1QFYA

Pea fnr y308s mutant in complex with nadp+
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
308
structure length
308
Chain Sequence
b'QVTTEAPAKVVKHSKKQDENIVVNKFKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGEVPYREGQSIGIVPDGIDKNGKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVYTNDAGEVVKGVCSNFLCDLKPGSEVKITGPVGKEMLMPKDPNATVIMLGTGTGIAPFRSFLWKMFFEKHEDYQFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPENFRLDFAVSREQVNDKGEKMYIQTRMAQYAEELWELLKKDNTFVYMCGLKGMEKGIDDIMVSLAAKDGIDWIEYKRTLKKAEQWNVEVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FERREDOXIN: NADP+ REDUCTASE)
molecule tags Oxidoreductase
source organism Pisum sativum
publication title A productive NADP+ binding mode of ferredoxin-NADP + reductase revealed by protein engineering and crystallographic studies.
pubmed doi rcsb
total genus 96
structure length 308
sequence length 308
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1999-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1qfyA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1qfyA02
2QTZA 1VQNB 4ZV4A 4ACBA 1JA1A 2CRVA 1G7TA 1VQ9B 1YHQB 1FDRA 5EMNA 4RD1A 4LBVA 1YJNB 3CCJB 1WDTA 2PMDA 2BV3A 4ZCIA 3LYUA 3ES9A 3AVUA 3W2IA 2VNKA 3ZZUA 3CCQB 2DETA 2VYQA 1YI2B 1IJFA 2BM1A 5THXA 2EFGA 4FWTA 4P3YA 4C0SA 3U6BA 2CNDA 2VZLA 3SJZA 1TLLA 4IW3B 1N8RD 1EFUA 1QX4A 1VQ8B 1JNYA 4U9UA 1BJKA 3QFRA 3W5VA 4ZGNB 4FK8A 2GQFA 3ZZTA 3CCMB 3AVTA 3VO1A 1Q81D 1D8TA 1N0VC 3JQQA 1Q7YD 3I56B 4HE6A 1QFYA 1K8AD 4P6VF 4RD6A 4YAWA 1OB2A 1GO2A 2DEUA 3WXMA 4G1BA 1IJEA 4B48A 1D1NA 2B7BA 2J7KA 2VNJA 1FNCA 4PC3A 2QA4B 3OJWA 5TV2A 4TMTA 1CNFA 3VNVA 4Y7CA 4K1XA 3FJOA 5HXBA 3W2GA 1TTTA 4WQMA 1FNMA 1SM4A 2YWEA 4YALA 4F7DA 4RD3A 3W2HA 3CCSB 1VQOB 1VQMB 3OW2B 5TY0A 2PIAA 1XB2A 1FRQA 1EFTA 4B44A 3AVXA 1M1KD 4ZGQB 2BPOA 1U2RA 1NJID 3WY9A 4ZCMA 1YITB 1AIPA 1ZM9A 4RCYA 2EIXA 4RJLA 4RD2A 3ZC3A 1F20A 1KK0A 4DQLA 4C43A 4TMWA 4B43A 2AHOA 3A1FA 3QE2A 2ZITA 1G7RA 2BSAA 1DG1G 3ZBTA 1YJWB 2BVNA 1H85A 1KK2A 3VNUA 3AGQA 2QDXA 4PC1A 1S72B 4M1KA 5GV7A 2YWHA 2E1RA 3AVVA 1YJ9B 1HA3A 4PGOA 3G4SB 3CXCB 2B5OA 4ACAA 2DCUA 3B82A 4YAOA 1QGZA 2QN6A 4PC6A 4Q7JB 1F60A 2XNJA 1QVGB 3CMEB 4YHBA 3VO2A 3E1YE 3JQRA 1GAWA 3CC2B 1S0UA 2OTJB 1FNDA 1SKQA 2OK7A 3P26A 4N3GA 1TUIA 2BGIA 2X3UA 4LBYA 4TMZA 4TMVA 1R5OA 3U6KA 4G5GA 3CMAB 1KC8D 1QVFB 2DERA 1KRHA 3MHPA 2XEXA 3QFTA 4MYUA 2QMUA 2BM0A 3OZWA 1QFZA 4B47A 1KJZA 2R6HA 3WBKA 1QGAA 3WNBA 1XE1A 2C77A 1J9ZA 4M4SA 2YWGA 3CB4A 2RC6A 1KK1A 5FA6A 3CCUB 4YAUA 3OJXA 3CC4B 1G7SA 1CQXA 1QGYA 1E63A 2C78A 3OZUA 5KSWB 3B78A 5JBQA 4NBSA 3JQPA 1FNBA 4RD4A 3WNDA 4LC0A 1K73D 1DARA 1QG0A 4TN1A 1VQKB 2RC5A 1BX1A 1JA0A 4Y9RA 1VQ5B 1OGJA 1DDIA 3W2FA 2QEXB 1DDGA 3I1FA 2FX3A 3E20A 4RCZA 3AVWA 1G7CA 3V76A 3MMPA 2HDNB 3CC7B 4YAFA 4AF7A 3CD6B 4M2LA 3QFCA 1D2EA 1GAQA 2D74A 1YIJB 3G71B 1M90D 1NDHA 3G6EB 1OGIA 1ZM3A 2BMWA 1BQEA 1VQ4B 2VNHA 1H42A 1KK3A 1EFCA 2BF4A 1Q82D 4RD0A 4TMXA 3J81k 4AF6A 3ZBUA 4LBZA 4M53A 3QSYA 1ELOA 1EP2B 1ZUNB 1JJ2B 4Y9UA 2GPJA 1EP1B 4PC7A 1N0UA 1QH0A 3CW2A 1EWYA 3CCRB 4UAJA 4N3NA 1UMKA 1R5BA 2QTLA 4R71A 3CRZA 3LVBA 4HE5A 1GJRA 1ZM4A 1GR1A 1FRNA 5H59A 3MCAA 5TR9A 2DY1A 4EH1A 1AMOA 2HMAA 4FN5A 4J0QA 3I55B 3CCLB 3PENA 5H5JA 4M0LA 1E62A 3WNCA 3B8HA 1W2BB 1KD1D 1A8PA 4ZCLA 2BN4A 1QUFA 1TVCA 3WBJA 4DQKA 1OB5A 1VQPB 2YWFA 3WYAA 1QUEA 4BPRA 1JB9A 2NPFA 1KQSB 4G1VA 3FPKA 1VQ6B 1W35A 2OK8A 2XNCA 1ZM2A 2BGJA 4QHYA 3CPWB 3LO8A 1B23P 1K9MD 1CNEA 1R5NA 4H9GA 3W5UA 1B2RA 1I7PA 3AVYA 2B7CA 3LRXA 2HCJB 3AGPA 3QFSA 3VMFA 1EP3B 1W87A 3U2QA 2OTLB 1VQ7B 5GV8A 1GVHA 3W5HA 1VQLB 1QFJA 5AN9A 3CCEB 4QFMA 2VNIA 1W34A 2PLFA 4LBWA 1IB0A 3ZZ0A 4PC2A 5DSZA 1KTVA 3P27A 1Q86D 4NCNA 4AC9A 4MYTA 1E64A 3W2EA 4B3XA 4B4DA 1EXMA 1BX0A 3CCVB 3OZVA
chains in the Genus database with same CATH superfamily
2G3YA 5I9TA 2UYGA 3ZCTA 3O73A 3O8NA 1IQRA 2D0DA 1LWNA 5E2BA 3ITEA 1Y3FE 2XZDA 1FJGB 5H02A 5JARA 2QJWA 3ZS8A 4LRUA 1XE3A 1VHEA 5FLYA 4JLKA 1KOFA 4RVNA 3Q3GE 5DRYA 4FTWA 1U7PA 3RJZA 3MS4A 2FZCA 4ILKA 2JCSA 3M9LA 3GA7A 3FTFA 4FMDF 1EFHA 1T13A 3CF6R 1QHXA 1VE5A 4GOLD 4V0QA 5CG1A 2HR1A 1U2SA 1GADO 4AKGA 1G8SA 4OHWA 1XDUA 1NPYA 2H00A 3A3BA 2DVMA 4EARA 4D56A 1SCUA 3GRYA 5E6RB 1DAOA 1SURA 4O8CA 1YE5A 3C6YA 1Y4AE 1N2CE 3LC7O 3AEUA 4Q39A 3IDQA 3HA7A 1M6NA 1FA9A 1QDLB 2EKPA 3LLCA 1QIJA 2F90A 4BBZA 3TFOA 4EGAA 1YRWA 1PT7A 3FJ1A 1IJFA 2VPXA 3VSBA 2OO5C 3T53B 1M8FA 1QZUA 1KY5A 3S0JA 3E48A 4TVOA 2C88A 4V0KA 3ZDYB 4DJTA 2EFGA 3FWZA 4B3BA 6Q21A 1TZJA 1YOBA 2GN4A 4XZ3A 3ODGA 5TPWA 1SQ6A 3WQBA 1IG3A 1CS0A 2IEAA 3X3HA 2FN8A 2PL3A 3FI9A 4TXHA 1ZJ6A 3K4QA 4G0OA 4R1PA 4M9UA 4MPDA 5C5DA 4DLPA 1ISSA 3PL5A 4DB4A 2XYHA 2B83A 2OGSA 3M4XA 3T56B 2LIVA 4OB6A 4EDFA 5IYWA 1BHSA 3IP7A 1T15A 3Q4GA 1PU2A 2DOKA 3PRKE 4DQDA 2C5EA 1BS1A 4Y2RA 3T7SA 1G2OA 2QJRA 4TKLA 3SC4A 2IHUA 3TRKA 1JLMA 4QJ4A 3WMWA 2ZJFA 3P9IA 4ZODA 2IX9A 3GLUA 1B2LA 3IGFA 4TL8A 2VYVD 3LBIA 3PC7A 1M2GA 4MP3A 4AO7A 4P0QB 4KRFA 4JITA 4P81A 1YJXA 3GNTA 1QVVA 1QF7A 4IQGA 3I45A 1XF9A 3CKMA 1ML3A 1GU7A 4PHTA 3R5HA 2HPAA 4BDSA 4N39A 5I51A 1WPCA 1UZNA 2BC9A 3UOWA 1MQ8B 2B4TO 5BUQA 1GLGA 3H5NA 3K6RA 3SYNA 4CEHA 4RXUA 5G4LA 3C8UA 4X05A 3EJ6A 2BBOA 5HEKA 4Y2TA 4BJHB 4DWWA 1MVOA 1VKNA 3R6GA 1PL8A 4LTDA 2NLOA 1P3Y1 5KTTA 1IN4A 1JEYB 4L85A 2GEUA 3GPBA 3C6MA 1MOZA 3SAJA 1AUXA 2D00A 4U7HA 4BMZA 3W3ZB 4FFNA 4F97A 2Q5FA 2VF8A 2FGKA 2QA4B 2ZCJA 2NACA 2B30A 1L5KA 3W1WA 3IOYA 3ZK9A 1K28D 1CY8A 3N58A 5I4BA 3MJ4A 2DHQA 1HETA 3FVRA 3MHTA 3VR2A 1E79A 2RAPA 2V6IA 2RHDA 4R9SA 4UM5A 5DM0A 1EA7A 3KT6A 4LNUB 4J4BA 4P2BA 1FFGA 1XNJA 1R37A 2GHRA 1UKYA 3Q41A 3RCBA 4CODB 1E79D 3DLBA 3Q5DA 3CNLA 2D2VA 4N0EA 4RE6A 3ME5A 3IR7A 4Q34A 4XVQA 2GN9A 3A35A 3JQAD 1GG5A 3EF1A 3EN0A 3KJEA 4GD3Q 4BXOA 3CLTC 2QW8A 2YYAA 1Z13A 3RK4A 2EX4A 2G76A 3K71B 1JKJA 2H2AA 2ZRAA 5HQ3B 4FD2A 3QVMA 3Q85A 4EA6A 4HUJA 1F6DA 3E7WA 4IKOA 2C95A 3D5TA 2XMSA 1GPYA 1ZOOA 3HO8A 3SQDA 3ZHYA 2ESRA 5L8VA 1TM7E 1X8JA 2FF7A 4JZYA 3W79A 2EL7A 4R2IA 4D9JA 1C9DB 1PGPA 2WPDA 3PDHA 4J16C 5JJBA 1IOWA 5BSWA 1K66A 1DAEA 4Q3CA 4X66B 3QY0A 1BXKA 5EOVA 3DA8A 3RC9A 4ZCMA 3BB3A 3BJRA 1Q92A 5AW2A 3KD3A 1XZLA 1KQOA 1BRMA 2V3CC 2H1OA 5E6UB 1RIFA 3EQ8A 2DXIA 3TE6A 3U9TA 2H5JA 5MF6A 4QPZA 1HKHA 3P9XA 1GZVA 1HFWA 3BWEA 3MRTA 4IHAA 4QEZA 1GGNA 3BTSA 1FSZA 3AF3A 2H4FA 3AEQB 3GN2A 3JASA 4X85A 1F7UA 3DWFA 3KIPA 1C9MA 3LPMA 4WLEA 3RYIA 1DAKA 3CX7A 1C9KA 3HB7A 4GKBA 1UWKA 1YVRA 1WTAA 4QL3A 2O2IA 2O2ZA 1E5TA 2WZQA 3HKEA 4LFAB 2G1KA 3HYTA 1LF5A 3GBSA 1CR1A 2LZJA 4N1AA 3AGQA 3F7TA 1E1MA 1V3UA 2X8JB 4IZ6A 3V4VB 5JATA 1YRBA 2PR2A 5DNWA 1HVXA 3Q3CA 2RBGA 4UQLA 4KH0A 2HWUA 1P8AA 1BFKA 2HQ1A 3Q3EA 4HRAA 1CDOA 3DCJA 1Y5MA 2ZRPA 4KQ9A 1YJ9B 1R3DA 4MQMA 5AQEA 3ZE0B 4D2IA 3QU9A 2FRDC 3GDFA 5I9BA 2HK7A 2PUWA 2QMHA 2I3GA 4CF7A 1JYFA 2QGNA 2RI6A 4CEJA 3O83A 5KYUA 5BR1A 4QO8A 5A62A 2CWWA 4CM8A 1WXEA 2XUKA 1YIAA 5G1PA 1MIOB 3QYAA 2IVZA 4B76A 1Z88A 5HOEA 4DCNA 4CHGA 1WSRA 3AI2A 4DR5B 4AJEA 4O25A 4LZZA 3RANA 3KLNA 4W5RA 2ZB7A 1TCVA 4P31A 2G77B 2NUTB 3MUFA 2HWKA 1JR2A 2Z43A 3LP5A 4EFDA 5AXAA 2HSDA 4EPWA 2Q3LA 1PR2A 4FVTA 4WWHA 2DYIA 4ZVRA 5ECGC 3GJTA 3CINA 2RK4A 4DG9A 3MWEB 2PDAA 2DJ5A 2W37A 5BV8A 2QVYX 4JLDA 4NBNA 4NPCA 1XA3A 3D1VA 3ABRB 4D7AA 4I50A 4B46A 4UHCA 3FMPB 1SO8A 3HE3A 2RBKA 3RC3A 4AYXA 1WG8A 2O2JA 4Q1DA 5JNWA 1WABA 4D8VA 1BA3A 4KKXB 1AE1A 1VLOA 4AMGA 5L53A 1R6VA 2AEJA 4GC9A 4K40A 4KGVA 2VEDA 3RNLA 2R65A 2FU5C 3TX2A 4DGSA 3UHJA 1RLJA 1PG0A 2J9YB 4TVSA 2XB2A 3BSYA 3OQPA 3AVQA 5KOJA 2GM3A 2NUAB 2UYHA 1U0SY 2V03A 4H6WA 1GPAA 1E4VA 1SQ5A 4HDNA 1W36C 2HK6A 3AY3A 1DIGA 3X1WA 4KQGA 121PA 1T0HB 1U90A 1NVWQ 1SA0B 2Y77A 4IP0A 4V02A 3KTOA 1X15A 3ILHA 2IYNA 2D3TA 3GWGA 4RH3A 2NOAA 1JLKA 4D8TA 2C4VA 1PJCA 5EIOA 2FR1A 3EEFA 4Z3KA 1XTJA 1AF4A 4OA8A 2CN1A 1QGYA 1JWLA 1MNAA 1C14A 5CDUA 5CA1A 2E4WA 4C88A 1A4UA 3EFOA 1WSVA 2YXBA 3M2PA 1XA0A 1UP6A 1DC5A 2O1EA 2X4DA 4EZEA 3OTIA 1JP7A 1LCIA 2R7MA 5EZ6B 4CL2A 1D1TA 2HRQA 3AL2A 3P2EA 4CM3A 4ID9A 4W5QA 2ZYRA 4LOJA 4YO8A 3RAGA 4BL5A 3PPXA 2WD9A 1LBIA 3VBCA 1FXUA 3OC6A 1ZP6A 2ICAA 4CL8A 1MHTA 1RI1A 1GNVA 1HI9A 1WDKA 1ZCZA 4LYJA 4W1RA 5DBHX 3S7TA 3CE6A 4BFYA 3IUEA 3W9YA 4B81A 3T1HB 2PX3A 1SHTX 4BNTA 3EULA 1MD9A 3SCZA 3VU8A 4US0R 1FUKA 3M33A 4L8FA 3TNJA 4BQQA 4D4IA 4PQEA 3KZ1E 2QSZA 4PXYA 2QWXA 4JUFA 2FWNA 5JI2E 1T8WA 3O8DA 4ZOLB 1CUYA 2H29A 2QXYA 2W6NA 5BMVA 5CYGA 5DW0A 1QTQA 4JR1A 4BEWA 1E9BA 4C29A 1SB8A 5A9TA 3J81A 1WXDA 3JYPA 5C8XA 2JI7A 1U1CA 3PYXA 1DXYA 4RIFA 5I9IA 4ZKEA 2I66A 3T52A 2YNMD 4PG6A 2ZAMA 3NKLA 2JANA 3LHDA 1LF0A 1KYWA 1D2GA 1G21B 1VMIA 2D5IA 2BJVA 2UDPA 4I5DA 4PZ0A 3WWZA 4BVLA 4E2WA 2A3RA 4OXRA 4F8JA 1ZMBA 1CE8A 1ISJA 2FRDA 2IKQA 4LSGA 3TDMA 1ZU4A 4INJA 1NXVA 3FB4A 1Y6FA 2ASEA 4JU8A 5LR6A 3KZCA 3GUVA 1XXHE 3IESA 1MQSA 4GIBA 2MMGA 2Z5VA 3IUYA 3R3XA 4X3CA 3TVTA 3THWA 2Q28A 2R8PA 1KZGB 4B8WA 5HSGA 4GRDA 3IQFA 1O87A 1E1LA 4AZ0B 1CY7A 1SCDA 3DB1A 3EMDA 3TI7A 3HLTA 5EPUA 3WGOA 5C32A 2BSQA 4BRUA 3PGVA 4XB6B 3VYUB 3LQRA 4IOKA 2QTNA 4MWOA 3D8TA 1EIZA 2LDBA 2BFFA 4B4WA 4EY5A 1J24A 1L7RA 1XZFA 3IERA 1T1EA 1ELOA 1NPDA 1N7IA 2FE4A 4Y9UA 2PJZA 1G59A 1D2MA 2WM2A 3CC8A 5T8KA 3GRCA 3FW1A 4D97A 2AJDA 3LDFA 4J1TA 3L04A 2ZW9A 4QUHA 5ANRB 1NFFA 1OYVA 4UHBA 3LXMA 5IJZA 2O5CA 3R9KA 2P6OA 2C5FA 1XC7A 5CIWA 2WP8J 2IYQA 3ZWCA 2FY8A 2A1UA 4NH0A 1MT3A 2P30A 2RHGB 1DDOA 3ESBA 1SVMA 3LQYA 3QBTA 3QVTA 2PH5A 4NYIR 1VHJA 2ZYSA 2W6CX 1AA9A 2X5NA 1XTZA 1CUVA 1VBNA 3BB4A 2QEQA 5COQA 2FRVA 2G0TA 3LFUA 4G63A 4UBIA 4A23A 3HVRA 2E6KA 2PY6A 2ZUBA 1G63A 2CHFA 3ABSB 2BFWA 2BI7A 2WUVA 3GUUA 1NYLA 2WTNA 4MUBA 2J85A 4WCFA 1LXCA 2O50A 1O8BA 5T8KC 1BXGA 1JS1X 1WXQA 2P2ZA 4QBFA 2D2FA 1DUSA 2CNWD 5H5JA 3N9IA 1V11A 4MRMB 4Z9BA 2ZR7A 2DIEA 3UCEA 5JAOA 5DTIA 3MWLA 4NSNA 1KNQA 1VP3A 1CUUA 3QW4B 1DWUA 4P54A 4UUQA 3FBTA 3W5AA 2I6GA 3T1OA 3QTLA 1O9GA 4WBNF 2IYEA 4K86A 4EVIA 1RHQA 3U17A 4MR8B 3SYMA 4RCVA 1YZYA 2CY0A 1CR6A 4Y3UA 1HR0B 3OFND 1ZONA 1QR6A 5ERXA 1FL9A 3ICVA 1NMYA 3FCAA 4C4ZA 4ZJYA 1FJHA 3BK7A 4NNPA 2GPTA 3FSGD 4KQHA 4QVKA 4LNAA 1D6SA 3JR3A 2FRXA 1IHOA 3K72B 1RNLA 2QPAA 3SR3A 3ZY6A 3HY3A 1YAJA 2VF2A 4XCVA 2PJRA 3U4QB 2ORWA 1RAGA 3OTHA 4G5YA 3MMNA 3V7NA 2C96A 4LMBA 3P0IA 3R5KA 4UEKA 3YASA 4Y98A 4L8LA 2IYLD 2Q9AA 4OHRA 4UHKA 1UK7A 2FWMX 4XX0A 3SE7A 1HLDA 2AOXA 2JIOA 4GX2A 3CZAA 3KNZA 1PWEA 2EHDA 1MJGA 4JLBA 1PJ2A 3RD5A 1WUYA 3ZI4A 1EZ1A 4QVAA 1T9BA 4KMOA 5SY6A 3ASUA 1HSZA 2XYVA 4RHUA 3AB3A 3CPWB 1T4DA 1SFRA 2H4YA 2W11A 3AEYA 4ZDKA 1TMGE 1RADA 4QICA 4NCAA 4WLFA 1K9MD 5H3LA 3GDGA 2B8NA 1D09A 3QJGA 5LWHA 4KIJA 2QPOA 5LYYA 1E3XA 1NDUA 2EFJA 3N2IA 1K4YA 3HJTA 3NAZA 3D7KA 3LRXA 2HCJB 2FSSA 5JISA 2B37A 4NBTA 5LKRA 3ANXA 1PVDA 2P0AA 2PKXA 3HZHA 3KPYA 3DDOA 2EJCA 3UAXA 1T5EA 3H83A 5DWVA 3OTQA 5BSFA 2P3MA 3OT5A 4MRVA 3HCNA 3MPUA 2TMKA 3ENVA 1RYZA 4O1HA 3VYWA 1NIJA 4CLRA 1CXZA 1IM5A 2PZMA 3Q40A 2O14A 4HPXB 5E7JA 4B2YA 4EGQA 3TO5A 1OY1A 5I5EA 3M5WA 5DASA 1K5DA 1NWCA 5DSXA 1VECA 1IULA 2G0NA 2PSFA 1CZNA 3N74A 4IH1A 4AZ3B 2A7XA 4V0OA 3WLSA 1TEXA 4OGLA 2JIZA 1PS9A 1U8TA 3P45A 5FTJA 4IGIA 3QLTA 4U7JA 3AXSA 4OBWA 2Y6UA 2YOFA 3PFKA 4TLCA 1LW6E 2X7HA 2XNKA 4ZV7A 3BXZA 2IIBA 4QVGA 3K9BA 4O2BA 2Q21A 3F96A 4ZT7A 3HMQA 4PU0A 2Z8XA 2ZXIA 1WUKS 2XRYA 3MERA 3JD2A 4BNIA 2F6RA 4JQCA 1ZMTA 3QXGA 1DINA 4TTPA 2GGSA 1WXXA 2BTQB 4PGAA 4Q1VA 5AI4A 1H2YA 3KQHA 2BFDB 3U7HB 1GG8A 4A15A 1A76A 3OZVA 3G82C 1WZEA 3IMEA 5F76A 2P9GA 3JVIA 3K5PA 2IVFA 1G21A 2Q3MA 4K1LA 3IE0A 1LX6A 1E1RA 1I2MA 1UDRA 3SI7A 2W83A 3UB4A 4D9HA 2EWWA 3CVWA 4E46A 4XJTA 5ECDA 4LSWA 5GWXA 4HP8A 1T9GR 4C7OA 5LMZA 4LNUA 1KZYC 3MG9A 4KYUA 2E0IA 1TYBE 1YCHA 4K0KB 1U3VA 3HYLA 2FETA 4EI2A 2Z9BA 2FPLA 3NBFA 4YRFA 2EFEB 5CD9A 5A3SA 3UMRA 3HK2A 1DFHA 1ECBA 2B7LA 2YRFA 5LUBA 3HYRA 3ZQ4A 1K9SA 1KARA 2HV9A 4PV7A 1NUTA 2PVCA 3Q5EA 2CHGA 4IQ0A 1WDTA 5CB4B 1QGED 5HQ3A 1K6IA 1YHNA 4OKSA 1P0MA 3A7DA 3N3BC 4HGRA 2WYVA 5LMNB 1Z6XA 3KU4A 2P35A 3EGXB 3F9RA 1NW5A 1T29A 3FGOA 1JFLA 3ESDA 1Y7PA 4PY2A 3ZU3A 1FDOA 5EPEA 4BEVA 4H0CA 4CHTA 2AK3A 2LVBA 2ARKA 1IUKA 2JFNA 3PFFA 2QLBA 2WG0A 3IQXA 5IDVA 3U0VA 2ZUWA 5I7EA 2DETA 3FDFA 4S1OA 2JKYA 3GPIA 3H5WA 4F4HA 4D6YA 2DUNA 2LCFA 1UKCA 4URWR 4WZAE 3PF9A 4OLAA 3L5KA 3G2MA 3MMZA 4N0PA 5BWBA 3I04M 3I2IA 1FVXA 2F67A 1MQAA 3OZIA 1AG9A 5K3DA 3CU5A 4KWHA 4C0SA 2A5LA 1GTVA 1E94E 1MR3F 1Y98A 3OIFA 4ME6A 5DCWA 5BQ3A 5HKAA 4KQCA 4IW3B 1I3MA 3FR8A 2UXBB 1QHHB 1ZJWA 1N5DA 1IAVA 2DR2A 4BCDA 2CHVA 3M4ZA 5IBPA 4CWAA 3KHKA 1ZR4A 4CUZA 1G6HA 3CEJA 2BKEA 3B12A 4RV4A 4FEEA 2BIFA 3BMXA 1UP7A 2W6ZA 4KO3S 2SKDA 3DUFB 4HGQA 1V16A 5M2QA 2QVBA 3L7JA 5LLSA 1WU7A 1V11B 4MRMA 1I3CA 4JI6B 1G55A 1UBHS 2NQTA 3GCDA 4P7FA 4AMVA 2P91A 4QRIA 3MTAA 1J0CA 5JI3E 1OFVA 3WMFA 3QUTA 1A8SA 4LK2A 5EMLA 2GAAA 3GGGA 4FZRA 4PZDA 4WXYB 4XAQA 3JU4A 1KXJA 2IV3A 5J2TF 3UNXA 5KQGA 1VG8A 1S3GA 4WZKA 3CZMA 3GVKA 2B4QA 4TL7A 4DADA 3B60A 1GVNB 1JXMA 3WRVA 4V1CI 3L92A 3K09C 3IQDB 5CBPB 3KT3A 3MQ2A 1G8KA 2E49A 3ETNA 3JS5A 2ZZKA 3HY6A 1QCZA 4OU5A 4DKXA 4B48A 1UWCA 4FSDA 1RAAA 1HTBA 1IJBA 1WWKA 2DUJA 2H9YA 3DC2A 4R8LA 3KSUA 3KS9A 5EQDA 4QJIA 3W3AA 2JFVA 1TD9A 4FS8A 5UKDA 2IYXA 4I5GA 1ID1A 3ORQA 1N1MA 3DHYA 1UZAA 4WD3A 4L4SA 1T8PA 3G2PA 4BWYA 5C3MA 1IXKA 2ZOSA 3A4IA 4L95C 1MB9A 1R10A 2CLCX 4D1YA 3DXYA 3IP5A 1GCUA 2BEWA 1E99A 5FHRA 4WQMA 5KWSA 1RWNA 3FZQA 2QD4A 4MCHA 3LJKA 4P93A 2AIRA 4Z7QB 4V0MA 3U4AA 2GJPA 1SG6A 2IITA 2J0QA 1TFUA 5FADA 4NULA 4Q15A 1A1VA 3TMKA 4R1MA 1PJRA 4EPTA 2B98A 3EXIA 2HNAA 3CRW1 3CX3A 3G0GA 2NZVG 1EINA 2ACKA 3KT0A 3KV1A 3NIGB 4LYGA 3Q5GA 4YJGB 1TAGA 4IG9A 1XZJA 3VZDA 1W94A 1ECCA 5DU2A 1EXDA 3V9AA 2FSPA 1V8OA 1SHJA 4KR0A 1VRWA 4P6YA 4GLOA 3JR7A 9LDTA 3TCKA 1BMFA 3Q6NA 1M0TA 1VCMA 3WYBA 3CCFA 3HVHA 1FS4A 2CV2A 4BX0A 2NUAA 4YUVA 3HEMA 1I3OA 1WR8A 3HA2A 4KHZA 3IVMA 2ID9A 2YY7A 3O94A 4EAQA 4NS4A 4F9TA 2JJYA 5EQJB 3NTVA 4AYWA 1L5RA 3EGOA 2H11A 4EYQA 2H4XA 3VPGA 1TO1E 2JVKA 2X9NA 2ZRFA 1BX3A 2LW7A 3I5AA 3PBKA 2R1UA 5I8ZA 3ZLTA 3I64A 4ZCRA 3SHOA 1KGDA 2GAIA 2B1JA 1ZR2A 1ORTA 3OHMA 2C58A 2C5BA 1KC3A 5FOTA 1VPTA 2V0NA 2GZ2A 3GLGB 3GBVA 2CXUA 2V0CA 4D9IA 1GA6A 4YREA 5LLDA 3SYRA 1HEIA 3VNUA 4FI3F 2R1ZA 2PXHA 2RJ3A 5DYWA 4LQLA 2EZTA 5K3FB 3SIPA 3UT6A 2JLXA 1Y8RA 1P1FA 4LSZA 1A69A 2VS1A 4G4JA 4ABTA 2DX7A 2HJGA 4YDRA 4BOYA 3S40A 3JZFA 4YDHB 3A8IA 1N2BA 5GV7A 1ESCA 2RGDA 1NQVA 4PRYA 4X7RA 3D7LA 4WXMA 4DAEA 4BNZA 3AVVA 2VJJA 1USIA 3DKRA 3MJEA 4YJDA 5CPFA 5JZOA 5FOQA 2EFDB 4D9BA 1WCWA 3T7DA 1SCQA 4UAVA 2VLIA 3CXCB 4B6JA 5ED4A 4NNJA 3V7AA 1XPUA 3P9KA 1C1YA 3K0BA 5DHQA 3UPTA 1DC3A 1GA4A 1FYDA 5HBGA 1CUGA 4DMGA 5JD6A 2J67A 2AXQA 1TZ2A 2J07A 2RKOA 2AFIA 5A4JA 3ANSA 4DLVA 5BN1A 3EODA 2HHHB 1JMYA 2OO5A 2GNAA 2ZTHA 4OMUA 4OHKA 1P8JA 3ELBA 3Q7SA 2RARA 1N33B 2AF3C 2XTNA 4X7DA 1XAGA 4UULA 3U9LA 3C6QA 1YQTA 2NO1A 4ENVA 3V3TA 3ADCA 2XNHA 3VO2A 1S3IA 4L0DA 1F4VA 1QHGA 1GAWA 2D59A 4RTPA 2BFCA 1JFFA 3UQYS 4EY4A 3DXXA 2QTTA 4FB5A 1SKQA 3GFFA 1CE8B 4DMUB 4NIMA 1ZAKA 4J2OA 2BGIA 2H9AA 3W8RA 1V8BA 4CI0B 4YC7A 1NUUA 1K75A 3TFWA 3EVTA 1F0YA 3LCJA 4JEUA 3TQFA 1RZRD 1V71A 5JVDB 1U1EA 1P2BA 4OQPA 4TMVA 3CXUA 4TTQA 4Y18A 4YMIA 1H4QA 2PL9A 2V6MA 1GG9A 2H31A 3HBNA 1ITZA 3M0EA 4CF6A 1NXOA 4BQFA 1WSWA 3MRVA 3RAJA 3GFRA 1MJ5A 3ZD9A 1YMUA 1YR3A 4YRLA 4YR7A 3MHPA 1RDFA 1D2AA 2PXAA 5JLJA 5AVTA 4NR0A 4D99A 1CS4C 1DV1A 4NTZA 4Y2QA 3VTKA 1SC4A 4PFQA 3IMKA 2BFFB 4L0CA 5BQ5A 4BFWA 2DBQA 4J7AA 1XNRB 1S3FA 2PX0A 2C77A 5I7HA 1ZHHA 3F7MA 4OQMA 4X92A 5FA6A 3TGLA 3KVOA 2UU9B 4YIHA 1Q0QA 2JJ1A 1RPJA 3CTMA 3MIZA 3DMGA 4D44A 3TCXB 2ZRIA 4DUZB 4KXMA 3SY8A 2R96A 4D42A 5HCUA 1YU6A 2W6ID 4PZPA 3OZUA 5D3ZA 4JMLA 5F7JA 3TBFA 5HIAA 2OD9A 2HLNA 3I34X 4NZPA 4TLAA 3VH1A 3RV3A 4B6QA 4JSYA 4TTTS 4JJGA 5E7MA 1J6UA 5B4VA 3Q98A 1F0PA 1PK9A 4FKBA 4NMMA 4EKDA 3GJ0A 5GM2A 5H16A 4HR7A 1Z37A 1MB0A 4BN4A 1VHOA 2IPLA 2FPMA 3DOOA 1DTEA 3RROA 4YI3A 3T9AA 1OXMA 3IEKA 1HEYA 4KOEC 2YXEA 3S3TA 2ZS7A 1YZFA 3SM3A 3LBAA 2IEIA 2PM8A 2R85A 3ML1A 5ALVA 1VCOA 5BSUA 1IZZA 5DH9A 5IXSA 1ZX1A 1O0SA 2MYPA 1LC3A 5FYQA 3GD7A 4NONA 1GKUB 4ND2A 1Z73A 1YZUA 2OTCA 1MCZA 2P4QA 3CKKA 2W2LD 3M9XA 1OGJA 3OY2A 1CUXA 1E2PA 3E03A 4WBNA 3HBMA 1D4ZA 4CXMA 3CE9A 4RNCA 2C83A 4GPZA 2AZXA 1KEPA 5HF9A 1E9AA 1OFTA 4J7UA 2IBSA 4RIHA 5FR1A 4LDAA 1S1MA 3MAAC 4HI0E 4EUEA 3U4QA 2Q2OA 3M4NA 4LYHA 4S05A 5F98A 4DBLE 2QVGA 4YCNA 4FDVA 3T3DA 2IKSA 1GKYA 1Q12A 2NU6B 3KVRA 2VYND 5THQA 3WK8A 4YYEA 3BN3A 5LBTA 2R47A 2YZGA 3B1WA 4LJ8A 3PZRA 1HLFA 2WYUA 3GL9A 1KP3A 1R74A 2PMKA 3RIGA 5KU1A 3F5DA 4NDAA 3RF6A 3MFYA 3F8TA 3SC2B 1LFAA 3ELWA 2EU8A 1TVMA 3ZE8A 1ABFA 4RF3A 3DBLB 3OKCA 3L0CA 3WO1A 1W29A 4BLUA 1T9CA 5BOSA 1VCHA 2Y1KA 2ECKA 4FGKA 1WQ4A 3AFOA 5DO9A 2XADA 1SUPA 1QOPB 4UVEA 4AO6A 3P2YA 2F3PA 3IUNA 1VDMA 1O6CA 5CYPA 1D4FA 4JX9A 4RX1A 5CIYA 2BF4A 1P18A 3PQ4A 2RHRA 3FSEA 1WB4A 3H4TA 4D92A 3ID6C 2CYAA 5AM2A 1O0BA 3RUEA 3VR3A 4MR7A 5FQOA 4BGDA 2ZR9A 4J3JA 1PQUA 3C98A 1O6ZA 3ELDA 4MV3A 5K45A 3KPJA 1K08A 3KQSA 1Y1LA 3PIDA 1LPOA 4YUZA 1NW6A 1U99A 4PE5B 1RM4A 2OXEA 2PEZA 1OROA 1NUPA 1ZD8A 2WFLB 4NCXA 4NG4A 3TIIA 1YJBA 1G4UR 3ON5A 3MF4A 3LQKA 4LZWA 3IDSA 1LC0A 5TR9A 3WRYC 1S2LA 5D1NA 4AY3A 4EY3A 3ZQKA 3G88A 1VRCA 3BWCA 4HNSA 3MRXA 1GAEO 1C3VA 1N75A 1PNOA 5T5QA 3S1AA 2G1AA 1ULBA 2O52A 4WKPA 221PA 5L51A 1CLEA 3OZRA 2VJPA 1UEIA 4JKOA 2HMAA 2WWWA 5KJFA 4G8BA 1TTPB 4G2TA 4ZI5A 5T7BA 2FEAA 2MYTA 2OM6A 4P5PA 4REQA 5IM4F 3GFVA 1YLOA 3C48A 1UZMA 4LXGA 4UAGA 1CJBA 1RFLA 2BTQA 2IY7A 2OHHA 2P7IA 4QYIA 1PT8A 4RLFA 1XN1A 3DAHA 4HQLA 2ZI5A 4YYZA 4ZOEA 5KYVA 1VSTA 1U2TA 3FMFA 2Z4RA 2ZT8A 5FFFA 3OJOA 1K68A 2YUIA 3AJ8A 3U61B 2XBMA 2BHTA 3ZCUA 2A35A 3I83A 2NQ2C 3OOCA 4S24A 2VBIA 3A6PC 3SYKA 1MBZA 2FMXA 1IY0A 4CCAA 5JAHA 4WRRA 2IZ7A 2VH2A 4MB6A 4OTZA 3HU2A 3WAKA 5B6PA 5EWLA 1KIAA 2HZBA 3K4HA 1RRPA 3R77A 1CR4A 2GM9A 5TT1A 2IPMA 2ZJZA 1P2TA 3GYGA 2XQFA 3QZUA 1N7HA 1HE8B 1JYEA 2JC3A 2TRSB 5CVDA 4AP5A 4AN1A 1RAHA 2E2WA 1I6LA 2P2DA 2XDWA 3L7AA 1CD5A 4O3FA 2RH4A 1ZN2A 1G1MA 3R9IA 1EMDA 1Z2NX 1TAUA 1II8A 1E7WA 4FW9A 1N6PA 1RTKA 1NX9A 2FKNA 2CFSA 2OM2A 3N07A 5EINA 3STYA 5MN4A 3I9JA 4HDMA 4LTNA 3ZQJA 4C05A 4F2WA 4QJ3A 1PYOA 3GCWA 3OM0A 2GYVA 3DSRA 1MDFA 2W7TA 2GK3A 2N47A 3GZ4A 4LX8A 4D4LA 2FSVC 2DQ4A 4ZXFA 1WKBA 3NHYA 3B6IA 5FLEX 2WTBA 3S8YA 2UUPA 2BFEA 3LUAA 1ORIA 4JA0A 1KYTA 3HL0A 4K3UA 4KQXA 3AZQA 2O8DB 1ZSNA 1PSDA 1Y5LA 5JEDA 5DM2A 3UV3A 1WPGA 2EQBA 2ZKLA 5LMUB 5EP4A 2ZUVA 4RXTA 5B58T 4OU4A 1XDGA 1NVEA 2FE1A 1QIFA 3D0KA 3OG9A 1L4NA 3PU6A 4JQYA 3SJ7A 5BSVA 3QVUA 3TIVA 1X74A 1CJTC 4BNWA 3EVBA 1NBEA 4J1TC 4U2GA 1QGUA 3FOWA 1M6YA 4BNDB 4DREA 2C7OA 1FW8A 3GVIA 1KI8A 4FU0A 4ZZIA 3ADBA 2BFMA 3O31A 4PABA 1H1TA 1Z4OA 3R0VA 3SQMA 3SQXA 1W52X 1VTKA 2ZE6A 3P94A 4CU5A 4WA8A 2KX7A 2ZZNA 1FLVA 4X94A 3O84A 3K6SA 2VJAA 4C3OB 4IFBA 1Y4ZA 4QQRA 4K05A 4XGRA 3TQRA 5B7GA 3RBAA 2C1XA 2JGNA 2BHRA 4YJ3A 3WRXC 1DIHA 1E5VA 4PC2A 1RYEA 2Z58A 4HC4A 2Q6KA 1P7ZA 2ZYUX 3ORRA 3OU7A 4CMGA 5HPYB 1KZ1A 4FHEA 1CIJA 3C14C 3T3PB 3T5GA 1FXSA 5KHLB 4Z4HA 4IZOA 3GVCA 3OEHD 4XEUA 3VHLB 1U5BB 1JHMA 4CM7A 4H6PA 1J0EA 1K98A 4Q9AA 1T91A 2X42A 3PXXA 2WJJA 3E7DA 2QQFA 4I4CA 1U7TA 2H17A 4YCCA 2G08A 1VQNB 4YXWA 2A84A 3HVJA 5D5PA 4MHOA 1YR7A 2C3UA 3DFMA 3UICA 1NNI1 1K63A 4ZV4A 4IUDS 4ACBA 3TZBA 1HTWA 1U8XX 1PS8A 2IZ6A 3ACDA 4CM4B 3THYA 3GGPA 5IK2A 4LUCA 2PV7A 2JGDB 5DNVA 3VYRB 3MWGA 5JYDA 3JQ6A 1FFWA 1TEHA 3MTQA 3CSDA 1YHQB 1O89A 4WX2B 5AHRA 2QAIA 1ACMA 4KR9A 3ZDDA 4GL2A 3I6QA 4KFSA 4DV3B 4F8YA 1BWSA 1VLVA 2PSSA 2FV8A 3DBLA 1UFRA 1W5EA 3KZKA 4OSOA 4MVJG 1AC5A 5CGZA 5LNK6 4PHHA 1E1QA 3UWOA 3UAOA 3LX8A 2R4TA 1F38A 1U94A 3DBIA 1QM5A 3H42B 3IPXA 5C37A 3AR3A 3ZDEA 3RVBA 3QI2A 3V1MA 3TINA 4TYYA 4TS1A 4WNYA 1V1JA 2FZWA 1KZ4A 3QVKA 3TGWA 3EXIB 5F3DA 4DSAA 3FOBA 1CW2B 3UW1A 3ZKAA 3AVUA 3KD2A 3NUQA 621PA 4EW1A 1XELA 2GLTA 4H7FA 4Y6RA 4DK1A 2VQDA 5DE3A 5IKMA 2PUTA 1TZMA 3ENWA 5K9ZA 1O4VA 3PUXA 5IXJA 2D3WA 2QENA 1RAEA 4LWQA 3WQZA 3QA3E 4P26A 2JLAA 2PRSA 3FGNA 4RFLA 4EUNA 1ZOPA 3QEAZ 4P3YA 2C2KA 5HQJA 1MB4A 3I28A 4HVTA 4BDTA 1EK1A 2CDCA 1CYEA 1W46A 4NDNE 2R8EA 1G8AA 5FKJA 3WR5A 4L4XA 2VPYA 3TTSA 1NVVR 4PXSA 1P9OA 3CMCO 1IHUA 1SVNA 2FTKE 3IMCA 5IYRA 3EDRA 4EW2A 4C7XA 3PD1A 1C7FA 1VQ8B 1UIMA 3GSIA 3R6WA 3TTYA 1Y4UA 1KBOA 1AK1A 2NVUA 1BH2A 4LV8B 9MHTA 2IPAB 3IIMA 3KRTA 4KODA 2BM9A 1DLIA 4XM1A 4BNGA 4BQNA 5KNDD 4EYGA 2OFPA 1V5WA 2DMRA 1KYXA 1YKSA 2QMEA 4LXYA 4YECA 1D9XA 1E58A 3RY8A 4NU5A 4RK6A 1T4GA 1NGSA 4H7KA 2WG2A 1I01A 3ZD7A 3GH3A 2HX1A 2AT1A 2SNIE 2PMWB 4GUDA 4JHLA 1Q7YD 1IVNA 4PYLA 1U1GA 2A8YA 3FB1A 1R8QA 1KNXA 3O0DA 1RWXA 3LSYA 2HH9A 4L0MA 3O1JC 2EV9A 1JQBA 3DE0X 2WQZA 2Q8PA 1BE1A 5KQMA 4UREA 5HJ5A 4WDQA 4ARZA 1ZHOA 2JCGA 3B2NA 3GDWA 3PDIB 1Y5IA 1CZOA 3GIDA 4R05A 1X3SA 2EJBA 2LDXA 4NBKA 5A2GA 2JLCA 2ZWIA 2VZ9A 2IWHA 2MSCB 1DLJA 4IIVA 4U7WA 3EUEA 5BWOA 3MWKA 2VSXA 2WIJA 1Z29A 2MMCA 3NVKI 4ZRMA 1R6UA 3V8QA 3H5VA 5EIBC 2QNBA 2PBZA 3BAFA 1CERA 3I73A 3LLVA 1CUDA 3MBOA 5D3KA 1BDHA 5FPTA 2XF8A 3KAJA 3IKTA 1EXWA 4GI2A 2X0RA 5HXBA 3MRSA 1KVSA 4KN5A 2GNOA 2L42A 4EHBA 5L6LB 2RGRA 3C39A 2GBIA 2WNIA 4JYMA 5IH7A 4R2MA 3K6JA 5DGHA 5K09A 5AWFC 4E94A 1PFKA 3H6KA 4W7HA 1ZW1A 4DCGA 1LI5A 1Z6QA 3CO5A 4OQXA 4RLQA 5DDIP 3SN6A 5HJ7A 1ZINA 1VQOB 3NETA 1D2HA 2W4IA 4C1BA 4AX8A 2XRZA 4FFDA 4P58A 1E6MA 3FCUB 3QUCA 4HDCA 4OLHA 3ZKWB 1H2RS 4YRPA 1DJPA 2OSBA 1O97D 1YGYA 1VYHA 2R48A 4B44A 3A1DA 5EWJB 4N76A 4A16A 3AJ9A 3VPAA 3EC7A 3G2IA 2JAQA 3ZE7A 5AJVB 2JFWA 2OBMA 1RWPA 3B9RA 2LCQA 4F4CA 1XZIA 1XFOA 1ZM9A 1HDOA 3KOYA 1AK9A 4L78A 1ZJYA 1J21A 2G1UA 2OYNA 5EIWA 3DGEC 2UXDB 1QGDA 3A27A 5EZSA 4L7QA 3KWJA 4MGYR 4ZVNA 3ZY2A 1P61B 2R2GA 2QP4A 4UVIA 2MJLA 3WIBA 4AJPA 1L3CA 3FWNA 4EBFA 3QE2A 3H19A 1U04A 2ZM6B 3AHDA 3AJEA 1GUZA 4LQCA 1YJWB 1A8UA 3D2LA 1U5BA 3U81A 5KJEA 1MH9A 2P6NA 2QY6A 5BN3A 4JIGA 1P7YA 2WKRA 4RLHA 3KYIB 1UBKS 3JQ9A 3MINB 3QF4A 4M1WA 1NKTA 2BDUA 1BCRB 5FBRB 4OY3A 3TLJA 4LQDA 4GWLA 4PVDA 4DYHA 2QDXA 2QMQA 2WJZB 2E5FA 4B09A 1XD9A 3LP6A 4RJJA 3DTYA 2R60A 2OYRA 1OD6A 3L7IA 3T7RA 1SOMA 5B7NA 1EDBA 3HV2A 3HEBA 1NHWA 1QIDA 4Q9NA 4W8GA 3KE9A 5AVRA 1Q7RA 3V4LA 1EWRA 2XDQB 4Q9HA 4C6RA 5ALRA 1KS9A 5G53C 2NUTA 2CFCA 2FUCA 3KOZA 4EP1A 1OC2A 1PJTA 3QUSA 2M9MA 4PSDA 4GX0A 3ESXA 3IEMA 2CB0A 4O4HA 3UF0A 3C3JA 2XOKD 3C7KA 1KPIA 3G0IA 4QU0A 3OLZA 4Z9YA 2W6MA 3GT4A 3TLCA 2R3SA 2BR5A 5JE8A 4TLBA 3NV7A 2IIQA 2FOIA 4GR4A 3KYDA 4PHCA 3A7EA 2O0KA 4UZEA 1VA4A 2D8MA 3M3DA 2YMQA 5GP1A 3HUDA 4Q7JB 4MHSA 1PWXA 4GRAA 3UMFA 4Y2JA 1ODLA 1C1XB 1IM2A 4IJUA 1RHMA 4OP1A 4DC0A 4YXFA 1BEZA 1E4EA 3VPFA 1I14A 1L7MA 1NRKA 3G2OA 4MS3B 2JH9A 1JLSA 1NXQA 3OUTA 5T4EA 1YZHA 3DOIA 1ECFA 5KMGA 1NXWA 3AO0B 4X7FA 1GRRA 3FRIA 3LZDA 3QUBA 5CGQB 1G16A 4N8EA 1Y8QB 3GOHA 4PCAA 3CX6A 4P98A 2OQRA 3CVVA 3HUUA 1G5RA 1Q0ZA 3GJYA 2R6ZA 3LWDA 4BP3A 2CV1A 2WM9B 4UM8B 1NKSA 3H2YA 4PAWA 2PQ6A 2WZDA 1H0KA 3U6KA 4G5GA 1CKEA 3F46A 3H2SA 1HYBA 2DERA 4URXR 2PSHA 4IDQA 2GZMA 4YAGA 1ARZA 1XAIA 2V58A 3GUHA 4AJJA 1MJFA 2YCBA 4FWIB 2XEXA 2OL4A 2ONCA 2VSFA 4JVNA 4XWTA 1UJ2A 4L4UA 3VKUA 3EGIA 5EVCA 5SYAA 1Q11A 3MW8A 1A9PA 1S2MA 3DHWC 2PZJA 5JXHA 5ADUS 1W5AA 4WVLA 4QGAA 3FSGA 1NL3A 5P21A 3L7LA 3PJFA 5G0SA 2HUNA 4RTQA 2GREA 1ANKA 1DRVA 1ST2A 1U5CA 3O7MA 1Q17A 4OFBA 5IT5A 3OJXA 1CZRA 4DNPA 3T9BA 2FDRA 3K5IA 2WFLA 4OUKX 3USES 1L4UA 1AKNA 4ARZB 6REQB 4K6HA 4Q5IA 2ZTGA 1GXSB 1RBMA 5KSWB 4AMYA 2QUKA 3B78A 3CJTA 3M34A 4YONB 5SZKB 2EJTA 2PTGA 5T6MA 1EK2A 2DWOA 4I6JA 4R68A 1WZIA 5BYBA 3S1AB 3DHEA 1R9NA 3NPAA 4KQFA 1BLIA 2EZ4A 2WAXA 3EBLA 3FTQA 1Q7TA 1REQB 3L6OO 1EUCA 1CUSA 2QN1A 2JFHA 2Q5OA 3BGDA 1K73D 4B6EA 4EYEA 2WUGA 5F21A 4DOMA 4C5CA 3ICCA 1Q3KA 3P0HA 4MIYA 3BMCB 2RC5A 1OLXA 3FROA 3IAS1 3M1LA 4LDQA 1XZDA 3NHWA 1B0PA 3B85A 3AMVA 3DNPA 4ZHSA 3CLSC 1MEJA 3SEJA 5CFPA 2X15A 1GQRA 4Q3KA 2OOSA 1BX1A 3GH1A 3LIPA 4GXNA 4AJ9A 8AT1A 4C01A 1W85A 3HLYA 1KO7A 1R4MA 1EFDN 4G0NA 4JJIA 4B9EA 3DE5X 3ORSA 5A2QA 1C8KA 5D6OA 2FCAA 4PPFA 3VKHA 3H5LA 4H18A 4JLWA 1P1CA 1EFKA 5FOXA 1G5IA 1D03A 1O58A 3FTCA 3LCCA 5B58C 3DL0A 2ZWPA 3DMPA 3GEMA 4PFKA 5IMBA 4ZAWA 3HN6A 1C1HA 5F51A 1LK0A 4HMPA 1J7KA 2W2MA 4UEOA 3NFRA 4MMYB 4ETIA 3FDZB 4P1VA 3BWYA 4AJOA 1JHYA 4LF4B 3FX2A 5G4KB 3AVWA 3AUSA 4NKRA 1I32A 5DM60 2XKKA 3N8DA 1P5ZB 5CCDA 3UG6A 1IATA 2VTVA 2WWFA 3IPLA 4W8OA 1SC9A 4Y6GB 3GB9A 4ZYVA 2HLHA 3LA6A 4JSTA 3JALB 4OGGA 1JT9A 4G56A 4O63O 3N39C 3DVRX 5EJ2A 3T0GA 3DDHA 4PYKA 2NZJA 3ZJ5A 1D4OA 2Q2NA 1IZ8A 1NB9A 2C42A 4O4JF 1Z28A 3ABOB 4IMJB 3T3IA 1FSSA 1NUQA 1JHOA 2DT8A 1XZMA 3OBIA 4TN5A 3TLGA 4ON9A 4MS1A 1EK5A 2XCLA 2G9ZA 4DNRB 2QUJA 1VQ4B 1Z5WA 2GZDA 2QX8A 3IOCA 3LDUA 3WMEA 1PJAA 4R0MA 1N2HA 2WDPA 3SR0A 2D1SA 2QZZA 4NBUA 2H1LA 1U9JA 3DDUA 3GCGA 2FR8A 2R62A 4X6YA 3SBOA 5EGSA 3ZBUA 4OQQA 3U4GA 4Q4HA 5BN4A 1DADA 2ZB2A 3WFIA 1EP2B 1ZK2A 1U3CA 1UFVA 3QVSA 3W5SA 1UXHA 3WGQA 1QV6A 4HAWA 3GU3A 1TYZA 2WSLA 4OA5A 3NBKA 4WCFB 2C99A 1IMOA 2B6NA 5EVJA 4E33A 2J6IA 2HMYB 3NWPA 2YN2A 1PDVA 2V9CA 5KNDH 2GOYA 3IKMB 4MS4A 5G40A 4BNFA 3SKYA 3EGWA 1UOOA 5DM70 1Q1GA 4R71A 5AOAA 2B8WA 2AG1A 1LTQA 5HP4A 3QVGA 3N28A 1H05A 2YDXA 3B9BA 4QG3A 1O5IA 3C3MA 5EQFA 5EZYF 4U02A 2E5WA 2F7SA 3LHIA 4HUQB 4RJ2A 5LUAA 3KYDB 4CKZA 4J0QA 5JAZA 1HOXA 4B3SB 2NU8A 4DR7B 3TX6A 1LY1A 4H7JA 4IQFA 3O8RA 4B71A 5JDCA 2D8AA 3DAPA 1A8IA 4TYNA 4OHBA 5CLQA 3R7SA 3HKBA 1W2BB 3QPDA 1B6GA 2JAXA 2V8OA 4A82A 4MS3A 4YCJA 1AO0A 3TECE 2VBTA 3O82A 4UZSA 2DQZA 2F1OA 3QKTA 3WOVA 5ER9A 2PCLA 1OREA 2XGMA 3A9VA 4FLFA 4XE5A 5DBEX 3W05A 1E3WA 2A9FA 2PXXA 3D6HA 3JYNA 3F6EX 5SZJA 5K7SA 5LZ4A 3LSTA 4M9CA 3WB0A 4CCYA 1CWUA 3SEFA 2XKJE 2YCLA 1T0BA 5KYWB 3WYAA 3KQUA 2F48A 4D41A 1ECPA 2JJ1D 4DCTA 3FOZA 2H85A 3PEYA 3G9QA 3LC1O 5TX7A 1N5JA 3PICA 1VOTA 1ILWA 1NJ2A 3PNOA 4J4HA 1LDNA 4FMDB 1Z0KA 2AFHE 3W06A 1ZNYA 2ZKIA 1N32B 4Q9LA 3QMPA 3IEXA 3E23A 4DIKA 4Q66C 1GNSA 1NQXA 2MDTA 1N3LA 4LY9A 4X44A 2V3WA 3HJGA 1WTCA 5I45A 1CZUA 4L51A 5HIIA 3CF0A 1PFUA 4H9GA 1RC1A 3C4JA 1MJGM 4MINA 5K8LA 3A1TA 4G0XA 4WJLA 1VJGA 3T0IA 4UMFA 1QPBA 2FAXA 2VP6A 2BZ1A 2JN9A 1KEZA 1PBNA 2FXIA 2JGJA 2JVIA 2WOJA 1OBHA 2PKWA 3R5JA 4N3BA 1ZIOA 1A9ZA 2H1HA 2YHSA 3NH6A 1I24A 1L7DA 4XVCA 4TS3A 2VJNA 1KH1A 1XQ1A 1ZWLA 4A0HA 1YFJA 1UD8A 1RI4A 1E5LA 1T43A 4MRPA 4HFNA 1BCSB 2H1VA 4FUTA 4HAZA 4OQEA 1AQUA 5LIPA 1T36B 2GK7A 5IYZA 1N6IA 2NV0A 1YB2A 3ETJA 5JU6A 1Z68A 5EYPB 2C5GA 1CJSA 5JD5A 4UOQA 1GVHA 4EGFA 5EKDA 3W5HA 5CK5A 3GP8A 3L1UA 4G1MB 1BXRB 1BFDA 1U7ZA 2YS6A 2B5WA 2Z5LA 5E9QA 4BB5A 1E1YA 4RVFA 4BVKA 2F43A 1T9KA 2FLKA 3GDOA 3ONVA 4HEA6 1C7ZA 1YR6A 3NM6B 5C5CA 4BO8A 4REOA 1G60A 2RGNA 1AURA 2P8SA 1F8UA 5AJTA 5K6TA 1UINA 2OD2A 5IAOA 1QZXA 1BD4A 3GLRA 4J29A 2CMKA 1O9HA 2Q3JA 1A04A 2HU2A 2QGZA 3CPXA 1V8ZA 4AJIA 1RCFA 5CLLA 5E6SA 5AKKA 4MV0A 4CMJA 4KSCA 3S2SA 4R2HA 2EBHX 5HE9A 1USUA 3OPYB 2QTZA 2FLVA 4M0CA 2Q49A 5IABA 5A5EA 1QU2A 3GA0A 5F1PA 1N9GA 2MU1A 1JA1A 4LRWA 1V26A 3H1BA 3JATB 4CVNA 3IUMA 1LS1A 3GLVA 1L5WA 3P97A 1KE1A 4BZPA 2FSVA 4HN9A 4OFWA 1G7TA 2JJ2D 2OBTA 3W4JA 5IYPA 3C5CA 2VUUA 2PD4A 3PFCA 3ESZA 3LGAA 4A1FA 1TPYA 1ZD4A 1WCYA 4M1QA 4J0EA 1NVKA 1YDHA 1CVIA 1YIDA 5BVGB 3SXJA 1NXPA 5CDHA 4LHVA 1W96A 3KOUA 5C8YB 1E2FA 4V2UA 6YASA 1TEZA 3URKA 2IXTA 2O8BB 1QHEA 3HU5A 5E95A 4DT1A 1U0LA 4HEHA 4OBXA 3PUMA 5H3HA 4HDKB 5ICMA 4QVJA 4X0CA 1NU8A 1TOAA 3OAAD 2NZYA 3W2IA 3U4HA 1LDYA 4YBRA 2Q6TA 4R9NA 4E6PA 2VBFA 3NOVA 1UPAA 4D9GA 5EWJA 3PNLA 5ETJA 1RM3A 1W0KA 2MTBA 3WRXA 2AFHB 4ETNA 1DBQA 1C4WA 1T8TA 2VP2A 2YYZA 1YVDA 4RIEA 2RHLA 2ZRNA 2CXNA 3EWSA 3KEQA 4RPHA 3WLRA 1JU4A 5AJWA 1B43A 4HQNA 2DJIA 3T8YA 4BAGA 4EZBA 2X0DA 5F7OA 5ERYA 5REQA 1Z38A 4XM0A 3RFUA 4PX5A 2BP7A 3PX3A 3QVGB 1UZLA 1GQOA 4R9RA 4RMNA 1MH1A 1MMFB 1SBYA 1B0UA 2V7TA 2E4ZA 4ZDWA 2FEOA 5CFMA 1G2IA 5DIZA 2EBFX 5KZMB 2HF8A 2CLFB 3IQHX 4LWPA 4QDXA 3PFIA 5JO0A 4JI7B 2G5PA 2GBFA 3IH5A 3SHFA 4NG5A 4AJ4A 5A5VA 4CEIB 2XRFA 3VR4A 2OQIA 5FWYB 3BHJA 5LJLA 1Y3AA 3MPOA 2P3LA 4IFTA 4ZGNB 5DBOA 1HE3A 1IOLA 2RB4A 2VYCA 4NAVA 2QQGA 4CQLB 1Q84A 1BCRA 2VHZA 1USGA 2VVTA 4BEBA 5JSQA 1F2TA 5JAMA 4ZGBA 4F4FA 1FNNA 4A8JB 2AI2A 3ZIAA 2P75A 4RIGA 4OLFA 2RDMA 1Z0FA 1IHXA 5L4NA 3C7DB 1VJ5A 1WLYA 3ZPXA 4K88A 3CZ9A 1DO8A 3RPEA 4HDSB 3AFHA 3WOHA 2G04A 2XQIA 3KUUA 1TM4E 4RD6A 1U80A 3BXOA 4O0MA 4WK4B 3VPDA 3DP7A 3EVCA 3MWJA 3AH8A 2OCDA 3NS7A 4AY4A 4UTVA 4MV8A 1FMFA 5FTWA 3MWDB 5EE5B 2Z08A 4XM3A 3L40A 3MGCA 2P3OA 5J4VA 5IBRA 1BMFD 5D2CA 5BPFA 1UBMS 4HKTA 4LQ4A 3HYNA 1QK3A 5B1IA 1ECJA 2ANBA 1Q21A 3P19A 3VR0A 4N4AA 4ZO9A 4C4OA 2A4KA 4DXDA 1C1XA 2QYSA 3DP9A 3B6JA 4G2NA 4TQUS 4OHMA 4WNCA 2NSLA 1ZITA 3E3OA 1TT5A 3RIEA 1NASA 4D4KA 3PC3A 3LOPA 1BS9A 4EYSA 2NYUA 5A3JA 5AW3A 1F8YA 2GQ0A 1YL7A 1C9JA 1YDWA 3H5IA 3LIIA 3NIBA 3HXOA 3HGMA 1PKXA 4GGMX 2IPNA 4KTVE 4A8PA 1GILA 4BMPB 3MQFA 3O21A 2PBFA 2V7UA 2VJKA 1I4OA 4BO2A 1V9SA 1A8HA 3RS3A 3DMTC 3K1TA 2P9HA 1VG1A 1KPGA 1L4KA 3PKJA 4PQYA 4DWOA 3I2FA 1OAAA 4IVQA 3B9QA 4RS3A 1XVVA 2AC7A 2ZYTX 3T5MA 5BQFA 1UQRA 2EP5A 1P1JA 2IA5A 1J0DA 3AIOA 4EF4A 4ICIA 1NF2A 1Y3DE 4CEHB 2Z2JA 5HM8A 2GNPA 2ZYWX 2WKQA 1W76A 2WWXA 1MFPA 4M36A 5J59A 4EHKA 1K7EB 1G3MA 3L4SO 3TW0A 4E14A 1V47A 3SHWA 2P6MA 2P5UA 4C2BA 2AI1A 4ENQA 2VA8A 1M0EA 1F20A 1HE2A 4LMPA 1VSBA 5DN9A 1GNQA 3DTVA 1W1UA 4RF2A 1E3DA 1OLOA 2I99A 3OZAA 3GEIA 2JI6A 4IJMA 4M6WA 4MR9A 5A05A 4CIYA 2BSAA 1H2HA 2B20A 2M6SA 1YK0A 3C70A 3JW8A 4XIFA 4ZT6A 4DRYA 3ZWXA 1RKUA 2OCAA 3O8OB 5BWNA 2Q9CA 4GVXA 1GTRA 2FN7A 1M2KA 5HS6A 3HB5X 5T3YA 3OWOA 1R8XA 2Q6IA 4QUKA 6LDHA 4MA0A 3WK9A 1QQ5A 1WA5A 4KQEA 2DTXA 1ZBDA 3OPMA 2LV8A 4M0UA 1SXJC 2YMPA 4DTCA 2VWPA 4K8RB 4XFKA 2F62A 3FF4A 4H3SA 3D7MA 3RDPA 2GUWA 3O8QA 1JE1A 1W75A 1F9EA 2YQ5A 2HMTA 2WABA 4PGOA 2JATA 3CWQA 3ANYB 3OHPA 3HCDA 1PFVA 1QYDA 4ZI7F 4NXNB 4X7PA 2XXAA 1PYDA 4RZSA 3LC2O 3VSAA 2O8DA 1XEAA 4DUGA 1XOIA 3FPJA 4UU0A 2HK8A 1DEXA 4LYYA 4MKXA 2WWYA 3CGWA 3AT1A 3RJ5A 4BVHA 4OFZA 1TQ2A 3C16C 3FNRA 4BB6A 1Z35A 3ETEA 5AOVA 8LDHA 4YVFA 1UK8A 2OYCA 1E3LA 2GZAA 4DUGD 2HJ9A 4QUGA 5IDXA 1JJ7A 3R5FA 5DTMA 4EGCB 3OECA 4BLWA 1OAOA 1TZKA 4ZQBA 3WK5A 5EIXA 2CNNA 2CLKB 2GASA 2P1ZA 3VR4D 3EEOA 5HZAA 1DL5A 2IGBA 2IL1A 5B3AA 3PKZA 1RWMA 1FTWA 3F3MA 1NJGA 1PQWA 2WJVA 3SDBA 2H16A 1RHRA 1UPXA 1CP3A 5HM6A 5AM0A 1Z2CA 2EKQA 3KLOA 3A4TA 1N1GA 1NQWA 4N3GA 3BGWA 1KH2A 2X8JA 3K8QA 4CN8A 5ABPA 1S96A 1RM0A 4KGXA 2H0RA 4IV5A 4D4JA 5JS2A 2Q0SA 3WLNA 3RUFA 2ZYAA 1R66A 3KCQA 4AS1A 1N5LA 4CEIA 1V5GA 3OT1B 2ZAGA 3RKUA 4IXNA 3DDWA 4B80A 1VG0B 3JU3A 1YA8A 4RFSA 3WLIA 5IFKA 4GYJA 3QNMA 721PA 3NT5A 3OQVA 1LKZA 4BFXA 3WLJA 2G7ZA 4QA9A 5F33A 1J09A 3RARA 4X64B 4CUKA 1MDBA 1JU3A 4QKQA 4ZEVA 1UC4B 1QX3A 4LGVA 4UMEA 1XLTA 3GFOA 5IVKA 2C1ZA 5KCZA 3K1AA 5SV2A 3G9ZA 2NTEA 2G9UA 2FUG6 5DMHA 3CC4B 4K26A 3EXG2 1ORWA 3L1KA 1VBFA 2ODPA 3EQ6A 3BRWD 4AY5A 4Q4CA 4BMXA 3L82B 4C6SA 4EJSB 2F59A 2I2FA 4BNYA 5TS2A 4UMVA 3AILA 2JIZD 5EJ4A 1FTQA 4CIWA 5CLJA 5AW4A 1K97A 1IY1A 2Y6VA 4RANA 1K5PA 4XH9B 1FX1A 5F4OA 1ODFA 1YTLA 2IGTA 5JAQA 1YDFA 1YVPA 2JLBA 1R4ZA 5IH3A 4URFA 2PFGA 5LZ7A 2OBRA 3DDSA 1LBSA 4JVSB 1DARA 5IDQA 4W5NA 3QNWA 4F12A 1U31A 2NPIA 2YVKA 4IDEA 3ZDXB 4HQ0A 2GA9A 4OJTA 5EJMA 3GI1A 3JAWB 1TYAE 1W6RA 3JD4A 3LZ6A 4HAUA 3REFA 4X95A 3C1UA 5H4HA 1RAIA 2BDTA 1J0BA 3T5PA 1HOTA 1FNSA 1KEVA 2RHCA 1VDZA 2QGFA 2WU3A 2XIQA 4BQPA 1WDLA 3PR2B 3HR7A 2O07A 2VYFA 5JADA 1Z0DA 3K94A 3W2FA 5CNIA 3Q15C 5ALSA 2HV8A 4UXJA 1DJNA 2JW5A 3NEJA 1OFUX 2CJYA 3U3OA 1UF9A 2XT6A 1RQGA 1BVUA 2EVWX 1DDGA 3KQVA 4TMKA 3RS9A 3WYCA 3AF1A 1EM8B 4OHCA 4CMHA 2A59A 4KXUA 1IY9A 3DCIA 2WD7B 2V54A 1QR2A 1U1IA 2ONYA 3RVKA 4R7GA 3RADC 1NUHA 3BZBA 4NYJQ 5EY5B 5A5FA 2NP7A 3QYJA 4QNMA 5DX8A 5C1IA 4ARIA 3WWDA 5A0VA 1RTTA 1QH8A 2QHXA 1C9NA 4EJFA 3WGVA 2WWVD 1SKYE 4YQEA 2QB5A 4TZ0A 2EDCA 4JT4A 1TAQA 3BSSA 1NY5A 3OQIA 4YP9A 4A0SA 1NYTA 4AQDA 5JH7F 4IWXA 3AKDA 1B93A 5TGZA 3WQQA 3BDIA 3E9QA 2VUIB 3DMYA 1RQ2A 1GP2A 3EB9A 4FEAA 4QOFA 2VJDA 4RDHA 4KPUB 4Q4AA 4U0KA 1DT3A 1MVNA 3P9QA 5KJCA 4BMYA 1E0AA 5FA8A 2VPTA 2O2EA 2E89A 2VQEB 4BGVA 1MAUA 4OUDB 3X44A 5J2UA 1DC6A 2HQRA 2V5VA 3WYFA 5AVQA 1T5OA 3Q8XB 4OI4A 1R00A 2HPZA 3DM9B 4OAOA 1XNGA 2X2EA 4Q4JB 5LKAA 2D3NA 4RDCA 4ZI7B 2CVPA 4FDAA 4ZCQA 4MV9A 4H59A 3RTAA 2IE0A 3RJTA 3WDSA 1Y63A 2J33A 3BWMA 4LDNA 5J5VA 3ZXSA 2ZIXA 1P9WA 4REQB 3L4KA 2ZJYA 3CUYA 4N3NA 4I9HA 2Q1TA 4RVOA 5DP2A 2XYRA 4PWYA 4QYIB 2FZVA 4UNNA 3LVBA 2YZNA 3RAEC 1BC5A 3GLHA 2C7PA 3IXQA 3CNQS 1QAMA 3OZDA 5BSHA 5BORA 1R0SA 1PCXA 1G98A 4LV5B 1X7DA 2QM3A 4QUEA 3CISA 4CCSA 5B1EA 4B87A 4FQ5A 3AF0A 3LW8A 4BAZA 1SBHA 1ZN9A 3QI7A 4DAOA 5CXUA 3JRNA 4MOWA 1L8OA 1M2WA 4MKGA 4KQ2A 1E2GA 4XPIA 2FW8A 3EVFA 3L8HA 4UTPA 5G02A 3CR8A 3AP1A 1C4KA 2ISCA 4ZYUA 3WNCA 4PZUA 4X5OA 4E5NA 2Z2IA 4QJBA 2FVYA 1BKDR 2YMLA 5MFZA 1EHIA 3B13B 3I2YX 1K6EA 5DV9A 4DLYA 1W5TA 3KUDA 1UBEA 4MJLA 3ZTWA 2QAJA 2KVOA 4D8UA 1D04A 1IHMA 1N9GB 2HU5A 1MGOA 3W90A 5JHGB 2ORVA 2VPWA 2Z8YA 4IUCS 4JEHA 2C59A 3K2BA 2Z1DA 3SLRA 2WVAA 5LJIA 3DT8A 1QE3A 2ZYGA 3I5UA 3EC2A 3VC3A 3AHJA 3FR7A 1MLDA 1V2GA 1NOIA 4D0RA 3D02A 1Y9EA 4PSCA 2HXYA 5KOJB 1L4BA 3L1JA 3V8RA 5L45A 1WP4A 2NSYA 2GAJA 1NN1A 1PFQA 3N76A 4L73A 2AR7A 4K2AA 4P5DA 3RLFA 3T54A 5KBYA 2WZCA 3NJ8A 5TJHA 4FC6A 2PEYA 4WN9A 1FTYA 4DT1B 3ONNA 3WQRA 5JNRA 1NG9A 3ASPA 3D3WB 2KSQA 2FZ5A 2G5GX 2FXVA 2GK4A 4M98A 3HJFA 4DM4A 4YNBA 1ZSVA 4LZAA 2HA4A 1QJCA 1WUHS 1JQKA 5IN4A 1T9GS 2EWMA 4Q47A 3M82A 1RABA 2X5XA 1W49A 4NMWA 5KKCA 1JR3E 2BMJA 3PHBE 2YJ3A 4IVNA 3STXA 2FF5A 1M5RA 1LD3A 1VIMA 1ZIPA 3TUZC 2N3ZA 3BDVA 2HWXA 2HFKA 1Y8CA 3V4SA 2DKFA 2CNOA 1I4WA 2P9TA 3L8EA 3LZCA 4D25A 1NBOA 1SBQA 2ZEJA 4FCWA 3I4FA 3QELB 1WZUA 3JQBC 1Q50A 3A37A 3S2IA 3K73O 1DUVG 3WMXA 3ZWBA 5CDGA 2CZCA 1GL9B 2FX5A 5KTOA 4LHXA 5SY9A 1XLUA 2D6FA 4JGBA 3NEAA 2ZYVX 2ZT5A 5H81A 1CB7A 1SXPA 5TQJA 1XF1A 1GITA 2D7CA 2IY9A 1ZQ1A 1HZZC 3UUFA 4JI4B 4MQLA 2CNLA 1GNTA 3EIWA 4DJEC 4GWGA 1EGHA 3BREA 3EGVA 5F73A 1NBWB 5LZ5A 4I50F 1JPJA 2YL2A 1XQ9A 1ZS9A 2E6UX 1S9HA 3MS7A 3OY7A 4I9NA 4O4IB 4U00A 4DSZA 4CTOA 3BIWA 2PWZA 4BZQA 2YJ4A 1XWIA 2VYNA 5BURA 3EMKA 1U7DA 1VLJA 4ZC1A 5DP1A 3BMNB 1M76A 3O1HB 1SH7A 3WNZA 3W2EA 1AB5A 1UMBA 3KDSE 1JQLB 5HXAA 2XVYA 4CTKA 2WY2D 2ZANA 2X53S 2WHPA 3H8JA 3BPSA 1Y8AA 2B1QA 2HBYA 1EE9A 4H08A 4RMHA 1L1RA 1C9YA 5KYTA 4A91A 5MFPA 4JUAA 4C03A 3H9GA 3ZNNA 3BE4A 5BWMA 2APJA 3U44A 3W78A 2IHJA 1O3YA 4KQ1A 4Q9JA 2F3SA 4AG5A 1UFOA 1A2BA 3NDJA 4V1CA 4EO9A 1YE8A 5FRDA 2O8CB 4GLFA 4KR3A 2Q5CA 2FMIA 4YCSA 2BHLA 3VR5H 2O7QA 3L6DA 4RO0A 4XLZA 2VRBA 3OIWA 4BMDA 3HPQA 2YWJA 1HQKA 4FFWA 1XQWA 4RMGA 4CLRB 3DQZA 4X61A 2WF9A 4UPEA 1TEVA 5M04A 1STOA 2IJGX 2J9FB 4QVIA 3VVLA 1YB4A 4MEJA 1B14A 4KREA 3T7AA 3O1LA 4J3NA 2BEVA 3O9VA 3O8CA 3EPKA 3RYFB 1WNFA 3N0RA 3L5OA 4OPOA 4QQ8A 4PPYA 3UFXA 4EY6A 3F1KA 1RZRA 1N0IA 1ZI8A 4XVRA 4RA6B 4JGIA 3I9OA 1PZHA 3JAKA 1S7GA 5IC4A 5C7LO 3UK0A 2PCJA 2XTAA 3WP1B 1JEOA 4L8VA 3T1NA 2C82A 5EEGA 5ENVA 3WGGA 1L7EA 5FJJA 1FP4A 2YXNA 2EKDA 3LUFA 2HTFA 1OWOA 4X90A 1U4NA 2WJ6A 2NVUB 3LLSA 4XWWA 2PE5A 3K35A 5A4AA 4OOXA 5TVKA 5EERA 3N5CA 4F6LA 1DCKA 2PUCA 2KWIA 4UBNA 4FE3A 3OJCA 1IH8A 1GCOA 3JQFA 4MWBA 4K46A 4X1KA 2FZEA 3BULA 1RYMA 1RZ3A 2I29A 4JEMA 4R1LA 3C85A 4Y2SA 5E9AA 4PEVA 1BN7A 4X8OA 1UJ6A 2ZT7A 1FDTA 2BKAA 2FPWA 1WW2A 4M76B 4XIYA 2ZRGA 1KSFX 1KDRA 4QODA 1AY0A 2G4VA 1DRWA 5ALLA 1Z2DA 3ZDFA 3RSCA 4FLMA 3S8MA 4ED9A 4NATA 3O47A 4LWOA 3PIRA 1VL1A 4MR9B 4QYXA 3M1IA 4EPVA 4CM1A 1BJKA 1W47A 1QC5A 2QRGA 3CO0S 4PX9A 3W5VA 3IR5A 3MLAA 1B8PA 2MSDB 2YIDA 3UGJA 4XR9A 2GQFA 1PEDA 4LGMA 1D0IA 1KQFA 2VRNA 1K8RA 1MX3A 1GEEA 2VXYA 3ETHA 2XMDA 2LNDA 3D4IA 1D8TA 4UATA 4DDKA 2Z56A 2RHMA 5AHOA 2QMZA 5FL3A 4DG5A 2DFLA 2EGHA 4YLYA 2ASVA 1C9EA 4I9FA 1KJIA 4DLSA 3TIFA 3OOHA 1E4YA 2W58A 1M83A 1QFYA 4WUVA 1UBNA 2XXJA 3GDHA 4YUWA 3BHNA 1WZ2A 4AG6A 1GO2A 2DEUA 3FPGA 4DXAA 1XEXB 1F4PA 5TC4A 2HJRA 1ZI9A 2JGKA 1TJNA 2CNBA 1COWA 1E3JA 2EEPA 1PRYA 4IXTA 2A0WA 4PZCA 5H9WA 2NZWA 4JQZA 1L5LA 1WUJS 1KETA 3GEGA 3LX4A 1OHHA 4JC5A 4PX3A 2JI8A 3VC7A 2BGTA 1NE7A 5LDGA 4X1OA 3G0OA 1B6SA 3Q0EA 3T95A 3TQHA 4K8OA 3UMCA 3OJWA 1SU6A 3ZX5A 1H93A 2ECOA 4BC1A 2XZOA 1TO6A 1ISIA 1SGWA 4HPWA 3E9RA 2IV7A 3UHOA 4F45A 4XPZA 1ZJ4A 2AS0A 4EJ6A 3G6KA 4CIBA 2QRLA 1YH3A 1LV8A 1J4AA 2DQYA 3QUAA 1JG7A 4E5DA 5BSGA 4E1VA 5CNMA 1UAAA 5A3VA 3PIIA 4UHEA 3RVLA 3FSRA 3ETDA 4ES6A 4Z4UA 1RXYA 2EFYA 2ST1A 4GPBA 2E85A 2OAGA 4XVHA 3IO5A 1Z06A 4O4LB 1FNMA 1G8HA 3GAFA 1UT6A 4KHPB 4ZQHA 3ASZA 4F7DA 1K8QA 3ONWA 4J1SA 4RD3A 2ETXA 3F9CA 3NASA 4U9IS 4A5SA 3SLDA 4E3ZA 4Z7JA 1E3EA 4H1TA 5CNJA 3CCSB 3RV4A 2PUAA 5IX8A 3SNHA 3TPFA 3IE1A 3USZA 5DGTA 3RTCA 3OW2B 5K0EA 5I7OA 3C43A 3VZSA 3DEJA 1Z0SA 2CFOA 3BMOB 3H1AA 5G0TA 1V6AA 2GXSA 2HF9A 3NIWA 3HZOA 4EIWA 4GICA 3ICWA 3A1EA 2EC5A 2EYQA 3PVZA 1TKAA 3DV2A 4RFSB 4UTOA 4WGGA 1KHTA 3LPDA 1M54A 3D81A 4G5SA 3ONUA 3F6SA 3G0CA 3LKBA 4K9LA 4Z9XA 2GKSA 2PWPA 3AQ4A 1JFVA 3AW8A 3OTGA 2C2WA 3ROMA 1WUIS 5K4GA 1YB1A 3UQZA 4LF7B 1FDIA 3WLLA 2VP3A 4KRYA 1WB6A 3CLRC 1NTOA 1OXUA 1O97C 2WJ3A 5AJXA 3DKPA 3RQIA 1Q14A 1QB8A 4LV6A 5JR3A 3R7AA 3UBMA 1UOQA 2I9PA 4EHHA 2SCUB 1O1YA 1DG1G 2A5GA 3WC4A 4GDFA 4CETA 2PRJA 2YBDA 3Q6QA 1P39A 3PSHA 1MHPA 4XGKA 2QTHA 3U9SA 4CJXA 3FOCA 3LK7A 4X93A 2POQX 3D6NB 4KC0A 3CUTA 1AKTA 4NU8X 2JVJA 4MA5A 1E3ZA 3TKLA 3TOCA 1UKBA 4G86A 5KNDA 1L5HA 3U44B 1NVUQ 5JCZA 4PAAA 5D1HA 4QHTA 5JRZA 3DWIA 1XZPA 1DAIA 2CW5A 3TL2A 1FEZA 2XA1A 1IDN1 2W2NA 4KDFA 4AJHA 1JVNA 2GWHA 4G7WA 1NG1A 3G4SB 5HIMA 2BKVA 3B3GA 3OQHA 4N7RA 1OI3A 4E7OA 3DAGA 2BFPA 3TBKA 2HMSA 3D0RA 3JAWA 4JAVC 4P4SA 2ZQZA 1U3TA 4B8ZA 4QBKA 3SWWA 2X22A 1ATIA 2D62A 2O7RA 4W99A 5FUYA 2WFAA 2Y1GA 2V65A 1G3RA 1O77A 1SBIA 1SRQA 2B5VA 3QV1A 4LXIA 1YB7A 1Y8QA 4A0GA 1VG9B 3WJ2A 4PYJA 1Q7GA 1OH6A 4P35A 1L5SA 5HW0A 5D7BA 2Q2QA 4CIXA 5FL7D 5AUPB 2FQYA 5HGXA 2R84A 3VC1A 3C3PA 3TIGA 4B2IA 4DPLA 5JEEA 5L3QB 4MW6A 4DIUA 1B0AA 4HRVA 2WD7A 1P5JA 1F1BA 4Z4TA 3PNKA 3E1YE 4OM7A 2CC2A 4JI3B 4DF3A 1BEEA 2DC1A 2NX2A 1G18A 3HDVA 1HDIA 5C4GB 2RHBA 4LIPD 4B3HA 4YN3A 3AI1A 1XX6A 4YMGA 1TX4B 1UDCA 5C1DA 3ENKA 3UV6A 3DV0A 5JYCA 2NG1A 4MCJA 1Y8RB 1O94C 3OF3A 3PNBA 2OZVA 3T51B 3N05A 4G01B 3IRUA 2HPHA 4QFCA 4MPPA 1NSYA 1TYCA 2BI4A 4CMIA 1GL6A 1OA0A 5HILA 5IJ0B 3AHEA 3OPXA 3QPCA 5G3ZA 1KC8D 4OX9B 2QRQA 3FVQA 5CA0F 4FJ0A 4P7BA 2GRJA 1G3UA 4XYEA 2DKNA 3TJRA 2WTUA 5B2ZA 1AUOA 4FNMA 1J90A 2VBSA 3PXGA 3D5EA 2IUFA 3FTPA 1A9XB 1SVSA 2XE8A 2I54A 1B41A 4PGFA 1DBVO 3FWHA 2G1PA 4LE2A 2VP9A 1QGAA 5JFOA 3CJRA 1SXJA 2GAFA 1Z22A 3FFXA 1HV8A 3NIFB 3K9FC 3WL5A 4DV6B 2HUPA 1NBIA 2NO9A 2PZ8A 4G65A 5HFNA 4C14A 2QXTA 2CL6X 2QTVB 3ORHA 6CHYA 4JUDX 3P71T 1EX7A 5H9VA 3KPWA 4B74A 2IU3A 2AMVA 1A7KA 2J4DA 4ZREA 4C7MA 3KR9A 4Q1AA 5A8AA 3EIXA 4QHSA 5GONF 3S2UA 2JA1A 4K3VA 4ISCA 4D4GA 2PS3A 4QU9A 4TKVA 5AP9A 2PWYA 3RIMA 5FO1A 4XN0A 4NBSA 5I9SA 3TUIC 3TEFA 1E8DA 4WXHA 1VIYA 3G17A 5FUMA 3SOPA 3WNDA 4C08A 1RKBA 4NHEA 5DJ5A 4Q16A 2MINB 2ZXHA 1U3FA 2PT9A 3QRWA 4TTAA 4WOBA 4ZQFA 3FWYA 4TSRA 1CP2A 3TLBA 3ZK7A 4JYZA 1IN8A 1WHTA 2UZ4A 4NH4A 2B4RO 2I62A 5FOVA 4BZZA 1BYUA 1OBCA 1XAHA 3RYHA 3FG9A 4K81B 5HJ2A 1J1ZA 2NW6A 2ZI7A 3ADOA 2IEYA 3OZXA 4MSUA 4ZALA 1GTSA 1ZRMA 4Y30A 1UXGA 2ENUA 1J39A 1CG6A 3L0YA 3L8CA 1EPUA 3LYAA 2BE7A 4WI1A 1EWTA 2IUYA 4QD3A 2R97A 1NW8A 5JCJD 5A3QA 3IPCA 1P9RA 4MQFB 2G07A 1HL3A 3DJYA 3MMXA 4EJ0A 4E1BA 3GT0A 1BW9B 1NJ8A 5DIFA 1WETA 3HWSA 4XKVA 1EX1A 1QNLA 3OMLA 1BHQ1 4IDAA 3GJ4A 3AHCA 1TMOA 2DPYA 3JPYA 1S2DA 4IIYA 1A7UA 3QE9Y 3MGBA 821PA 1VLLA 4MJ7A 1CF9A 4X1YB 5CJPA 1I2BA 4F72A 2BL4A 1L8XA 2DQSA 3E6AA 4EG3A 4JB8A 2XB4A 3R5TA 1JDZA 1N6OA 2LKCA 3NAQA 4UNPA 3TBHA 2P0EA 2Q7XA 4HXEB 4YP7A 4WK2B 3K70C 2WSSD 5BOVA 3SBEA 1G291 3KTFA 4X54A 3N2LA 4Z49A 4OQLA 3GLFE 1U5AA 1WF6A 1NP6A 2JI9A 2RAUA 3KDPA 3LT5A 3SR4A 1HF3A 1T9ZA 2YQ4A 3AF5A 4MS4B 1DKMA 1OFGA 3G6EB 1OGIA 3AU8A 1YQ9A 3CX8A 4UUMA 5HDBB 1YACA 4JC4A 2AD1A 4GI1A 5H70A 5CH3A 5BV7A 3IAFA 1KSGA 1Q19A 5FF9A 1ZFNA 3WGNA 5ICGA 1K4KA 3B38A 1J9EA 2DPGA 2HMVA 2Q1YA 2OLKA 3HNOA 1CZHA 4FP9A 5TLSA 1BSVA 1COZA 2GF9A 2FQWA 4BIMA 1QPZA 4LHYA 3W9SA 2NYAA 2N9UA 2Q5IA 2ZJBA 3QPVA 4JP3A 4NWIA 5DT2A 2H9IA 3NBMA 4ZTBA 5ULLA 4DNTB 2XT9A 5AVUA 4J8PA 4XR4A 1LJ8A 1VSUA 1LQTA 1EYZA 3DFFA 3PFWO 5L3VA 1Y0BA 1A72A 1Q1EA 4Y2XA 3GLGE 5K0SA 1TXGA 1T9DA 4L5IA 1K6JA 1KFJB 2NXCA 3ZHSA 5HRAA 5KPJA 3R7WB 1HTTA 3I09A 4O4IA 4RAOA 3A05A 1ESZA 3UT5B 1JHVA 5KYXB 3SJUA 1DKQA 1S8NA 2ZYHA 4DC9A 2H3EA 5BQXA 2G5CA 1PJZA 3ZHCA 5B57C 1WHSA 1U0HC 2MT9A 2P69A 1FIUA 4JELA 2CMGA 5AKZA 3VVMA 2BAGA 1SKAA 2IUTA 3HNPA 2EKLA 1ZKMA 4M0LA 1KZHA 3F97A 1LS6A 3IIIA 3IL2A 1YJQA 4NZYA 1PR4A 3LT2A 4EPYA 2GCOB 3B8HA 1EU1A 4NX2A 3H9UA 4EB6A 1P4AA 4XUCA 2AJTA 1YS2X 3UJHA 3ZGLA 2GSWA 1QKIA 2XWJI 4TT8A 4DGQA 5F4ZA 2NT4A 4HQ6A 1RWBA 3E3MA 3KETA 3E70C 2GM5A 2VDOB 5FBLB 4E5VA 4BV9A 3OX3A 5TQVA 3WIUA 5FQNA 5FI3A 4KNVA 1OB5A 2GXUA 2IYPA 3DAYA 4E5UA 1NB0A 3LLUA 3D31A 2H7XA 4MUXA 3NHRA 3H0KA 4NYIQ 4DHEA 4AJ2A 3RYFA 5TF0A 3LNNA 4UCQA 1H3EA 3CM0A 2YNMC 3UFXB 3ADDA 4MUFA 1HDEA 2IHVA 2PZFA 1G5HA 1W4LA 1KMHA 1NNUA 2X9VA 2DECA 2FJUA 3K09A 4GYWA 1QG4A 1GPH1 5TEWA 1T5TA 2J3DA 1GSOA 4RHFA 3ZXXA 2A1TS 1SKYB 4XB2A 4FYVA 4HWKA 4RL6A 1DKPA 4TV8F 1EVEA 4HDRB 2ZJOA 1NV8A 2L17A 4N5DA 1AD2A 3GIRA 3W7BA 1QQBA 4Q3LA 1AU9A 3OQJA 1C3OA 5SICE 1I7PA 2J3IA 4EQ6A 4GH5A 1F6WA 3JQBA 1A27A 4S0XA 1XD2B 3NOOA 4AQ7A 5DM1A 1BAPA 2FJ0A 3L9WA 1SXHA 16PKA 4DEYA 5IYQA 1KI9A 1U2ZA 4D8XA 1UKVY 4XR6A 1TVKB 4MVCA 1SG0A 3DZDA 1D1PA 1LVGA 4NY1A 1IUOA 4B6SA 1PR3A 2ID7A 4DSNA 5L4LA 3AKZA 5NLLA 1EFPB 2GPAA 4L2IA 3WLAA 3P9PA 1QBKC 1EP3B 1PE0A 1C0EA 1ZIC