1QFYA

Pea fnr y308s mutant in complex with nadp+
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
308
structure length
308
Chain Sequence
QVTTEAPAKVVKHSKKQDENIVVNKFKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGEVPYREGQSIGIVPDGIDKNGKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVYTNDAGEVVKGVCSNFLCDLKPGSEVKITGPVGKEMLMPKDPNATVIMLGTGTGIAPFRSFLWKMFFEKHEDYQFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPENFRLDFAVSREQVNDKGEKMYIQTRMAQYAEELWELLKKDNTFVYMCGLKGMEKGIDDIMVSLAAKDGIDWIEYKRTLKKAEQWNVEVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FERREDOXIN: NADP+ REDUCTASE)
publication title A productive NADP+ binding mode of ferredoxin-NADP + reductase revealed by protein engineering and crystallographic studies.
pubmed doi rcsb
source organism Pisum sativum
molecule tags Oxidoreductase
total genus 96
structure length 308
sequence length 308
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1999-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1qfyA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1qfyA02
1Q7YD 3U2QA 2DEUA 1QGZA 3MCAA 4M2LA 1Q86D 3WNCA 3QFTA 2C78A 3G4SB 1SM4A 2HDNB 4H9GA 4Y9UA 3OW2B 4ACBA 1F60A 1FNBA 4R71A 5AN9A 3W2HA 4MYTA 4N3GA 5GV8A 2QDXA 2DETA 1FDRA 4TMZA 3WXMA 1XB2A 2QN6A 1B23P 1EFUA 1EFCA 4RD2A 3AGQA 2BSAA 1UMKA 3E1YE 1ZUNB 1GAQA 1R5NA 1H42A 5THXA 2VNHA 3CCEB 4IW3B 3LO8A 3ZBTA 4LC0A 2HMAA 1IJFA 1OGJA 1FNCA 3CCRB 1NDHA 1YJWB 1BX1A 3U6BA 4YAWA 4B48A 1K73D 4N3NA 4LBWA 4U9UA 1KD1D 1B2RA 3AVXA 1TLLA 4HE6A 3J81k 1N0VC 1DDGA 2XNCA 1F20A 2EIXA 3W2GA 4B47A 1BQEA 4TMWA 1YJNB 1E62A 4ZCMA 1TUIA 4TN1A 3SJZA 4B3XA 4PC1A 1OB2A 3CRZA 4P6VF 1QVGB 1J9ZA 3PENA 1GAWA 2BF4A 1G7RA 2OK7A 2VNKA 4BPRA 2VZLA 4TMVA 4DQLA 1AIPA 4Y7CA 2D74A 1QUFA 3WNBA 3QFRA 3I1FA 5TY0A 1QGYA 3JQQA 1ZM9A 4PC3A 2BGJA 1TTTA 1QX4A 4P3YA 4YHBA 1KRHA 1JA1A 1A8PA 4B4DA 3CPWB 4HE5A 4UAJA 4RD0A 4AF7A 1N8RD 3LVBA 3VMFA 3LRXA 5HXBA 3AVWA 3ZBUA 4ZGQB 1KC8D 2B5OA 2BGIA 5KSWB 3VO1A 3VNVA 4K1XA 1QUEA 2VNIA 3CCVB 1EP2B 1ZM4A 1QGAA 3I55B 1VQ6B 1S0UA 2R6HA 2DERA 4RJLA 1H85A 1QFZA 3E20A 2VNJA 1JA0A 3AVUA 3CB4A 4TMTA 3B82A 2HCJB 4YAOA 3CXCB 3G71B 2OK8A 3OJXA 1JB9A 3WY9A 3B78A 4AC9A 1QFYA 3JQPA 1KK2A 1Q82D 4QHYA 3AVYA 2YWEA 4ZGNB 2RC5A 3CCMB 4J0QA 3CCLB 1TVCA 1VQ5B 1FRQA 3V76A 1I7PA 1BJKA 5EMNA 4ZV4A 5TV2A 3FPKA 5TR9A 1GVHA 2AHOA 4LBZA 3JQRA 1VQKB 3VNUA 3W5UA 5DSZA 1K8AD 1CQXA 4C43A 1S72B 1IB0A 3CCQB 2B7BA 4G1BA 2YWFA 3CC7B 4YALA 5H59A 1GR1A 2BVNA 2X3UA 5JBQA 2PLFA 3W2IA 2RC6A 4YAFA 1WDTA 1KK1A 4ACAA 1GO2A 1SKQA 1G7SA 3CMAB 2GQFA 1VQNB 1YITB 4LBVA 4EH1A 1W35A 3I56B 4PC7A 1YI2B 1D8TA 3FJOA 1ZM2A 4ZCIA 4G5GA 4F7DA 1QH0A 3OJWA 3WBJA 1EP1B 1QG0A 1E64A 1E63A 1M1KD 4B43A 2QA4B 1GJRA 4PGOA 3MHPA 2YWGA 2DY1A 1R5OA 1FNDA 1EXMA 1KJZA 1G7CA 4RCZA 2GPJA 1KK3A 3P26A 4FN5A 2BPOA 3W5HA 3U6KA 3OZVA 3QE2A 1U2RA 4M1KA 1ZM3A 4C0SA 4DQKA 1HA3A 1M90D 2BM1A 2VYQA 1VQ8B 1EWYA 2QEXB 1EFTA 1R5BA 4MYUA 2YWHA 3ES9A 1NJID 2OTLB 4RD4A 1W87A 2E1RA 3P27A 3W2EA 3CCJB 2QTZA 1VQ9B 1OB5A 3CD6B 2QMUA 2QTLA 3A1FA 2C77A 4Q7JB 1AMOA 5GV7A 1JNYA 3QSYA 1D2EA 4NBSA 1VQMB 4G1VA 3G6EB 4PC2A 1DG1G 1W2BB 2EFGA 1CNEA 1OGIA 3ZZ0A 4RD3A 3QFSA 4M0LA 3CC4B 3CCSB 3CMEB 2XNJA 2XEXA 3ZC3A 4M53A 3CCUB 1KK0A 1JJ2B 3LYUA 1KQSB 2J7KA 4Y9RA 4YAUA 2BV3A 4WQMA 3B8HA 1VQPB 4FK8A 4PC6A 2BMWA 1IJEA 4M4SA 1YIJB 2FX3A 1YJ9B 1DDIA 3ZZUA 1W34A 3AVVA 1DARA 2NPFA 4LBYA 4FWTA 2CNDA 1VQOB 4RD1A 3ZZTA 2B7CA 4AF6A 1EP3B 2CRVA 3CC2B 2ZITA 4RCYA 3CW2A 3AVTA 2PMDA 1CNFA 1VQLB 3WYAA 1D1NA 3WNDA 4NCNA 1QVFB 1ELOA 3WBKA 3MMPA 1XE1A 2BN4A 4TMXA 3OZWA 1YHQB 4B44A 4QFMA 5H5JA 1Q81D 4RD6A 3AGPA 2BM0A 1FNMA 3OZUA 1BX0A 3VO2A 1N0UA 3QFCA 2PIAA 2DCUA 1VQ4B 3W2FA 1QFJA 1G7TA 3W5VA 1K9MD 5FA6A 4ZCLA 1KTVA 2OTJB 1FRNA 1VQ7B
chains in the Genus database with same CATH superfamily
2OB1A 1HZZC 3K70D 1FRVA 1PP4A 2GMWA 2Q6LA 1NVUQ 4ZQFA 1N7GA 2Q3LA 4GWLA 2DEUA 2AVNA 4IFBA 4TV8F 1U4NA 2GRUA 2QAGC 1XV5A 3CLRC 3LBHA 5IHPA 5KYUB 4QLAA 4R2WA 2UUOA 3W3AD 1PRYA 1GSOA 1SZPA 3VDQA 2JFGA 2GM9A 1GTRA 2A4KA 3O8QA 1PZFA 1N5IA 4R1QA 1IIBA 3M6MD 3N05A 2O6HA 3QVOA 2ORED 3CZPA 1LQUA 1YC2A 1OAAA 1MJNA 4YROA 3AV0B 2H1WA 3P9XA 4XVUA 2RAUA 2VPWA 4Y9UA 2XUQA 1P4RA 3PIRA 4YBZA 5C52B 3FCCA 3R6WA 4TKOB 4J8PA 4PYKA 3GDWA 4M7RA 4NEHB 2VCEA 5K0NA 1M34B 3PC6A 5KYUA 2IDKA 2PYDA 3PGVA 1YZGA 4MUBA 5LQMA 2HMWA 2TMKA 3HYNA 4NQRA 5A89A 3AFNA 1A9ZA 1RVV1 3OPMA 1WSAA 4HVTA 1UD5A 2C3PA 1PL8A 3D0RA 3A6LA 3PLAE 1AHIA 2DETA 4UOEA 1U7WA 4CM8A 4ZGWA 1LD3A 1H2ZA 3I0MA 2OR3A 5F2OA 1JLHA 2Y2UA 3S2SA 2JGNA 5A4MS 4I66A 4C1NA 1IOVA 2Q5EA 1EX7A 2DPXA 3CURA 2I67A 2PNJA 4MI6A 4Q1EA 4KMRA 4ZYYA 4NU5A 1XNGA 1YBVA 3UFXA 3ONYA 4DCMA 2JIZD 4IY1A 2J30A 3KQPA 1QVAA 3WKEA 4B7CA 1FL9A 1HT2E 1KWGA 1J56A 2X3FA 1PEYA 3V1YA 1OIVA 1K6JA 1QO0D 3IBCA 4MEAA 3DAOA 4P92A 1QIMA 3ZK8A 3ZK7A 1JAHA 1QTNA 2YWRA 3MWEB 3PEUA 4X95A 1CJVC 5FV4A 1VBFA 3P0HA 4W1PA 3R8XA 3L8HA 2W70A 3SKBA 1TM3E 8GPBA 1AUQA 4G7WA 3D3WB 3K53A 4GOND 1R8QA 5D3MB 3VX3A 2FPWA 1ACJA 1P6XA 2AE1A 2G8LA 3BMNB 4OQXA 5F52A 3SYKA 3VNBA 4QJ3A 5K6AA 5JJIA 5AI0A 5BXYA 3FWHA 4URUR 1CV2A 3ICWA 3UN1A 4K3VA 3VH1A 3IUQA 4V38A 2ZW9A 4TLAA 1BKSB 2OTCA 4B8WA 2W0SA 3RBXA 1P0CA 1G66A 2WVAA 4GVXA 4ZEXA 2JLYA 5A6SA 2B4TO 4FWBA 4W4TA 1WCIB 2Y71A 4D02A 4ZI2A 2J5XA 1UJNA 1WZCA 1INLA 2EIXA 2HSEA 4W7SA 4DXHA 4IDOA 1OPRA 2FRXA 4PZLA 3E7FA 1E7SA 1JR3D 3ECSA 1XZHA 2L42A 1DHTA 2WSBA 3PUHA 1XKXA 4BC1A 5JDIC 5GMOA 5C1PA 2IXGA 2QX7A 2X6RA 4KO1S 1RT9A 2RB4A 3DH0A 1WHTB 3DHNA 3E7DA 4LX8A 5DYYA 4BTLA 2ID7A 3B3AA 4G2TA 4BMCA 1TF7A 2LGJA 2WHXA 4BAZA 4PONA 3WDMA 4LPKA 1H65A 2QGFA 2NW6A 2WTEA 3R76A 3ZTYA 1R0RE 3RK1A 4RX1A 1J9ZA 3TPCA 2ATEA 3ZV3A 1R9JA 3VKFA 5FEUA 1I33A 4IEIA 1NGSA 1WEHA 4BKOA 3A8JA 5LC1A 5B1YA 2O5EA 4QT0A 1JIUA 4ZOLA 1Z5PA 5A1JA 1NBHA 3V7UA 4F2DA 2ZJ1A 4TMVA 1J90A 2C0QA 4ZARA 1U9CA 3VKUA 3AF5A 1JTVA 3K5HA 4ARAA 3HFSA 2P3LA 4FEAA 1SC3A 3PC4A 1ODLA 3GCZA 1BDMA 2WKRA 3LBIA 4YUXA 3FFBA 3QELA 4RULA 2AXPA 2ERYA 1N2ZA 4WKOA 1J0DA 1F5NA 3DMTC 3WDSA 4EKEA 2XGJA 1CUUA 3BC9A 4HSGA 2LZ0A 2O05A 2W2LD 5DNWA 3WMEA 5CA0F 4O4JF 2D1TA 2KE5A 4WCVA 4G0YA 1CUVA 1R27A 3ZE1B 4FFMA 4UU0A 2YJZA 4QE3A 4FILA 3IAFA 4L3OA 4N5HX 5E2IA 5L51A 1NJGA 1S1CA 3OQ6A 3SYLA 5KTKA 4CEHA 4UEOA 4MQ5A 4V0SA 3VC7A 4I36A 5EQJB 4AF7A 4R01A 4JODA 3ESCA 3LVBA 5LZ2A 3PL5A 1NHWA 1BX3A 4B80A 2XE4A 4LWZA 3IAS1 3OM0A 2HRRA 3K5WA 2WJGA 3AH8A 1MLDA 3F5MA 4EIWA 3S1LA 4WA7A 1E1CB 2R1VB 5TC4A 1ZH4A 1KOJA 4FZRA 4W1RA 2COUA 3UAGA 3G2LA 1WUIS 3L6OO 3P5BA 3OFNA 3CP8A 1U2PA 2JS7A 4LJ9A 4LJ6A 2AK2A 1X1EA 2P2ZA 4G86A 1OLXA 4EB6B 1XJCA 4H4EA 1M8FA 5CDGA 2IUUA 1SY7A 2GTHA 2W8ZA 3QWBA 1DTSA 2R8XA 2LKDA 1XTPA 3K15A 3K6JA 2H16A 4XARA 3KYDA 3NTVA 3QXSA 5IF9A 1VQ6B 1CVRA 1VJTA 3PQCA 1J6UA 3UJBA 1JB1A 2HC9A 2ZCJA 3VJLA 4LF6B 5P21A 1HDEA 3E70C 1XPRA 2C00A 3FLEA 3KVNA 1GCGA 3SEZA 1N2CB 4GSYA 5I45A 1NBEA 5JFTA 4FFLA 4K6CA 2GHIA 2GYWA 2XVYA 4KKVA 4WCFB 3U3RA 5TJHA 5ITWA 5J58A 3ICVA 3PKJA 2HMSA 1L5HB 1BE8A 5JARA 8AT1A 4RVNA 2CYBA 2O6LA 2ZXHA 4BKPA 2J85A 1JFFB 1EFVB 1TYEB 1G6KA 3ZE7A 4AKSA 2QK4A 2XWQA 4LKOA 1WJGA 2GZAA 4UUNA 1I2AA 5JEEA 1SCUB 2DFVA 2P68A 2XCOA 5LIPA 5DLPA 1JDBB 1RLJA 2GD6A 4HNAA 5KVQA 3WKBA 1KVQA 3ZDRA 5IFKA 1LEHA 2OZEA 3LMKA 3RGGA 1QVVA 2J6CA 5HFAA 3ZX5A 3K2QA 4KFSA 5I7HA 5JZVA 5KTSA 2XMBA 1UM9A 3TCKA 1W4AA 2DE0X 2G04A 1IONA 1L4HA 3C48A 3ROMA 1BMFD 3CEPB 2X8LA 5BQ3A 4JY7A 3I9FA 1XDGA 1TEXA 1OU0A 1RHRA 3FBTA 3HB7A 2QQ0A 1DKLA 1YKGA 3G5TA 5TV2A 2PJUA 5TPZD 4YFYA 3FPKA 3HXQA 3FZQA 3D8BA 3K0FA 4YCSA 5K6RA 4IUCS 3R3UA 2VWHA 2Q49A 3C5CA 1QJCA 1GARA 4KXNA 1MHPA 1R10A 4WVFA 2YV4A 5DHTA 3ZQ4A 5HQ3B 2HLDA 2ZYWX 3ILXA 3CLSC 3G59A 3EW9A 1YGYA 5E7MA 5E4JA 2B7BA 2EVWX 3PE4A 4MCAA 3H17A 3URMA 4E4TA 2X3UA 4DREA 4Q01A 4KGXA 4XYBA 3F0TA 4NU6A 1H2RS 1Z26A 4CZ2A 1QTRA 1NP6A 1XYVA 1GO2A 3TPZA 5EJ6A 5BV1A 4UNSA 1J07A 1PKEA 5ALSA 5MGNA 4FGZA 4KTVE 2HU7A 3NBZC 3QU9A 4N41A 1XQYA 1XF1A 2WMYA 3AR9A 1PI3A 2ZRMA 3M81A 2OZLB 3BFJA 4MHTA 3ETCA 2P9QA 1XZIA 1ZOSA 2F9MA 3F78A 3HSKA 3A9TA 3O75A 4OXXA 4KNVA 1KE1A 1Q95A 3L7NA 4CEJB 1W36C 3RUDA 1QH0A 5K0FA 5BUQA 3U09A 4DLKA 1QBKC 4JVOA 4YC7A 1BH2A 3LCCA 1XZAA 1TRHA 3TVDA 4H0CA 1EP9A 1PHPA 3F71A 4OBXA 2ZCVA 5IJAA 3FGZA 1VG9B 1M1KD 1TAHA 1MQSA 2W43A 2QA4B 2ACVA 5LQSA 1V11B 2XF2A 4BQIA 3X1JA 3QPVA 3VVCA 4C87A 3E9ZA 1VB5A 1C7QA 1ZI6A 2NU7B 4QBKA 3KAPA 3TM5A 4DUPA 3LQKA 2Q41A 3KEGA 1GYRA 1RC0A 2GBLC 2WPDD 5K3BA 4FHCA 1LBQA 5B6IA 1FNNA 1Z6XA 3HKEB 1AZSC 3GOQA 5DP1A 1M1YA 4TXJA 1Z6TA 1B0PA 4X62B 3ZGNA 3W5HA 1HNWB 2YXEA 2HJGA 2IYOA 4TSKA 5B58T 1PL6A 2HQOA 3RS3A 1NIJA 4OJTA 5EIAA 4NBTA 2J5BA 2O4CA 3IIJA 1AV6A 3RAFC 3OCWA 2BT4A 1OH7A 4C0KA 1IM8A 3HN2A 3M89A 3OCYA 1C4XA 3G7NA 3CGWA 1FUIA 2FY8A 3WL6A 2C2BA 5JH7A 4NICA 4AULA 3BICA 1V7CA 1EWYA 3MAAC 5EN4A 2PQ2A 4BGVA 2GXAA 1ECFA 1U7XA 1W5FA 1XRQA 3GXBA 4QXAA 2LZJA 4WOPA 3SC2A 3IMGA 1CQJB 2AJBA 2VYCA 1YC5A 1TKAA 2JIRA 1MT0A 2OBSA 1Z7WA 3ES9A 2AE2A 4U7HA 3JVIA 2R7MA 4YLYA 4KKUA 5JI2E 2A5YB 3OJFA 3NGLA 1KDYA 5IBCA 2CKDA 2D13A 5AK4A 3T5CA 1ISRA 3I6YA 1DQSA 2E1RA 3B1KA 4PO1A 3DDWA 4E6PA 1QHXA 3MINB 1U99A 1QX3A 3CCJB 2R6JA 1OFIA 2ZYIA 3NNDA 4QEDA 2JGEA 2AFIA 5EOVA 5FWDA 3VPXA 5FTMA 2GZ2A 1VJ5A 2ZSJA 4ZFNA 3TB4A 4OQ4A 3A3NA 4UTVA 1R8SA 1GZUA 1PL0A 1LBEA 2C5FA 4IEEA 4CM3A 1UJ2A 4P58A 2LVBA 4PG5A 5LP6A 1S89A 2PX0A 3KEFA 2VJOA 3HPRA 4P36A 2E4ZA 4WLFA 3J81A 1Y34E 2DFLA 1YUBA 1J8MF 3O1LA 5B55A 5GV7A 4L8WB 1RJFA 3PUJA 2ORYA 5E8RA 3TAXA 4J03A 2ZL5A 1VRVA 4L3VA 2PWYA 4P5DA 3I9NA 4TVKA 4WGGA 5JQGF 9MHTA 2WJHA 2J46A 4P3PA 3L82B 4EI9A 4ZVQA 3G6EB 2J9ZB 3GGOA 4FHEA 4HBGA 4EKNB 3EZXA 1LFAA 1QGOA 3BMCA 1BXKA 1FPQA 3ASVA 4M0PA 2OSVA 2IIPA 2CFTA 5HW0A 2O52A 1M2KA 4KFUA 5HEKA 3UMFA 3VTZA 2RE8A 1UCFA 2AH5A 3UMBA 1DG3A 1Q6ZA 4RDIA 2BI7A 4CG2A 1U3UA 3PXDA 3DL4A 1GCAA 4LRYA 3VR3A 3CCSB 1ZVMA 2G5PA 4R9UC 4X8MA 3KTDA 1JT9A 1V26A 2BY4A 3JARB 4F72A 1GQ2A 2WYRA 4JVMA 4ER6A 3MT8A 3GEHA 3OEYA 5IS2A 5L3QA 5CXQA 1N2XA 4YO7A 3BYZA 5DMHA 1S9DA 3TE7A 3E22B 1J0BA 5CPFA 3NBFA 5E4YA 3W9BA 1GITA 3QKRA 1XJWA 5BQPA 4RETA 4JFRA 4RPDA 2PCJA 4O6VA 3OTQA 4ALKA 1LX7A 1Z7GA 3DWEX 4R98A 4TXLA 3HUTA 4YECA 4EHNA 3G9UA 3HN6A 1BRTA 4RMNA 4C0WA 4LDPA 5CNKA 3I6MA 4IIJA 4HBZA 5C8VA 3OESA 1I0LA 4HN9A 4GOOD 3SU8A 3ZCQA 1I7SB 3L79A 3F6BX 3KXIA 1R12A 4UXHA 3V8VA 5KNCH 1MCZA 1AY0A 1H93A 2NLOA 2YQ5A 4L6IA 5K8JB 2JJ2D 2IUFA 1PTKA 1PS8A 3H9NA 2JJ1D 3Q7IA 4GYKA 5I47A 1DV2A 1NATA 1S7GA 2R48A 1NJ8A 1E60A 1T91A 5AESA 1Y8CA 1YDHA 1RLMA 1TZJA 2JCVA 1M2NA 1KVRA 2B6NA 3DV9A 3L46A 4ZJYA 4D8UA 1UOEA 3IURA 5AVTA 3GP3A 4MYSA 4TS9A 3BCHA 4DAEA 3PQ7A 4FZ3A 3AI7A 4B2PA 1GAEO 1X7YB 2FX5A 3NWEA 4INAA 4LKRA 4YLGA 3WX0A 4IO0A 3W9SA 3WGIA 4E0BA 2QLMA 3C43A 3K05A 3OZSA 1BE6A 4M8LA 1P4HA 1JKJB 4BB0A 3UMSA 4LZOA 5AWFC 3LBAA 1E2LA 1HXHA 3VRHA 4DEXA 4EW2A 2GSDA 3TM4A 3EEOA 4JJEA 4INZA 2VJIA 2BTEA 3LUAA 3AZQA 2XGSA 1P45A 4HX2A 4URFA 4NPAA 1K1EA 4Y8VA 5B3JA 5FDFA 5GY7A 2HPVA 2E1PA 2O4UX 2YTZA 5HRAA 4RD6A 5IYQA 1EWRA 1O9GA 1YRWA 2VPXA 1FFXB 1NM5A 3EA5A 3HA5A 1G5HA 3QF7A 4I6EA 4B35A 3NBMA 4MQFB 5ICSA 4Z4QA 4QUGA 5AQ1A 3VU9B 5AXDA 2YWXA 2MIIA 4CCAA 3NVKI 2IE8A 2FEKA 4F5WA 5ALKA 5KU7A 4P22A 1WQ3A 1SUSA 4LRWA 5KVAA 1SCQA 2GK7A 2ZS9A 4MDFA 5EQFA 1DQYA 3OX2A 5EXXA 1YS6A 1SA0B 1ZUIA 5FORA 2JI4A 1T2VA 2PL9A 2DHEA 2OAQ1 3GCWA 2B8JA 2QPTA 4UE3S 2KLHA 1I3CA 3UMJA 4LCJA 4R8VA 2ZRLA 4LQCA 5DISB 3TJMA 2H1SA 2HSJA 4U2BA 4MVJG 2D1SA 3QEMA 4P0QB 2DBYA 3OI7A 4TVOA 1YIAA 2YMMA 3E82A 1CRLA 2PSJA 2RI0A 1OKKA 4C0AC 5AW2A 4EHFA 1RCUA 1TA9A 2SBTA 2FA9A 4GKBA 3M5PA 4OJQA 4X3PA 3GRCA 1ULUA 3KKPA 5LBIA 3Q85A 5LWQA 2CWWA 4M88A 3Q11A 1ZFNA 4XI9A 6LDHA 5I7EA 3E4DA 1GIAA 4JXJA 5AI8A 2WP8J 2WUDA 1YE8A 2YUIA 3ZWDA 4YCMA 4YMIA 5A7FA 2JD2A 1JEDA 4AT1A 1T9CA 5JMOA 1YWGO 2XA2A 2KMLA 2QRMA 3SX4A 1FSFA 3CLVA 3O3CA 1Y6ZA 3AR3A 2H1LA 3W4KA 1OX5A 1B8UA 1NUQA 3CVYA 1IBSA 1GXSB 1KI6A 3DJYA 3EOAI 3GG9A 4HDRA 1FNBA 1Y5LA 4XA8A 3UNXA 1EXNA 1RR6A 2WAMA 4EGJA 1YRLA 5JZ9A 3SHOA 1RLTA 4E7PA 1UXKA 1RMTA 4L9RA 1L4UA 4JXKA 1T9ZA 1FDWA 1URPA 2HN9A 3Q15C 4Y1EA 4EPXA 4CTJA 4F56A 4A36A 2OGTA 3BJIC 2O59A 2O0MA 3QE9Y 4AJOA 2BR4A 4ECEA 4GM4A 2I2BA 1HQKA 3DBRB 2QN9A 3SQLA 1T1GA 3LCRA 3WQRA 4X0EA 2W6ZA 3AZPA 1RQLA 3WP1B 3E9QA 4V02A 2WEKA 1H4VB 1W75A 4B83A 1KC1A 5BMVA 3V1TC 1HLDA 3QENA 1LTQA 3E58A 4ZO8A 2PLNA 3RUHA 1RAFA 4BASA 2BCEA 3I6ZA 2QPOA 5C7OO 3O82A 2G1PA 1EG2A 2X5XA 4DDKA 1YNSA 2ECOA 2YXBA 4RZIA 3WS7A 1M2VA 2NUTB 1NC1A 3GT7A 4AP5A 4BJ3A 2HOQA 1U1CA 1U7ZA 2ATIA 3H1FA 3AERA 3QW2A 4QGAA 4RO0A 3W0LB 1N36B 3LKDA 2BHNA 5AKYA 5EXPA 3W2TA 4G63A 2BEVB 2QQGA 4GX2A 3ZKWA 4KHZA 4ZU6X 3KWLA 1NFQA 5AP9A 1JZQA 2OWDA 1NE2A 3H84A 4LK3A 4LJ5A 1J2EA 3M6XA 3F73A 2RGRA 1T26A 3SLDA 4R2JA 1UKBA 4YCLA 3AF0A 3VTFA 3W34A 1CJCA 4U2DA 4UUAA 4MB6A 1YBHA 2Z0MA 2O1WA 4DSAA 1JQAA 4WA8A 1K5DA 1TRKA 1LC0A 1A76A 5DIZA 3A9SA 2BEWA 2C5AA 3AILA 4IDGA 3ZDDA 5JJBA 3BZUA 4CGZA 1KXZA 2HRQA 3A4TA 3P9IA 2W2TA 2M32A 4FINA 2W2OA 1YCFA 4MLPA 3UK6A 1R15A 1I2CA 2FLVA 5IC5A 3LBYA 4AN1A 2RH5A 1FS5A 1NBME 4HNTA 3IQXA 1L5LA 2R6FA 4OSPA 5KYXB 3PXCX 2K87A 1SHJA 3BUSA 3P8ZA 3OKPA 5DB4A 1KOLA 3G0IA 1C7IA 3IDQA 3RYCB 2ZU0C 5BUZA 1V37A 3U1BA 3DZIA 1EVQA 2SKCA 2FPLA 4H4DA 4UVIA 3IKJA 4WINA 4XCQA 3RVMA 2C59A 4BGDA 2BEJA 4ROXA 2KBEA 2POCA 1AO0A 2P3OA 4YJFA 4NCBA 2QG9A 3BZBA 1P1KA 4TN5A 5DK4A 4LTMA 4HH1A 5C1IA 4MUJA 4MB2A 1Q14A 5A4JA 1GL7A 3FTDA 4KZPA 5AHRA 4BLPA 2CVQA 5E3JA 5COQA 5BPFA 2Z6QA 1MG0A 1TZBA 4NOLA 4UNNA 2DSTA 3DOFA 3B5EA 2I5PO 4CBVA 4LOHA 4MR7B 1TCUA 4U3JA 2PUJA 1VCOA 5C31A 4MNTA 1ODJA 1DAKA 3UGQA 3B6MA 4PTYA 1QV7A 4DY6A 4NKRA 3LF1A 4PINA 2OBMA 1CFZA 3IC5A 3S2GA 3ZGZA 3FKQA 1EZ1A 1R4MA 1JDUA 3B1FA 5CAEB 3JZMA 2QD5A 3TTYA 3V8EA 4YRPA 3VYRB 3EC1A 3ZI0A 1JXAA 4P33A 4F06A 1L4GA 2C5EA 1B7GO 1HSZA 3DEIA 3HDGA 4XM2A 4L5YA 3CB2A 4G9EA 5CFLA 4XH9B 3OSZA 4CM9A 2PGXA 5JS7A 1QX4A 4MVJH 5T4BA 1X1RA 1X80B 1JDVA 2YVKA 2CUTA 2PTHA 4PICA 5IKPA 4KQXA 3HFRA 3E3NA 3RVLA 5IWCA 3RJTA 3S81A 4G4GA 1AKWA 5GJCA 1D7AA 4C2TA 3UICA 1NOIA 1O94D 1QE0A 1WZNA 2G4LA 3GH3A 1U28A 2DHQA 4IS3A 3V3TA 5AVRA 3OIVA 1U4SA 1YU9A 4X7DA 3AVWA 3FSGD 3P97A 1GDHA 1SUAA 3CTAA 5DGCA 3G0OA 1YK1A 3GBPA 3EZGA 4B8YA 1XRLA 1DT3A 3DE0X 2RIPA 4RKEA 4H6XA 2PYIA 2LP4Y 2I7VA 2X19A 3FD8A 3HH8A 1T36A 4MEBA 5HILA 5C37A 1EP2B 3OCJA 3O83A 1LDMA 3EF3A 4RM0A 3EXFB 1WETA 4G4JA 3SXUB 1V4BA 3WSVA 4I5DA 2Q6VA 3S7ZA 3RT7A 2VPQA 4Z9FA 3K0AA 3M9WA 3R44A 2PGAA 1FDTA 4GBJA 1Q1AA 3U48A 3BXZA 4R2MA 3RLIA 1T0JB 2WF7A 1S8NA 1EFHA 3CH4B 2AFVA 1G9XA 2BH2A 4PRYA 1JALA 2K7FA 5JISA 3JQGB 4AW9A 4EFNA 2H0AA 1G42A 3OTWA 4D57A 1OXXK 3NR2A 3FCOA 5IXSA 1JB9A 1YRYE 1HSOA 2FRDA 3OAAD 1CZKA 3AF4A 4ZTUB 2BZ1A 3V7AA 2GEDA 1V3TA 2VATA 2R4UA 5B1SA 1AQJA 3DR3A 5BW4A 1T2EA 4HGYA 3K7EA 1QP8A 4S0ZA 4KIGA 4MICA 5I4IA 1KGDA 3EC2A 3ZIAA 4OOVA 1I30A 1XZKA 3VYVA 4ED9A 1E5QA 4MGYR 2C8LA 3KR2A 3OIDA 4H3KB 5B1DA 3DZKA 2QVGA 2V45A 4DIKA 3E1KA 4OHXA 3KXKA 4ESHA 1DTEA 2GPTA 3EEYA 1T2NA 2DSNA 4MAAA 4CQMA 1FTWA 4E13A 5K8IA 2H1OA 4I55B 5EP3A 3Q9LA 4MR9B 1VM6A 4EHBA 4HMPA 1M6WA 1RZUA 4BNXA 1E2IA 1YE3A 1VQKB 2CHEA 3W5UA 5GONB 1UT6A 1DXYA 4K6HA 4BMSA 5J47A 4EY7A 3DTVD 1G2IA 2NUAA 2XB6A 2WKQA 1Q0QA 4QPCA 4XEHA 5HX7A 1RU3A 2DFNA 5A9SB 2C2YA 2FWRA 5IKEA 3CC7B 3ZXUB 2OOSA 2BBOA 1XXHB 2C7RA 4YMSA 4OY3A 4DWOA 1WIWA 3RFTA 5JVDB 4DA6A 1B6GA 1DT5A 2WSYB 2NU8B 1EZZA 1W76A 5ITSA 2J3JA 4JA2A 1VHDA 3DSRA 1GA4A 3NPAA 4G8CA 3ZV6A 3DO6A 5DWQA 4WN9B 3AONB 1G20B 4MDYA 2ZSAA 4TUYF 4KN5A 2ES4A 5K0LA 1WA5A 3JWEA 1YR1A 4HADA 4I14A 3ADDA 1N6IA 3QTTA 3VR5H 3WGKA 1MAWA 3EHDA 4UCWA 2BMFA 2ZWVA 3D2LA 3NHAA 5EWMB 3RUAA 1RSZA 3J7TA 5DYWA 1EP1B 3VR4A 1SXJE 1VPLA 1YRHA 3V1UA 3AUYA 1PQWA 3ETNA 4BUCA 2VPTA 4IOJA 5DX8A 3OJEA 4I5GA 4WLUA 3I8OA 2AXQA 2XXAA 2ZWIA 4TTAA 4Z3DA 5KHAA 1RKBA 4KRXA 1NVFA 3LV8A 2O8CB 4J16C 4ZYWA 1G6OA 3BDIA 5B1HA 1TMKA 4WJKB 3UHJA 1D09A 2VHQA 4XD7D 2O57A 4CDMA 4Z1OA 1MH1A 4OUDA 5LMNB 3Q8LA 2A0XA 3UB3A 1KK3A 1PNVA 1T5SA 2HK9A 2QUZA 2RBKA 4MW4A 3SD7A 2JFHA 1PJ3A 4MITA 4NPCA 4MQMA 1DC6A 4IHJA 4Q18A 5EAIA 3M7IA 3TXXA 4BO6A 4HPXB 1TL7C 4GE0A 4BQRA 4R3NA 5JSZA 5EJFA 2AJLI 4FNMA 2X2OA 3F7NA 2H4FA 4IDEA 5F1OA 4LFBB 1JLLB 5FUVA 2DY0A 1KEEB 4OB7A 2QRLA 1BRMA 4ETMA 3H75A 4PAOA 5DTJA 3X3HA 3KOUA 1ICEA 4I9UA 4EHHA 4EJMA 1U0HC 3IOEA 3Q2IA 1C14A 1N6HA 2EU8A 1H1TA 3KD2A 4L75A 1EFTA 1EEHA 2BKLA 4Q6BA 1P39A 1X7WB 3ZU4A 1BFDA 4OLAA 1C3JA 1E66A 1QB8A 4WEQA 3IQWA 4P4SB 3HDTA 2YWHA 4L4RA 5DMXA 4HLNA 1E20A 1T9AA 3UMCA 3ULKA 3R5HA 1WDWB 1PK7A 3H5VA 1C9NA 1AF7A 3M5WA 3VNAA 4B71A 3AJDA 4BWYA 3R4VA 1GUZA 4OHUA 2G07A 1PWZA 4FOOA 2PPLA 4KB5A 7ADHA 4LISA 1M6HA 1F7VA 2HDOA 3AKDA 3HYCA 1WXFA 1Z8HA 4NULA 5COAA 5AJXA 5DRYA 4CTKA 4CKBA 4TMYA 1D04A 3UKOA 3C5WP 2NO9A 1NYTA 2QW0X 3A1FA 3B9QA 3OPYA 4LXYA 1JR6A 4D9EA 1XQVA 3T3DA 3H5WA 3JD1A 1WBDA 1YS9A 3EEIA 1VE1A 3HKBB 1AM4D 3FDFA 4RPKA 5KSZA 4QDTA 2AQIA 1GQOA 4WZBA 3GLIA 2VAWA 4E6EA 4PU0A 2VF4X 5AO9A 3K71B 2VWQA 2CW5A 2CN1A 3AQIA 1VQMB 5MF6A 1JFVA 1HQYE 1CETA 1GEGA 4ID9A 4L9AA 4RK7A 3V4PB 2AJCA 1XMSA 1GZ7A 2WSSA 1QZUA 4RY0A 2Q45A 4TX1A 1L1FA 1A95A 2F4NA 1UJBA 2XQGA 2UU9B 3UJ9A 1QANA 4L57A 1UL1X 1ZXBA 4KQ1A 13PKA 1P5JA 2GF2A 4PSCA 4DM4A 5BY2A 2LCFA 3EZFA 3AL3A 4AN4A 3LZCA 2CGEA 2RAVA 1VL6A 4TTRA 4Q9IA 4E11A 2H65A 5TE9A 5KIAA 1JG6A 4K46A 4XIJA 3ZC3A 1FQKA 1HDZA 1VHWA 1R6BX 4MUHA 4RKFA 1RRPA 2W4MA 4IIEA 2QSUA 4R41A 4XR6A 1Z5OA 1GPWB 2WU0A 1V2GA 1O0SA 4HXGA 3WBBA 3FRIA 3Q39A 1PGQA 2FPSA 4YPVA 1TQDA 5I6DA 2XNDA 2Z8ZA 3C16C 3JQBC 1AHHA 2X7HA 5KQSA 3ZWCA 5JZBA 2FKAA 3SKXA 1RKQA 4ER7A 3FHJA 2FLKA 1NNUA 5EY5B 4MGKR 4E88A 4DDWA 3FYUC 4BLVA 1XE3A 3Q98A 5AKEA 4KBYA 3STWA 4UTXA 3LLMA 4D4HA 1XJ0A 1DDIA 2OM6A 4EUHA 4YA6A 2QXTA 5KEIA 3W1VA 1P33A 5G4LA 1TMYA 4RFLA 1P4MA 1YL7A 4CLRB 4BB5A 4DBLE 4DXDA 2OT3B 4YJGA 2DJIA 1E43A 1JUDA 1KYWA 2YVLA 3FMVA 2XTNA 4KQEA 4WCFC 5D3QA 4BP1A 4EAAA 5KJ1A 1H9CA 1JR4A 2NACA 3MWLA 4FJ2A 3CR3C 3M2TA 4ENPA 2IF0A 1AKQA 1U0TA 3BSWA 3HFJA 4G9BA 1K8XB 1UD2A 1MOPA 3D7RA 4JMPA 2QT0A 3DLTA 2M1ZA 2EHDA 4KAJA 5EJAA 1I4DD 3S2IA 1YR3A 4J3JA 3CC2B 2FPPB 3E0QA 2ZITA 2P8JA 2X9LA 2QKYA 1JDBC 2HNAA 3VYSB 3THYB 4EY4A 3GZTB 4UTRA 4I8IA 1V6AA 4UJ5A 3C3XA 4MAMA 2IXTA 2P62A 2ASEA 2CDRA 4N5NA 1RTTA 3AKCA 1EZ4A 2NV6A 4WESB 1BO6A 2CFOA 4FC6A 5KSOA 1JEQA 3KWJA 3IMKA 4RAOA 1TQ8A 1NF8A 3LQ6A 1DLJA 1YO6A 2DHCA 2JKZA 2IUSA 3EVNA 1PQYA 3BTVA 3K0CA 4DMKA 2AFHB 1IC6A 4FD3A 4EATA 1L7OA 3ZEIA 1A8SA 1T29A 1THZA 1U8UA 5B1EA 2FHPA 1A82A 3LCJA 4RFSB 2RGEA 2BGTA 2XCRB 2ZJ4A 4YJ3B 2EHJA 3I23A 1CZRA 3RUIA 2QQ5A 4MW9A 5LL6P 2F8SA 4XWKA 1E1YA 3UT0A 1FXWF 4EG5A 5JCJA 2IYXA 1UFKA 2Q5QA 3BF8A 2OLJA 3CEMA 3EEBA 4E2YA 4EABA 3O4GA 3M9XA 3D3QA 3OPXA 3B13B 1QRUA 3KXDA 3WYDA 1CSEE 3EBLA 2IOHA 2ZI5A 3DFIA 1XNQB 2O0HA 3WLRA 4MROA 1OAOA 1KMCA 1GU7A 2XZDA 3BGSA 3IPAA 1XZEA 2Z5GA 2CNWA 4D0SA 3CPXA 4V1CA 1SD5A 3UXYA 3M34A 3R0QA 2VC2B 2HZ7A 1E3ZA 2VJQA 4IVPA 4MJXA 3WIDA 4URVR 1XDWA 5ALIA 1D6MA 2JC3A 3CE9A 4KYTA 4JP8A 3T12A 2UKDA 3KFVA 2QHXA 1BWQA 4MPDA 1CS0B 3I01M 2F90A 2J3QA 2AJDA 1Q7YD 2HRCA 4HTFA 5DLQC 3UM9A 1U80A 2O8VA 4CEIB 2PX5A 3EPHA 4PYLA 3RC9A 1WPXA 5IX8A 3KJIA 3VU8A 1UP4A 2NPOA 3RIYA 3QUBA 1ZVVA 3V9PA 1N3BA 2YS6A 1PFWA 3R4CA 2PKEA 3ET4A 2FPUA 3B1YA 1SG0A 4XONA 2IOYA 4GT1A 4TYMA 5E9JA 4GP9A 3ZY5A 5FTLA 2V58A 2QJTA 1VLVA 3RSSA 1KZGB 2REBA 1M73E 3NWBA 3PWTA 3ZJTA 3HA2A 3MOSA 2VHWA 3T0IA 4D74A 1TTPB 2QG6A 1Z36A 1Z0JA 2IEAA 3OQIA 4BO1A 2G25A 5FLEX 2WHQA 2M6SA 2JEYA 3LC2O 5G02A 1Q7RA 3RBAA 2YHAA 5JHGB 1NB9A 1XJ5A 1ISHA 2W0MA 2ZANA 3B3FA 4QQ8A 5JWRA 2ZL7A 1U6JA 2QR2A 2YRFA 2XMPA 2B98A 3AYZB 4MO9A 4KSBA 4RZQA 9LDBA 5LYJF 3EW7A 1YR7A 1PR9A 1U0EA 4TV8A 4MSUA 1STOA 2C84A 4I4CA 1NAHA 1QIKA 2ATXA 3MLAA 1P81A 3KKEA 1UJ4A 1VRWA 4P0TA 4UAUA 4XDZA 2Y66A 5JNUA 4F91B 2I99A 3ACBA 3AP1A 2I71A 4ZVUA 4MMYB 4YREA 3ZDCA 3CRQA 3RSLA 3NXSA 3BERA 2HTEA 1FFEA 2YZKA 5DN9A 4EF6A 2QN6A 1HPLA 1Z7EA 5JAMA 1FRFS 1PZHA 2ZAYA 3PDHA 4DM7A 1ZD5A 2Q0SA 3GWGA 1U2EA 4KCGA 5JYBA 5TX7A 4RD2A 1RRKA 1P1IA 1IYZA 4LF9B 3D4NA 1EBFA 3D6VA 5AJYA 1B8NA 4AO7A 2BM8A 5HKKA 5FIUA 4OLJA 4U0JA 3A10A 3LT1A 5DT9A 1EAYA 2FFQA 3AESB 3KOZA 1WPCA 3OZ7A 4KEAA 5K3DA 4C7MA 5BN4A 5I9NA 3MA0A 4PQFA 3ZBTA 3E05A 3WDLA 4E2ZA 2Q3CA 5HS4A 3L7IA 4ZVKA 1GU0A 5JD6A 1V5GA 3CPJB 5J59A 3PTAA 3IO5A 2G76A 1UZMA 2CHQA 3H2SA 3UMMA 4B7UA 2JLQA 3NI2A 3RVJA 1OI2A 3PNBA 4BX3A 3OIFA 4GL2A 3FZEA 4LRQA 4Q15A 1NRWA 2OFOA 5A3JA 4MJLA 4UE2A 5T4EA 3QXGA 4JIMA 1JLRA 3UYKA 4XKWA 4NE2A 2KBFA 4QU0A 1XTVA 4D80A 3P2OA 4DF3A 2WKWA 5K51A 2HM7A 1KBQA 4XX1A 1QTQA 3MJEA 3C45A 5BSVA 2JFQA 4JXXA 1BVRA 4XL9A 5A7GA 1GGKA 2VP4A 3A1NA 5KS2A 2W98A 3L2OB 1LPNA 2GAIA 1EEXB 3PUYA 1AVTA 1R0WA 4K6MA 2X9QA 1CC1S 3DNFA 3GROA 4HY3A 4HWOA 1BH6A 2CMGA 2XEDA 5DGDA 5DW0A 1F2UB 5G4KB 1SKYB 5GOTA 1E6WA 4YAJA 3SG0A 1TD9A 4ZEMA 5LQDA 2FFHA 3E2MA 3AW9A 2VJAA 2VZ0A 1TZCA 4L6CA 4OHFA 4CMKA 5EIBD 1V9LA 3LRTA 1NF3A 5BUCA 3PJRA 3MZ0A 1XFAA 4FW8A 5DSTA 4JU8A 5CT4A 2C7QA 1GQFA 3MFYA 1V8PA 1VLHA 1E77A 3R9XB 1GZHB 1QCZA 2KPOA 3FNIA 4J7UA 4GX0A 4IOKA 3T1TA 2XJ4A 4BNGA 3LK6A 3K9WA 4PIMA 4FGWA 3LDGA 1JAXA 3ASYA 1KJJA 3PX2A 3L18A 5AVQA 5G41A 5J2UF 3HJAA 1GAJA 2I4TA 2OLEA 4C0BA 4RY2A 3L3BA 3G2QA 5JI3E 4F85A 3WZLA 2VZLA 1L7NA 4FFPA 4ZOAA 4EGAA 4D99A 1DO0A 1JSCA 4B1FA 3NS7A 4Q9DA 3SHFA 4X64B 4G0OA 2FJPA 1VDMA 2YMLA 3A2LA 3GFBA 1MO4A 1A2OA 5HQJA 1TYAE 4EYEA 2APJA 5HCNA 3F8TA 1F8GA 3TTXA 1ATIA 1VXOA 1SG6A 1Z56C 1B8OA 2ZB3A 3MJDA 4BNYA 4PQEA 2CLKB 3PFFA 5C51B 2AI3A 3KELA 3KKZA 4FU0A 3KQTA 4FKMA 2EJUA 4C07A 1X15A 4TLEA 3U3OA 2Q21A 3LWZA 4J75A 1ZD4A 3WLTA 1UD3A 5K8CA 3BT7A 4YHBA 1UZAA 2ODNA 1EK5A 1X7HA 5LFAA 1EXVA 1LDEA 4BMOB 3C3CA 3SIRA 2AZ4A 4LQLA 3IOMA 3I5MA 2YJ4A 2GN1A 2WWRA 2XDWA 2ZT5A 4NPHA 1YRAA 2SECE 1SPXA 3WI7A 3I9JA 4C6RA 2QEQA 2QRUA 2W2KB 3IIKA 1U2GA 2V3VA 4JLDA 5A3SA 1HYHA 3DM9B 4ZO4A 2X13A 4MLCA 5IVDA 2Z5VA 3DAYA 4XUGB 4UATA 1VBNA 1Z6AA 2JZCA 1V1MB 4HLUC 1E9DA 1T3ZA 2ADMA 4X41A 5ECWA 1KMMA 3VTAA 4YCCA 4JYZA 4HQ6A 2Q6OA 1GRCA 3IV9A 4OHMA 4B3DA 2R6AA 5CA0A 4O4JA 2X6QA 4R8SA 1D2AA 5CH5A 2I1WA 1KZ1A 4MW2A 3E9CA 1K27A 1P0QA 2WU1A 1QAQA 5GZ6A 2M2IA 3EJWA 3N8HA 3UWOA 1L7QA 2Q3MA 1MRZA 3GYGA 2B3DA 1II8B 2PKWA 2LUOA 5DXFA 1NN1A 3ZJ4A 3L43A 3H9GA 1IZ8A 3I3OA 1JSZA 2IHYA 3WWZA 2CJYA 4ICIA 4UNRA 1JA0A 2GEBA 3QKWA 4BLTA 3Q38A 1B73A 5FO1A 3KOMA 4CT4B 4EHLA 4GEKA 3IKTA 2A9FA 1HRKA 2WYOA 4MUYA 2MJLA 1IZ9A 1NN0A 2QN2A 5E8JA 1UANA 4X1OA 2DIEA 2AX4A 4GI2A 4DZZA 1TI7A 5K8TA 3Q0IA 5TPWA 4YBRA 5IJ9A 3PFIA 3DE7X 2X4DA 1G8GA 4PVCA 1NUHA 2EF0A 1HTWA 4II3A 3A8TA 4M8SA 3GT0A 3Q7EA 4I3HA 2EZ4A 5HPYB 1R2QA 4G5XA 4Q9HA 1WY7A 3B8EA 4JJ6A 3ONWA 4HHEA 1NQXA 1ZH0A 2YS7A 4ZGNB 3FIUA 2JL1A 4MV1A 4P4LA 1Q0UA 2JAWA 5G0SA 3JRXA 3O1HB 1U0FA 3GN1A 5DTRA 2VBUA 1Z0SA 3EULA 4J0QA 3F97A 1ZCFA 1JGTA 3H13A 4EVRA 2D1QA 3TNYA 4QLBA 4A7PA 1P5RA 2P2LA 5G0WA 3WGYA 5CLHA 4MKFA 2B1GA 2WSIA 4ZV4A 5DTMA 5T7BA 2D2VA 5K09A 2WJAA 3DE1X 3FCUB 4NQZA 4E94A 2Q7OE 4LBZA 3WLFA 4L0MA 3JVUA 1VIYA 5LNK1 1SUBA 5GZ1A 3IT0A 3TKAA 1VYTA 1HVXA 2I80A 3TZEA 4NFSA 4OMUA 3EB9A 1E2EA 1S72B 4MKRA 3B89A 3G2KA 2R6ZA 1X38A 2WI8A 3WTCA 2QP9X 4DV7B 1WD7A 2R6CA 1QQBA 1ZJ5A 5CDYA 3IIEA 1NHGA 4OIFA 4BN5A 1FUUA 2QNRA 3O2QB 5JBQA 1RQ7A 2QIPA 2IA5A 1ZMTA 3N59A 1FFGA 2VS1A 4G23A 4PYQA 3PR3A 4RKYA 1ADCA 3U26A 3KR9A 3WADA 1SBIA 1QDUA 1QHHB 4Q16A 4RSRA 4ODIA 1NKVA 3QV1A 4FMCB 4XVHA 3TTUA 2HMYB 1YULA 1FU7A 2C4NA 2I6TA 1K68A 1Z35A 5A9RA 3KQHA 1V71A 4JP1A 3TWOA 5T8KA 4H7JA 4J43A 4MHSA 1KE2A 5JUWA 3KYBA 1UUFA 5SZJA 2FZKA 2O2JA 3BAFA 1P6UA 3UBMA 4DM3A 1XRSB 5F7XA 1EWTA 1ANKA 4Z2AA 1J5XA 3HU3A 1DCKA 1HDYA 1P61B 4R7GA 1VIVA 4CXMA 2D7DA 5ESWA 2OILA 4Q4HB 2IUEA 1BXRA 1JDNA 4W99A 3U61B 4P1VA 1M6EX 3A4VA 1ZOIA 4ZVMA 4IQ4A 4WNIA 4P4GA 2BFAA 5CDHA 3PXEA 2FPRA 2IEIA 1AB5A 2WZBA 3RAPR 3R77A 4MRRA 4DR7B 1DRJA 2OSBA 1B76A 1XAHA 3ENQA 3PTZA 4J07A 3T38A 1PDOA 2Z2KA 4C3ZA 3LK7A 4NH4A 3NHYA 3V1LA 2E0IA 5B3KA 4IIXA 1W9HA 4UW9A 3HZOA 1N8SA 5IBQA 2BPOA 1P5HA 1Y3FE 2X7JA 2YHIA 1F6DA 3CQ9A 4CKZA 3VU1A 5CJJA 2DMRA 2VSXA 4NG4A 2O14A 3WFJA 1EAMA 1Z75A 4A23A 2PH7A 2DPYA 2QMHA 3FPJA 3QBEA 2XYGA 4FJ1A 4B4VA 3TK1A 4BFZA 3H5RA 3I8XA 2QTNA 1FYXA 3AU9A 1RAEA 2FMHA 4IQGA 1GL6A 4M0FA 4TLCA 1AZTA 1UMBB 3HI4A 3O03A 1HT0A 1XZGA 1WMSA 1FB5A 1TA4A 2FFBA 4RPJA 1SIOA 2CLCX 4IM7A 4X94A 1LSOA 2VHXA 1P9RA 4CMCA 2BM1A 1FVHA 2H1RA 3OE4A 1Q1EA 1Y48E 4LVOA 1RQGA 2JFWA 1DKOA 5HWSA 1M0EA 4NAUA 5C53B 3GFOA 3KQUA 3E8MA 2CFCA 1TC2A 3AF3A 3SZMA 3RAJA 1NQAO 2KW5A 3EG9B 1NJID 4I50F 4ESOA 1WW8A 3QYFA 2IPNA 3L7DA 3FPEA 3U9TA 1VE3A 2OL4A 3AIKA 5BSKA 2V6BA 4WFJA 1N7JA 4E33A 5HUQA 2VXCA 5HP4A 3K70B 1VQ9B 3DZBA 4BJHB 3H3XA 1A8QA 5KJCA 1CY6A 3VPFA 1RBMA 4NFHA 1MX5A 3I72A 3OMWA 4Q12A 5AUPB 1EFDN 3ZQKA 4EPTA 1G21A 3IUMA 4V3CA 4PLZA 3W4IA 1DBRA 4HPWA 2C1EA 5CG1A 3SS7X 3ONFA 3KVVA 2C29D 4FLEA 4ZC8A 1N6NA 5DS0A 4RF2A 2DAPA 1ZQ1A 2NTNA 3CNNA 4MH0R 3TJZA 4DT1A 5AFSA 4U02A 3L5KA 4GM1A 5LZ9A 2WYWA 5JAHA 1BW9B 5C8YB 1JAYA 2PSDA 1FZTA 4JBHA 1I18A 4S24A 3SM3A 2MINB 2K4MA 1UMDA 4H1HA 1THTA 1SEPA 5FAXA 2E1BA 2W6IA 2Z95A 3LQYA 3KPUA 3OFJA 4Q3BA 4P25A 3CTMA 4FGKA 1TAQA 3LY5A 3NHUA 4HNUA 2CHFA 4JLKA 4FFBA 5B37A 2GKSA 3FOZA 1Z17A 2GAAA 5L46A 3N3AC 4YRAA 2DR3A 4YELA 4N3AA 3ZH9B 1YACA 4KKSA 4GRDA 2WLTA 2GEVA 3ZWOA 2CZCA 3LC0A 4K05A 1A4IA 1X19A 1W46A 4Y2UA 2O3JA 2Q6IA 4U7TB 3W9YA 4CGYA 3ZUGA 2NYAA 3I30X 3MN1A 2VJMB 1ZCJA 1ISSA 1NW3A 4JUFA 1BYIA 4BE9A 4BZXA 2MWMA 1BFKA 2BDUA 2PKRA 2Z6UA 2YX1A 5EJIA 5EESA 4E51A 2NU9A 3UENA 1O77A 1YHZA 1K7FB 1MRSA 5AJWA 5B4UA 5FH9A 2J59A 1O96B 4R1TA 1QK5A 3KE8A 4YRTA 2R60A 4RL6A 4FQ5A 3SQMA 4KVZA 3JS5A 3NE5B 1CG6A 2HA3A 3K6RA 3NW9A 3LCMA 2C92A 5CDFA 3I2JA 3JD4A 2FUKA 1IFXA 2JJQA 3OCXA 4M3NA 3GLGA 1NRXA 1ZPDA 3ZCTA 2H08A 1T6NA 2GWRA 1V8BA 2ZJ2A 4RD1A 4UNQA 3RSZA 3TGLA 3PGLA 3AF1A 3T7RA 4YPOA 1N9ZA 1I7QB 3P2KA 1J25A 2PS0A 4M49A 4KVGA 3D4IA 3FCEA 1PX0A 3ICPA 4NNOA 1IMOA 1YB1A 3DMNA 5J5AA 3GJ7A 3NVMB 4C20A 4D9HA 3O8LA 4LOAA 3RG2A 2BFBA 2HPAA 1MORA 1FY2A 2DUMA 4OJNA 2V65A 4XFJA 1BXGB 1ZVKA 5CM8B 2JLZA 1IHYA 5G3YA 1W1WA 1JW9B 3HO8A 3ZVMA 4ID3A 1P9WA 1YI1A 3SOZA 4YT5A 2JCSA 2JIMA 1H1LB 1QHIA 4DUGD 2WTBA 1N2IA 4BO3A 1U5AA 4Q3DA 2R85A 3MMPA 2JAOA 2VYVA 3I1YA 1Y8ZA 3N8IA 1PR0A 1X7DA 3QMWA 4RLHA 5ECYA 2V0GA 1IG3A 2ZJAA 3MSXA 4F5DA 4KITB 4O2BA 1UP7A 3ZLUA 2J07A 2Z6BD 2P1RA 2BM0A 1WX1A 2G5TA 3BS4A 1E7MA 3K96A 4LWPA 4R2XA 1JKMA 1CY8A 1RHMA 3E27A 5A2QA 1PUIA 1Z25A 3CJTA 4JA0A 2X5NA 5TQ0B 3AUUA 3ZCUA 5BN3B 2IYZA 3BCSA 5IDVA 4IHKA 2BAGA 4HC4A 4N8EA 1M2EA 3LFTA 4P53A 4IWYA 1VPDA 3CMCO 2XMDA 1PJZA 3NC0C 2Q8NA 1P7YA 4PO8A 1KKMA 4J4TA 3TDMA 5ALMA 2NSHA 2ZI6A 5E6SA 3PA8A 2QAGA 3JPYA 4WHMA 2P2CA 3V2UA 2MYNA 3VR3D 1WXQA 2F67A 1VMIA 2VT6A 2IYRA 3EN0A 3NWJA 4XQEA 5I48A 4M1WA 1ECJA 4M99A 3S40A 4KN9S 2GZRA 2C7PA 721PA 4DVGA 4DKJA 1MW8X 2JI9A 1BQ3A 2Y8EA 1BVUA 5HBGA 1PVDA 3WL8A 2KS6A 1HE3A 2ZQ5A 3OFVA 3C8MA 3W7BA 2GD2A 3BY1A 5H68A 4E3ZA 1U1DA 4I3GA 4EDHA 2REXB 2D3LA 2V3CC 1NF9A 2XQFA 4E3WA 1UQRA 4BEBA 1PO7A 5MGBA 2OV3A 2FCRA 1L5GB 3VVLA 4QWMA 4PG6A 1MPTA 2CK3A 2P5SA 3H2ZA 2FW7A 2VP6A 3KXLA 4KR0A 4FR2A 2ZTGA 1B15A 1ZW1A 4WAUA 2Y93A 1JSXA 5DHPA 3NOQA 1ODIA 1AXGA 5CXSA 1TGYA 4MCHA 4E14A 1UOQA 3CLSD 4Y2JA 3PNOA 1PVOA 4RANA 2ZETA 3QEOA 2FAXA 3GL9A 1SK8A 2PWBA 1SCJA 4AF8A 1FZQA 3TIFA 3EGVA 1AHNA 3REOA 1E3WB 1AXEA 1H0RA 2BBSA 2YOHA 4RE6A 3KZKA 2Z8YM 2OXIA 4QHSA 3G5UA 3B52X 1TQHA 3G5MA 3G6KA 1NT2A 3FGNA 3HNRA 4XJVA 5D00A 4YY3B 5E1DA 1PSWA 2VRNA 1WTHD 2LIVA 3EVGA 2H3HA 3IJRA 4JNKA 3WXBA 2FHSA 4B2IA 4X66B 4AMUA 1AD2A 4Q03A 4CU2A 5KYYA 4BO0A 4A1OA 1G98A 3H16A 4WK2B 4Z99A 3SEQA 3EXG2 2GS9A 1BCSB 4GX1A 3K0EA 3KKOA 3OHSX 3ZWWA 2JH8A 5IU6A 1RZRD 3P0EA 4B17A 3SLKA 2WE8A 3LO5A 3VI4B 4DB4A 3HR8A 1LV8A 2H85A 3X1DA 2Q7DA 1QGED 4H2DA 1GQSA 5CYPA 4HDNA 1UKYA 2RG7A 1UAYA 1TF2A 4JKYA 5D01A 5D3ZA 1H42A 5KCMA 5JTUA 1MNQA 5KNLA 4IW3B 3LO8A 1HL3A 4QYIB 4R54A 3MOIA 1UXOA 2BBTA 4V39A 1UKVY 3PNMA 4X45A 4C7XA 4DSTA 1V1RB 2I3DA 2Q3JA 3V33A 2GTPA 1LS6A 3R7WA 3NLLA 2AMLA 1UPXA 2CDCA 2OUKA 1J8FA 1ZZGA 4AX4A 2FOLA 4GPAA 3F3YA 3DJFA 3OD5A 3PWSA 2ZXEA 3CSDA 2AW3A 3HY6A 4XCVA 2RMKA 3QVMA 3LQFA 1I5EA 1DG9A 2FFAA 5D3KA 4UAGA 3QEKA 3R9IA 4AQDA 4DQXA 1CYEA 3ITNA 4OQEA 2NO1A 4NFYA 1E4OA 4ZVOA 2R6GA 3UK1A 3C8HA 4OFZA 5IYZB 4WNAB 5AI6A 2PL1A 3V4ZA 1RYYA 3H6GA 3S44A 3WISA 4R8MA 2VDJA 5BOVA 2GESA 3BDAA 4MV3A 3H6KA 4XRRA 4B73A 5IARA 3WGZA 4YRZA 1DAGA 5L6MB 2NZVG 4YUWA 3FXAA 4U9HS 2BFFA 4EENA 2R11A 1V16A 4WZAA 4JEIA 3SDBA 2J48A 1B00A 3H9QA 3B85A 3LUDA 4AJIA 3DO8A 1AQUA 2XGMA 1OKKD 3EGEA 3FVWA 3NHBA 2CMKA 3P96A 4B3XA 2QRVB 1L4BA 3PGKA 4JOQA 5CT5A 5BVHB 2GR9A 3IOYA 3W8RA 3IOBA 3BJMA 4JMQA 1VG8A 4GNKA 1O6ZA 2OGUA 2Q9BA 4ZXFA 4XDHA 3DW3X 2X85A 2AZXA 4ZCSA 3AJEA 5IBPA 1GAWA 4KU4A 4ZQCB 2VBFA 5M5BA 1SQ5A 4DCUA 5PGMA 2D8MA 3DMTA 2PMEA 4WK0B 3V1KA 1P0IA 5JS1A 2X6XA 1X14A 4KO8A 2CCGA 1IEXA 4S1OA 4YCAA 4OP2A 3T95A 1G1MA 2AC2A 2J7PD 3LDUA 3RO7A 1MO6A 3L6DA 3VNSA 2VHYA 4Y7CA 4WNYA 3JD0A 2C98A 1NXXA 4HX5A 4NMLA 5GVRA 3V4LA 1CUGA 2YWJA 3H1TA 2Q0XA 2VHCA 4R3UC 2PM8A 3WB2A 3LQQA 5BP7A 4BO8A 3GPCA 3AUXA 5CT8A 5IFLA 3FA2A 4B7AA 3JQQA 1ZM9A 2CEKA 2PMKA 2VDWA 1YJXA 2QY6A 4UARA 1U0JA 4X44A 5CYOA 1RRMA 4B85A 4OPMA 1PAUA 4BVKA 1TZMA 3DAHA 4HWGA 4LI0A 2DLCX 1K98A 1W0KD 2PT9A 1S2NA 1QKJA 1Y4SA 4RHXA 4D26A 2O07A 1X92A 2PUHA 1CJMA 2GN6A 1R0BA 2B2CA 1YB7A 2H3EA 2IE0A 2Z5FA 3DMPA 4M7OA 5F2EA 1Y3AA 4U39A 3CZAA 3DZHA 4JB0A 1OHHD 1XPJA 3R2JA 1GZ5A 1N8RD 3BOSA 3NZEA 4R5MA 3SAJA 5KC9A 3U4QB 3ZH2A 4M1EA 3PQ6A 1L4FA 2WF5A 5LZ5A 3K32A 1ISMA 3IT3A 3WGHA 5AD1A 2C96A 1GN8A 2ZYAA 1N6PA 2FW9A 3KXPA 1WEKA 4XLEA 2G82A 4J3FA 2BGIA 1KPHA 4HD8A 5KSWB 4FMDF 5F3WB 3N28A 5KNDD 4O2AF 4BP8A 3U16A 4O4LB 1OWMA 4BEVA 1N33B 1OR8A 4HUQB 3IB6A 3TLJA 1IJKA 4NZMA 3L8EA 5JPCA 1X94A 4EB0A 1MABB 1IUKA 5IJXA 2IITA 5FRDA 4QEKA 4MUNA 1AF4A 3U5TA 1O1YA 3KOYA 2BFDB 1DC4A 2FU5C 3FNFA 4HL6A 4WFIA 2O54A 5K2OA 4BN4A 3ASUA 3HB9A 3QHPA 3EXIB 4NCKA 1OSNA 2I9KA 1HKUA 1T1IA 4RJJA 3AVUA 4PQGA 2MSNA 4B3GA 4IJMA 4PLTA 1KEUA 3G0HA 3C8DA 2R6DA 3I9V1 4PHGA 3CXCB 2NPIA 3DE4X 1S8FA 1C3LA 5IRCD 4JR1A 3PRJA 4PZZA 1RJ9A 4RPGA 1P2TA 1OE0A 5H8WA 4XQ9A 2ZBFA 2P69A 3GAMA 1JDZA 4AC9A 3HNPA 3BSYA 1WOMA 1LTHR 2BJVA 4IPTA 4ZVNA 2P7IA 4YJ2F 4TV9B 3WVNA 2ZYDA 3UKDA 3V8MA 1K5GA 5CB4F 1U3WA 1JDTA 3B6IA 4EFKA 5C8ZA 1RZ3A 3EBOA 1GAXA 2IX9A 2QXYA 4LQDA 3UJ3X 4C6TB 3UPDA 1RADA 5HR5A 1QG6A 3H3JA 4JT9A 2H5EA 5TVKA 4TS3A 2D62A 2Q5FA 2UYGA 4X1IB 4E7OA 5LKAA 4MWDA 2OFFA 1AT1A 4H7KA 4R2IA 1AGXA 3DKKA 3EZNA 2Q1WA 2X58A 4D6PA 3AIMA 5F7ZA 3KHSA 1ECGA 3PQ2A 4R1SA 4KIFA 3O8OB 4ER0A 1JWLA 1PIWA 2VBVA 3V34A 3HNOA 3KSAC 1TZKA 5LMUB 1W4ZA 5KYWA 1B1CA 3AKEA 5F73A 5F4JA 4QBTA 3THXB 2Z5LA 3ROTA 4HDMA 3O8BA 1CUFA 4OOXA 3ZPNA 1J23A 2GBGA 2J4DA 1YQUA 2DWQA 4JB8A 1TD1A 2YINC 3NAGA 5EUBA 2Y3IA 3JAKA 2IYFA 4WV3A 3HJHA 1GR1A 2QSYA 4V0OA 1VE6A 2B7LA 1JBKA 4MRVA 2YV2A 4CNQA 1R0CA 1O6FA 1QC5A 1Y6RA 2NMVA 5CLFA 3TINA 1ZUNA 3R3XA 4BBAA 5AIBA 4HWRA 4FQ8A 5DBOA 3WWPA 1GCUA 2V7GA 2VYND 1QOQB 3IVRA 1BMQA 3WLEA 2CV0A 4EH1A 3H0EA 2ZK7A 5JPIA 2C8VA 4R83A 3GD5A 2VQDA 1E7YA 3DCJA 4MQUA 1XK6A 1ZM2A 1RZVA 2BCJQ 2GBLA 5COBA 3MMZA 4UZSA 3RODA 4EITA 2I33A 2ZRQA 5HKOA 5HJ7A 3TSOA 1YTUA 4GKJB 4WEOA 2IS6A 3IP9A 1S5PA 4OJYA 3RABA 4Q82A 4EO4A 1ZGAA 4E2XA 3P0IA 2YC2C 1HEYA 1PR6A 1NBMD 1Z3CA 1WSWA 2HU5A 3MIIA 2GEFA 1VKJA 2N9UA 3RSGA 3D6AA 3E9NA 2W6MA 2JLRA 5GWXA 1QP4A 3CRRA 1NASA 2P67A 4CF7A 3AUKA 4EY8A 3GZJA 2IODA 1YZ3A 3I52A 4J9VA 4NIMA 2GPJA 3EPLA 1NW7A 2I7XA 3UMRA 4DNOA 4HN2A 2GM5A 4DYDA 1YFJA 1U31A 4TT3A 1L5ZA 2XQKA 3P26A 2VAPA 1YMVA 1L7VC 4ADSG 4FN5A 2WOJA 3ZKAA 4D9FA 2G88A 4AMGA 4OHWA 2NXJA 2PXCA 4OUKX 2JGAA 4GF5A 3U6KA 3OURA 4ANFA 2D1YA 3BHMA 3QI7A 4IV8A 1JVBA 4QO8A 3G13A 4JVNA 4EM6A 1OA0A 1I51A 4OM7A 3CZRA 4KQMA 1U2RA 1EA5A 3H9CA 5DHRA 1QZXA 3PA1A 2GPWA 3E3OA 3WIBA 5FA5A 4CL8A 3WYEA 1WR8A 5JXGA 4WMLA 4Y2HA 4BNTA 3AXTA 3SP1A 821PA 2RH9B 1U63A 2VYQA 4ZPXA 2ID4A 2RK4A 3N2KB 4ZCPA 4GYJA 2OBRA 1MXFA 3D9QX 4E15A 2Y1KA 1Q0LA 5FBVB 1QH8B 4G8JA 4JLSA 3L0SA 3QEJA 4MZDA 2IYSA 3R3WA 1N3LA 4XIYA 4TKVA 2IZZA 2PHZA 1DJMA 1JJAA 4QJ5A 4B84A 4NV1A 4E03A 3GLQA 1JTEA 2OVFA 4JS0A 1KDTA 4RD4A 3FJYA 3MT7A 4RVDA 3TQQA 5BR8B 4BZPA 2FG7C 3DF9A 1I3MA 3DXYA 4G37A 4MRNA 4RF4A 5HDQA 3GEGA 3LX5A 3TKYA 3A6KA 4G2NA 2JFPA 2C31A 2G06A 3MS7A 1ADGA 1NA5A 3EY4A 4Q21A 4WN3A 1UOOA 3P0RA 4YNBA 3VR6D 1DAOA 4ZIRB 1EM6A 1NMQA 3M1YA 3UWPA 5JCPA 4QXOA 2FW0A 5KDOA 3HO1A 5IDWA 1VLYA 4BVAA 5KNCA 1JNYA 1T9BA 1X6VA 4PAAA 4FHDA 2IU3A 4WZ6A 3ROEA 4LHEA 3NM6B 1DKMA 4LY0A 1N2EA 3QUTA 1VL2A 4WUVA 5EC8A 1B3RA 2QUBA 1N6OA 3BMQB 2RSLA 2ZIWB 1O8BA 1RABA 3QBDA 1E99A 3OG9A 1NURA 3R1IA 5L7YA 4A5OA 4EOGA 3MLBA 3UCXA 1D4ZA 2DWCA 3WNZA 1XKLA 4GW3A 4OXNA 1SC9A 3CONA 1QFMA 4RYDA 1C0LA 4AZ0A 1C9DB 4CKEA 5BQ5A 4NG5A 4H08A 4CCYB 3RHZA 2QBYB 3H5NA 2GYUA 4IH9A 2GASA 3O3OB 4YHHB 4E46A 1OOEA 1AK2A 1VP3A 2PZ8A 2G7MC 3L1VA 4LPSA 1U2DC 2Q6TA 3S1SA 4Z4RA 1PUJA 1NQOA 2UZAA 1VQ1A 5ISMA 5GQSA 2E55A 1K86A 4W82A 5I9LA 4WE3A 4DLTA 5KOJA 1QAOA 2Q9CA 2XNJA 2I3GA 3A06A 2NUPB 5J9FA 4KVFA 1ABFA 4GMGA 3K4QA 1T9GR 4PGHA 3EDMA 4Y2VA 4QPNA 5DM0A 2PZLA 4AO6A 1Z5VA 3ZWBA 3ZD9A 1VJ0A 4EZBA 1H94A 1Z4QA 2CNKA 4MP6A 3KAJA 4BLWA 3OEHA 3MWKA 3IQZA 2VYFA 4JLBA 4RUKA 2ZP1A 1JFRA 2ZVQX 4DRZA 1FTQA 5IAJA 1SHKA 2AMYA 3ND6A 2WKSA 1Z68A 3NORA 2NYRA 3GX1A 3Q9NA 4EJSB 5EINA 1VQPB 3HLYA 3JD2A 4MWOA 5CFQA 2A92A 3P2IA 4HDOB 4FK8A 4FZ5A 4PC6A 1E9BA 3NHPA 4FDAA 1KERA 3OFKA 1ORWA 2A5LA 4XQGA 3Q9SA 3H2KA 4O1MA 3JAWA 4WKBA 1Z4LA 1C9MA 2A84A 4HOYA 2NU6A 4E5VA 5HG0A 1QWOA 4ND8B 4U00A 1DWPA 2BSXA 3BWBA 3MGGA 3D4OA 4CL2A 2VK1A 4COOA 4OV6B 1MG5A 1ZVQA 2B3TA 3V8QA 2NPFA 4NATA 4YIKA 4ZT4A 3DG9A 4HMOA 3UW1A 3F6EX 3V48A 4TVSA 1H8HA 3ZIDA 5CFPA 4IGEA 2PUFA 2IUTA 4IDBA 3NTOA 5E0KB 5FBLB 3H18A 2EFCB 1FMFA 2V7PA 4Q1AA 1GRVA 1RXCA 4EWLA 3MHTA 1N32B 4Q7EA 5LQUA 1MV5A 1I3LA 2X8BA 3BB3A 1P9LA 1XTUA 2OHVA 1A9RA 3GLUA 2O2DA 4L2IB 5DKFA 2G9NA 3S1AA 1SUEA 1PT7A 2IXBA 3DBLB 3GZNA 5I9SA 2PN1A 2CJPA 5CK4A 1T3HA 5KOIA 1FMJA 1K08A 5I8WA 4FGUA 1SHLA 3WNDA 2H18A 3U3JA 5IKXA 1OLOA 1QRSA 3RW9A 3IT2A 4RQTA 4X71A 3EIOA 4DV2B 1M1ZA 3I62A 4ZI7F 1XD8A 1LKZA 4O4IA 2HHLA 3OICA 4WLOA 1X8KA 3OT4A 3PUVA 4KIWA 4KJXA 4MKGA 1OBOA 4Q6WA 4BO7A 2ZDQA 1HO3A 1KO4A 2FWIA 3EWIA 2VSFA 5KX5A 1RWWA 2EXXA 2IHTA 1L4EA 1H4TA 3ZHVA 1ZONA 3OT1A 2DC1A 1ULHA 3E23A 1SXJD 3I8SA 3ORRA 1Z39A 3OLVA 1WXXA 3IV7A 3FPFA 3E8SA 3UWKA 5K8VA 1DRUA 3AR2A 1I6WA 1KYTA 1DAHA 1E9CA 1OX6A 4IWNA 2J6HA 2BUBA 3B9PA 4N0PA 3PDCA 4HDAA 2PUTA 4OATA 1DZIA 3P19A 5DH9A 5HGJA 5A9TA 1SCBA 2I8AA 1PGOA 2EJWA 3QA3E 1EFKA 5AYVA 4ALNA 3CWZA 4PHTA 3ZE0B 4I1YA 1G38A 1SHTX 2PJZA 2W48A 3TH5A 1M0SA 3K8QA 3UA3A 4JJFA 4ETNA 2F43B 5GAJA 3RVKA 3V1MA 2FJ0A 1S2IA 4Y9TA 4FCTA 3DCNA 3PC7A 1XDBA 4F96A 5DXAA 3OZXA 4UTOA 1D03A 3AYXB 3U2QA 1XQ6A 4YAEA 3OMXA 1Z8NA 4ZREA 5CYFA 4UD2A 4AJNA 5EZYF 4N18A 1AQLA 3DE3X 1ZRMA 2C4TA 2V6MA 2GCGA 1F3LA 1CK4A 3A04A 4YH1A 1TM7E 2CLEB 5M2QA 3IDZA 2IS2A 2VCYA 4RH0A 1L7MA 4QRIA 1T1JA 4AZ3B 4BNDA 3QVSA 3DPIA 1ZAKA 3KT3A 4MQEA 4IIHA 4YQYA 2B94A 2VXOA 2IV3A 3S7TA 4CLEA 1JHMA 3GFTA 3GRPA 5E7IA 4YT2A 5KSYA 3FZNA 1QM5A 3A4IA 3HDHA 1WMEA 1ORTA 4DABA 1KMQA 1VSQA 1RRGA 5JFGA 2OBNA 1RP1A 4Y67A 2UZ1B 2GUWA 2ZTUA 2OESA 2HGZA 1D1TA 4F2HA 2H4YA 1KP9A 2QZSA 2PAAA 4R71A 1FFHA 1OLSA 3BWYA 1C7ZA 3KPYA 1XTRA 1KETA 2P6RA 1BD4A 1Q7BA 1HK7A 2QA5A 3VDNB 4H6PA 1GP2A 2IU0A 5H4HA 3B51X 2V7EA 3LW8A 3PJGA 5SICE 2R44A 1YD7A 1CUCA 1K3FA 1ZITA 3WXMA 1UBJS 3H1GA 3STUA 4DCTA 3OE7D 4HYTA 1T8SA 5K99A 4YT4A 2CXPA 3P7MA 3QGMA 2DU8A 4Q3AA 2G40A 3PV0A 1NVVQ 1XMJA 3FPLA 2PZFA 3C3AA 1KFEB 1RWVA 2JLBA 1WXEA 5LYJA 1V7QA 4B3MB 2C4UA 3IUEA 1ZIDA 5LXTB 1N0HA 1OGJA 1FNCA 4RK1A 1L5KA 1R0ZA 4C0HA 3H0KA 2R1TB 3U6BA 4HATA 4B48A 1YF3A 5FR2A 3MAGA 4MQ6A 1VMAA 4LV6A 2K7ZA 1YL5A 1Z2NX 1OYWA 1SVSA 2HD4A 5J2TF 4BLUA 2G7ZA 4KBGA 2A3RA 3LLVA 4PSUA 5AVKA 1M2OA 5KDLA 2QR3A 1PJ6A 3DDUA 3EDYA 3QPBA 1FU4A 4FE3A 3RAEC 4AP9A 1S96A 5HNKA 4I4TA 3OA2A 5FA8A 3J81k 2AN9A 1KMIY 1T0PA 1BOFA 2EZUA 2OZPA 3W7AA 2ZJOA 2QVYX 2Y6UA 4AS3A 3GVJA 4XSGA 2FQXA 4YJDA 3SXJA 4W7HA 3WB1A 2NADA 4MVJA 4L4ZA 3DTVB 2IYYA 1E94E 2OQIA 4L85A 4D0LB 1QP0A 4JI6B 3W6OA 4G5SA 1GGHA 3JQAA 5ILOA 2B8NA 2E5FA 2FPIB 4O8CA 4B3CA 2XMSA 8ATCA 4TMWA 3VR0A 1I4LD 2EKBA 4AY2A 1V4NA 2V7WA 1KYZA 3GVLA 1J00A 1F9EA 2HPHA 4GLLA 4G01B 4HB3A 4LX0A 3IVXA 4LYDA 5IMSA 1C3OA 4CM4A 1G0OA 2AI2A 4KWIA 4OI0A 2I7CA 2VBCA 1DBIA 2ZPAA 3L6EA 4F6LA 1UK8A 4FI3C 1CR0A 3JASA 2G3YA 2KVOA 3CRZA 4KLRA 2MMCA 3UPUA 3K1AA 1MO5A 1NYRA 5TF0A 3W3AH 4EG6A 3HR4A 2FR8C 4QEZA 2B8EA 3IO3A 5BUSA 1L7BA 1QH1B 3D31A 3O4RA 5K20A 2R97A 5AW8A 3DUFB 3KJQA 3BD7A 2W58A 3NHRA 4G5HA 5I4BA 4I1IA 2CUNA 4H1TA 4L4XA 3BREA 2VG8A 3RARA 2BEUA 2XDQA 3VAYA 5F21A 4NNJA 1LDNA 2Q28A 4NNPA 5ED0A 5IYPA 2FP4A 2ODQA 3DZGA 3L7JA 3GUCA 3IUBA 2X6TA 3TI7A 3V6LA 3PXXA 3ZU6A 2GPNA 4YRRA 4R4JA 2XD4A 3BGVA 3IVGA 1P8AA 4L6AA 5BT8A 3QEAZ 4A8JB 3FTEA 2WDPA 4BP9A 2ODEA 3Q5EA 5UKDA 4JX9A 1YSCA 1SOUA 1YMUA 1ZH8A 2GRAA 2XE8A 3P9NA 1VHLA 1N1GA 1RWOA 1E1QA 1KR5A 3K4PA 3PRYA 1E2JA 1USGA 1AV7A 2GCNA 1IH8A 3M6IA 1VPEA 2MOKA 4MRSA 4UBNA 2QTTA 4L7QA 3JU3A 3VPSA 4LOJA 4QYSA 2WHRA 3HJCA 4ZGGA 3C3WA 1QTIA 1A9TA 4MP8A 4BB9A 1HDOA 1ESNA 4DDHA 2FZLA 1FBTA 4PHCA 4HYEA 4HE5A 1NNLA 4NY1A 3PC3A 5CPBA 3IPYA 2CLFB 5GGXA 4D3ZA 4DIFA 3HFGA 2BISA 2Q2VA 5EQDA 5HXBA 1X7XB 2HH9A 1H0KA 1P0FA 3OTGA 1NG9A 3ZBUA 2V7BA 3QIAA 1NYLA 2XBLA 3GDFA 2FMTA 3WGQA 1KVUA 2SCUB 1R9MA 4RKWA 5F1PA 3EX7C 1CIJA 2AD1A 4GBMA 4YS6A 1R0LA 4CF3A 4K1XA 2E4UA 3TLKA 5DT2A 4ZAXA 1DUVG 1ZM4A 1PBNA 1V7PC 2PZEA 1UKZA 3C3DA 1CR1A 3O8DA 1BOOA 3KZNA 1AOXA 4PS0A 2EATA 3A6DA 3JQ7A 3HUFA 2A30A 2R25B 1P80A 1X8JA 3C4JA 3WRYC 3BSFA 4URXR 3FUTA 4WBNF 3DVQX 1A7KA 1DI0A 3GNQA 1SC4A 3AOEC 2PX4A 3PD7A 4IZ6A 4EKIA 4KXYA 4TKUA 1GTSA 2XUHA 4E5UA 1VPTA 2WK1A 3G9ZA 3VC2A 2OPHA 4FB4A 3CB4A 1EVIA 2YJTD 4A82A 3W5IA 5A88A 1SBNE 1Y5MA 2E5WA 2RK6A 4O1HA 4A6PA 2Q4EA 1N7IA 4PGAA 4AROA 1NW6A 2PVSA 4G9GA 2F8TA 1CR4A 2WYUA 4ZZ0A 3EPJA 3CCFA 2NP6A 3PYXA 2GDJA 4N01A 2XVZA 1CYDA 4A16A 1D4OA 1JIXA 3WY9A 3TD9A 4HV4A 3SFZA 1UZLA 1N5KA 1NBOA 2ZIZA 3KM0A 2ECKA 2X7XA 3O47A 1MKYA 4PZAA 3VR5A 3VGPA 4BNLA 1AQYA 3UUFA 2DKFA 1Z2AA 4F21A 4KBFA 5TMPA 1IM2A 3K9QO 4XOUA 3ZPXA 4Z4IA 3JVVA 1RVDA 2RGCA 3CA8A 2VP0A 3EVTA 3GQBB 3HRKA 1FFCA 3P0JA 3OWOA 4KQFA 4EG3A 5LA6F 4UHBA 2XF8A 4OX9B 4IIBA 1H3FA 1U7HA 4IQ8A 1M34A 3L8YA 4DJAA 4YR9A 2JHAA 3L0PA 4GZ5A 1OPXA 3DXZA 4WUTA 4XJXA 3LWBA 1FW6A 3T99A 1E6UA 4EVQA 3KIPA 4DS3A 3WIEA 1C8LA 2FQWA 3CX6A 1NN3A 1O08A 4NEGA 4R1OA 3H2IA 1OXUA 2CYCA 1GPLA 2NZUG 2Q4DA 4UBMA 3ZOKA 2V7UA 1K8AD 2GXQA 5JMTA 2D5CA 5LMZA 2PGNA 5YASA 3PDIB 3M6FA 1YRBA 2HY7A 5CVEA 3AKZA 1D1QA 2MSDB 4FJ0A 3WJAA 5AQEA 3U44B 3MUFA 3NB0A 2CL6X 1NOKA 621PA 2OCBA 1GFIA 1LB1B 3VX4A 1T35A 4HEA6 3U3DA 1P9OA 1IY0A 1WMAA 2FEAA 4C08A 4DR1B 3L7YA 4GDFA 4YJHB 1ZD8A 3MOGA 2EC5A 1K3TA 2O50A 2H54A 3FIJA 4DMLA 1W52X 5CHYA 3B38A 3GFPA 5E38A 1D0IA 2E4XA 5U9CA 2ANBA 3LECA 2DQZA 2JCXA 5EWLA 3I56B 2I7TA 3GUYA 3MWEA 4D8YA 1D07A 2PUCA 2QR5A 2CZQA 5DI3A 2FPMA 3FJOA 3KEOA 4DNRB 1DWOA 1FC0A 2P78A 3D3WA 3I05A 3OZGA 3PB3A 4J76A 2XOEA 5D3MA 5D5HA 1IZZA 4R40A 3UFBA 1M67A 3BMNA 2JDIA 2R9VA 4H7DA 4HAYA 4MV6A 2W2PA 3VPBA 3RBZA 3VHQA 4YRGA 3RVRA 1B6SA 2QTRA 2H2DA 4Q4JA 2IPAB 2XHEA 1IXSB 3LP8A 3UANA 1TCBA 4JT2A 4DIUA 3LP5A 1VHOA 2DY1A 1LDYA 1EXMA 2W00A 2H0RA 3GLHB 4OGFA 5ESXA 1K97A 1RYZA 4WNCA 4A6EA 1QF7A 3CIFA 2W6CX 1E32A 3S0JA 2G4CA 3WZ2A 4RY9A 1R9GA 3JSAA 2V4UA 5FOTA 1MEOA 2QLJA 2I1QA 4TWAA 4I4IA 5FFFA 2HKIA 5EJ5A 4OH1A 3RSHA 2PS1A 3W9UA 3CZ4A 2DRIA 1NUPA 4FDMA 2J9RA 4PRKA 1E7RA 4DR6B 2BGRA 2C03A 4E5MA 4M1KA 3L7MA 1WHTA 1ZM3A 3JU4A 5A0FA 4DV0B 4OOEA 4Z4HA 3INGA 3KFLA 3EZ6A 5CIWA 5DOZA 2JVIA 1HA3A 3GYBA 5ER9A 2ZXFA 1L8AA 4LTNA 3O26A 1J9EA 3LT4A 5DEOA 1UDXA 4LECA 4ZDWA 1E3IA 3TOZA 3L6RA 1PFYA 3F3MA 3PEYA 2IDZA 3RTAA 1MDFA 3Q8XB 2V0CA 3KYIB 3OIUA 1VTKA 2A0YA 3T53B 2IVZA 3IEXA 1XR3A 4MVCA 4RORA 4DC1A 3G2PA 4DNPA 2NTVA 5EIWA 4JCOA 3L92A 4HGRA 4EEZA 1WQ1R 4QG3A 5DTIA 3HP7A 4KVAA 4KYVA 4GR9A 1IBKB 4LF4B 1VE9A 2FXVA 4S0XA 4V2UA 2GFQA 4XSVA 1KI7A 3RWMB 4D45A 1BS9A 1N4DA 2WD7B 3CH6A 1QO9A 2FWAA 3B1ZA 1AKUA 3QY9A 4KI0A 1ARZA 2HX1A 3HXTA 4XN3A 3ISVA 4RL4A 1FP1D 5CR9A 1CP3A 3GIWA 4P83A 3I1IA 1V0EA 1UBOS 3NEAA 1L8XA 5JLJA 1LXCA 2WTNA 4OMCA 2VP9A 2VDVE 3IODA 4Z4UA 1ZCAA 4Q93A 4TXHA 4J2TA 5AVYA 1IXZA 3TOCA 1TJYA 3UXEA 1IEWA 3MILA 1H3NA 3KT0A 1UFOA 3GJQA 3OX1A 1XPUA 1Z83A 2AR0A 4XSHA 3ANTA 1I5RA 2CCJA 4LXHA 1M0WA 3OUTA 4G1VA 3VHRA 4BGUA 4RA6B 1KDZA 5CA1B 5CLJA 3U60B 4FYKA 4PPYA 2J3LA 5G2OA 5HMMA 3UJHA 4EY5A 4PLFA 5AW4A 4NBWA 2YW9A 1ESZA 4G56A 5F2KA 3KKMA 1U5CA 1TFRA 3NOOA 4BKQA 4DSOA 2R1VA 4G97A 3H11A 3B3GA 5AI5A 3T06B 1NQTA 1RRFA 5HXAA 3UOGA 1NVBA 1PFVA 3IA7A 3NIGB 3STYA 3PT9A 4REMA 4M0LA 1JBQA 1FVFA 1RWKA 2QZZA 2ZB4A 4IVQA 4P7FA 3C70A 4XTRA 3USCS 3A05A 3RYTC 3QA9A 3R8FA 3CUUA 4EB6A 4WZZA 2QTGA 4HQFA 4RK0A 1M6YA 3R8CA 2WG0A 4X7BA 3R7NA 2VDLB 1UEXC 1ONPA 3O0TA 5CLLA 3WSWA 3MGAA 2XGOA 4D96A 5BV0A 3AVPA 1XJQA 1AKMA 3ADPA 3RVBA 5ALPA 1DFHA 3WJ1A 2PMBA 2QVBA 3LDHA 1G0NA 4R81A 2DHDA 2A7QA 2VSNA 4Y7DA 4BO2A 2OCAA 1N2CA 2CXQA 3W6ZA 1E3DA 1MW9X 1PL7A 1ZK2A 5K0TA 1RFLA 3FM9A 1QPZA 4OEHA 4WCFA 4KGZA 2Z9CA 3O91A 2PLWA 4KE6A 3RU2A 1L5HA 4G5YA 4BECA 1WXGA 2FZ4A 3LHKA 3WWCA 2BMWA 2YNMC 4FYJA 1GCIA 4KACA 2F1HA 1ZQ9A 2XZPA 3F4LA 1WE2A 1JFFA 1V3VA 1EFVA 2GN9A 3MTDA 4PXYA 2MDTA 3RDPA 1M75A 2OYSA 3G17A 2VDUE</