3HI1B 3VRIA 4UIKL 1GCFA 4MJ6B 1ODAA 3UC0H 5E8NA 1F6AA 1NFDA 2CIIA 1N26A 4ZAKD 3ZKXC 1BZQK 3BJ91 5HYJD 3VFVB 4PRID 1DFBL 4H8WH 5ADPL 5HDQH 1P4BL 3GHEH 1DBJL 1PG7X 3O2VH 3C08L 2XV6B 3GMNA 4ORGB 4OFYA 4OF6A 4L29A 2BP3A 3PQYD 4PJBF 2JTDA 3EYUL 3OKDB 2BMKB 1GGTA 4MJIB 1A9EA 1NBZB 2WIIB 1MRFL 4PRHD 4HJGB 3SKNA 2I5YL 2CRZA 1K3ZA 4LPUA 3QEHB 5HI4D 4Z7NE 3WUZA 4NQTA 4IRJC 3HE6C 2VTFA 4OJFH 1IC7H 3ARED 2DKSA 2V7HB 1JWUB 1NGZB 4NQUA 4XP4H 3S37L 4X99A 3T65A 5C0AB 1QNZH 4OD2B 5CZXC 1F4AA 4QF1B 2J8HA 3MOBH 4NYLB 5HI5C 4KKCD 3DYOA 2DD8L 1M71A 3D6GA 3GSRA 5GJTH 3VI3F 3W9EB 5B4MC 5EORH 4BZ1H 3DX8A 3MLXH 1OOAA 1QQDA 3UPAA 1NCUA 4YXHL 4M7KH 2NY2B 4KI5F 5D1ZD 5EU4B 1BOYA 3GSUB 4MZ3A 4R4NC 4XAWL 2AS5M 3QDHA 5FV1L 5J6HA 3WDJA 1EPFA 2OLDA 3DHJA 5T5NG 1HWHB 3ZKMD 1MFEH 2NNAA 4ERSH 3MRKA 4NPYB 4CU7A 1ZT7A 4S1RH 1RIUH 4UILH 4X6EB 3TIEB 3KLSA 3ULUL 4KJPD 4QXUL 4JB9L 5EUKB 1QBAA 4WJ5B 1R3KB 5D1QD 3CC5A 2YPLB 5HD8C 2HN7A 3MNWB 3BD3A 4JM2B 2UUDK 5JOFB 4M03A 4P59L 1IGJB 4KK6C 4YXLL 2NY4D 4BK5A 3BEVB 3R1GH 2FH8A 3V6OE 5D7IA 4NM8L 2XZZA 1NCDL 2XT1B 4OZHA 5F9WB 5FV2A 2EDRA 4WWKA 1EHLH 3QIWA 3VXPB 3CVHB 1HQRB 1XGQB 1J8HD 5T3ZD 1NFIB 2A83A 4R7DA 3MLYL 3QDGE 5T1MB 1HHKA 3BGMA 4XNUH 1N59A 5F7UA 2DWDB 4M6NH 5EU5A 1RHFA 4ZXBC 3S37X 3A6CH 2LFGA 4K9EL 4RCAA 4FG6C 1TNNA 2WSKA 5H35A 3OKMA 5C2UB 5DJYB 3BP6A 1VGEL 1JGLH 3BZEA 5JQ6H 4MS8D 4HIEB 5HHNA 3D3VE 3LN5A 1KTKE 2GY7B 1BJ1J 3BZFB 2BOBA 4OZFA 3RAJL 4X4XB 1KCUL 2IH1A 5DJZA 5DZOA 4X8JB 1OSPL 3Q3GA 2ADGB 1G7LA 3CVHH 2DQFA 1A6AA 3U2SB 5CSZA 4HWBH 4G8IB 3AS2A 5T1LB 1A7PH 3ILPA 4K8RL 3KJ6H 5BV7B 1QLRA 1NAKL 4N9GB 4C54A 2G75A 4CNIB 3PF2A 3VFNB 2CKBL 3RWEB 2DIAA 2VDOH 4DK6A 1J7VR 2EEDA 4WGWB 1TETL 4YO0A 5ENWA 3KPSB 5K9JL 2GHWB 2VKWA 1S5IH 5L88L 1KJ2L 3W9DB 2K7PA 3LQAH 3VXMA 4KROD 4M4RA 4LSQH 1LO5B 3VFOA 1ND0B 5E00B 1I1YA 1OGTB 3BXNB 5L6YH 3I85A 3QQ4A 3UAJD 4CVXB 3OGOE 1UXSB 3OQ3B 5E2WL 3RGVB 2CKNA 1TQBC 3ZKSD 3HNTH 4S1DC 1X5XA 2R9HD 3GSOA 1NEZA 1YQ2A 1I8IA 1C08B 5D72H 4LCYA 5BV7H 3O11B 1GZQA 1WWBX 4GG6B 3SN6N 6FABL 4MQTB 5LQBL 1OAXL 4CW1A 1X3DA 4PLKD 3VGAC 1E6OH 2IBZX 4N0FB 2VOTA 4G8EA 5LGHL 3ARDB 4TSAL 1A3RH 3UTOA 5DGQA 4XCNA 5HVGB 1U8HB 5ECJE 2MQCA 3FO0H 5D2LF 4Y1AA 4LQFL 4MSWB 3NGBC 5LAXA 3EOTH 1X5IA 2DJSA 1KN4H 3BPLB 5J7CC 4LSRL 5TH2A 4KY1H 1CZ8H 3R0NA 3P0VH 1BLNA 3KAAA 3WS6A 1ZHKB 4YK4C 5B38A 4XBGB 5CJQH 1KIUA 3GI8L 3DX6A 1KC5H 4AL8L 1MHPH 3EGSA 1F3RB 4IBLT 3T2QA 1T83A 5M95B 1U95B 4JO4L 3MRDA 4K3EL 1H9VA 4JY6A 5GGSY 5TGBA 4OT1L 1OAYH 2GSIA 5ELIA 2F5AH 1GHFH 4H1LG 2VN7A 4RGND 5ERWA 3QUYA 1H3GA 1QLFB 1UM4H 4DKFL 3GSNL 2AJYL 5IQ9B 1IM9A 5FB8A 1SHMA 4EI5A 3WLBB 2PXYD 2MCPL 2V5RA 4M5YH 5HGAB 4CAGA 3ZE0F 1RURH 3IXTB 2UZIH 1FGNH 2BVTA 1UZ6F 3G5XB 3S34L 1OD9A 4MCZA 5JHDE 3C9NA 1I8LC 2VR5A 4HS8H 3EYVB 3RWGB 2DQJL 2R15A 1LEIB 1CFBA 4PY8I 2V2TA 4RRPG 4RISH 5HGGS 3W2DL 1AHWA 3N85L 4XT1C 2V2XB 2B1HH 4ODBD 1PSKL 2AK1H 5FYLD 1BVLB 1LO0H 3GMMA 5D7JA 3O9WB 1I7UB 3V0VB 4GH7B 3C6LB 1EEYB 2ZG1A 4Y16A 4OQTL 4ZFZA 4MMXC 1CGSH 4QRSA 2Q86A 4PJFF 3VDBA 4HG4J 1BFOA 1UFUA 2B4CL 1I1AC 1KELL 1MH5B 3SDDB 5A43C 5I16A 1F11B 1T2QH 4MLSA 4PGCB 1V7MH 4XMPH 1Q38A 1HIML 2ZUXA 2RCSL 3MLTA 4F8QA 2R0KL 4XI5D 1EXUB 3MRJB 1FZJA 4X6FA 4POUB 4JJ5B 5KSUA 2Q6WB 3E1F1 4GKZA 3K2UH 1BZ9B 2IG2H 1AO7B 3ZE1E 3GMRA 4M8QB 4WFGD 4E41A 4MHHI 4ZQKB 4NT6B 2FBJL 2XWBB 4L3EE 3FQRB 5C71A 1X7QB 1TIUA 3IS1X 4Y19B 5E5MB 4FQJL 1W8OA 4AMKH 5BQ7B 3MLZL 2CMRL 1P84K 4LIQH 2FO4A 3INUH 4J4PC 3T0DA 1BWWA 1NKRA 5KW9L 3PWVB 1JIBA 4Y5VA 3LKNA 5D9SB 5CINL 4XP6H 4L9LA 4Q9RL 2Q76B 3QO0A 1KB5L 1SBSL 1SY6L 3F7YA 5FYJE 3LS4L 3O3DA 4KQ4H 3O3BB 3LEYH 2BNQD 3WJJA 3EOAA 2VDQH 5IHUH 3U6RA 4WEBH 3FRUA 1JPGB 2AJZB 2XZCL 1DR9A 1XF5B 4O51B 3QUXB 2XWJA 3FFCE 4M48H 4RMUA 3RTQA 2CK2A 2ZCHH 4Z7UA 1FFRA 2Q8AH 4KUCF 5JW5A 2XPGB 4LGPB 1ZWIA 3EYSL 2NY3D 5CJOH 4WO4A 4E0RB 3MV7A 2J6EL 2XRAL 1N5YL 5GRJL 1EERB 1Y6NR 4PJ7F 1J10A 3PGDB 4Z0BH 1YNLL 1TITA 4OAWB 1UCBL 5GRYA 2D3VA 2XA3A 3NFSL 3QCUH 4KKBD 4X4MA 4PJ8B 4F8TA 4MB5A 1F4YH 4HBQA 2DQTH 2VLKD 5DD0L 1QBLH 3FQWA 4FQ1L 2PN5A 1R3HA 1OAZL 4NQEE 4OLZL 3HUJF 1NCCH 4HJJH 1A1MB 5E9DD 1OF2B 3DBXA 1A4KB 3MROA 4JFQB 4Y5YC 1JRHI 4TRPH 4Y4KC 4F7TB 2Y06H 2HTLC 3ARGB 1OP5H 3ARYA 4EI6A 1MCHA 2XQYK 5F7EH 2HMIC 3NIDF 1IILE 1QHOA 4GRWH 1IM3B 3PGFH 4JHWL 2EXWD 5I2IB 2IJ0C 4P23D 1BD2E 4DEPB 1VGKB 1N7ML 1GAFL 1W0WA 4Y4FD 3RU8H 4XTRD 2XG4A 3CFCL 4ZAKA 4LDEB 3S98A 4FQQB 4TULL 5HYJA 1IEBA 4PRIA 4XVUC 3WUWA 4E42B 1ZLWH 1RUMH 2YC1A 3QIUD 3BX7C 2BFVH 2R1YA 4LEXL 3NCCB 5HI3C 5EG6C 3RX7A 3EFFA 1PQZA 3V5HB 2FIKA 1UH2A 5BJTB 1MIML 2BVQB 4YHZL 3NA9H 1A7OH 1DBKH 3RWIB 3IT8D 4GAJL 4JFPA 4OF8A 3HE7D 1GVIA 3PQYA 4DKEH 3JV4B 4PRHA 5KAQF 1CGYA 1D5XB 3UBXI 3QUKB 3FKUS 4GKOA 4WI7A 4PS4L 3T0XA 3ILQC 1X5AA 4OLXH 1S7QA 4HK3N 4OCSH 1E4KC 1IFHL 3AREA 3IU3B 3MCKA 3UTTE 2D7PA 4U0RC 1HXYB 1JUFA 4LSUH 4OUOA 1JV5A 4JHAH 1CFNB 3BKJH 3LKOB 2OL3B 1V7NH 1J1XL 1VKXB 5F44A 1FNGA 2GT9B 4Z76A 1UJ3B 1MQKL 3RKPA 1JWMA 2ZG2A 1TZGH 4EVNB 1A3LL 3QEGH 2HJFB 4HIXL 1KUMA 4PJDE 5GGSB 4R26L 1NCAH 1B0GA 5C7XL 3BESR 3H9HA 5D1ZA 4LCWD 1OAUL 3PGCA 3RVWC 4HIHA 1Z0MA 4GQ9L 4PD4K 1LQSR 1R3JB 1YQVL 2NLJB 1WJ3A 2V5TA 1QSFD 1FFNB 5SWSA 1YPZE 3L1OH 1U8LB 5BW7A 3NZHH 4MDIB 3RWJB 4IRJD 3HE6D 1P7KB 1U93A 2GJJA 2ATKB 3MLRH 4YX2L 2OL3H 2CGRL 4MD5A 4PGDB 1A7RH 4K3GA 5D1QA 5F7YC 3UTZB 5DUML 4OQ1A 5CZXD 1H0DB 2DQDH 1BJ8A 2X1OA 1FP5A 1A9BB 2P24A 2I9LB 5ISZE 4U1GB 5B4MD 4PV9A 2BVPA 4LLYB 3AMLA 1FYHB 3QUMA 4PGBB 4HUWA 1PFCA 4O58L 4WUKH 3KPRD 1KPRB 4WV1C 3EJYC 4L4JA 4QRTB 3AGVA 2FJGA 5IQ7L 4R4ND 5IFHH 1H3VA 2V7NA 5CWSB 3V5KB 3MZTA 1WITA 4F7CA 1P4LA 1OGAD 1J8HA 4X6DB 5D2LB 1DBBH 4I5BB 4S0SD 4U6VH 4M3JA 4RQQB 3G08A 4XCYB 1FO0L 1H3XA 4X5WA 2DQHL 2PR4H 2BSTA 1EVUA 4TVPD 4N5EC 4MNGE 3L5JA 1B2WL 4TUJB 1FRGH 2NZ9C 5HD8D 5F88A 1INEL 4BKLB 4AIZA 3NZ8B 4NJ9L 3ZTJG 4NC1E 1KTRL 4OCYL 4PJCE 3TCLA 2AEQH 4KK6D 1MAJA 2KQMA 4X83A 5SWZD 1JGVL 4L8BB 1UH3A 3T0EE 5AUMB 3U7WH 1MREL 5MEOA 4NQVA 1U42A 2VC2L 4QNPE 4HCRA 1ZLVH 4U1NA 3FHAA 3EFDH 2AK4B 4Z7NF 5MENE 1CL7L 2FDBP 2SEBB 5E94B 1CD1A 1K4DB 1A6WL 5CZVH 5ANME 4P5MA 5JW3H 2FHCA 1BIHA 4ZXBD 3SJVE 1CFVH 5DC4B 3UC0L 4P49A 4FG6D 4XC1H 3BPNC 3L3JB 1YYMH 1Y18A 5BS0E 5L9DH 5E6ID 3RVVD 3BKYH 3TA3C 3O45B 2BSRA 1MHHB 1KIPB 3B83A 1NDMB 1JWSA 1F2QA 1Q9LB 2R0LH 3GHEL 3R06A 2BHZA 3I2CL 3WFHA 5DJAA 5FYKD 2NR6C 1RJZA 4LVOC 5FCUL 1LE5B 2AJUL 4F37F 1R5WB 4PJAE 1R5IA 1R0AL 2FJFA 1OP5K 1EIBA 3ORJA 1Q9KB 2M26A 4QHUA 3C60C 2YN3A 3JWOH 1UA6H 1V3KA 3QZWG 1CLOH 5FHBH 3RA7L 3GKWL 4LK4A 4H8WC 2YD4A 4ZFOB 1ONQA 4ZNEA 1YDPA 5MHSD 2W0FA 1FVEA 2OZ4L 4JREB 2ZUTA 5HYSA 3BRDA 2VDRL 4F9PA 3IDIA 2Q7NA 1M7IA 4UINL 4M43H 2F15A 1DQMH 3MOBL 5DTFA 3T8XB 4IHOB 1ZSDB 3DUHA 3Q2CA 2Z31D 4YZFE 4S1DD 3SDCB 4OI9A 4ONGL 2QR0A 3MLXL 3TN0C 4O2CB 3PV6B 2XN9D 2YPVH 5DF0A 4MAYB 3O6KL 5D1XC 4PFEA 3LPWA 5T3ZE 2ZCLL 3VXQB 5F3BB 4X7FC 2YBRB 4NZTL 3D0LB 1EO5A 5C0CD 5IIEB 4TUKL 5ITFB 5FKPB 3O0RL 1KJMB 3EBAA 2FR4A 5ALCL 4OCLC 3H9YA 3PWNA 4FFZL 4H20L 4IRSD 2PXYA 1V3LA 5IB5A 3O8XC 2P7TA 3MRFA 3JTTA 5EU7E 4R2GC 2CDFB 1IGCH 1I3UA 5ID0B 3WJLC 1HOCA 5AAMA 4NWTH 3TV3L 1IAMA 2YZ8A 1U6AL 1G1YA 1X5FA 3JV0A 4L8SB 4ZUSA 3BPOC 2ZJSL 4HFUH 1H3WM 1A21A 1NC4B 2EE9A 5K9OB 2D7TH 2VLJD 5CGTA 4YAQA 1AGDA 4G8GD 5C8JA 1U8NA 2E27L 1GGBL 4JG1H 2XZAH 1WWWX 2YD1A 1FN4B 1CDJA 3WKML 4M6NL 4WTWA 3HUJB 2XY2A 3CDYA 1TVBA 2DBLH 3GMLA 3SE4C 4GQPH 4YUEH 4GMTH 5IVXE 4JVPA 3TBYA 5TE4L 1Z6JT 1RZKL 5GPRA 1NMCB 1KLUB 4TVSa 4R4BB 1RUAL 1BQHG 3O41B 5A16B 3KJ4B 1TMCB 1Q1JH 4MDJB 4GW4B 4WFHE 5TE6H 1IQDA 3MA7B 1U3HC 5ALBL 4ZUTA 4ONFL 3M1BA 4D9LH 5EH1A 4XPTH 4HX1A 1A14L 3FOLA 5HPMA 3ARBD 1A7QH 1CICC 3IVKA 4MJ4A 3K7UA 2NW2B 5DRZA 3ELAT 2GFBB 4UDUB 2BVYA 3FO2B 4JM2C 4O4YL 4I18C 4PGEB 5DVLA 3PWPE 5EOQH 4YHKH 5JIPA 3FCTB 1FH5L 1I1AD 2VQ1B 1X4YA 2W9EH 3PABA 4HDIA 3VG9B 4R97C 3BGFB 4UAOC 1PY4A 3MUGB 1ZEAH 4LL9A 4PUBH 3A6BL 1MWAB 1T4KA 2VXQH 2IALA 5FKAA 2BNQA 5D7IF 3X12B 1EFXA 2VR4A 1MCFA 2A1WH 5I1KH 1CU4H 5JNYB 4PB9L 2RBLA 3HNTL 2PTTB 1X5JA 1J0KA 2F54D 1MEXH 2FD6L 3HZKB 2HFFB 3SGKA 5EA0L 1KIQB 5D72L 3OXSA 4IIQB 5C09D 4LAQL 4JY5L 2C3HA 3LQAC 1I8KB 1BQLH 1K85A 2BY0A 1D6VH 4I3GA 3JWDH 4HKZA 4BH7A 4L5FH 4ZUUA 5CEZL 5JW4N 2YMXL 2VQUA 1ZHLB 3KPLB 4J8RA 5BZWB 4J4PD 1RZ7H 2G60H 4PGJA 4KVNL 2IANB 3THML 3TVMB 1IBGH 1PKOA 1HNGA 2VLKA 4UT6L 4QGTA 3D48R 1MWAH 3O6LL 3EAKA 3EOTL 3WFZA 4DGYH 4PB0L 1T03H 1QFWM 3TYGH 1CQYA 3IAPA 5GGRY 4OCRH 2OXGA 4NRXB 4ENEC 2X5PA 2Y7QB 2FBOJ 3PDDA 5E9DA 3NACL 2IPTH 3RIFK 3FOMA 4I9WD 4IMKA 3ULSB 1S9WB 2E6JA 1F8TH 5AZ2L 4N9OB 4WW1B 1LEKB 3HAEB 3EIFA 5DC9B 1YMMB 2CDGB 1SJHA 2FATL 4PGZA 2YRZA 3MXWH 4R8WL 1IEHA 1RHHB 3S35H 5BXFB 3NPSC 1ZHBB 4Y4FA 3T1FB 2IWGA 1A5FL 3TBTA 1BVZA 5HSFA 5GISH 1MLBA 2Z8SA 3ES6A 4PJXA 4PTUA 2G2RA 2Y5TA 1BQSA 4FQCL 1BFVL 3DX7A 4NKDA 4OM0L 3QIUA 3VCLB 5ADOL 4U1JA 3D9AL 1NFKA 2DM2A 5FHAL 1MFBL 2ORBH 3D39B 3OTTA 2UZIL 4CRPA 3ZE1F 3P0YH 4KPHL 3HTLX 2WAHA 4MJ5A 4FNLL 4XX1E 5I8CA 2GAZB 3HE7A 1MIEH 4IS6B 2ESVD 3ZT5A 5EO0B 3MV9D 4UV4H 4XHJD 3HAEH 5IBUB 2ADJA 4GBXC 1MRCH 5C0EA 5TF0A 4CN6A 3IAGC 5C0GB 2HMID 2O61B 1P84J 1E4XI 4XVSL 4CN4A 3S5LG 3T0VA 4DVBA 2DTML 1B0RB 5CBAA 5ITBL 1XAUA 3GDBA 1S9YA 1MJ8H 2VNCA 3U4BL 4XAKE 1N5AB 2PTUA 1S7UA 2FSEB 1TJHL 3V5DB 5DR5H 1AD0B 1T2QL 2PW2B 1RFDL 3P4NA 5HI3D 3BWUC 5E56A 3D0VB 1RUQL 1T1WA 3DX9B 4JZNA 1S7SA 2VLLB 4WFED 3OR6A 43CAA 3CGTA 3HR6A 1BM3H 3CZFB 5T1DH 2OJEA 2HJKB 4DFHA 4LCWA 1FG2A 1KB9K 1HKFA 1MUJB 1FC2D 4H0GA 4HGWB 1ETZB 1HCFX 4KHXH 3PL6B 1QSFA 1NSNH 1EVTC 2HRLA 1QVOB 2DKUA 3GJFK 4LGSB 5TDOA 3T3PE 3ILQD 1DSFH 3HE6A 2X9XA 3LDBB 3AFLA 1QR4A 3CCHB 1XMWA 3SBWC 1FZOA 1C5BL 3QFJD 5EU6E 2XKSA 1I7TB 4NO0B 1LP9A 3MRIB 1W72A 5F71A 4ODVH 3BZ4A 1SVCP 5GJSH 4NQDD 3NCMA 5F97E 3KDMB 2AEIT 3LHPH 4RDQF 4X5XA 3LY6A 1FFOB 5I75B 5EIIB 2XQYG 5EBWB 4NFDA 5CAYB 1T04B 5DMJB 2L7JA 2HAZA 3UJTH 4WVRA 3KPRA 1EGJH 3HI5L 2IQ9H 5I30H 1CD8A 4Z18A 3JZ7A 1WZ1L 1OGAA 2CO6B 2DLIA 4M4PA 2IFGA 3P11H 1QA9B 1CD9B 2ICCA 2APWA 4KTDH 4KRMB 4MWFB 4P9MH 5E03A 1N6QH 3SDXA 1ZVYA 3IRZA 4WTXA 4D9QD 2PYEE 4HZLA 3GI9H 2W60B 3QDJB 1UWEL 2JE8A 3D1MC 1U41A 1Z9LA 4XPFL 5DRXB 4X6CE 1OPGH 1ZT4A 3QDMB 4DUVA 4MXWH 3VRIB 2KQNA 3QDGB 5F7LB 2CUMA 3ULVH 3DO7A 1ZGLP 2ILLA 3MMEB 1IVLA 1F6AB 1BJMA 4XP1H 3VMPA 5SWZA 2ERJB 2R29H 2EC9U 2CIIB 3EJYD 1ES0A 1E27A 2DQEL 4JJHA 4J3UA 3CSGA 4NSKA 4G6JH 4KMLB 4NZRH 4DGIH 3P30L 1KV3A 3L3OB 4IDLA 1QLEL 2NX5D 2PF6A 4P2RE 5F7EL 5GGUA 4P2QD 3GMNB 3MRQA 2C4FU 4AENA 3ZSTA 4ZXBA 1G0XA 3GSVA 4H1LA 3HPJA 4L4VE 3FJTA 1HH9A 2W59A 4L29B 2CLRA 4N5ED 1ZLSH 3ISWA 3A0OA 4IJ3C 5JPNA 1A9EB 4ZFGH 4HPYL 3U7AA 4KK8D 1Q94A 3SKNB 2PUQT 3HPLA 4ODWB 2P8PB 2BERA 3IAQA 5E6IA 3VXSD 3BKML 3F7RA 1L7IH 3F6LA 4LMQE 1HYSC 1LO3H 2BFVL 1U3ZA 4LHUD 4PJDF 2D03H 5C0BD 1KIRA 3VXRE 4MNQE 5FYJU 4X99B 4UT9H 3T65B 1A7OL 1DBKL 1P7HL 4G3YH 2DIJA 4PD4J 1Z3GH 5DRWA 1YPZF 4GW1A 4RRPA 5GS3A 5IB4A 3WSQH 3NCYS 3DO3A 3LCYA 3IDNA 1H5BC 1M71B 3GSRB 4A2MA 1HYRC 2XTLA 1DL7H 2VAJA 3L3HB 4Q9BA 1QQDB 1BHGA 3DRTA 3M8OH 3O2DL 4JFFD 4DVRH 1ULVA 4OKDA 1RK0A 1WIOA 3UO1H 3AXLA 4UT7L 4Z7WA 4X7CC 4CU8A 1XZ0A 3CSPA 4DOHE 2NNAB 2B7DT 1IZKA 1L7TH 3MRKB 5J89A 1ZANL 2Z31A 1ZT7B 1EEQA 1LHZA 4BZ2L 4M02A 5C9JB 1JZ6A 2NR6D 1J5OH 3CC5B 2XYCA 1RAMA 2HN7B 5A1AA 2R1WA 2VL5A 3GO1L 5D5MA 1X5GA 3TT3L 1CK0H 1UACH 3VFTA 5C0CA 3QCVH 3B43A 1G6RA 1B3JA 1ACYH 2XTJC 3HMXH 3WS3A 4L1DA 5FUOH 5J12B 3AUVA 5D7IB 2QSCH 1RSFA 4OZHB 3BH8B 4IRSA 3O4LE 2EH7L 4YE4H 3RI5K 3BO8B 2OL3L 4KZDL 3QIWB 1YEDA 3TFKD 3EYOA 4JKKA 3S4SG 3DGCR 5HY9A 5IP4A 2NY0C 2GJ6E 2JF1A 3LS5H 4NKOB 3JTSA 4R7DB 3W39A 5LBSL 5C08E 4ODTL 4APQC 5KSBA 1HHKB 3BGMB 1FVCA 5IROC 3AAZB 1G7JA 4PJCF 1N59B 1TJGH 4H88H 4EUPG 1RJYA 3QXAA 5EU5B 1F58H 2W91A 1JHKH 1VACA 1WCBA 1BFTA 4HEME 3TN0D 3ULUE 3BWAA 4OCXL 2GITA 2VISA 4QNPF 5TFSH 3WEXA 5D1XD 3OKMB 4LLUA 4BQCA 2VDMH 3OKEA 1ED3B 3BP6B 2VLJA 4FQLH 3BZEB 1KCVL 4G8GA 4HWZA 4MVBC 3LN5B 5CGMA 2BOBB 4OZFB 2IH1B 5DJZB 2KBGA 1CF8H 2WUCL 3MNVA 3Q3GB 5DJ2B 5T33H 4B0MM 1B4JL 1G7LB 4NNPH 2DYPD 3P4LA 1A6AB 1WZKA 2XNAA 2Q1EA 3QWOA 3O8XD 4M6MH 3EHBC 3GRWA 2D9QB 4U1LA 3ILPB 5F6IB 1FRGL 2G75B 4R2GD 1HILB 2VDPH 4JPKH 5I8KH 1F3JA 5KN5A 4MZ2A 1I8LA 2IGFH 4W81A 3W5NA 4OGYH 1N4XH 3CXHK 1RZFH 4U2YA 1LD9B 3QNYA 4ONHB 3ARBA 5MP6H 4OZFH 3QQ4B 3QXWA 1RJLA 1FAIH 1RK1B 3TBVA 1CDBA 5D7SH 3PJSA 3GSOB 3ARRA 1NEZB 3RVTC 3CLFH 5EULV 2DL2A 1I1AA 1I8IB 4K3HA 2JB6A 1CFVL 2V2WA 2GTWB 4LCYB 4XCEA 3LKPA 2OI9C 1E4WH 3K8LA 4L3EB 3KYOA 4R0LB 2H41A 3IJYA 3MLVH