1QFYA

Pea fnr y308s mutant in complex with nadp+
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
308
structure length
308
Chain Sequence
b'QVTTEAPAKVVKHSKKQDENIVVNKFKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGEVPYREGQSIGIVPDGIDKNGKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVYTNDAGEVVKGVCSNFLCDLKPGSEVKITGPVGKEMLMPKDPNATVIMLGTGTGIAPFRSFLWKMFFEKHEDYQFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPENFRLDFAVSREQVNDKGEKMYIQTRMAQYAEELWELLKKDNTFVYMCGLKGMEKGIDDIMVSLAAKDGIDWIEYKRTLKKAEQWNVEVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FERREDOXIN: NADP+ REDUCTASE)
publication title A productive NADP+ binding mode of ferredoxin-NADP + reductase revealed by protein engineering and crystallographic studies.
pubmed doi rcsb
source organism Pisum sativum
molecule tags Oxidoreductase
total genus 96
structure length 308
sequence length 308
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1999-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1qfyA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1qfyA02
4G1VA 1VQ4B 1N8RD 4YAUA 1NDHA 2BMWA 1QFZA 1JA1A 2CNDA 1IB0A 5TV2A 4YAOA 4M4SA 2XEXA 1KK0A 4FK8A 1KK2A 2QDXA 1VQLB 4B43A 1Q86D 2BPOA 3CB4A 1Q82D 3CCUB 3ZBUA 1Q7YD 3CCRB 3QFTA 1W87A 1OGJA 1ZM2A 1H85A 2HDNB 1R5OA 3AVWA 3ZZTA 1IJEA 2C77A 2BN4A 1ELOA 2GPJA 4HE5A 4NCNA 1D8TA 4PC3A 5EMNA 1VQPB 3MMPA 4MYUA 4Y9RA 1YHQB 4ZGNB 3P27A 5THXA 3ZC3A 1F60A 1K9MD 3OJXA 2OTLB 3A1FA 1KTVA 2D74A 3WXMA 2QN6A 1FRNA 1BX0A 4RD1A 3FPKA 4ZCLA 3CC2B 1TLLA 1QUFA 3CCEB 4G5GA 1VQ6B 2VYQA 2C78A 3JQPA 4PGOA 1QGAA 4MYTA 2EIXA 1DDGA 2B7BA 4TN1A 5HXBA 3OZVA 3W5UA 1TTTA 1DDIA 2QA4B 4FWTA 3ZZ0A 4B3XA 1VQMB 2YWGA 3I56B 4RD2A 1R5BA 3WNCA 1YJ9B 1GO2A 3W2HA 1F20A 3W5HA 4ACBA 3AVUA 2BF4A 1VQOB 4RD6A 5AN9A 1ZM9A 1YITB 1CNFA 3OZUA 2BGIA 3CRZA 2QEXB 3AVYA 1QVGB 1JA0A 4ACAA 3CCJB 1EXMA 1KQSB 1VQ8B 1W34A 1FNBA 4C0SA 1TVCA 3W2FA 1G7SA 3U6BA 4J0QA 1QH0A 3U2QA 1YI2B 3AVVA 3CC4B 1KJZA 1E63A 5GV8A 3G6EB 4FN5A 1BX1A 1FNDA 1EP3B 4LBZA 3W2GA 2OTJB 3QE2A 1KK1A 2BSAA 5JBQA 3W5VA 1GAWA 4R71A 4LC0A 1EP1B 3LO8A 2B7CA 1B23P 3MCAA 1QFJA 2HCJB 4PC7A 3G71B 3VNUA 1K8AD 3WNBA 1DG1G 4LBWA 2XNJA 4H9GA 4RCZA 4G1BA 3SJZA 4PC2A 1VQ5B 1G7RA 3B8HA 4M0LA 4RD0A 2CRVA 3ZZUA 4LBYA 2PLFA 1H42A 4RCYA 3OW2B 1EFUA 4AC9A 3G4SB 3B78A 5H59A 2QTLA 4RD4A 1YJWB 4M53A 1D1NA 3QFRA 3B82A 1QGZA 1KD1D 1VQKB 3JQQA 3WBJA 3I1FA 2NPFA 1YIJB 4TMZA 4DQLA 2RC6A 3CW2A 5H5JA 3WNDA 1GJRA 4QHYA 5GV7A 4PC6A 2XNCA 3AVTA 4DQKA 4YAFA 2DEUA 1I7PA 1CNEA 4ZCMA 1W35A 1E62A 1W2BB 3CCLB 4YALA 1Q81D 3WBKA 5FA6A 1B2RA 3ES9A 4P6VF 1N0UA 2X3UA 4RD3A 1ZM4A 2GQFA 2OK8A 2QTZA 1OGIA 3FJOA 3W2EA 1QG0A 4LBVA 1EFCA 1IJFA 4PC1A 1FNCA 4ZGQB 1UMKA 2B5OA 4Q7JB 4IW3B 2VNJA 1NJID 1QVFB 2VNKA 3AVXA 4AF7A 1WDTA 1S72B 2BV3A 3CCSB 2DY1A 5TR9A 4QFMA 4TMTA 1E64A 3OZWA 1D2EA 1KC8D 3QFCA 3CXCB 1J9ZA 1HA3A 1SKQA 2J7KA 1EP2B 2HMAA 1QUEA 2BM0A 3E1YE 3CCQB 1OB2A 1TUIA 3LVBA 5KSWB 2VZLA 3QSYA 2DETA 1ZM3A 4HE6A 2OK7A 4B47A 3U6KA 3LYUA 2BVNA 2DCUA 2QMUA 1OB5A 1G7TA 1CQXA 3QFSA 3OJWA 4RJLA 3CMAB 1JB9A 1M90D 4B44A 1S0UA 1GAQA 3VO1A 1QFYA 4B48A 3P26A 1JNYA 1VQ7B 1A8PA 4F7DA 1KRHA 4TMWA 1VQNB 4Y9UA 3CMEB 2YWFA 2BGJA 2RC5A 4WQMA 1BQEA 1FRQA 1N0VC 3VNVA 3CCVB 4Y7CA 2PIAA 1R5NA 4N3NA 3AGQA 3JQRA 1FDRA 4YAWA 1DARA 2ZITA 3CD6B 1QX4A 2PMDA 1AIPA 3PENA 1FNMA 3W2IA 3LRXA 2AHOA 1ZUNB 1SM4A 4M1KA 1QGYA 2VNHA 2E1RA 1YJNB 4UAJA 4ZCIA 2YWEA 1EFTA 4YHBA 1G7CA 1GR1A 1XB2A 3CPWB 1EWYA 1BJKA 4NBSA 2BM1A 3MHPA 2EFGA 4BPRA 4B4DA 3WYAA 4EH1A 2R6HA 1AMOA 4N3GA 4M2LA 2FX3A 5TY0A 1JJ2B 4AF6A 4P3YA 1U2RA 3AGPA 4TMXA 2YWHA 1XE1A 1K73D 1GVHA 3WY9A 4U9UA 5DSZA 3I55B 1M1KD 4TMVA 1VQ9B 3CCMB 3CC7B 4ZV4A 1KK3A 3VO2A 2DERA 3VMFA 2VNIA 4K1XA 3ZBTA 3J81k 3E20A 4C43A 3V76A
chains in the Genus database with same CATH superfamily
4AI6A 1TADA 1VQ4B 1NJ5A 2HHJA 3KLOA 3DDSA 1AB6A 5HG0A 4YRQA 1UJMA 4PGGA 4NZZA 4BFXA 5LOVF 5LQCA 3B7GA 3LX4A 3ICWA 2Q3CA 1C4XA 4WBNA 3AY3A 5L4SA 4Q82A 4DTIA 2HQRA 3UYKA 3EVAA 3FBGA 2H59A 4IMIB 1I1OA 2CNDA 4WZBB 1M1ZA 1CP3A 2IJGX 3I30X 3COJA 2XEXA 3BTUA 2FPUA 4NECA 1U2SA 5L51A 3LRPA 1W8IA 1IVSA 5HW0A 1U9ZA 3PVDA 2MYUA 4E4RA 3KK0A 3VH3A 4TWZA 4FMPA 4RABA 3ZWNA 2G80A 4KTVE 2QDXA 1GFWA 3DT6A 3A1TA 5AKKA 1ZNYA 2WBLC 2BFFA 1RWPA 4WZEA 4LYEA 5ECDA 3UATA 1K7FB 4FFRA 4OQNA 5DZSA 4GC9A 3TG8A 3OZRA 4DW8A 1CRLA 3OEED 1T9GS 3QLTA 3I39X 4XZ3A 2C7QA 4G8JA 1MC4A 3PUHA 3DDOA 3EQ8A 1DC5A 1VLYA 2JARA 1ZM2A 2JFNA 3PEEA 4KDCA 4PPYA 1LLUA 1XC7A 3I76A 3ZNQA 4FFLA 4B46A 1G8HA 3NP9A 1QO0D 4YAGA 1QZZA 1YHZA 3SSNA 1QS0B 2HA0A 3DPUA 2R6R1 3ISTA 3NBXX 4X3PA 1BXKA 4ZIRA 1H2HA 3GDFA 3HA7A 3KDSE 3L49A 3NNNA 2IS2A 4YJ2A 3ED1A 4HTFA 5HRUA 1YU9A 3B1XA 2BN4A 5TDHA 4IQ8A 2F59A 3P71T 4WOCA 5CLFA 2FSGA 3LVFO 1MPTA 3ZCQA 4DQVA 1HFKA 3MMPA 4O08A 1CZOA 3M5CA 4H4CA 2RHDA 1EGHA 3AWIA 4BLWA 4CFZA 3OU2A 1JZSA 2D3NA 2IV2X 4ZU6X 3GLFA 1NYLA 1TUEA 2XITA 3N2KA 5L40A 2IVZA 1P73A 1SCUB 3FYUB 4EG4A 3IPXA 1QHIA 1ZK2A 3HB0A 1BVHA 1E79D 1M8PA 3MFQA 4ITRC 4F72A 2PD4A 1M5TA 1BGVA 1T24A 2GXQA 1Y34E 2VZEA 3PDUA 4K6CA 1GCAA 3MHTA 4EHBA 1C3LA 2ZZGA 1SZJG 3EBLA 1KQOA 1ZJWA 1E99A 3UAGA 1QTQA 5DX0A 7ADHA 5DN6A 1PEAA 3I23A 1WTAA 2DWUA 3C70A 3IUJA 3NWBA 3LT2A 3OC6A 3K0CC 3TLYA 1ABFA 3S8MA 4C06A 5AKGA 4DUPA 2WTEA 3KEWA 4HLUA 1L3BA 2OCDA 1XO1A 2R8EA 2WU1A 3TNLA 2PJUA 3E22A 4YV1A 2V3WA 5KJEA 4Y2YA 4BX2A 4F3YA 2P69A 1Z8FA 2JLWA 4W5HA 3N70A 1FFYA 3BD6A 4RVDA 2R8YA 2EWWA 1QHNA 2DWPA 2XXJA 4IRXA 1UUFA 3VUFA 2B8NA 1XLUA 1MAAA 4IBOA 2C3UA 4N40A 1RP1A 3VDRA 5MN5A 3ZDAA 2UXDB 1B26A 2NYRA 4PHCA 2W5UA 3K71B 3A2KA 1PZHA 3N75A 4JCOA 4X93A 5F5XA 4D82A 4ZYVA 3C15C 1PWXA 1JQLB 1SVMA 1VHJA 2QN9A 1RWMA 3A1VA 3N3BC 3OX1A 3STUA 1W0JD 3I0ZA 3GYBA 1DAPA 1NW7A 4QUEA 2YTZA 3JQBC 1ECPA 1E3DA 1E9FA 3A58B 4H0FA 1DC3A 4L7QA 5CPFA 3TSCA 3NFYA 3WYBA 1SXHA 1YJ9B 1UWVA 1TC1A 4JU8A 1CS4C 2PX3A 1KYXA 1U9IA 1V7CA 4EY5A 2ZCUA 1VE7A 3W6PA 1USWA 2XMGA 4TQ9A 4B7AA 1GZDA 3BXXA 2EARA 8OHMA 3TOSA 1Z0ZA 2EKBA 3EZGA 4YCMA 3PEFA 3SFZA 4DCNA 1E6WA 2QRPA 1C4KA 2YHBA 3NRCA 5AVTA 2EC5A 4FI3F 2AK3A 2EDAA 5EWMA 1B6GA 2WZPP 1E7MA 3TN7A 4F3NA 3E5RA 4CETA 5KOHA 1QV7A 1N2CA 2CBZA 1N33B 1KVQA 4R9SA 3ETJA 1KO4A 2D5CA 4L51A 1DHTA 1QVGB 3A3GA 2Q49A 4DIOA 2P5TB 1W36B 4DQUA 3UHOA 1NQAO 4MB6A 1N5LA 4W1RA 3RSGA 1OB0A 1VJCA 2HMUA 4C4ZA 5M7EA 3HXOA 3B6JA 2QYSA 1OVGA 2HTFA 3GP5A 2GVZC 1SU6A 3B6ZA 4PHHA 1FUYB 4C2TA 2GF0A 3ZTWA 1TTPB 2AOTB 2CXPA 4RNCA 5IS2A 5E7MA 4ECAA 3ENQA 4XSVA 4D6PA 2LDXA 1EK5A 1YZUA 1NJSA 2XOXA 1N9GB 3R6JA 5TMDA 5EMMA 3R5FA 1G5FA 2C9BA 1JHUA 2KYRA 3EVZA 1FDVA 2R8RA 3QKUA 1YL6A 3QM1A 2HC9A 4NBLA 3CNLA 4OA8A 4UTNA 2VSOA 2QRVB 4ZAVA 1G3MA 3QLVA 1Q7GA 3RG2A 5E6SA 3RS8A 3D54D 4MUXA 1R6DA 4WINA 4MULA 1I3OA 3L8DA 2FJ0A 2COKA 3DFZA 4EJSC 2QSYA 1HX7A 1W0CA 2J5XA 5EXXA 4Z9YA 4KNYA 3GEIA 1EA5A 5IULC 1Z5GA 4D3DA 5BSVA 4FOLA 2BD0A 1MMFB 4R3WA 3S6JA 4RULA 5CIQA 4EATA 3E9RA 4Z49A 5PNTA 4RH1A 3G8AA 1YZFA 5JYDA 3EEBA 4KDEA 5JBQA 5D3QA 5B37A 3W2TA 3MJ4A 1W25A 2OV3A 3W5VA 2PRIA 5L6LB 1P9LA 3CLHA 1ND5A 2B2XA 1UFRA 4GFDA 3BQ9A 2JFYA 1DQZA 1RI5A 3PNBA 2AOWA 4ARAA 1ZO8A 3VO8A 4KSYA 3WL3A 4BU0A 4LRSB 5EYPA 3IMGA 2F17A 2ORIA 4HX2A 4NYJR 4UM9B 3IKJA 4HEQA 5A5EA 2FWIA 1V5EA 2PX4A 5KC8A 2KSQA 3KZVA 1ZSYA 3E4CA 2Y76A 1YK0A 3STVA 5I4BA 4F9EA 2BZSA 3C8MA 1EJBA 2EX0A 4QPDA 3SICE 4U2KA 4F96A 3IEIA 4L9RA 4M9QA 4UBKA 1TW2A 2W6CX 1QHFA 1UPTA 3ZH2A 3URKA 3HB1A 3QHPA 4U2GA 3WG9A 3IMFA 5FJJA 4CI0B 2GJ9A 2PSSA 2ZYHA 2O57A 4MAAA 4MPDA 1ENPA 1EQAA 2VHVA 4WFQA 2AJDA 3GRUA 4KVAA 3HKCB 3L7KA 3ITKA 4MAMA 3UHJA 2IHZA 4E09A 1VDMA 1IDN1 2FN3A 2X19A 3FYDA 3PPYA 3CLVA 1UJNA 4FYWA 4KQFA 4UPDA 4WE3A 2H16A 1UMBA 1FW8A 3BB4A 3QH4A 2NTNA 3AZQA 1SZPA 2BEWB 1LX7A 4ENRA 1QG4A 2ODQA 3MCWA 1ANKA 3PVCA 1E2DA 2ISSD 3TGPA 2G72A 3GRAA 1UBRS 1YE8A 1U8XX 3WBJA 4BP8A 1BOOA 4CKEB 1HDGO 2XB8A 1XLTC 4IH4A 1SBZA 3WGMA 2H7VA 3PPVA 5K03A 1SVSA 1SO8A 5BNIA 4UULA 2FHSA 3H6HA 1SU7A 5C4GB 1F2TB 4MYCA 3PZBA 3S1LA 3IP7A 4PWYA 2IYAA 5DGTA 4FGKA 4N5HX 4RY9A 4YT8A 4PC6A 4YP0A 1P1HA 2C3YA 2V96A 1L5HB 4BNMA 3ZQ4A 5BYBA 3T95A 3FA2A 2GBIA 4OEHA 4BUZA 3AEKB 4P4SA 1LPBB 3ZWPA 4O63O 1Y9EA 1XKTA 1P5HA 5IK2A 4R98A 3TJRA 2FWBA 3S40A 1GG9A 1KAHA 3AK4A 4MQ4A 4C1BA 5AM5A 2D06A 3H5LA 4DBZA 1W19A 4Q4JA 3UMFA 4R51A 3ZXSA 1RCTE 3HZZA 4ZT5A 4M0EA 4AYXA 5LDHA 1A1VA 1XEXA 4Z8XA 4RD3A 3E18A 5J23A 5I4CA 4LJRA 1ZM4A 1N5IA 2AG1A 3ZHXA 1NJFA 4CIBA 4EDHA 2QV7A 1CC1S 3D4OA 2AH5A 2XTNA 1IUKA 2WWXA 2PUHA 4HDCA 4HP8A 5A9RA 5CFMA 4RYDA 5TRDA 1LLFA 1WCYA 5C35A 3LQYA 5I48A 3FFWA 4MRAA 4C0WA 2KVOA 1SN7A 1N2OA 3M6VA 4GZ3A 4Q34A 1TNDA 2FX2A 4LFBB 4QJBA 1AK9A 4RDCA 1SC6A 1PJSA 3EC1A 3PNMA 1V2HE 4Q6WA 4RKQA 2ZPUA 3NBZC 5B55A 3FAKA 3SBOA 1VIAA 1Y7TA 2J32A 2WWGA 4KOAA 3VKWA 1KF0A 3UFXA 2GWHA 3VZPA 5AVYA 2FEKA 1QOZA 1RAFA 4CR8A 4EJMA 1K5GA 2I54A 2G3YA 3HKBB 5FNZA 4LQCA 2R7MA 4QX6A 4U7HA 1DEKA 2P79A 5JS8A 3CZ9A 3OE5A 5JI2E 1MB0A 2WHYA 2QXTA 3QVXA 3V1YA 2IHNA 4FEYA 1EQUA 1KSFX 3OX4A 2IVFA 5C8ZA 3LCRA 1E64A 2GCOA 3AX6A 4KIFA 4MW2A 3NTVA 3OQBA 4I3FA 3RRMA 1Y6FA 1FTYA 3NOOA 3QRWA 1FRVA 3FOWA 5CH8A 1VL0A 4P22A 2AW5A 4PBTA 4W9NC 3W1VA 4C01A 2HIHA 5CX1A 2NTVA 3SF0A 2HLDA 4GEKA 5F2NA 2ZE8A 4B87A 1N2SA 2CXUA 5LXTB 3CHYA 1V26A 1MHTA 2C94A 2CDCA 3R7LA 3N2GB 2YCBA 4ES6A 2GFHA 5LM3A 3DL4A 1ZZGA 3H3FA 3DZHA 4ZVKA 4LPSA 2YXPX 4TWRA 3FGZA 4X95A 2EJVA 1P4RA 5KNBH 3RODA 1RW4A 5JYCA 1XN1A 3OQIA 4Q5IA 3OOEA 4DKXA 1GYPA 3PFWO 4PR3A 2B1QA 5DCWA 2ANCA 1HT3A 2H4JA 4MPRA 3ER9A 4QBTA 1CQXA 3O3CA 4KR9A 2DHQA 5LC1A 4OHZA 4EIWA 1SBHA 5BR1A 1L5NA 2NUBA 1SBQA 2BJHA 2I33A 4EA8A 5H68A 4HB2A 4BBAA 1U0BB 1GZSA 2CWWA 8ABPA 3RSZA 2C5GA 3IT2A 4R1SA 1TA9A 4CDNA 3FOCA 2WPDA 4EKGA 2N42A 4BOYA 3ELYA 4LF7B 2HF9A 1W5TA 1PX2A 1YA4A 2A3RA 4QBFA 3VKFA 1Z2OX 3FTCA 3BK2A 1N5OX 1DO0A 2QMOA 4FILA 4EJFA 2PBZA 2GRUA 2HH9A 3KU4A 4K88A 3LKDA 2EW2A 1T36A 3PGLA 1J0CA 1OQAA 3LX8A 4MIEA 4P53A 2OBTA 1VQ7B 3L6DA 2VCYA 3NTXA 2LD4A 2R97A 3AOEC 3L8EA 3Q7RA 2O3TA 4KDFA 3ZI7A 2FPKA 2IOQA 1KYWA 3KO8A 2PQ0A 3H7IA 4IXMA 4Q4HB 4BO6A 5LJIA 2EFJA 2RHRA 1PP4A 5DP2A 4E08A 1OPRA 2OTCA 2VYVD 1FRQA 4DK0A 3CN9A 4FMBB 4F4JA 1US8A 3ADPA 1G64A 2EW1A 3GGGA 5FUYA 1OXMA 4N6OA 3KPWA 4FBGA 1R5NA 2QMZA 3QUCA 3D9QX 1O4VA 2QAGA 3EHDA 3KUXA 4B6QA 1HNWB 1WD7A 1MRSA 2JFHA 1GEGA 1L4UA 3NJ4A 1K68A 4YP9A 3UMBA 1N9KA 3VR0A 1KMHA 3OO0A 1LSJA 4RY0A 1QM5A 4PSDA 2HO4A 2Y1FA 2ODEA 3T1VA 5L7YA 5FLEX 3G9TA 2AG8A 3THOA 2J7PA 4BQPA 2PMDA 5JBNA 1QP0A 2WFAA 3PFFA 4E33A 5KAMA 1Z26A 1N57A 4MPJA 1U4NA 4WKGA 3RSLA 2X5NA 4CDMA 5AVXA 1CUIA 1CTQA 4GPTA 4LMPA 3Q40A 3KHSA 3QITA 2IYWA 5CJJA 1SIUA 5DN6D 2PT9A 5B58T 1TO6A 5KTRA 3B1KA 3CRQA 3Q2OA 2CF4A 3D7LA 4ZCIA 3M6LA 3MUNA 4Q4LA 1NQWA 1EH5A 4UE2A 1YNSA 1V7PC 1UKCA 1RQRA 2H00A 2PQ6A 2Z1DA 3NM5A 2FAXA 3M1AA 3PT5A 1T9HA 2H1CA 4EVSA 4DUGA 2H29A 1VRWA 3QF7A 4DR3B 4U6QA 1U90A 4UUNA 1RJWA 4AXBA 4KBGA 3EVFA 5TGTA 2A1TR 5B7GA 3B53X 4A2PA 3DULA 1O5OA 1PJTA 1WXFA 5CM8B 5C5DA 5ALGA 3R3UA 2FMHA 3BQMB 4EH1A 1NTOA 2W9XA 4FGWA 3DBHB 3G9UA 2UUCB 1TD9A 7ABPA 1T35A 1YWGO 3ESBA 4MGKR 4HZGA 1GD1O 1XAHA 5CXXA 8LDHA 3ADDA 3DCIA 2JKZA 1BDIA 2H06A 3B6KA 1Z06A 3RASA 4B4KA 1NUTA 3BUSA 1V35A 2FVYA 1VPTA 3DOUA 1UMCB 3CF0A 3REFA 4N4AA 4PPFA 3Q7SA 1TYBE 4R31A 4XR9A 1MBZA 1P0FA 1K73D 2EWMA 5EPEA 2AMYA 2MHCA 4MICA 1XKQA 2CHFA 3P2EA 1A27A 3SSMA 2ZKIA 4C3VA 3C7AA 1U3VA 2GNAA 5DSZA 3DJYA 4GLFA 3L8MA 1NMZA 4XLLA 1L8LA 4PSUA 4YJHB 5ADUS 4TMVA 2ROQA 1JHVA 1JHPA 1WZUA 4MQ5A 4JDUA 3T9FA 1Q92A 3B52X 2X4IA 3RJ5A 4D81A 1UP7A 4E5YA 3SYKA 4M1OA 1FP6A 3DDYA 4J9VA 1R6UA 5E9WA 3R7WA 3WKDA 1F0YA 3ZPNA 4R2IA 3MYRA 3GLQA 4YP7A 1DBWA 3VMFA 4KEAA 1XYYA 2XF2A 3D4PA 1F1JA 4L3VA 5IW8A 2L42A 1ZC4A 1E2IA 2O3UA 3M5PA 3EIOA 3DVAA 3PS9A 4GP9A 4LYDA 4NONA 4UHHA 4C43A 2NGRA 2NVBA 5ER9A 2HIMA 1Z29A 4S1PA 1J8VA 3GP3A 2VC2B 3TVYA 1QIIA 1RRGA 3GOHA 2CYCA 2ALJA 1ABBA 3BREA 1ZU4A 1NMEA 1ZGCA 2YJGA 3DEHA 1GL6A 3HPQA 3PQ5A 4KV7A 3NKLA 4IDQA 4EI2A 2HK8A 1CUVA 1Z7YA 2WM8A 1UBUS 1IB0A 2EOAA 4A5SA 3FUTA 3O3MB 3OI7A 4CQLB 4RK0A 3VI4B 5LQNA 1ZKDA 3LPDA 4BFUA 1XYGA 2X3FA 2PMKA 2PMFA 4UBMA 2CJXA 1WBDA 2J9XB 3DBLA 1ZI6A 5J35A 3FWKA 1X7XA 1CUBA 1VYTA 2H51A 2J67A 1QOQB 3CLSC 1LV8A 1E3EA 1P7CA 1ZK1A 4V1CI 5DK4A 1U99A 3OFVA 3ZHOA 4FHFA 5K09A 4OLAA 5ARDA 1EVZA 1KI2A 1VE9A 4WJZA 2EU8A 4GX2A 3P2OA 3MJCA 1U2TA 4QBIA 1UADA 2CZQA 4XOUA 3WJ7A 3A3NA 3WMWA 3PNOA 1R16A 2C4TA 4GXQA 5HFJA 3B7PA 4L85A 3ZVRA 4ERNA 2PPVA 4EB8A 9ATCA 4MS3B 4BRUA 5KNDD 2EERA 3OKPA 2E48A 2OORA 3HVJA 4QU8A 1SB8A 1A2BA 2YX1A 2GD2A 1K2WA 3KLPX 3U7RA 3KOMA 4YHHB 5LA6F 5DCUA 5BSTA 3ZDQA 4V2UA 2Q2VA 2XUZA 5KYKA 4NCNA 5EMNA 1SIOA 1VLVA 3CT6A 4DRYA 2MSDB 3GI1A 1DO8A 1KZYC 3HKDA 1AKWA 4J2TA 4X20A 3A1EA 5KWJA 2VZ0A 5K20A 1FXSA 3A4TA 1JYSA 3ONDA 4LHXA 2QQ5A 1YQTA 1GPH1 4I5DA 4P1ZA 5IVIA 1HDZA 1YOVA 4D45A 1IZ9A 1KR5A 1NVVQ 3EF0A 4FGLA 1I4OA 3PE4A 4QUKA 4CUZA 3H2SA 1ZRNA 1WULS 1GUZA 2BF7A 2BP7B 1YL5A 3NLLA 5KQSA 3HCWA 1JP7A 3OKFA 1IG3A 1ND6A 1G21A 2OFOA 1OH5A 2Q4DA 1RQNA 2VN8A 3W8DA 4CFYA 1XRJA 1JHDA 1HQKA 2PD6A 4MPPA 3GYGA 1Q91A 5K8TA 4DM3A 3KCQA 3LRTA 4MKXA 4WT7A 2C4MA 2OZLB 1ZIYA 4OK5A 4RGYA 1BD4A 3OT1B 3TZQA 1YQWA 4B2IA 2D5AA 4RETA 1E2PA 2QY6A 2YMQA 4FIDA 3B12A 1JSRA 3PC8C 3DE5X 4GMFA 2IXTA 2JH3A 1Z5VA 3BKWA 4C78A 2SCUB 4XTRA 4OL9A 1AK1A 4AKEA 3O4HA 3FNQA 2ZBUA 1VKHA 5BQ5A 3R9XA 1WSWA 2NPOA 2BUBA 2GETA 4NABA 1PVOA 3WQZA 2GBLC 2YY5A 3UJ3X 4E3ZA 3I0MA 5KKNB 3QU9A 3BWBA 2G77B 4OAPA 3L1JA 2GFIA 4TN1A 3O74A 4DLVA 1R88A 4DOMA 5JRDS 2HR1A 2IC5A 3L43A 4DCTA 1XELA 1TZ2A 1E69A 2JZCA 1KVRA 4FI3C 4Q9DA 1K8ZB 3ZZ0A 1EFVB 1SKYE 2P62A 1G6OA 2O6HA 2QVYX 3H8SA 4JP5A 4CDGA 3KJGA 4DCVA 2H1RA 1V48A 1JKXA 1LJUA 2GLTA 1I9CA 1NQVA 2XGGA 4OI1A 5KVCA 1S02A 3G2QA 4O25A 1Y6GA 2YHSA 1YR7A 3UKJA 3WGJA 4AKTA 1KWGA 4I9UA 5JSZA 2VUIB 2ZJOA 1PG0A 3BWVA 1VQOB 5AN9A 4QUZA 3W6NA 4IL5A 5KKAA 5FTMA 3SHWA 2ZS7A 2PYDA 3GB9A 3R77A 1QDEA 3N74A 5EIBC 1AQYA 2IF2A 4UUQA 2AE2A 2Y92A 3RVDA 5JARA 5EJAA 4RV5A 3E84A 3RNLA 1H8EA 1R64A 2F43B 3CGWA 3IAM1 4ZVNA 1D5WA 4AVYA 1OX5A 1RYYA 5HF9A 2PUWA 1O7JA 4L6AA 5BMVB 4ZJPA 2QN3A 3DNFA 1HV8A 3CCJB 1SC1A 3L05A 1FYXA 1TT7A 5C0OE 3HP1A 1YJQA 5BVGA 1LFDB 1KJWA 3EW9A 5K0TA 1PFKA 4Y8VA 5K0NA 2J5KA 1KAGA 4Y18A 5G1OA 4C03A 2W6QA 3ZY2A 1Q3HA 4UU8A 3KEFA 2G9VA 1U3CA 1UXHA 2ACWA 1FX0A 3DTNA 1IN8A 1NSFA 3FBTA 4MV6A 2FMTA 2EP5A 4I9GA 4MUGA 2W6IA 1PJ7A 1U4SA 3VR3D 1FP2A 3F78A 2JGDB 3B3FA 1P39A 1NMYA 1E63A 2G08A 2N3ZA 2V55B 3E7PA 2XCQA 4ENVA 2HLDD 5IYPA 3WJ1A 4BGDA 5IJ0A 1GZVA 1RJ9B 4HGPA 5A4MS 3PCXA 3JQBA 1KZ4A 2VPYA 3K72B 4KW7A 1L4HA 1Z83A 3WK8A 2FJPA 4D42A 2H2FA 5IAEA 3UXEA 1AF4A 2XDAA 1XRPA 4WFJA 4IDNA 5CYPA 2GYUA 1I2DA 3GUUA 2V7BA 3QKRA 5LFAA 3O7MA 1XPJA 2LUOA 1D4ZA 4EGJA 2B3DA 3GCZA 4UPVA 1C1XB 1G8SA 4W5JA 1M1NA 1MNQA 1KZGB 3F5MA 3INTA 2COUA 4NJEA 3WI7A 3LU1A 1X9HA 2MU1A 4CI9A 3NBKA 4UAUA 1KGSA 4R71A 1NT4A 2CUKA 4QNMA 2N1BA 2P41A 3KKEA 1YC5A 4WAUA 4X0EA 1K6XA 3BGSA 1O87A 2FUNB 1MJGM 3VHRA 2WPDD 4UMDA 1JEDA 3EIHA 3GUYA 4IS3A 3KSDO 1ZH8A 1N34B 5C8YF 4LRYA 5ALFA 5CLLA 3D6NB 4H1TA 3ICOA 3WIDA 4HC4A 3QQ5A 1P44A 1NP3A 5E9AA 1A50B 2IDJA 2VP0A 3TD6A 5I9LA 3GFOA 5F7OA 2QX7A 3MPOA 4R84A 5LJLA 5LU8A 2GZSA 3QLJA 1J2EA 1JQKA 2JJMA 3RVPA 3HB7A 3TEJA 4KQ9A 4AJ1A 4CW7A 2PLFA 4EB6B 2CXHA 1D4OA 1RDFA 4EY7A 1YJCA 3O4IA 4O1MA 1GAXA 3F5QA 3K35A 3PUVA 4QPPA 1D2HA 3FWYA 3KZOA 4LWQA 2P8JA 3ZI4A 4O2AB 4LN1A 3CLUD 1MABB 4ZJZA 4CLRA 1Q1NA 3EWAA 3R6TA 4RGBA 3EVGA 2DU8A 1PF7E 1VMDA 2CVQA 4EJSA 2C59A 1LI5A 2FZGA 3JQDA 3K5HA 3MUFA 4P3NA 2VRBA 1BXRA 4F2GA 1PK7A 3NWPA 4AXXA 5K8UA 3AP3A 4N01A 2JNWA 2ZJ7A 4RANA 4BV2A 4LYJA 3QVJA 5TB5A 4YMGA 1M8KA 3WNDA 2EZUA 1Y4ZA 1W75A 2J7PD 4Y98A 5D1HA 4EI7A 1AH2A 1A95A 4BNJA 3NXSA 1YONA 2ZZKA 2XXBA 4C9BA 7YASA 4D9GA 4M86A 4CHTA 4KLNA 3A3YA 4ICIA 2YWJA 2OXEA 2XD4A 3PEVA 4UEWA 3ZWKA 4DNTB 3A7DA 5ALXA 2OPBA 4R69A 4AMVA 2CJWA 3IT0A 2C88A 4MWDA 4XYMA 1M6EX 3ZY4A 5JAOA 1W2BB 4E70A 5L45A 2VSQA 3FFXA 2REQB 4DV6B 1QIJA 4G67A 1Y7LA 3TUJC 3RVMA 2E4YA 5DBEX 4E13A 4DUGD 5JXHA 1H2EA 2VK1A 1V4NA 3ES9A 3MILA 4GX5A 2O8BB 1NW4A 1HZEA 2B0JA 2B34A 2IXDA 2XVAA 5FUWA 1JIKA 3TEFA 5JRJA 3D1JA 4D02A 5FWYA 5IKXA 4JI8B 4GSLA 1G66A 3N5CA 3O1HB 3OOHA 4IILA 4RAOA 1LDYA 5EQFA 4D99A 4EGSA 4H08A 2QUIA 5I8ZA 3OPOA 4BO4A 3DYVA 3NIBA 4QD3A 5ECWA 3F8SA 4GZ5A 3JQGA 1K28D 1ZFNA 3PJFA 3WJ2A 3VU9B 1ESDA 5LQAA 4DLZA 2IEGA 5A02A 2RJOA 4S12A 5H3HA 4P3KA 1FNCA 1AS0A 1D2RA 4BUCA 3B20A 2PO7A 4YRFA 4CNBA 1ORTA 4PTYA 3U3KA 1FYFA 1ZIPA 3BG5A 4L50A 5ALOA 1GQOA 3SBDA 3R3JA 4CTKA 2BHRA 1GPWB 2VI5A 3BNWA 3NR2A 4Q7JB 3OHPA 4RMGA 4XVRA 5HRCA 3ESCA 4M22A 5M2QA 3WAGA 4CMHA 2IIPA 1QVZA 4RGVA 4HGZA 4F21A 3CCSB 1CRZA 3SFVA 2B4QA 2PL9A 3GT4A 3OZWA 2IQ5A 1WPCA 4DLRA 1UBMS 3M4JA 2O8FA 3WWCA 4BAZA 1BO6A 3O47A 2JLUA 1J9ZA 1QRAA 4J8PA 2IU0A 1SXJA 2BI4A 5NLLA 3UOAB 5JJIA 1QQ7A 3E4DA 3ZX4A 1ZA1A 2HMAA 4Z53A 3H5RA 1ONNA 1PJ2A 3FM9A 3PL5A 2QM7A 4BVHA 4H27A 4AW9A 3TB4A 1ZCBA 2WTBA 2FZVA 3O8DA 2F1JA 2V98A 5HA5A 4JI6B 4CJXA 1F8FA 3GGJA 3LT5A 4D9MA 4B80A 1DX4A 2REXB 4H16A 4Q3LA 6PFKA 4ZHQA 1FYDA 2WFLA 5C4IA 4LF4B 3U6KA 3KQUA 1GSIA 1I5EA 4QAJA 3I6ZA 3HHEA 1U28C 5B1HA 1UC5B 1QLJA 1YB5A 4HZIA 3PWTA 4B6GA 1UJ2A 3FOZA 1NAHA 3AYXB 4IDCA 2DLDA 3GVIA 3O8RA 4QTXA 2JHGA 1BCSA 3O4RA 5JEDA 2CLLB 2VXOA 1DUVG 1XJWA 2EKQA 2ZRNA 3K70D 2A1IA 3IP5A 4Z0PA 1BWPA 3NVDA 3CMAB 1XQ1A 4JBXA 2APJA 3L1UA 3L7LA 4ZI7B 3UBTA 1V1RB 1DB3A 1XRLA 2QUZA 4W1QA 2XHEA 1Z4QA 3NAZA 2WF7A 3BL5A 2HHLA 2PLRA 3QW2A 2WE7A 1CB0A 3BIOA 4S1NA 5J2UB 3ZUPA 3BMOB 1JKJA 1Z75A 3KZMA 3JU3A 2ZQ5A 1NQOA 3N2YA 3OQJA 4YPOA 4F2HA 2ZSJA 3NORA 5EKXA 4L9WA 2OGSA 4BZXA 2H54A 2CEAA 3PT9A 3BH0A 2O8VA 1ACJA 2XVZA 5GOZA 4I4IA 2UZ3A 4GPIB 2IPNA 3OMXA 4IZOA 5JQGA 3KEGA 4TS4A 2YWFA 5DB4A 2GJ4A 3N2EA 4A27A 3FUXA 3E9MA 1CEXA 4GW3A 4DMHA 5TX7A 3RBZA 3TEMA 3DAPA 4YP5A 1P2GA 2ZL6A 2Q3FA 2GPWA 1IOZA 1KHHA 2WSBA 3H1TA 1J09A 1BS1A 3LCUA 4JODA 3A8IA 1DAMA 1NULA 3FF1A 3KQHA 2OAP1 1L5QA 1PSWA 1XVVA 1V41E 2FQQA 3AILA 4B8ZA 3SQNA 2XIJA 4DPKA 3UCFA 5JSHA 4N9WA 4YCCA 5JPIA 1MOZA 1PVVA 1FDTA 3D4LA 4WCVA 1Y3IA 1IIRA 3DE4X 3EVEA 1A4IA 1EB8A 3HBMA 3O26A 5CM9C 1PG5A 2NU6B 3SR3A 3W5DA 2NU7B 3ILSA 4F12A 1RM0A 1YQ9A 3VU0A 5EHNA 1YB4A 5LWQA 3ROQA 3FOEC 3IEPA 1YCHA 3Q6QA 4MKGA 4OFWA 2IUUA 1T2EA 2IV3A 3HO8A 2X5OA 2GD0A 3QVVA 3GD7A 1EXWA 2EP8A 2QMYA 2R7LA 4MP6A 5EJGA 3SG0A 4BJ1A 2H1FA 3KYCB 5IFKA 1X7ZA 1P5FA 4UAJA 1F6DA 1TU0A 2FMIA 1UR5A 3UQZA 2IZ5A 2WM2A 4LA4A 4IRMA 4Y6LA 3TLBA 4JI3B 5JAZA 5FUXA 2DX7A 1XL1A 3WJAA 3P4XA 3OQVA 3I2IA 4PXSA 2QTRA 1GR1A 4INPA 2VP5A 1VCIA 4JJZA 3RHZA 3C45A 5TVGA 3SE7A 4F1JA 4CKWB 2F4VB 2QHXA 3AETA 3SOZA 3TCKA 4QG3A 4QM7A 2Y1KA 3AERA 4JKOA 2GKGA 3RHTA 3SD7A 3V46A 2QM3A 2PV0A 3LK7A 5KYUA 3KOUA 3HA2A 4WXMA 2MSWA 3WP1B 1PLLA 2J3DA 3AOEA 3DDWA 4C1NA 5B4VA 3U7HB 3A26A 3HDQA 4QXOA 5EWLA 3EVCA 4FM9A 1Y7PA 2G70A 1DKPA 4F38A 4V03A 1HE3A 4PLPA 1Z22A 1T9AA 1YAJA 5J4LA 3W9YA 3Q11A 3DLIA 4DLNA 1CQIA 1SZDA 1T1RA 1G5HA 3OX2A 3WYFA 2QR2A 1C9MA 2QBYB 4C14A 3EMKA 2LIVA 1ODSA 4JMPA 1IN6A 3RC9A 1TUBA 2G9RA 3II6X 4HDNA 1W76A 2OV2A 3FPSA 5CH3A 3O90A 1VL1A 2VFAA 3GPCA 3KKQA 4HGQA 4BATA 2P0YA 2H48A 2PK3A 3ZH9B 4U9UA 4E1AA 4Q1BA 1UEXC 1RTKA 3GVXA 3RVBA 5C37A 1RU3A 1W2GA 3I83A 1UL1X 5EQJB 2XCSB 3KBOA 1JX6A 4KL8S 5JCJA 2ONJA 4HFRA 3R5XA 1RYMA 1G18A 3KB1A 1EWRA 4Q1EA 1EM6A 4E15A 2BGRA 3EGOA 1Z4MA 4QVJA 1GNRA 4WA7A 2H0QA 2FWAA 4FIZA 4LOIA 4EMTA 5LZ9A 1KK3A 3FPAA 4O2BB 5DSXA 5C8DA 2RDMA 2CDBA 1ZLYA 6AT1A 3A35A 3SM3A 3OLXA 5LB2A 5HILA 2PKQP 1H8ED 1HORA 1SVUA 3KJFA 1ACMA 1KI3A 1RAGA 1RHRA 3IHLA 4FB5A 5JSFA 1L1EA 2FKAA 3CB2A 3ZHRA 3EJ6A 1UWCA 2HCTA 3L9XA 4DXAA 2Y9PB 3QUTA 3TRKA 4EKDA 2DSNA 4K9KA 1E5LA 4UCWA 4B85A 1M8GA 3CNOA 3WWDA 2WWVD 2WTMA 3IB3A 4MVJM 1ULHA 2ZSDA 2ORED 1Y5IA 1KQFA 3KOOA 4ML3A 4RORA 4CM4B 1P75A 1IXKA 1GY8A 3CEAA 4ZOLF 5F3DA 5JSYA 3I2KA 4ZMRA 2FR8C 4CLOB 1PR9A 4V0LA 3DHWC 5K8CA 3OZTA 4BLQA 3BVPA 2W6ID 1VE1A 4TZKA 3U3RA 2HLHA 1N05A 1KNQA 4RV4A 1S3GA 2XB9A 3FPFA 3U1VA 4DGSA 1FMFA 1JHYA 4CL3A 5B3KA 1IBKB 1NY5A 1L5RA 4UZUA 2IPAB 1RHMA 4KQGA 3F90A 1NX9A 2ZUSA 3U7QA 4CGYA 2Z3VA 1OBOA 2RSLA 3UTDA 3HZHA 4EMSA 2V54A 3IVMA 4JS0A 3IIKA 3GLSA 1XJCA 10MHA 3BCRA 1VSUA 5SYNA 1JPNA 3C48A 2VEDA 1ZIOA 3OPYA 1OF1A 2ZZMA 4DSZA 5K4GA 5G02A 1HE1C 1Q0ZA 3H1EA 2ODBA 1QMPA 2GM4A 5KWSA 3ZWAA 2AXPA 4BZQA 1Q7CA 2Q3LA 5LOVA 1SK8A 2H7XA 4K0RA 4TROA 2ZBRA 5L53A 1P1IA 4WESB 3LQ1A 2OCIA 1I3LA 5JYBA 1UJBA 4MQEB 4YC7A 3D6HA 3EYAA 4CTJA 1R4NA 5CA0B 3U80A 3K2BA 3LXUX 2YN2A 1O58A 3BQNB 2YUTA 4JR2A 4OJTA 3PGA1 2PQ2A 4F4UA 5AKYA 1T26A 2QT0A 2ZUEA 3HDTA 2ZJAA 1QK4A 4L0DA 4NBWA 5ICFA 4CUJA 5GY7A 2PKQO 2WAXA 4ARIA 1H4VB 1J42A 2R1TB 3ENZA 3CRVA 5ICSA 4KVGA 5MF6A 3DW3X 3GVPA 3HU3A 2ISCA 2XTZA 3S81A 1L4KA 1O77A 3RJTA 4YRAA 2GN9A 3IAS1 4GBED 1JTEA 1GITA 1ZBDA 1IYZA 3GJZA 3RWBA 1SG9A 4E6PA 3WFIA 1MJFA 2QEQA 3K8YA 4KQMA 5TRTA 4Q7QA 1OXVA 1DS6A 2HQ1A 3BIFA 3E2IA 3K1TA 5LQRA 4OLJA 1HUQA 1P3Y1 1UZLA 4HLQB 1JS1X 2HA3A 2WKPA 3O3OB 5FV7A 2EWVA 5IH7A 4GVLA 1TLLA 4N8EA 5DPMA 1E1RA 2C83A 2H1SA 3OEWA 2AA3A 2BTQB 4OXYA 1XEWY 1P33A 5B6PA 2A0YA 3EMDA 1ZY2A 1K75A 3CCEB 3K31A 1C7FA 1QTNA 3IOMA 4DDUA 1JDPA 1TCCA 2W11A 3EF1A 2V59A 3MCZA 4DJJA 1VQ6B 2QTGA 2JEYA 1Z0DA 2C7GA 2BMAA 2XA9A 2JCYA 5TMEA 2P2GA 5JC1A 4DCGA 1ZD5A 4MYTA 4C5BA 1R1DA 3WGLA 2ET6A 3D31A 1U0RA 1YQGA 3BM5A 3FWNA 3L6BA 3T3HA 2B7BA 3C1UA 3K0KA 3QFHA 4NCAA 3SZGA 5FFNA 1QHHB 3GC6A 3OUZA 3K9CA 1G3IA 2ZI4A 1BWRA 1ESCA 3LHKA 4IGEA 1FB5A 2FZ4A 4UOZA 3LQ2A 4QSHA 5EZ6B 1VKOA 4WXPA 1PGQA 3T9EA 1BGXT 4TV9B 3HI4A 1ULTA 1KRWA 4FDTA 2B82A 4BTLA 1Y1LA 1U5BA 4F91B 4KQKA 1UBJS 2WF8A 3CX6A 5FFFA 1DHRA 1URPA 2KBEA 5A5VA 1ULAA 1X2BA 1N2EA 1PSZA 1ZM9A 4KIUA 3OPMA 4RZXA 1VCNA 3WIVA 4I50F 1FZQA 2WJ6A 1XTTA 4HK4A 2HPAA 5HX7A 5FKJA 1M1YE 1UD8A 3P2KA 1BOFA 2V5AA 3CF4G 3ONVA 3FCEA 4A6DA 4EKEA 1HNZB 4HRYA 4I3HA 3WDSA 1RC0A 4IFBA 5IKPA 1WBJB 2X53S 4KLAA 2CC2A 1T0PA 1XZIA 1GLGA 2Q1UA 4G0PA 3ZHCA 4B75A 1TU4A 1N4DA 4LIPD 1EXMA 4LMAA 3NC4A 5JSUA 1W34A 4X7BA 3CRRA 1WUHS 3PC8A 4JBGA 1HK7A 2O5VA 4G4GA 4WXRA 3TSAA 2WU8A 5GGYA 1W8DA 3LL7A 3GT3A 1NR7A 5ITZA 4E3WA 1KOJA 4XWTA 3DBIA 5JSQA 1PUJA 5KNCA 1XQ6A 2VPXA 2IUSA 1UKZA 4I4TB 4MUJA 5L3QB 1SVNA 3B3GA 4FLMA 5K6TA 2GBLA 2PBFA 1YI2B 3IRVA 3EF3A 5JS2A 5GV8A 2P9FA 3EK2A 2WVAA 4RKEA 1MA0A 4OGGA 1M2EA 3ZIAA 1SXJD 2J33A 4BAUA 4BFZA 1II0A 3DVSX 3MTAA 5I7EA 5KEIA 5DTIA 3HVIA 4TGLA 1LS6A 2RBEA 1RACA 1ZK4A 2QVCA 1FFHA 1XZNA 2MT9A 3HUDA 4OPSA 2PMEA 5LSAA 5IDVA 2O54A 4ARBA 4F3KA 2C97A 1KOFA 3DYIA 1FSFA 2HBQA 3LBHA 4U9HS 4D80A 3TTUA 2OBMA 1AZTA 1NKSA 3VU3A 1CZUA 2LKDA 1XXLA 1OZ0A 1QHSA 3RSHA 2G82A 1Q7TA 2NTYC 2Q1XA 2UZAA 3S1AA 1N6HA 3DT9A 3TPFA 4CV3A 4CTOA 4LQLA 1V4VA 4C30A 4JOSA 4LC0A 2DBYA 5E7IA 2OQVA 4WLVA 5AUQA 3A8KA 2JH9A 2QZZA 1C0KA 4KO2S 3P0EA 4UHCA 3S5JA 3E3NA 4TTTS 2YMMA 4QVIA 4FW8A 2OM6A 1GNTA 4G0WA 5FPQA 1LDBA 2NYAA 4L5BA 4NESA 5CCXA 4JOCA 3U48A 5JD3A 3BWMA 3UHFA 2E4AA 1NIJA 2IS4A 2WUFA 4M1EA 5I7UA 2IDKA 1Z7EA 2ERYA 4WMLA 1JQBA 5CEEA 4FOSA 2XYQA 1Z74A 1BQ3A 1JPUA 1MW9X 5DXAA 4G1BA 3SJZA 4QBHA 4DABA 1R6BX 2GTPA 5TPWA 3ZXXA 2VCEA 1KWKA 3ZZUA 2D4HA 2R751 4GKBA 3VYTB 4B79A 3L1HA 4RSRA 1RXYA 1ZJ4A 3V42A 5CB4B 1J0AA 1RP7A 4RIHA 2CKMA 2A8YA 1JH8A 2GCNA 4HCJA 2RGGA 1I80A 3U3DA 1EDEA 5T4FA 3FUWA 3GEEA 3A6ZA 3CX3A 4U7WA 2AYXA 3A9WA 4W6QA 4MH0R 4ZK2A 4K6HA 2OAGA 1XQXA 2D0PB 1DKRA 5D6NA 1WP9A 3U4AA 4EY4A 1VQKB 4GYJA 4W7IA 1UJCA 3R4VA 1AGNA 1U3DA 4N8SA 4LAFA 4C0XA 3DH0A 1PFQA 4PNEA 1U2ZA 1XXHE 2A4KA 1H2ZA 1P5RA 2AMLA 2VUHB 3GFTA 5AM1A 4ZCPA 1KI8A 3CXRA 2QX8A 2Q8PA 1CUFA 3ILVA 4PAGA 1Y48E 4ZC1A 4UNRA 3TFWA 2P9QA 1YI8A 2IY9A 4RZIA 3DPIA 4LNHA 4KYTA 1C5KA 4DR7B 4X05A 4WUVA 3T4EA 4AZSA 2A59A 3PQ4A 3RG8A 2DFDA 5DK6A 4DQXA 1MB9A 3GNQA 3W5CA 1Q0QA 3R3ZA 1FYWA 1DQNA 1CYDA 5A6SB 2OBFA 1PKVA 3U5TA 1E77A 3V1KA 2GYYA 3BWCA 1U0TA 2UAGA 1JAYA 3D4IA 4HUQA 4X7PA 5E6RA 1YACA 2OKGA 5I7VA 3ROGA 4N3AA 3BRQA 1TTQB 3TTYA 4P6VF 4AN4A 3FLBA 1JGTA 1E3JA 3UHPA 2XW6A 1KXZA 1N3BA 3GFQA 3VSDA 1DWPA 4HO1X 4RMNA 5LKRA 2QA5A 5BYKA 3C2QA 4G5QA 4P54A 3TFOA 1KFBB 3AJ9A 1KHTA 1T5IA 3WYNA 4QSMA 1E0DA 2R25B 4OXRA 4UASA 1IULA 2D2XA 2GDZA 3OMLA 1Z0JA 3SSAA 1UANA 4DEVA 1AQUA 2Z4SA 5C3MA 3ONEA 5AT1A 1CFZA 4KR0A 3G82C 4GOND 4V0KA 4C22A 2JGMA 1G9XA 4CCYA 3RS3A 1XTBA 3W6ZA 3FMVA 2AMVA 2QTAA 4FJ1A 1I5RA 4MWOA 3DMHA 5AJTA 1PGPA 2PT6A 1UDBA 2WG1A 2ONKA 1YS7A 4FGSA 5DM60 5K7SA 2OGZA 5I7SA 2X9QA 2QW1A 5AM3A 3DE1X 1M0WA 1UKEA 3BCDA 5DM70 1YGPA 1FFXA 1QVFB 2X4GA 4TN5A 1WIWA 4C6RA 4EARA 5JCJD 4RHXA 3L40A 1QYWA 4D79A 2C7RA 2JATA 1GG5A 1L1FA 4AMBA 4OLBA 4UZSA 1UDRA 2HSZA 4HLDA 4IV8A 3CP2A 1KC8D 3GFSA 3K2IA 4GE3A 5D5PA 1TE2A 3FE2A 4PCVA 1WTCA 1G55A 1HEYA 5ADVA 1HQCA 3ND7A 1JILA 4NIMA 1U6JA 4HX9A 5JDCC 3E9ZA 3L4BC 1OW3B 2JJQA 4HNAB 4S24A 4UVGA 1O6CA 1PR5A 5F5NA 3TZ6A 5IT4A 1JWLA 4XYLA 3T3MB 3CCQB 1OB2A 5HKBA 4LE0A 2ZUCA 4HRAA 3UV7A 3LW8A 3V8MA 1NF8A 4OH7A 4OYLA 4X7MA 3IL2A 3MD0A 5IBCA 4WKPA 2QQ0A 2JA1A 1KA9H 2Q4RA 2VOJA 3UB3A 3UW1A 3KSRA 5AD1A 3ZUGA 4AJNA 5ALTA 2F1IA 3A05A 4LSZA 4TMYA 5I7WA 2P2YA 4XEUA 1GPKA 3ZHSA 3HP7A 1OFHA 2UYGA 3KVVA 4U5XA 2WV9A 3OZIA 3WL4A 5LQMA 5IASA 3EPPA 2QN8A 4CM6A 2WB4A 4YCBA 1NWCA 2DUWA 1LPMA 4PGAA 2W2VA 4LYYA 3OJWA 2E4ZA 1BW9B 1ZCAA 2CGEA 2NZYA 2A94A 2JIRA 2P1DA 2B4KA 5A4FS 1OLOA 4RENA 3WA7A 1KZ6A 3NW9A 5ED0A 4AO8A 3IELA 5CFRA 1GM5A 1XWWA 4G65A 4NU8X 1Q1BA 1QZXA 4RMHA 4XDYA 1I13A 1GAQA 1USVA 4NULA 1HC7A 3MT0A 3UAYA 1YB2A 4JBNA 2QD1A 1EUYA 1UDCA 2YJ5A 4WCFB 5C80A 1FVFA 2C8JA 4HXFB 5FO1A 3W34A 4HG2A 1YQXA 4N12A 1SKYB 4Y9UA 1IXZA 5IBRA 3L7MA 2DVMA 4TYQA 3GJ8A 2Q3MA 1QF7A 1Z0SA 5FPPA 5TQ0A 1M66A 1RS0A 2II6A 2Z2XA 2QTMA 4P3XA 1WWKA 1V3VA 2JAWA 2JIDA 2CNWA 2E4WA 3DBRB 2W2XA 4RFSA 5DCLA 2ZJ4A 1NATA 3L84A 4DY4A 1Z33A 4YAJA 1J5XA 3CCVB 3FZGA 4H3KB 1YBFA 3D3EA 4NS4A 4BX0A 4COKA 3N8DA 1PBTA 3PV0A 1NLUA 5F77A 1M3SA 2R85A 4D0GA 2PGNA 3G2JA 3V1LA 2DHEA 2PX5A 3C3EA 3KYJB 3ZE1B 4NKRA 1U28A 1X2EA 3PGXA 3I0NA 4DC9A 1UBLS 1RLJA 1QX4A 1DRWA 2JIPA 2VHJA 2J6HA 5CVEA 3CUVA 5T67A 5E95A 1LPAB 2CLIB 1TMGE 2EL7A 4MA4A 4Y3UA 4X7DA 4A2QA 4KITB 5KU1A 1ZLXA 1VFNA 1WCWA 3DEJA 2J0UA 5TQVA 5HOEA 4DV2B 3AF3A 3UPUA 1NUAA 2D0OB 4D92A 3HP4A 4RA9A 2ZYUX 3BXFA 1PUIA 2ZR7A 5HXAA 2UZ4A 2VNHA 4XKWA 3THYB 1W6RA 3KBBA 4IVQA 4BNYA 1PRYA 1ORWA 1RXVA 3CLSD 4TT8A 5JJKA 1EFTA 1JDBB 2YXEA 1E1RD 1NTRA 3F73A 1T8UA 4QPZA 4HUJA 4HNTA 3LQFA 1GNQA 4J75A 5FBWB 4BWVA 5ENZA 3VHXA 2F1MA 4MJ7A 1Z6XA 1ZVMA 4R1MA 3LLUA 4KFRA 1AA9A 4OXIA 1BS2A 1NUQA 5I47A 1G8KA 3HJFA 1LFAA 4MV7A 2O2CA 4DLPA 2EFGA 3CLTC 2D0DA 3CZMA 4KN9S 4M21A 5JUWA 1MDFA 2GHIA 2ZRJA 4KJZA 2HQOA 4E0FA 2DAPA 5JMPA 4R1UA 3OJFA 2GCGA 4FZJA 1GTMA 1C7ZA 1B6TA 3PUIA 5EUQB 1FE8A 3QUBA 4AF6A 1VL5A 4LQDA 4FR2A 3EA5A 4Q3OA 1NOIA 4Y7DA 3NHBA 4X8HA 3BZWA 4XKJA 5CTAA 1G0OA 1JKFA 4DDTA 1XT6A 3BRCA 4P0QB 4YDRA 3WHKA 2KLBA 3L2OB 4KC0A 5CW2A 2DY0A 4U0JA 2LCIA 2WKWA 2PJZA 4DPLA 4WJLA 3KB2A 4OX9B 1CJCA 4BIMA 1G2OA 5HM8A 4C3ZA 2NU8B 1VGRA 2VZ9A 2VT6A 2W2MA 5IKEA 1N2JA 3P9KA 4J43A 5LN1A 1NFRA 1UOEA 1Y9AA 2QD5A 1YVDA 1YF3A 5LXTF 4L6CA 1XNJA 1OLXB 4X7EA 1GZHB 1KYIA 1IDOA 1LRKA 1WRBA 1T5LA 1X15A 1ZC3A 2FNAA 2Y6UA 3DDHA 4UTXA 5HKAA 3KKKA 4TQGA 3LWDA 5JWOA 3DBOB 1MJ5A 2CL6X 3G8DA 3ETHA 2AN1A 5IKMA 1QVRA 4GSYA 1YT5A 2F00A 2INGX 4BX9A 3QEMA 1SD1A 2C8VA 2WQ7A 3ZU3A 4JBIA 5KVSA 4MV3A 2JVJA 1S96A 3NHPA 1KIFA 2HV9A 3FDIA 1U7XA 1F4VA 1L6RA 2CXXA 2JBAA 3DWIA 3QV1A 4WSOA 4BS9A 3ZLUA 2X0JA 4G3XA 4RO0A 2C4NA 3WK4A 5CT4A 4LDZA 3T1QA 1X8KA 1D04A 3SF8A 5B3LA 3T5PA 4RXTA 3L79A 5EJ7A 4K9DA 5KNCD 3THWA 1QFZA 2AMFA 5ALWA 1P9OA 1UXGA 4QQRA 5BR7A 2J5QA 3C3PA 4GI3A 3IQWA 2I87A 4ED9A 3UMCA 2WRZA 5JZSA 2FN7A 4B71A 4TXJA 4DB2A 1EE9A 4B2YA 3IP8A 5E0OA 2R62A 2WIKA 1PYOA 3JR3A 3NQ41 2MYTA 3FWHA 3X1JA 4DT1A 5ARBA 2NUPA 3IKLA 3REOA 1E1DA 2X1LA 1C4OA 1R0RE 1SG6A 1SVKA 3A14A 1DPFA 2OC4A 4A5OA 1GCOA 3VR1A 1WR8A 3DEIA 4J6EA 4ER6A 4AKSA 4OVKA 3BE6A 5K1ZA 5A3JA 4Q4AB 1V9LA 2GASA 1LNZA 1MXFA 2ZJ2A 2JHAA 4RS3A 1AO3A 5F1OA 2GZHA 4UXJA 1H85A 1Z28A 3BGWA 3EB9A 2J59A 3EOAI 1CBUA 1WZEA 2I6SA 1V8OA 3E9EA 5AKLA 1A9RA 3AVWA 4IIUA 5IYZB 4LZZA 1EAMA 1WE2A 4DCSA 2XR1A 3QY9A 3ZGXA 1KVUA 4MB0A 3AUUA 2HWUA 3CW9A 1HTBA 2N75A 1OE0A 1EJ0A 2J4DA 2H5IA 3QBEA 3D8SA 5HQ3A 1VQPB 3WAKA 1KQGA 3MQFA 5BSYA 4RVUA 2VDWA 3FTNA 4MYUA 3OQPA 7REQA 5BUSA 4GAEA 1IOVA 4L22A 2CMGA 4IIJA 2JFPA 4S1VA 3W0LB 1XSEA 1CZKA 2OYCA 1R12A 2YFYA 2FR8A 3EIXA 3T0GA 1FU4A 4Q3CA 1RCFA 1Z4KA 4X24A 3R44A 5J1TB 4BNFA 3TI7A 1JHQA 2MSEB 1XTVA 1FFSA 4PLGA 4CR6A 4XUGB 4F8YA 3GZNB 3M2TA 4HSGA 3K1AA 1IEVA 5H1YA 1L4LA 2JGEA 1YRBA 4ENWA 4YLEA 2CN1A 2D1SA 1V11B 2QQGA 3RB8A 4ETMA 4L57A 3NGMA 3G2HA 1Q1EA 1E98A 2XLCA 3ONWA 1GPAA 4FOTA 5JFGA 3RUDA 4WZ6A 4DV5B 3W8NA 1W4RA 3NT5A 4XTCS 2FSFA 2DCMA 5HFNA 1WMFA 2ADMA 4KMMA 1DFHA 3GPLA 3I1JA 4BGIA 2ZYRA 2X7XA 2AFIE 1J2TA 5IYNA 1NXVA 2RJNA 5ELXA 3IYLW 2IGBA 2VDLB 3JYLA 2ECFA 1OXTA 2DGDA 1BVYF 2W4QA 5A05A 3Q6NA 3W5UA 4L73A 3VR4A 1JU4A 2GPTA 4G81A 4OQYA 4RZ2A 1UZNA 4L1KA 4YMTA 3GNTA 3AI1A 3W5IA 5D5HA 5HP4A 3AUXA 2H08A 3L0PA 3GY0A 2B7LA 4OD0A 5IXSA 3ZVKA 2B4TO 2NNLD 2WIDA 3UNXA 1R37A 4QRIA 5LYJB 1K89A 4RWZA 5CB6A 1GO2A 1AG9A 3W2HA 2R8ZA 1WAMA 3ZHVA 1JVSA 4MW0A 4XX0A 1ODJA 1ZI8A 2IZ0A 1EJ6A 2PZAA 1RWNA 2YIMA 3EVNA 2A9VA 4FR5A 3L93A 4ENPA 5C5EA 2H3HA 4GZLA 3UK1A 5J43A 4L7VA 3LZCA 4JBHA 5HGXA 2R65A 3NHFA 3ORQA 4O5AA 4QJIA 3NWEA 3RE1A 3FUUA 2R96A 1NP6A 1ICEA 3IVRA 4QUDA 4P2NA 4ID3A 4QT4A 2D1FA 4MV9A 2HU7A 1E2JA 1KBOA 3BD9A 3SHVA 3TIFA 1COZA 3QX3A 4ZAGA 2ACEA 3WKEA 4P7BA 3NC0C 2UUOA 3RIGA 2ZRFA 1QYDA 4KQ2A 4DHEA 3TAHA 2OP1A 3PNYA 4RTMA 4I3GA 1Z16A 3OAAA 5CVCA 3DE0X 5JWHA 1CB7A 5DTRA 1OUMA 3E8MA 3F3KA 4X5OA 4CLHA 1IZ7A 3WLNA 1UM9A 4FQ7A 2BEUB 5K99A 1HDIA 1I6MA 4A1OA 4LV5B 1UBCA 2XQGA 1QWSA 2AF4C 4XIYA 1E4EA 1R4MB 1VE6A 1WOYA 2PU7A 2GEDA 1HLDA 4BFCA 3QBDA 1SR8A 4JQCA 2W00A 4X1YB 5F21A 3UMRA 1DCFA 4MVJH 4IV5A 3OP4A 3LZDA 1IIBA 3ADKA 2PDAA 1E58A 4PAAA 2WUVA 1E1NA 1FFBA 4NXMB 4FN5A 4G6IA 1Z4OA 2WWWA 4PXYA 5DISB 3AH8A 4IDFA 1DRKA 2WZQA 1YS2X 3PEWA 4JITA 1POXA 1ISGA 2JJ8A 2VBFA 3IFSA 4RZQA 2ZB7A 4FMCF 3I04A 1QNLA 2RHMA 3IS3A 1NMSA 3UN1A 3HGTA 3FYUC 3M82A 4UBOA 2VHUA 1P4GA 3C3XA 4CTNA 3NG1A 2PS1A 5BSXA 2BSAA 2ZTSA 1YIAA 3W1EA 2PSEA 4KREA 5CFNA 2BHNA 3QMWA 2W2OA 4H3HB 4LRWA 5J1SB 2GK6A 4A26A 1CDZA 3QPAA 3ND8A 3R5HA 3SS7X 4I2NA 5BQOA 2O07A 2R5NA 2VSFA 2B7CA 1P1CA 1P0CA 1QZTA 1XZDA 1QHEA 2ERXA 2KI5A 1ORDA 3RC7A 1T6NA 4BVJA 3ORFA 2B37A 2MWMA 4PCAA 2MOKA 5FTWA 2OA0A 2ODWA 2Q3JA 2GCPA 1QBKC 4AMUA 4H59A 4F8JA 2RHWA 4G5RA 1WLSA 5ADHA 2GI4A 3G13A 5JS6A 2ZG6A 3RVRA 4OP7A 1VJSA 3WNBA 5AM0A 1QH8B 3B85A 1F2UB 1FC0A 3FVQA 2XNJA 4FEEA 4I55B 5B7PA 2WWHA 3PQ2A 1JIVA 3KTAB 2B5VA 5HBRA 3R7BA 4EW1A 1P2FA 3T9DA 5EJ2A 1K97A 2ACVA 2M32A 2QDKA 4K9PA 4P8RA 4RVGA 1EXVA 4PO9A 2FH5B 2Q9CA 1TA0A 2BT4A 4AY3A 2G63A 2HQBA 3MERA 2AOUB 2CNWD 1WCIA 4CMGA 4UUAA 4TKUA 4DDWA 5DOZA 4MR9A 4WZAA 1EGVB 2X2EA 2C1EA 4MRVA 4OU5A 3OPYI 5P8WA 3EGCA 4J7UA 4UKDA 2OV4A 1VMKA 1M2FA 2HO5A 4RDIA 1M2JA 4Y1RB 4YCNA 4YGYA 5D3MB 1JE1A 3WFJA 4JI2B 1W4BA 1YIJB 1H2BA 4HDQB 2X8AA 3R3VA 1KEWA 1NBEA 2OG2A 1YBMA 2IIVA 2HU5A 2Q2NA 2ZI9A 3C1AA 3OPNA 4YTEA 4Z51A 4ZICA 2XNCA 1V0FA 1B1AA 3DR3A 3ASUA 3AVOA 1L5FA 1WB4A 3DFMA 3F2IA 2Z2ZA 4ZTBA 1N9ZA 1SCAA 4MLPA 4DAOA 2FWRA 1D03A 4CF6A 3KL4A 3DUWA 3G05A 3KT0A 4Z7OB 3BS4A 5TQ2B 5AW8A 5JO0A 3PA2A 2AN4A 3WSTA 2ZVPX 2QTBA 4L3OA 2CXSA 3TZLA 4AYTA 3PFIA 1A9PA 5BMVF 3OF2A 3PUYA 3HXLA 3LDHA 3QXXA 1UBSB 3BB3A 1DJLA 4H1UA 3P9NA 4JXJA 3KPUA 4PYKA 2C4HA 2H1LA 2XUJA 1LRJA 2ZBQA 2V74B 2XUKA 4ZT3A 4TVSA 1T2NA 2L0XA 4CIDA 1SU8A 2JKVA 2OK8A 5FPTA 1XKLA 2BR4A 5L9AA 3S8EA 1P4SA 3EBOA 1ZRMA 3LL4A 4QDKA 4KAFA 4X44A 3EC2A 5SZKB 4MMYB 1IHYA 2AR7A 2I5PO 4FT4A 4ZQFA 4UZFA 2JIOA 3BIWA 3FCAA 4QODA 2IPLA 4Z4GA 4Q0MA 4N65A 5DLDA 2I34A 3TLGB 2BAGA 3UH1A 4I5IA 4P33A 2O19A 2XWQA 1WB5A 4HEA1 4FFSA 3TLEA 2DQYA 3TSZA 4F85A 1OZAA 4N3BA 5IUNC 1M6VA 2REBA 1M6WA 3MT9A 2A1UA 4TS9A 4D9EA 1ZIDA 4B5KA 1ML3A 1PJCA 2WMOB 4MNTA 2VOEA 4NG4A 3BCHA 1IZ0A 3RC1A 1JR6A 2VNKA 2PZFA 4JP3A 4AF7A 2ZJBA 4RYLA 2ECQA 2PKRA 2CB0A 2DY1A 2QUAA 4P08A 3TW8A 1P2VA 3HZRA 3ID6C 3OWHA 4G5SA 3R9KA 3CF6R 1WOPA 4DG9A 1YQEA 4E2FA 5IDWA 4Z4ZA 2XKJE 1IHMA 5FUMA 3I61A 4IHAA 3VYRB 1YAHA 4DF3A 3B8EA 4NENA 2ZJ6A 3KOZA 1VZ2A 1QH1B 4W63A 1GAEO 4DLUA 4XCXA 5J5CA 3SZ3A 3HYLA 3ZYCA 1S7GA 1CY1A 4MOWA 5T7BA 5AK4A 2ZAMA 2IYEA 1L1QA 3FNRA 3L7DA 2NVUB 4YUAA 3EUEA 1N8SA 4EG6A 4A91A 3H8JA 4KH0A 1OXXK 1REQA 3C6BA 3WL6A 4B6SA 2FTKE 2WJ4A 4J0KA 2L17A 3J81A 2X5JO 4M88A 1TAUA 4Y2VA 3AI2A 3C7KA 1XOIA 3F74A 3GRKA 4GH5A 4DILA 4W8GA 2P68A 1QQAA 1B76A 3MTQA 3OCYA 2I6GA 4RVCA 5JAMA 1WSAA 4OSPA 4PNZA 3IBGA 1AV7A 4K05A 4MQUA 5HUHA 4UEOA 1GWNA 1L4NA 2PWBA 2JEZA 5IK2D 3T99A 1ZHFA 2NM0A 1I14A 4KGXA 1XL0A 4YR9A 2BJWA 3MRSA 1NI4A 1VL8A 5L3SA 1RYZA 3KJQA 1V9CA 1EJ2A 4FDVA 2L2QA 1ODFA 2Y8EA 4PZAA 2Y77A 1MW8X 1ZRHA 3I28A 3KZNA 1CF9A 1X9GA 3VRHA 4D8TA 3HXTA 1ZCZA 4B48A 3FHTA 3W7BA 1NW5A 1OLUB 5CR9A 2ZXFA 1FYVA 2NV6A 4K3VA 4F7DA 3LECA 1Y8RB 1KO8A 1WY7A 4O2AF 4TV8B 5I4KA 1AOXA 5ICEA 4Y2HA 1WHTB 5EIHA 2XEDA 4ESEA 5CNJA 5HUQA 4QUJA 1BRTA 1DOHA 3KD2A 4BVBA 4RVSA 5DNDA 4O5OA 3RIYA 5BY2A 1I7DA 1YRWA 1PYGA 2ZIAA 4JSRA 2JKYA 5LZ5A 4LNUB 3WC4A 4PM4A 5BSFA 2XCIA 1M10A 2HJWA 1BQEA 3H16A 3L4BA 4Y30A 2OXRA 1UJ5A 4JQZA 4Z9FA 1JA9A 1CNMA 1VLHA 3Q38A 3IIJA 4PYQA 3L4JA 1PJ6A 1U7OA 3IC5A 4FW9A 3HDVA 4ODIA 3X44A 1N5MA 3BC9A 4QRHA 4TM8A 3LNTA 1KPIA 1XVLA 1Z4IA 3E7FA 5DKFA 3G2IA 4H0NA 2NZWA 2QVGA 1DRVA 4XVCA 3UUEA 1UMDB 1CV2A 4JLAA 4CXMA 2WP0A 4PX2A 4KPYA 4WFKA 1DXYA 1JVBA 2POCA 5CBKA 2ZE6A 3UW3A 2X40A 1KJQA 3N3AC 4D0RA 3KPYA 4G85A 2Q9UA 4R8RA 1BE8A 1C7RA 2ZRCA 3H5WA 2HU2A 3PNQA 2XDQA 3SDBA 1KMIY 2J85A 4II3A 4RPKA 3ZU5A 3RWOA 4DQ0A 1XMJA 2PT7A 3O91A 4YMVA 4M1KA 1UZMA 2E1RA 2I3AA 3IJEB 3IBYA 1XMPA 1NQTA 1PYDA 1TECE 1C9EA 2W6OA 3H1FA 3IO5A 3N9IA 3KKPA 5C18A 4YHBA 3Q8XB 5B4UA 4OKSA 5T4BA 4OI0A 3MLBA 4QGHA 4AZ0B 4HJXA 3OSUA 1MEJA 3HNOA 4GC5A 3WE7A 1P2DA 1UWKA 2AN3A 2FXIA 1D4FA 2AXEA 1QC5A 5ERYA 1YJBA 3FBWA 2GN4A 2Q3BA 1BH6A 1ZK3A 4PZCA 3HCPA 1KSGA 5ED4A 2X0KA 2AEFA 3I2YX 4ALIA 2ZJ3A 5AUOB 3HA5A 3M7IA 1VKRA 3TL2A 4Q47A 4BXOB 2IHBA 3V8RA 2I9PA 1NAIA 3D43A 3D6VA 4JVOA 5K3FB 1CEEA 2Y3IA 3AR3A 3H0CA 5FOTA 2OY0A 1T3HA 5K8LA 5CD1A 4XKVA 3MGKA 3Q87B 4YVFA 3D6MA 4FZRA 3HMKA 4TVOA 1DC8A 1D6SA 4BE7B 4P86A 4CG0A 3R5TA 5AJXA 3BJEA 1EWVA 1ONBA 1YC2A 1HZZA 2V7EA 4QHSA 1OU0A 2OFFA 4L27A 2HMTA 2WA2A 2A5DA 2HOQA 3BD8A 3R6WA 4RQAA 3HKEB 2R48A 3WWPA 3TECE 2NSDA 1UXOA 1JI3A 3RAGA 2Q6TA 3DXZA 4YV7A 1GGEA 5AXDA 1B42A 2F3QA 2EXXA 1K4YA 1K27A 1FSSA 2OCLA 3DOHA 4X91A 1A9XA 3LY9A 3VO2A 2ATVA 2Y99A 4MRMB 3L8FA 4G0NA 1D7AA 3INYA 4Q01A 1SVLA 4US2R 2ZCVA 3ZBTA 3SZOA 1FYEA 3BF7A 2PAAA 3NV7A 3CX8A 3DOFA 3E1KA 5J4YA 5HQTA 1ZXXA 3OAAD 3WDLA 4X8LA 1AS3A 1IC6A 4RK4A 3LC0A 1ORRA 4XWGA 3OPQA 4FMDB 1C7IA 4J7AA 3HC7A 1NNUA 1LC0A 3O8QA 4FFNA 1BVUA 1WXIA 5DGXA 1AGXA 5E38A 1WETA 4FHCA 2LNDA 2YWCA 1WW3A 2BHSA 4RK5A 5SZIA 5TV2A 3DUFB 2XUDA 3U0VA 3K5PA 3WQHA 4WWVA 5DI3A 4AJHA 2QJFA 5J2UF 3D26A 1I3MA 3OTGA 1L7XA 3U3JA 4UMFA 5BW6B 1M2NA 2ZXHA 2GJRA 1H69A 1NBMA 4TTJA 2GT1A 3O2SB 1JG7A 1XZBA 2LW7A 5CCBA 2WD9A 4LPKA 4I8IA 2P0EA 4XDHA 4HVTA 1OA1A 2GAFA 1SXQA 3LWNA 2OYSA 4W9RA 2J48A 4PRZA 2OHHA 3LY5A 3NTOA 3E2MA 4UM8B 1HLGA 4WY2A 5B53A 1L7EA 5FO0A 1W0KD 4EFNA 1T8RA 2UZIR 4R8LA 3IOEA 1O0BA 4TLAA 2YVKA 4Z54A 4KE9A 1CYEA 3REQB 3FI0A 3S0JA 1TF7A 1GL9B 5B2ZA 1UDWA 4BNDA 2AEMA 3OQ6A 1I0ZA 4XIIA 1HPLA 1U3UA 2OSBA 5E7QA 4PYLA 2XB4A 1Z4JA 4DLSA 1H2WA 4ZXFA 2GUGA 5JC8A 2LZJA 2JIZA 1R74A 2WW8A 3D7MA 3GLHB 3MUOA 3O95A 4HQRA 4RPGA 4Z4VA 3WNQA 3UGKA 1NF9A 3UA3A 2I66A 4ZOLA 3OLCX 2FEXA 1ELOA 1KI6B 1M73E 1J8FA 2EFDB 3KR0A 4FOOA 4MTLA 3UWOA 4BMDA 3BCFA 3VBEA 3BA1A 3UKDA 4D9CA 1XWIA 2G67A 2WYWA 4JSTA 5EMKA 9LDTA 1IN5A 1KZ9A 3PUZA 3LQ6A 1BA3A 5IJ9B 2JFXA 2WOJA 2JGJA 3PGKA 1TZJA 2RGEA 3CR3C 4NZNA 3QWBA 3MTGA 5FPHA 2X0DA 4A3SA 1I7SB 1JZQA 1DC6A 1JR2A 5A4DA 2YVLA 2C3OA 1E2UA 3O8LA 3AF2A 3JAWB 4JC0A 1SUSA 5CP8A 4LS3A 2C9DA 3I04M 1KY2A 1LGYA 3V2GA 4JBWA 3OURA 1O96A 1NG1A 3NATA 1V3UA 2C2HA 1PHPA 1ACLA 2WILA 2WNSA 2WM3A 3NIGB 1R5JA 4QYSA 5ETJA 1N5RA 5MFPA 2ZIVB 5E6UA 2ZJYA 3PUKA 3JPYA 2ID4A 1B8VA 1I4TD 4G0VA 3BFKA 2IBMA 4OU4A 1FLNA 4O4HB 4KXNA 1NVDA 2PXHA 3H19A 4WGFA 1H9BA 5EY5B 4H7PA 3WSWA 1DBRA 3PCTA 3OZAA 2PUGA 1XDSA 1U6KA 1UKVY 1T8TA 3WMXA 1KC1A 1H0SA 1AS2A 3FIUA 2FFRA 3AF0A 1SOVA 1T15A 2DH6A 1QIDA 1V47A 2H2GA 4HMOA 1I2BA 1KMMA 3UENA 1EZ1A 3P9ZA 3W9BA 4E21A 2X8BA 4W5QA 2XTMA 3DTTA 5BSWA 1DDIA 1N5KA 3E9CA 3EZ6A 3WLTA 4NFYA 3EVBA 2DPYA 2P9EA 4DM7A 1I94B 3Q9SA 1L7QA 2C04A 2NSJA 5DEOA 3COZA 3FFAA 4L8WB 3TINA 3NHWA 3PDIA 1A97A 1X9IA 4PNHA 5FR1A 1QLWA 3X43A 2ZW9A 5JJBA 3PNVA 1HEIA 3OJOA 1EX1A 4WCDA 3W5HA 4HN4B 3ED5A 3M4YA 1LTKA 4P7KA 1R0CA 1C81A 2Q99A 2ZR9A 1F8UA 2CNOA 4TWJA 1U7UA 4MO2A 2UXCB 2FSPA 3L07A 4ETWA 2VA8A 4J29A 1J56A 1PQ4A 3G79A 3LIIA 1AU9A 1HRDA 1OIVA 3PC6A 3WYCA 2Z5VA 1YULA 1MJNA 3H13A 4B73A 1I4DD 4N5IX 4E2ZA 2AE1A 2WJWA 4MROA 1U4OA 1OX4A 2QTVA 4XMYA 4GP7A 2G36A 1IBLB 1E9RA 4E1BA 1N5JA 4A2CA 1RVDA 2WSIA 3HRKA 4BQQA 1B0AA 1NQUA 3ASVA 2C61A 4BO8A 4CT0A 1TB4A 3T52A 1FNBA 3OY2A 1DV1A 5FWXA 3REGA 1TVCA 4BZZA 2CLKB 3FIJA 3EXG2 3A3PA 3GMSA 4Z4QA 3DT8A 1JE0A 4HH4A 2EX1A 3E5NA 1U5AA 4NFSA 3ZXYA 3I9OA 4E5PA 3EG9B 3KDAA 2HYDA 4MAFA 4GKJB 4OG2A 1J5EB 2XRFA 1L7OA 5EEHA 4INOA 1XTJA 4MQLA 4MQFB 1I4LD 2P75A 2QL7A 4HYEA 5IXYA 4I50A 2YZGA 3KJZA 5FR2A 4UJ5A 4H7JA 1VLLA 4YJ3F 1ZH4A 2R86A 2RGXA 4OHFA 4PLCA 2C5SA 4WERA 4JHLA 3TIVA 1J25A 2ZYVX 1IN7A 3PDJA 5AO9A 5IJZA 1K3UB 2JEOA 3ETEA 4G23A 4BKPA 1IBRA 5IN4A 2VIIA 5JCXA 2ZJ5A 3FPBA 3RY8A 3ZQ6A 4LDQA 1A98A 1D0VA 2C5HA 1TYAE 4WZBA 4R1QA 2P9BA 2P11A 4G09A 2R1VB 3L3BA 4ZAYA 2AEEA 2P4HX 2ZSAA 2B8EA 4DR2B 4PLFA 3NDPA 1GAWA 3BIJA 3RADC 5EJIA 5KYYB 3WYEA 2VTDA 3CE6A 3WWOA 1P45A 3EGEA 2HJHA 3HLYA 3RVQA 1EUQA 2IIBA 2O3RA 2JGRA 2AXQA 2CFIA 2DMRA 3JU4A 3H1BA 1SCDA 3JATA 5DBOA 5EP1A 1AK2A 3C7DB 5M3BA 4B3JA 5IZCC 4JI7B 3GAMA 1ZJ6A 2V7XA 3DV9A 2WUWE 4M1SA 3DZFA 4KXQA 1B43A 4HB4A 4RLQA 3RREA 3UB4A 4E5SA 4IIYA 3RQSA 1RJDA 5ALDA 3C74A 4HQ6A 1SHTX 4A0HA 4HGNA 1VB5A 3H4TA 2ONYA 5CD9A 5D51S 4EZIA 9ABPA 5JLJA 3LYHA 4M38A 4WV3A 4XLZA 1QS0A 1A71A 3GGCA 3VYWA 1E9EA 1SKUA 3IP3A 4DXDA 1P4JA 1SFRA 3BSYA 4PQGA 4YQEA 5COBA 2O9JA 1KP2A 2PUJA 3JRNA 4KKVA 3I8XA 4I1PA 3BHIA 4UD2A 3NHZA 4ARZA 1W59A 3COSA 3IT3A 1O1YA 4C7OB 2P0AA 3EXAA 4OBXA 3DZKA 4PVCA 2QQFA 1V8FA 2GLXA 3C3AA 4PU0A 2QIOA 1YJWB 1PLKA 1GL3A 1VJTA 2AFRA 3QFRA 3B82A 4RF2A 4AJKA 1NDQA 1Z7WA 3LVRE 2OLKA 3A25A 2ZU6A 3KFLA 3UK0A 1FP4B 5FLXA 4UVHA 1SCUA 3FYUA 2OO7A 1ID8A 4GX1A 4PYRA 3ZHQA 4UBJA 3UKOA 4DKJA 2VBTA 3KKOA 3P0FA 3CR8A 4QHYA 3S1SA 4TV9F 1NVFA 2PR2A 5EKSA 2FDRA 3IQIX 4MMZB 3GP8A 1KBQA 1MO4A 2ZBEA 3H2BA 4ZCMA 2ZUDA 2H4ZA 1AD2A 4FT2A 3LUJA 2NQ2C 2XYRA 3JD2A 4LDAA 2OECA 1W35A 2H9AA 4MARA 4R5HA 3RS4A 3AEUA 5MGBA 1LV7A 2E89A 2EQBA 1L4EA 2RI1A 3D5TA 3ML1A 3NHSA 4NPAA 4YPFA 4GYKA 1E32A 5BQ3A 1YCGA 1E6LA 1F8YA 5FA6A 3I6BA 1UFKA 1G19A 1UBHS 3MGBA 1SOMA 2Q4EA 3PP8A 4TTPA 4N41A 3P9QA 4X7RA 3N2NA 5AVKA 3A2LA 3LBIA 4V1CB 1XU4A 1QV6A 2FVGA 2B8WA 2WUDA 4HBZA 4QU5A 4WVFA 5D7NA 4ZVQA 3W2EA 3N7UA 3RO7A 3L6RA 3EXFB 1NE7A 3VFDA 4OBBA 3N76A 4ZCTA 1JLLB 3MM4A 1EFCA 4MWEA 1APBA 3K0AB 3I5XA 3A1CA 1X1QA 2JFFA 3PX2A 4NPCA 3X1DA 3A11A 3A3KA 3H9JA 1S3FA 2GBGA 5DEIA 5DM2A 2A9JA 2P2LA 1UMKA 4P7JA 5LZ2A 2FW1A 4CU5A 1QYVA 1PD0A 2HWXA 4PFSA 2JC3A 3SC3A 3V1MA 4YRCA 2WUEA 2RFLA 4GYWA 3C6XA 3B2EA 3E1GA 4P5DA 2PLAA 2B0CA 3CJTA 4X92A 1IZ8A 1ZCJA 2Q8QA 2MJLA 3ZNNA 4GEGA 4O0LA 4NJOA 1GZ4A 4KLCA 2P1ZA 4WD3A 4TYYA 4JGBA 1X8LA 2HLNA 4NEHB 1Q50A 4GHWA 2IP1A 8MHTA 1SG0A 4E2YA 4LXIA 4MVJE 4LHVA 1C80A 1J2UA 2RH9B 4PSAA 4C6HA 5LP6B 1TGVA 5AJVB 2E5FA 2XZTA 1U8TA 2BEKA 3X1WA 4HLNA 4PCUA 5EIOA 1HA3A 5EJ9A 4EAAA 1JHMA 4TSFD 5E7JA 1EP2B 1P1KA 4OCZA 4CCSA 4D9HA 5EJ6A 3ASTA 1AF7A 2IYSA 2WC1A 5H3CA 3ZU2A 3CONA 2Z4RA 4OJNA 3ZCUA 4EG5A 1ATZA 1YCFA 3O03A 4TKZA 3SIRA 3DTVB 4B3SB 2IUYA 2OD9A 4J0EA 1FMCA 1SVIA 2V6GA 1CUSA 3AKCA 4QIHA 2OO5C 2YN0A 5DHSA 1H4SA 2OCKA 3DMGA 1E89A 3BX1A 3R5SA 4CZ2A 2DOKA 1D0IA 1FQOA 4IJUA 2HCFA 4ENSA 1EAYA 2G04A 2I55A 4DBLC 1BDBA 3CLTD 2R7KA 1WZ2A 1CR6A 1NBHA 1NSTA 3ASYA 2PL1A 1N9GA 4F5YA 5CDYA 1SRRA 2JIQA 4KXXA 2JAOA 2PNFA 2GHTA 1M75A 3AR8A 3S44A 1TO1E 2P35A 4BX3A 5E1OA 2QRVA 4RJLA 4LXUA 4B74A 1NBMD 4JMQA 1U98A 3FLMA 3DB2A 2HV8A 4XAQA 1DTSA 3R0XA 1M90D 4H60A 8ATCA 1Z9BA 1W1IA 2AFIB 2JF0A 2QF7A 1Y8QB 1JTFA 3VM6A 4EHKA 2QLFA 3LA8A 4HQKA 1Z4LA 3VO1A 2JFOA 4MDYA 4J94A 3I2HA 4YO8A 4GWGA 4F6LA 1KIAA 1P7YA 4BLOA 2R3SA 5DU2A 5FEMA 1E0AA 2D2FA 4MYHA 5DJ5A 1GR0A 5H81A 3RD5A 3A9UA 5I5EA 1KRHA 3GRZA 2Q6LA 1HO3A 1MG5A 1J1IA 3RGWS 1JIIA 3VV2A 1XQ9A 5E0KB 4YNBA 1SK9A 3PPIA 1E8NA 1L4GA 3QBJA 1F3OA 3VPHA 3W8FA 2ZZFA 4DA6A 2JIZD 3ONNA 3NTLA 5TQJA 3CCCA 1Y0BA 3L06A 1GPYA 5I7AA 3KQQA 4FEAA 4UDYX 4MK4A 3GPBA 1DVRA 1QVVA 3NHUA 4OUDA 2PG3A 1PK9A 1S2LA 2FKNA 2X7JA 4Y67A 3T7EA 4A7PA 5IYQA 3L7OA 3RUPA 2XGMA 1E5XA 1UBTS 3DEYX 4B8YA 4ESHA 3AF1A 4ZEXA 4HAYA 1UFOA 2OWDA 1XAGA 1K3FA 1EVEA 1WP4A 4Y6QA 3I73A 5C3UA 1P4AA 3RYCB 3R0IA 2IYPA 4M37A 4ZYXA 1OSNA 3H5IA 5JVDB 1WQ3A 4ZODA 3E27A 1GA6A 1L7MA 1ZISA 3ZKWA 3BIXA 3C16C 3HKCA 1RRKA 1AIPA 4K5QA 4IF6A 2QN1A 4PLZA 2GM5A 1XKXA 1V4BA 4F5ZA 2LZ0A 4YYEA 3NKVA 5CK4A 2XCTB 1KPHA 4TYWA 2Z2JA 3IQXA 4A73A 1V5VA 2AHOA 4DV1B 2JRLA 3RYIB 3KOWA 2J3JA 2QOEA 4HQFA 4HDMB 4K03A 1MV8A 5CAEB 3AINA 5BXYA 2IY8