1QFYA

Pea fnr y308s mutant in complex with nadp+
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
308
structure length
308
Chain Sequence
QVTTEAPAKVVKHSKKQDENIVVNKFKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGEVPYREGQSIGIVPDGIDKNGKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVYTNDAGEVVKGVCSNFLCDLKPGSEVKITGPVGKEMLMPKDPNATVIMLGTGTGIAPFRSFLWKMFFEKHEDYQFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPENFRLDFAVSREQVNDKGEKMYIQTRMAQYAEELWELLKKDNTFVYMCGLKGMEKGIDDIMVSLAAKDGIDWIEYKRTLKKAEQWNVEVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A productive NADP+ binding mode of ferredoxin-NADP + reductase revealed by protein engineering and crystallographic studies.
pubmed doi rcsb
source organism Pisum sativum
molecule tags Oxidoreductase
molecule keywords PROTEIN (FERREDOXIN: NADP+ REDUCTASE)
total genus 96
structure length 308
sequence length 308
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1999-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1qfyA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1qfyA02
1YJNB 4RD2A 1EXMA 3AVYA 2B7BA 1KC8D 3CCLB 4ACAA 3QFRA 1H42A 3LO8A 1B23P 5EMNA 3E1YE 2NPFA 2B5OA 4YAWA 4N3GA 4MYTA 1FDRA 2OK8A 1OGIA 1D2EA 4RCYA 1U2RA 3WNBA 1K9MD 2X3UA 1KRHA 3ZZTA 1BX0A 1FRQA 4ZCMA 3CCUB 3CC4B 2XNCA 1FNCA 2ZITA 3JQPA 3JQQA 4ZGNB 4TMVA 2QA4B 3E20A 4P6VF 2BV3A 4LBYA 3ZBUA 4PC3A 4U9UA 4C43A 3I55B 3W5HA 2VNJA 1EWYA 5H59A 1BQEA 1GJRA 1KJZA 4B47A 4G1BA 4M4SA 5FA6A 2DEUA 2EIXA 4TN1A 5JBQA 3B8HA 1QGYA 2QEXB 4PC1A 3AVWA 4PGOA 4TMXA 1YHQB 1KK0A 4LBZA 1TVCA 3AVUA 4RD4A 1ELOA 1F60A 4G5GA 1KQSB 1D1NA 1QH0A 1EFCA 4TMZA 1KD1D 1Q7YD 1QVFB 4Y7CA 1OB5A 1ZM2A 4AC9A 1N8RD 1CQXA 1ZM4A 4C0SA 3VNUA 4M1KA 2XEXA 3VNVA 4DQLA 4LBVA 3CCSB 1BX1A 1GVHA 1S0UA 2DY1A 3W2GA 3W2FA 4RD3A 1JNYA 4H9GA 5AN9A 3WNDA 4BPRA 4FK8A 1VQNB 1IB0A 4PC2A 2BM1A 1AMOA 1DDIA 1N0VC 4ACBA 2VNIA 3WYAA 1TUIA 1QFZA 1SM4A 1KTVA 1EP3B 1QFJA 1SKQA 3JQRA 3CCRB 3AGQA 1QUFA 4PC6A 3MCAA 2YWGA 3CCVB 2VNHA 1VQ7B 4K1XA 4YAOA 3LYUA 3CCMB 1GO2A 2B7CA 5H5JA 1J9ZA 2EFGA 3ES9A 1I7PA 3CC2B 3OW2B 3OZWA 5TR9A 4YAFA 4J0QA 1VQ5B 1E64A 3LRXA 2DCUA 4Q7JB 4B4DA 3W5VA 1H85A 1KK1A 1M90D 1XB2A 4LC0A 3CMEB 2OTLB 1W87A 2QN6A 2VZLA 1GR1A 3FPKA 4B48A 1YI2B 5DSZA 4AF7A 2YWHA 4M0LA 2BM0A 1JB9A 4RCZA 1G7TA 3G4SB 4WQMA 1G7RA 4RD6A 3QSYA 1EP1B 2BSAA 2PLFA 1JA0A 1KK3A 1VQ4B 1FNMA 3MMPA 3QFSA 4Y9UA 4LBWA 1IJFA 1OGJA 1DG1G 1NJID 3CD6B 3VO2A 1QGZA 3G6EB 3WY9A 3WBKA 3SJZA 3B78A 2QMUA 3PENA 1QVGB 2BGJA 4MYUA 1AIPA 4ZGQB 1TTTA 4YAUA 3CMAB 4TMTA 2CRVA 3WXMA 2PIAA 1OB2A 2BGIA 1G7CA 3CW2A 1EFTA 4YALA 3AVXA 1R5BA 1GAQA 2HCJB 4ZCLA 4B43A 4RD1A 2OK7A 3OZUA 2QTLA 2R6HA 2C78A 1IJEA 3ZZUA 1Q81D 3P27A 1ZUNB 4F7DA 4RJLA 3CPWB 4EH1A 3CB4A 2YWFA 1QX4A 3G71B 4DQKA 1NDHA 5KSWB 4QFMA 3AVTA 1A8PA 4M53A 2GQFA 1VQOB 4G1VA 3V76A 1EP2B 3VO1A 1FNBA 2VYQA 1XE1A 3P26A 4M2LA 1KK2A 3WNCA 1W35A 4P3YA 2C77A 1QGAA 5TY0A 1QUEA 2BF4A 2HDNB 1E63A 1G7SA 1TLLA 3W2HA 1Q82D 3AGPA 1K8AD 2RC5A 3B82A 1QG0A 2OTJB 4TMWA 3U6BA 1R5OA 2YWEA 1YJ9B 1N0UA 2DETA 3ZC3A 1DDGA 4QHYA 4PC7A 1WDTA 1JA1A 2DERA 2GPJA 3CXCB 4YHBA 2D74A 3A1FA 1DARA 1EFUA 1ZM3A 3MHPA 3QFCA 4N3NA 1VQ8B 3AVVA 2J7KA 3ZBTA 3QE2A 4NBSA 3OJWA 3CCQB 4HE6A 1GAWA 1VQLB 3QFTA 1R5NA 3U6KA 2AHOA 4HE5A 3OJXA 3CCEB 2VNKA 2PMDA 1BJKA 4FN5A 3W2EA 1YJWB 1UMKA 1Q86D 2FX3A 1FRNA 2E1RA 5THXA 1E62A 2HMAA 1QFYA 4UAJA 4ZCIA 2QDXA 3CRZA 4IW3B 3OZVA 1YIJB 5GV8A 3FJOA 1B2RA 2XNJA 4AF6A 1VQPB 1VQ9B 3ZZ0A 4Y9RA 2BVNA 4B3XA 2BN4A 1M1KD 1CNFA 2BMWA 2CNDA 1K73D 1D8TA 4R71A 4FWTA 1YITB 4ZV4A 1W2BB 1JJ2B 4RD0A 3CC7B 1F20A 3VMFA 3I56B 3WBJA 1CNEA 1VQMB 3CCJB 5HXBA 5TV2A 3J81k 3LVBA 2RC6A 1VQ6B 3W5UA 4B44A 1S72B 1ZM9A 3U2QA 1W34A 2BPOA 3I1FA 4NCNA 3W2IA 1HA3A 1FNDA 5GV7A 2QTZA 1VQKB
chains in the Genus database with same CATH superfamily
5CTJA 3VH1A 2QUAA 4NCIA 4AS3A 1JIQA 1JLLA 1N5KA 2CLMB 4I4TB 2WM8A 1M1XB 1NF3A 4UCWA 4RL4A 4QQKA 1K7YA 4QRHA 1NG1A 1V45E 2D2EA 2J3DA 1LD3A 1FTQA 1XVTA 3N8GA 3TMYA 2P4UA 5CDUA 1EEHA 2H0AA 1FZQA 1LS6A 4AUKA 5EE1A 5FP0A 3KM0A 4V1CB 4JLBA 4JEHA 3ZDAA 2WDPA 1GQOA 4A16A 4WAUA 1T26A 1G9XA 3H1FA 5EERA 3F2VA 2XB8A 3NHBA 4UHKA 1XRNA 4B3MB 1ZD3A 1RYBA 2RGXA 2YV2A 3PHCA 5FQNA 5JBIA 1CF4A 3ELYA 2XUFA 5MGNA 1H4TA 3IOCA 4NE7A 2I65A 3ULKA 5LOVB 3TW8B 1Z2AA 1DC7A 4MV8A 1GXSA 2O2ZA 1ZLYA 2PYZA 4B45A 1E6UA 5IKMA 1N1GA 4N7JA 1FDRA 1V71A 2VHQA 1EGQA 1LDEA 3MILA 5L6MB 3AC0A 3A1EA 4BKOA 2I4NA 3JQEA 3WNBA 1AGNA 4R3WA 3SZLA 4D96A 1L5LA 4KNYA 4D3ZA 3BJIC 5L3ZA 3H99A 4MAAA 4ROSA 3VVMA 1NT2A 3VZCA 3EFOA 4FW8A 4MW0A 2AIRA 2VPIA 3VVCA 3OTQA 3WJ1A 3PP8A 2EWMA 3K6SB 2E4XA 2Z83A 3UC9A 5HP4A 3LUGA 2A9FA 1HPLA 1TW3A 2GNAA 3Q2KA 2V7BA 4Q5IA 1KMNA 4XYGA 3V3TA 2GZHA 3U13A 2FNAA 2P41A 2BGNA 1BXRA 3H3JA 1AE1A 1LX7A 1ECFA 2P2CA 5IH3A 3GA5A 4D98A 4CKWB 4YXWA 4ESOA 2C1XA 1CWUA 3NGLA 4IAOA 3JWPA 1P8AA 3TLBA 4C43A 1FK8A 2FWJA 4CNQA 1G8FA 4HWRA 1G8PA 5BNWA 1P31A 3UMMA 1TO1E 4Q37A 4XMYA 3G8BA 5EP1A 1P75A 3MMSA 3EG9B 2C3YA 5GGYA 4B33A 3L0ZA 2LIVA 3EARA 3NHRA 3PEWA 4UM5A 1FNNA 1LBQA 4UVHA 4KTVE 4BAGA 4RDLA 3FPFA 5CXUA 4K9KA 1SCQA 3VPSA 5HZAA 4FYPA 3CT4A 1JXQA 4OUKX 4B4KA 1N0HA 2Z1MA 2O8BB 1J39A 2ZVDA 4OA5A 2QRGA 3EFEA 1JYSA 4LXIA 4I1UA 4OXNA 5DJ5A 1E1NA 1PYOA 2DHRA 3EPPA 1H0SA 1NOKA 5IK2D 1AURA 2Q6IA 4RPBA 4II7A 3WGGA 4HAWA 4Z1OA 1ZWKA 2H2WA 2UUAB 1BEZA 5I45A 2FUCA 4A27A 4W63A 5DGXA 3WRXA 2ENWA 3GLUA 3ZDRA 3EBPA 1ILEA 3M2PA 1IN1A 1DBWA 2QLTA 3S1AB 1YV9A 2GD0A 3BMQB 5JHGB 4IY1A 3W3AD 4DJDC 3IJRA 1W25A 5LUAA 2PZBA 3JD3A 3GPCA 1EFCA 4W1RA 1MABA 4GXQA 5TSDA 4EGAA 4B4WA 1JHOA 3LIPA 1SCDA 2WM3A 1OY1A 4K9MA 2VHWA 3ECSA 3BKWA 3Q10A 1VSQA 4NZOA 4LECA 1AHHA 1W85A 5TE9A 5CCBA 3S7ZA 4AC9A 3T5PA 1IN6A 3HQ4O 3KRTA 3VR3A 1YZGA 1J09A 2PBZA 1ITZA 1XXHA 5KMGB 4HJRA 3H5NA 1TCAA 4C0BA 3ZYCA 3H8SA 4FBLA 2ZWIA 1IXZA 4XD7A 1VHEA 2FUKA 3R5JA 4UEQA 2X53S 1NLFA 3TX2A 1YK0A 3FBTA 4TV8A 1WVMA 2FCRA 2YICA 5JANA 4Q4DA 2EU8A 1Q44A 4MV1A 2O8CB 5HFNA 2DUUA 2ZJ2A 4ZOBA 1HMYA 3LQQA 3PX3A 2HNBA 1RKUA 2AE2A 2P0AA 2BE7A 1N5RA 5AXBA 4I81A 4FDAA 3PKJA 3W79A 2W6JA 1ULHA 2ZROA 1J1IA 3AERA 3EVDA 1DT5A 3CEMA 2O8EB 4PTYA 4RD3A 5E9WA 1JYEA 2Z58A 4L72A 5HDQA 1Q11A 3IGFA 2W2QA 2ZTMA 1YGPA 3CR7A 2WICA 3Q8MA 3FG9A 4R8RA 3UBTA 1TKCA 4LJ6A 2Y1GA 1W49A 2XCLA 4K6KA 3IHLA 4KXQA 4CTMA 5FFFA 1XSEA 1FFCA 4F12A 3P2YA 4IMRA 4EB8A 2JCYA 5EKXA 1UBSB 2EJBA 3FSRA 1O6BA 5DWQA 1UFVA 2RGEA 4YK7A 3WYAA 2J3JA 1TUIA 5F76A 3GZJA 3CRNA 2J5BA 4FD2A 2ZJOA 4BRZA 1XRSB 4FHCA 1YTUA 1QP0A 5JMTA 3FUWA 1ZR4A 1ESZA 2HV8A 5FRDA 4HATA 4YRSA 2WZPP 1KXZA 4ALIA 1S5PA 3X1ZA 4HUTA 3KJEA 2BFDA 2PVCA 5HCIA 3WSTA 1IBSA 1TUBB 1B8OA 1RD4A 1OMOA 3EXAA 2C4TA 3L0CA 5G53C 1T2FA 5F5XA 3TKLA 3O4HA 2D7CA 1V3UA 2QROA 1T6BY 4MJLA 4XVUA 3OOYA 3VMMA 2GFQA 4MI6A 3IELA 3NC1C 1UMBB 3ZVMA 4PPNA 2AEFA 3CURA 4G6IA 1M9NA 1PSWA 4JU9A 2H57A 3KJHA 4QYXA 4Y1GA 2ZAOA 1ZW6A 4U7HA 3CNQS 1I3CA 2YVAA 3VDXA 4LF6B 3FHTA 4RIGA 5AOVA 2O0KA 2W43A 2QUHA 2XDYA 2M9MA 4PAQA 5EEGA 2JFVA 3YASA 3GFQA 3LW8A 4D9MA 4EYGA 1VHTA 3HCNA 2OPBA 3LTEA 5MHTA 3ROXA 4E6PA 4EFKA 4K6CA 4QOSA 5EYPA 3T5BA 2ZRCA 3UAZA 2VQDA 1XZDA 3DE2X 3ABRB 4QM6A 1G5HA 1QV7A 2WA2A 3AI3A 3K8QA 4G1UC 4QDXA 4IF6A 4RK4A 1ZRNA 2J0SA 5FO1A 1NKTA 4CIAA 3HYNA 3R6LA 3HKBA 4WHMA 1KSGA 3N0VA 3NUZA 1KO8A 2X2PA 4RJ2A 4RVNA 1ZNQO 2WIKA 4XDYA 5JNRA 3Q3JB 1GA4A 5DSZA 1T1SA 2FN7A 5A7GA 4UTVA 3OX1A 3ABIA 1OFUA 1BHO1 2GM3A 3QJGA 4BBZA 3AEYA 3K2BA 4ZVLA 4FHDA 3KLBA 4Q6WA 3OOHA 1K8RA 1CUEA 3SM3A 1VHWA 4WFQA 1G7TA 5IAGA 4GQIA 1S9DA 3G4SB 3DJFA 4QUZA 4I4TF 3OFJA 4J1QA 3SC6A 2JATA 4POOA 1JN0A 1VL6A 2DKOA 4LZWA 4WY5A 1J0EA 1UAYA 2AXNA 1HRKA 3ZY2A 1XBTA 3I30X 3D3JA 2IHKA 4M54A 3GT7A 4DLTA 3K5IA 3L8HA 1CNMA 2VJBA 1KK3A 5I6DA 4HLQB 4J3JA 2ZP1A 1LWOA 1FNMA 3OH8A 3WWCA 4E5UA 2DU8A 4LJ5A 1CJUC 3ZD7A 3A9WA 2Y9MB 1UP4A 1KI6A 4YJGB 2DWPA 1YGYA 4DREA 1NF2A 2PQMA 4BLSA 1M7GA 1CQZA 3GC6A 4LBWA 3KKLA 4P26A 5E9QA 2EX4A 3HLKA 2C2GA 2XTZA 5CG2A 1SVMA 1RAFA 2ZBQA 2ZWOA 1ZN7A 4BNDB 5M34A 1NJID 1XLUA 2FMFA 3IR5A 2O8EA 1QGZA 5GJBA 1OAOC 3GFFA 1QV9A 1DUIA 2Q1SA 3KZOA 2AKYA 1AGRA 3GAMA 4PLTA 4IKPA 3ZVRA 4Y1RA 5AI6A 5F5NA 2QMUA 3DR3A 2QQGA 3LWBA 1GYPA 1B15A 4D8YA 1GTZA 1CFJA 5TRTA 3N70A 2OCYC 1PNOA 3CN7A 3KKOA 4J4BA 4EFMA 5L3QB 1VSBA 4TQ9A 4GX2A 2BGUA 3WB9A 2I7TA 1LJLA 4UOQA 4X3CA 4BNNA 5FNVF 4ECAA 4GL4A 3ZW7A 3U39A 5TB5A 3A1UA 3JWGA 5EGNA 3C8HA 2CV1A 4BECA 1NVEA 2B35A 2Q4BA 3NBKA 4MKHA 1XZBA 1IDN1 1P3Y1 1I6WA 3EY9A 3L04A 3WRVA 2VYCA 1L5HA 1YQQA 3L5OA 1JJVA 1D2HA 1Y48E 2KBEA 4YMGA 5TQ0B 2DTEA 2JFZA 3R6TA 3ENNA 4GZMA 4QDJA 2ZWPA 2CT8A 1TUBA 2HI0A 3C3KA 4P36A 1A7UA 4JY7A 2PGXA 2F3PA 2D6FA 2YN4A 2Q7OE 5M29A 4PRLA 4UZFA 1RW4A 4Q0MA 5FWDA 1DQSA 3FZNA 4JLMA 4NMLA 3IEUA 3TLMA 2R7AA 2PBLA 1SCJA 3BMNA 4GLFA 2F8TA 2IEIA 4TRJA 2QRKA 1USUA 3PPWA 4GNRA 4BN4A 4ESVA 2J32A 3PTAA 1YCHA 2G9RA 1OYVA 2QJWA 2H3EA 2GCNA 1QF9A 2I4LA 3ZU6A 5EJAA 3BCHA 4QFMA 1AC5A 1K5GA 3HS3A 3K73O 4V1CA 4CIXA 4QGAA 4A8JA 4K0KB 1WF3A 4AUNA 4H1HA 1I33A 1L4FA 4XLHA 3ZWNA 2OY0A 1B6SA 2ZRJA 3KEQA 4LNHA 5JVDB 1IZ9A 2IYWA 4PWZA 4OTZA 5CFMA 1RZUA 1P5RA 1DWUA 3CRMA 2IYAA 5DW0A 3TB6A 1R6TA 5HPYB 3OZIA 1Y0YA 4IIJA 4JKYA 4XSGA 4BCBA 1HE1C 3V5NA 2YHIB 2AYZA 5ALKA 2QG4A 5LQDA 3WV4A 3Q4GA 3O95A 2I22A 2G9UA 4XKWA 1O9HA 2VDVE 2X6RA 4HEA1 4ERNA 4YYEA 1Q82D 2A9VA 4HSGA 4MVXA 4A5SA 2FYTA 1I5EA 1VPTA 2J87A 1DAHA 4KREA 1AH2A 2V3VA 5IJ0B 1A76A 2FEOA 2FZLA 3GT0A 4NMWA 4O0MA 4BMYA 3E61A 1ZIXA 4L02A 4E7PA 3DFZA 1SVKA 1N25A 3LD9A 1FX0A 4MCJA 1NBMD 4WH0A 1CR2A 1XTUA 3GRZA 3BL6A 3Q3IA 4OOSA 3U60B 3BD9A 3G1TA 4L57A 4AG6A 4BFLA 5J40A 3Q6IA 1CXZA 4N0EA 4W4TA 1FFXA 1B73A 2AUNA 4RHTA 2YJ6A 2ZTNA 4O2LA 1JA1A 3DD1A 3PHHA 1TFUA 3CXCB 4CFZA 5CDTA 1E99A 1JDBB 2FW7A 4IJ5A 3ZV4A 1QRUA 2P6OA 5CA0B 1D9ZA 3PQCA 2O2SA 4WXYB 3S70A 1VJ5A 1VM6A 4UHDA 1AQUA 5JATA 3O9MA 2EF0A 1UM9B 1RQ7A 4QXOA 2OG1A 3SQDA 2XMCA 1BU8A 5JV5A 1YDHA 3TM5A 4Y2RA 1CR4A 3LE8A 2ESRA 4PLHA 4D02A 5HWSA 3BY2A 1E79D 5KYXA 1X13A 1SBYA 1SRQA 1IAQA 1RMQA 3AESA 3EQ7A 4JBGA 4NENB 5FHQA 5T67A 5JW6A 1C7EA 5KINB 4UREA 1ZP6A 3F2IA 4KQMA 4N5NA 2P79A 4A03A 3FWKA 2CB0A 3O8QA 5AP9A 2HC9A 3OLYA 3OIGA 3VR2A 3GEEA 2OV3A 2CWDA 1NR7A 5ALSA 1RPTA 1LDGA 2BAGA 4LN1A 5G41A 1W2GA 1Y9JA 3AP2A 5EZ5A 4LWOA 4N49A 4PXSA 5AYVA 2G76A 1UD8A 3HWSA 1M1ZA 2H08A 3KTOA 1SBNE 4MUJA 4OOEA 5DYYA 1Q86D 2DIEA 2R9VA 3T0IA 3ED5A 3EVBA 3RS5A 2CNBA 4O2AF 1W75A 1V2HE 3HN2A 3ORRA 3OEHA 4RHUA 4E14A 4L0MA 2RKWA 2W2PA 3Q0IA 4GPEA 5CAEA 2ZW9A 1ARZA 1NYTA 3KS9A 3IQZA 3N53A 1NRJB 3I5UA 4L2IA 4ND2A 4OXRA 3KJNA 3WR5A 4MXDA 2A92A 2C04A 3WL7A 3ZZMA 4MYDA 1IG3A 2IYEA 2XLCA 4TKUB 4QT4A 5K6AC 2Z43A 1YIJB 2PT6A 1WR8A 3FUCA 2FMTA 4OP3A 2FPMA 2HMVA 3SX0A 5FWXB 3FMOB 5TF4A 4JL8A 4IILA 2ORIA 4M1OA 2XNJA 4DLLA 2DFPA 2FWAA 3GRUA 3SBEA 4H1UA 5E7JA 1YBFA 1M3SA 2BN4A 1MDBA 2ZT6A 3K72B 4CLOA 2XGJA 3TZQA 1JDVA 4ENVA 4Z3KA 3U3KA 1P6QA 1Y1PA 4NY1A 3WOVA 1TAQA 4B8ZA 4Q18A 1L3CA 3GJ8A 2BUBA 3HCOA 4GYJA 5FHRA 4AP5A 5EHXA 5LOVF 2PVSA 4M7PA 2J41A 4Q3DA 1YQWA 3JQFA 3RYFB 3RC2A 4HQFA 3WC4A 2EF1A 4D45A 5JMOA 1N3IA 4U3JB 3AF6A 1N6NA 2VK2A 3HMKA 4IOKA 2IXAA 2ZJ0A 2GZAA 4ALKA 2AFIA 1VCOA 3DOIA 3JQ9A 2EW1A 2ZDQA 4B8YA 3F4LA 4F11A 1Q3TA 1Z8FA 3OQ1A 4BMCA 1ID1A 2VN8A 4HS4A 4XUEA 5JAQA 1O08A 3D7KA 3U17A 5EXTA 1SD1A 1P1BA 2C5GA 4I4CA 5FDFA 3T34A 1LSUA 3C3XA 1KP2A 5CW2A 1M2OA 4UUBA 3SS9X 3NHPA 1PT8A 5EJGA 3I1FA 1A97A 4HGYA 1U04A 3A3OA 4CKBB 3G0HA 1UJ5A 3CN9A 2CDBA 3LK6A 1EXNA 3I1YA 4QFDA 4F9GA 4LHVA 1LDYA 1IZ0A 2FFAA 2PT9A 1FZTA 1TXGA 3DOEA 5AVUA 3HRHA 5KWSA 3VHQA 2JFQA 4G1MB 3FDZB 3LQYA 3T4PA 1OCEA 2G9QA 3UCEA 2WLSA 3FYHA 4BFSA 3TTUA 3FDFA 1DAIA 3I05A 1IEXA 4MUAA 5CB6A 3CP8A 2QPTA 4LW8A 2PUGA 4WZLA 3ONVA 3E3MA 1JHDA 3DCNA 1E1DA 2OENG 1OZAA 3FPJA 2QW0X 5DM2A 1IFXA 1KFKB 1Q7RA 1SXJD 2CXHA 3A0UA 5DCLA 3WHKA 3V4SA 1SQ5A 1DRWA 4IICA 1KY4A 3OA0A 4WRRA 2BY4A 1XQYA 3RVJA 3F73A 3FPBA 4EO7A 3UV3A 1E2QA 2QTCA 1BQ4A 2AG0A 3EC7A 5DCUA 3CLKA 1UANA 4M0FA 5CVJA 2IHZA 4JMQA 3A9SA 3KJIA 2RGGA 2FE4A 1W4AA 2H17A 4TSRA 5LQMA 3SICE 1Y4ZA 5HKOA 4JXZA 2Z4RA 4KE9A 4P9SA 3V8VA 1F2VA 5FBVB 1U9IA 5A4DA 3A2NA 3EE6A 1JHPA 2JLUA 1PR2A 3ITEA 1RYMA 1W47A 1Z8DA 4DXDA 5C51B 4I1RA 4RVGA 4XEHA 3BG5A 4K9OA 3KVOA 2IS6A 3FVQA 5CVEA 1X7XA 1P6UA 1T34A 2P3OA 1QDEA 3PFFA 3O2SB 1BW9B 1N05A 2HO4A 3I58A 4CYMA 5BMOA 2G70A 3O4GA 3IOEA 3EPHA 5JJCA 3V4PB 2Q1TA 4V2UA 2DBZA 4FZ3A 2IOFK 4ZVKA 1NPYA 4MHSA 4ZDIA 5MN5A 1W52X 5IH7A 4CQLB 2IHNA 1F0KA 1TMKA 2ZCVA 5E8JA 3OWOA 1SGWA 1Z56C 3WWZA 3FIUA 1IHXA 1ZK4A 1X86B 3OFND 1THMA 4KQ6A 4C03A 5CB4B 2A9QA 5ARCA 2YJTD 3D2AA 3H1GA 3KJFA 1VKOA 3M6VA 1NZJA 3WQHA 4J0JA 2W6OA 4FNGA 4WV3A 1LWNA 1B74A 1NVKA 4GWGA 4CM4B 3JAKA 3FAZA 3PUYA 4FJ2A 1AHNA 4XRRA 4DMRA 5J35A 1TRHA 2MYNA 3S28A 4GO1A 3T7JA 3UJPA 2JKZA 5KJ1A 3O3MB 4QUDA 4HBGA 4Z0PA 3IP1A 4KLNA 1I0LA 1SIWA 2H18A 1KETA 2REQA 3H2BA 4ICIA 4P3NA 4OUDB 4QJBA 4MQ6A 1DNPA 4D9BA 3EIQA 3QYFA 4AJ2A 4R1TA 3B70A 3ZGNA 3LQ6A 3WLHA 3NETA 4WACA 1WBBA 1EWRA 2K6GA 1KFEB 3IMCA 3TLYA 3KUUA 121PA 3BE4A 2X6XA 3STWA 4KWIA 1AQJA 3F67A 2IKSA 3SVLA 3JASA 1UBCA 1KS2A 2VP5A 1AMUA 2GR9A 4OXQA 1H1LB 3GPLA 2FVGA 2G8LA 4WT7A 1V2GA 4J03A 5J2UB 2XUPA 4N3CA 2BHNA 1QH8A 5FL7D 4C4XA 1V3QE 3KL2A 3V42A 2AYXA 4F5EA 2ZZMA 1RLTA 2XVMA 3K0CC 1KU0A 4YASA 4EGFA 2ZZQA 1Y7TA 1QH0A 2VF2A 4RKQA 1JG7A 3F78A 4BZZA 3F5SA 3T53B 1KGDA 3DTYA 1KPHA 4GMKA 4Y2JA 1RRGA 2QOEA 2VEOA 2Z08A 4JP3A 2N46A 3W7AA 4DIMA 4M1EA 1KWGA 3QMMA 1OLOA 1YT5A 4NF2A 1M2HA 4FFDA 4OQLA 2XUZA 1V0JA 4PHGA 5BR1A 2I2AA 3P5SA 1UKBA 4QZVA 1L4EA 1EP9A 1OXMA 1T1RA 2DUNA 2EGHA 2F48A 4WN3A 5EVJA 5T6BA 5LIPA 4HLUC 2ZUFA 4JNCA 3M33A 4FLMA 4OGLA 3C48A 3B6JA 1I7SB 3Q8LA 1T5SA 3G2IA 2R8OA 4DQLA 1PQ4A 2NU8A 1EUYA 2XTAA 1RYDA 1BKYA 1P2UA 2C4VA 1WUYA 2J31A 1BX1A 1W5FA 4G8DA 4IGKA 4XSVA 5JD5A 1RABA 2PWAA 4R9VA 5AQEA 4EGQA 5TJ9A 1MRZA 1I3OA 2PZAA 3AEUB 3MXTA 1QQBA 1AOXA 4DBZA 5DNYB 1JH8A 4U7JA 3X2SA 3CESA 3RI3A 3RNOA 4D79A 2C0QA 3D3QA 1NNEA 1MXFA 3Q8XB 2FDCA 4P3OA 1X70A 1U8TA 1YZTA 4FEAA 2RGWA 3GRFA 5AN9A 1W6RA 5DGDA 3V4ZA 2WT8A 4NHEA 1HKHA 3PUMA 1Y3BE 2HQOA 4E51A 2HU2A 4Z7OB 1JHMA 1R6AA 3DDHA 3DXFA 1WHTB 3VHXA 1N0VC 4LK2A 1IQRA 1USVA 4M76B 3UOWA 4JL6A 1O95D 3C6QA 2UZ1A 1FDTA 4TLLB 2OR3A 2ZIWB 4ZQGA 1BXZA 2IYSA 5B7GA 2VK8A 4B2IA 2DM6A 4NIMA 4PAOA 1YI1A 1KI9A 1P1IA 2XX3A 1M5TA 4HWGA 4IX9A 5I7WA 3DXZA 3KYBA 1UMDB 2A5LA 2HRDA 2X0JA 2L42A 4EBBA 1UD3A 1GPBA 4RTOA 2XOKD 5FX2A 1I5RA 4XD2A 3GUYA 3SS7X 2OWDA 4BC0A 3CCBA 3KOYA 2IHJA 2ZSAA 3AEKA 4X90A 4FPXA 1QUFA 3L4BA 4S0ZA 3U4IA 4BE7B 2PQ6A 4BEWA 1G291 2FMKA 1EK6A 1MRSA 4WLVA 5G4KB 3WQBA 1KHHA 4M86A 3TL3A 2ACEA 4BO8A 5K01A 4K1XA 2AN9A 2YYAA 5LZ2A 4KV9A 3PS9A 1JFLA 3TVTA 3HO1A 1EAYA 3LYUA 4GWLA 1H8HD 4PZ9A 1ULBA 2GRAA 5BSYA 4DN6A 3CC2B 2VT2A 3TF5A 4J6EA 3ZX5A 4QBFA 2DHQA 3MT8A 1DBPA 3T9CA 3OFNA 3VVBA 2X8JA 4JC5A 2PSDA 3G2QA 5A1JA 1LNQA 5F1YA 4M9SA 2LTAA 3IP7A 1PNTA 2FUEA 4QPNA 2ZZFA 3BICA 5FAXA 4C5AA 4CTOA 4RMJA 5DNEA 1OHHA 3A3PA 4ESEA 3PQ2A 2F55A 2YV5A 4QUIA 5CVCA 5ENDA 4J0GA 3LC1O 2IXBA 1KZ1A 2GRUA 3V55A 2IYVA 3RF6A 1IZ7A 1TEXA 1SVUA 3AV0B 2IBTA 2PSJA 2DQZA 1C0LA 1QJ4A 1YI2B 1EGHA 1PJ8A 2EG5A 2PFGA 3A9VA 5T57A 1CDZA 3GJ6A 2PSFA 3WKBA 1ZMRA 5D3KA 4JJGA 3I6IA 4B3SB 2BGGA 4F46A 1G4HA 5I9BA 5LMZA 2G8NA 4R7TA 3EJWA 4MIKA 3V8QA 5F7XA 2OECA 1CP2A 4CJXA 5GVRA 4EJSA 2UYCA 3QIVA 1N9KA 2HA7A 4MGZR 2WP8J 1XI2A 3OCYA 4KDEA 2BGWA 1HZZA 3AHJA 4EYEA 2WUGA 1D6NA 3BWBA 3H2ZA 1ISPA 5LZ8A 3GF4A 1JVNA 1F4LA 1VQ4B 1QNFA 1J2RA 1JMYA 3KUKA 3EC2A 2H00A 2V58A 2CHVA 2PKXA 3B1JA 1W9MA 1EX9A 2DLCX 1QLJA 4QVAA 1F12A 2GSWA 2AH5A 3B6KA 2NU6B 4HDMA 3WXBA 4R2XA 1A88A 2D5IA 1U8ZA 4R6XA 5ABPA 3T9EA 3BPSA 4TS1A 1Q5PA 4XB1A 5HDBB 3MS4A 4GBED 3V6MA 2JHCA 3R6KA 1L5WA 3LRPA 3MQ4A 4MS4B 2QTGA 3KO8A 5C8YA 3W8DA 4DQXA 4JUAA 2Y4NA 3QPUA 5ARDA 1X1QA 2RE8A 4AY6A 1MX1A 3H8JA 4OHMA 3B3JA 1CULC 2N1BA 3SLKA 3HVHA 3ADBA 2PXCA 2C5FA 2D59A 3E9DA 2ZSUA 5AKKA 5C3MA 2JD1A 4CN8A 3HDVA 1LLUA 3MBIA 3TZLA 3E23A 5HYVA 1GZ3A 3VR4A 2IEBA 1XAHA 3OSUA 3D81A 1YS4A 3D31A 1ADBA 3M4ZA 5A5DA 2V7VA 2ZI5A 1T15A 2VC2B 4MTCA 6ABPA 2FPGB 1U3GA 4Z5XA 2BKVA 3ZGZA 4FOPA 2WWFA 1KAMA 2JIBA 3C6ZA 3VV3A 3OUUA 4OHPA 3KKNA 2WTEA 1ADCA 2RHWA 4G0YA 3UW1A 3WLTA 2OB1A 2WIAA 1E32A 3AVXA 2J8ZA 2RGNC 3WTBA 2NTJA 1P2TA 1EE9A 5HRCA 2WNHA 3RDPA 4OI0A 1CT9A 4EDHA 1LTQA 2Z1DA 2I66A 3D2CA 4S35A 2OK7A 1QIHA 5WRFA 3CQ9A 4J94A 5BSWA 2CJWB 1XMPA 2ZVJA 3IKMB 2FY8A 3G23A 1J0AA 3II6X 3AEQA 1ZJYA 1QIEA 5D84A 1EDEA 3DHYA 4EPTA 4KIUA 2H5JA 1GTG1 2PYIA 4I1YA 5COQA 3KLOA 1FX1A 3K20A 3NM5A 3QFHA 3T95A 1EVZA 4HC4A 4R8VA 3ROGA 1R9NA 3CZMA 3L93A 1RJWA 1A5SB 3RVPA 4EDFA 2H1HA 4HH4A 4M0DA 4DCMA 1KNQA 4DWWA 3K1TA 2IYRA 4IHJA 4JJ7A 2OORA 1W96A 5GONA 5I01A 3SJBA 1SOUA 2CF4A 4M98A 4QODA 1UF9A 5BN3A 3C3BA 1P2FA 2Q2OA 2WUFA 3I34X 1OTXA 1PP4A 3JAWA 2I76A 2GQFA 5BSRA 1H2FA 1Y7HA 2A9KA 3OIFA 1WSVA 3IL2A 2XMRA 3K4PA 4JZKA 3V76A 3QWBA 5AW3A 9GPBA 4REOA 4Q7KA 4ZI2A 3IDQA 3EXHB 3NWJA 3PC7A 4HV4A 3K2QA 4ND4A 4MI3A 3TLXA 1CZUA 3NHFA 1Q0PA 1LJ8A 5BV0A 3RR2A 2JBAA 1ZLXA 2H1FA 2YUTA 2VK1A 3A3YA 3EQZA 4S2UA 3R7DA 2V4UA 2XB2A 4PO1A 5IJ9A 3N59A 1VL5A 3MJFA 4L76A 3L41A 4WW0A 1J5PA 2RH9B 3DPIA 4YRRA 5TY0A 3I2HA 1OJLA 2LKCA 3HHEA 2QR3A 2FEWB 1EX7A 4HEQA 2ENUA 2RHCA 5KOJB 1R0YA 2DPYA 4NSNA 4EKGA 2OSBA 4KPUB 4PZAA 3DVRX 3JQBC 3RADC 3HP1A 3OCWA 1BDMA 6NULA 3KKMA 2ZUVA 3RHFA 1BD4A 2CLOB 2GK4A 3HWX1 1EFRD 3R0JA 1DUSA 3JZDA 3SIPA 3HEAA 3OTWA 2XKAA 4FLEA 4H15A 2ZL7A 1TF2A 1G59A 4KXWA 2NZUG 3F71A 4OMCA 3T7EA 2Z2KA 1WY7A 1WV1A 3GBVA 2Y68A 3KV3O 2OXFA 4DLXA 5K0SA 4Q3NA 3EHDA 4IIBA 4P81A 4ZODA 5JZSA 1G5FA 5KOIA 3GT3A 3INRA 4IDOA 4QKQA 3UUWA 1UDAA 3GRAA 3SI7A 2QX8A 4CZ2A 1Q50A 3QFCA 2VJAA 2PLRA 3AIOA 3GWGA 3MMXA 1RPNA 4NEHB 4C7XA 1W0CA 3GLIE 3QK7A 1O95A 1N1MA 4H0FA 3QE2A 3EN0A 3NP9A 5DASA 2XCRB 1C4WA 4YJFA 4BL5A 1OKKD 1AF4A 1UMBA 2R87A 3D6JA 3L9WA 1FXUA 4DNOA 1PIWA 3FTNA 2J45A 2F3QA 4JLVA 2W98A 5CB4F 3ZK8A 5ALLA 1OI2A 4I4NA 1WW3A 1DHTA 2Q7DA 4PF1A 1U7HA 3A27A 1BQ3A 1VE9A 1CVRA 3VQTA 3LT1A 3T9BA 3M4JA 1JSRA 4W8OA 4A2PA 4U7WA 3TL2A 5IYRA 5DYWA 3ZYZA 1KMCA 3TRIA 3TOCA 4YUXA 3THXB 4II3A 4MI9A 5J5CA 5A2QA 1SR8A 2NOAA 4TUYA 3EF0A 5JRZA 2JLCA 1Y7LA 2R6DA 4ZI7B 4FE3A 4Z1MA 4DR4B 1H4QA 2IIPA 2PUFA 4RVOA 1IN5A 2IHUA 3CWCA 3OLXA 3TTSA 4E5YA 3KHUA 2V5UA 1QH1A 3PCRB 4IJ6A 3LWDA 1THTA 3A9UA 1D9XA 5AVKA 4XLAA 1CYEA 2DHCA 1U8CB 3TECE 5EHGA 4B6PA 2BGMA 1W29A 2QDXA 2RGYA 4L4XA 3F5DA 1JFRA 4QUBA 4IW3B 2J3LA 3V32A 4ZQCB 3NE5B 1E5LA 4KV7A 4J2TA 4I14A 3HFRA 2B99A 4I99A 2KBFA 3NTOA 1GIAA 3F1LA 3JVVA 2D0IA 4Y9RA 3OJ0A 4BNJA 3QPBA 3OLWA 1KL7A 1NMEA 3HWWA 4MW6A 1Y8ZA 2CVOA 4EB6B 1N2GA 4I08A 3DLAA 4PFKA 3LVQE 4R71A 3MFQA 4HWKA 4QU5A 3N39C 3SF8B 4DILA 5KTPA 3A1PA 3V1LA 1ZRSA 3B48A 3W8FA 2Z0MA 1V8OA 2AE1A 4RD0A 1I4LD 3B5IA 2AW3A 3JV7A 3ORHA 2E7ZA 4K0RA 2I2WA 3I8OA 2BC9A 4JBIA 2D9RA 3GBSA 4ZT4A 4WN9B 2VQ3A 3W05A 4HKTA 3OPYI 3WBJA 4X7MA 5EIFA 1XQ1A 2Y0EA 3V00A 1ZD8A 4E12A 1ZHOA 2V8BA 1WDMA 2AT1A 3BRCA 1X6VA 4UMEA 5AUQA 3OM8A 1VQ6B 4R2IA 4KPUA 2WJ4A 4L9AA 3VU9B 2R1VB 1X7GA 3VH3A 3ELDA 1ESCA 1W19A 1TW2A 4M6WA 2FPIB 3ZE1B 2V0NA 4NCNA 5I9IA 3AYZB 2A33A 2OFXA 4LOKA 4E21A 2BMVA 2HFJA 4D9GA 1SRRA 4PM4A 2WU3A 5C31A 1AK2A 4CTNA 1FNDA 3RSGA 1BDJA 2FWMX 3G0DA 5ADUS 4RMIA 1XXLA 1ZEMA 1M0EA 4GU5A 4XA8A 2Z3VA 3PRKE 2QLBA 1UPCA 2R6AA 5G02A 3AR2A 4BB6A 2QI9F 1TC2A 1ZNYA 1YL6A 3LLVA 4X44A 3K0KA 5C8XA 4MKIA 4TTVA 2BGKA 1Z82A 4C04A 1OVGA 2ZZNA 1ZH6A 5JADA 3TUZC 4X65B 4NKRA 2VTEA 3R8XA 2PKYX 1RHMA 4P33A 1PT5A 1ZFNA 2CLHB 2HTFA 3LT2A 3O31A 4LRQA 4RSGA 5AJZA 1VE6A 3WYEA 3F8WA 4G01B 5KKNB 1WBDA 2AG6A 4DNPA 2D5BA 4FYWA 4UTOA 3OQHA 2IYOA 4DRXA 4LX0A 1TEVA 3A36A 3AF2A 2C8JA 4G09A 3DULA 2BSQA 3E1YE 1UWVA 1N9GA 4L8YA 3GQBB 3FYTA 4CQJA 2P91A 2P65A 5A7FA 3DW3X 2WB4A 3TH5A 4Q4LA 2XT6A 4Q9IA 3RBXA 3VC2A 4J0DA 1XU9A 1YF3A 3MHTA 2J9FA 2I6UA 2XWBF 3QBTA 1AQLA 4RSMA 1WQ3A 4YLYA 4RCYA 1F51E 3WMEA 1N5JA 1QH1B 3K0CA 3F46A 5IS2A 2X3UA 4EHLA 4UMDA 4DV5B 2E9SA 3MGBA 2CSXA 3F6RA 2V4ZA 3P4YA 3EXEB 1ZJJA 3TW4A 1CPYA 1R10A 4LGCA 2XNCA 2ZITA 3JQPA 2FMHA 4HP8A 2FB9A 1PLJA 5DHQA 3QYPA 3X2FA 1YUBA 3GUVA 1U7ZA 3OCVA 1DL5A 1PGQA 2GF2A 5T4BA 3ZZNA 3FKSA 2VP2A 5CIWA 3I8SA 4PC3A 5FBKA 2VP0A 1Y7IA 5A5EA 5KTNA 2F1RA 1Z5VA 2RAFA 1KAHA 1I4OA 3NIDB 3H0EA 4YDQA 5IASA 5BQ3A 3K09A 3LG2A 2PTHA 3BDIA 1IHOA 2G82A 4R2KA 3UWDA 4F97A 1ENPA 4MS1B 4AWXA 3EA5A 1L4HA 1PBTA 4OQMA 3GJZA 4CT4B 4R2JA 1T2EA 4OHYA 1AN9A 3HP7A 4WLFA 3VH2A 2ORVA 4RE5A 2EIXA 3CF6R 3CRVA 4AQ7A 3KU1A 3I4LA 5JXIA 3LDFA 4GD3Q 1U4OA 4ED9A 4I3FA 2SECE 3J7TA 2QGZA 1UP7A 4PS0A 4G84A 5AKZA 3LDHA 1VE5A 1MB9A 4HPJB 2QJOA 4LBZA 1YOVA 4PGAA 3C6XA 2PS3A 1XN4A 2XAUA 4D9NA 2H1CA 4EGJA 3QNUA 3HA2A 1LI5A 2QYHA 2XA2A 3N1UA 1ELOA 5TQVA 1T8WA 1EK0A 1QFXA 2BYTA 2VQFB 3QX8A 1JLKA 3P9KA 4C05A 1VJGA 1D1NA 4PTLA 2YWJA 5TPWB 5ULLA 5CB4A 1AO0A 2VPTA 2WOJA 4X3PA 4NYJQ 2Y66A 1OROA 4BWFB 1R12A 1MJHA 1NR1A 5EMJA 5HFAA 1PNVA 1WW8A 3PD0A 2JLYA 4FM9A 2RBGA 4IZIA 2ZIUB 1N07A 2QZ4A 1O96B 2FEPA 2H1VA 1KFCB 3SPXA 1OXBB 3I2IA 3NBZC 5AUPB 1X1DA 3ETHA 3PT5A 8OHMA 1NDQA 2FZ4A 4CF4A 1XYVA 1NN0A 3GR6A 2L2QA 3AB7A 5JT1A 1V16B 1RR6A 2Q3MA 2YVQA 3ICCA 4K5QA 3E15A 2IHTA 4LOAA 5JAHA 1JH9A 4ARCA 1XZMA 1C30B 1QG2A 4H6PA 5FPTA 3EDMA 3SE0A 3A8IA 1JPNA 1JIXA 4PCLA 4WCVA 2W00A 1VI2A 5JXHA 4A2CA 3KZXA 1UXHA 3CF0A 3CVXA 4QLOA 4XYLA 1LXCA 3DYBA 1JAZA 2ZSDA 4XAQA 3RFXA 3T5TA 1FXWF 4TXMA 5JMPA 5IT0A 4DMUB 3SKYA 2Y0BA 1QH8B 3WZMA 1KAGA 2VDOB 2WE8A 4NVRA 4L2IB 4IRXA 3RYHA 4DBLC 3GLHA 3N5KA 4U7PB 3R2JA 2ZUSA 4H9GA 4IZOA 4R7ZA 5FLYA 2I6XA 1ZH0A 1L5FA 1CLUA 4GM0A 3PK0A 4XGQA 2C4KA 2DQYA 1MAVA 1YA8A 3KSDO 4YO7A 1PD1A 4BMOB 4C87A 4EYQA 1QNLA 2CL6X 1VQNB 2A9PA 1L5NA 3H94A 1BN6A 3DTVD 5KQGA 3U09A 1QONA 2HHLA 2P0YA 3I5MA 4ZV9A 5K2MA 1QMPA 4QOFA 4V0LA 1RZRD 3JD1A 1Y9AA 1E1CB 2ZJ7A 3SJ7A 3SXUB 1EE1A 1YB1A 2FPIA 1ZNWA 5HOQA 2D1QA 1PV1A 4QL3A 3T94A 5HCUA 5HKBA 3G3EA 1SKBA 2GWHA 3ISVA 3IVCA 1M75A 3A70A 2R65A 1AQNA 1UQUA 5ILOA 1NIPA 2C9ZA 1Y8QA 5CFQA 2DQSA 4D44A 1YMVA 1DGQA 2AFIB 2DQ4A 3OD1A 2WPNA 3GCXA 1GGEA 1RHRA 4Y6OA 1FW6A 4J90A 2ZUBA 3A1WA 1HZJA 3TAUA 2PE5A 9MHTA 3R3HA 2O1WA 1E0KA 4ZXFA 3BXZA 1EQ2A 3RVNA 1VJRA 3GPDG 1XZLA 2Q1YA 3BMCA 3BWDD 3RBAA 1K97A 1OWPA 3BB1A 1GAJA 4MH0R 4Z6KA 2JZCA 2V6FA 2J5XA 3JR3A 1X7ZB 4DMKA 1ZKMA 4WN9A 3V4RA 1S8OA 3M1LA 1NP7A 4R1MA 4F4HA 3RAFC 2NP7A 3F5QA 3OW2B 3UA4A 2QZPA 2XJ4A 3ZCTA 3LFTA 2QY6A 2XJ9A 5TMDA 1N36B 2FSVC 3PC6A 4H16A 4BE9A 1W9HA 1FQJA 3THYB 1UC5B 4MMXB 4P3XA 4CF7A 1MOPA 3ZW8A 1E1RA 2ZM5A 1WSDA 4MAMA 4MTLA 1XWFA 3H86A 5HRUA 3AKZA 1XPUA 1JQKA 3FLMA 1AT1A 2B34A 4WPGA 2HH9A 1EQUA 2P8JA 3ETJA 3R4VA 1Y6FA 2VCEA 2ANCA 4MMZB 2GN1A 5BORA 2D62A 3KQHA 1F8XA 1VKHA 1ADFA 1M90D 3CCFA 4C7JA 1O97D 2QN1A 1FMFA 5F51A 3BK2A 2OBBA 3RU9A 5FBQB 2BBWA 1KKLA 2EFEB 1CR6A 2OQVA 5JEEA 3FJYA 3GT4A 3UHPA 5I7RA 1HFKA 1NRXA 2XKKA 3ASQA 1FLDA 5DWVA 2A78A 4L0DA 3VSBA 2OVBA 3KWJA 4AZ3A 4KI0A 4BBPA 4PYOA 1UC8A 3WQQA 5DTMA 2AGVA 3PYLA 3DLIA 4EJ6A 4LAFA 1HX7A 4IBOA 4XCXA 3NC0C 2G4LA 2Y3IA 1G7RA 3FGPA 2QLFA 4Z99A 5TDHA 4C2UA 1I4DD 3EZYA 2JH3A 1Z12A 5L7WA 1SUPA 1RWOA 3LBNA 3ABZA 1C1DB 3BHJA 1JA0A 4MW5A 3SOPA 1IQPA 1UKEA 4K9RA 4EJSC 2AW5A 1O0BA 4EKNB 1VKZA 3PXUA 4KXXA 1RWBA 4C14A 5DM0A 2Q21A 2WD9A 3SLRA 3EVCA 1GILA 4HEHA 3SZMA 3W9BA 2E4VA 4EEKA 1I9CA 3WSWA 3AKCA 3IQWA 4YMUA 3FX2A 2VDKB 4HWPA 4PO3X 3U49A 5T5QA 3V1MA 1XVUA 1DKLA 4I4TA 2GPYA 1L8LA 3VDNB 4KSBA 2O7RA 1DG1G 2P9GA 1RWQA 1I6LA 1Q92A 4AJKA 3DMPA 3HKDB 2GUGA 4YECA 4NBLA 4FFPA 2BT4A 1LTHR 1FYFA 3ESRA 5FPPA 4ZWNA 1J9EA 4YEJA 2Q0SA 2OCXA 2XNSA 2UXBB 1K08A 1WB9A 4DVGA 1TTTA 1GGMA 1RWWA 2GAIA 2OILA 1GADO 4GI3A 5EUQB 4OHBA 4QEDA 5EN4A 2R62A 2OCGA 2XDQB 1MW8X 3L7AA 3VKVA 1K0FA 4CM9D 3ABOB 4GAEA 2VSNA 2QUZA 2WMYA 1YQUA 3TUIC 2QRVB 2P7HA 3GX1A 1T5BA 3GJTA 2H7CA 3H2SA 3HACA 4CL3A 2O8BA 1C8LA 1MVOA 3T7DA 1KQNA 3ZLUA 3ZIDA 2G28A 1I2MA 2EFCB 3MJDA 4ITVA 2YWRA 1GARA 3QVKA 4NZPA 3I5YA 1VDZA 3OZUA 4V0KA 1A9YA 2BHLA 3VPAA 4DLPA 4JBNA 3A6EA 1QKKA 3EY4A 2FPGA 3FNBA 1PWZA 3IUBA 1BHQ1 3OT4A 1JAXA 5JVDA 1O9GA 5AK6A 2WV7A 1FP1D 4UBLA 2WYOA 3R75A 4WKCA 4GOMD 1YJ8A 4TL9A 3ASRA 4RK1A 4L9SA 3FNFA 1IHUA 3KSUA 4GSYA 3LPDA 4EY3A 1UOOA 1PW7A 4PZLA 1YB6A 5IJWA 4PAWA 1AA6A 2O0JA 3R3JA 1NDHA 4HN2A 1UPFA 4N40A 1RC8A 4OYRA 3U0VA 1ZCBA 4BGUA 2CJWA 5C18A 4KE7A 3W5DA 2OWEA 1UDXA 3RK0A 1TQDA 1Z5UA 2VHVA 4LSWA 2ZIZA 4CV2A 4Q02A 1UQTA 2OV2A 2RHHA 1RLOA 1A7AA 2R7KA 1I1OA 4M7OA 5B6JA 2AKEA 3HUFA 1LSOA 2J3KA 4MVCA 5IEBA 3V34A 4BLWA 5JXWA 2BFBA 2JLQA 2GQ0A 4ZQEA 1PNRA 3O6VA 4P5PA 3D6UA 3P9YA 3VHRA 5AOAA 3U7RA 2O2GA 3ILHA 5K0NA 2WWYA 2R84A 4MS3A 1R0BA 5CLLA 2C59A 2OZEA 1ZUHA 2A5GA 2FX2A 4F3TA 3EJ6A 3CX7A 4B85A 2O2JA 2YY6A 2AFIE 2YY7A 1W73A 1TYEB 3GJYA 3HVJA 4I8IA 2VTDA 2HNKA 1BE0A 1K4YA 3CSSA 3KSMA 5C3UA 5CCEA 3FW1A 4IEFB 4S1VA 1EA5A 3PFNA 3B1ZA 1NVUQ 2VWHA 3IRUA 4J7AA 4NFSA 5CIQA 5LLTA 2C2ZA 3UENA 3H6KA 1J2TA 3SR0A 5C81A 5LYYA 4FSDA 4L0QA 4U7GA 1E3WA 2H1LA 3C70A 3G0IA 4OXIA 3TQIA 1D0VA 1NE2A 2H5IA 2XXAA 3S29A 2JKYA 4QYIA 1D2RA 3VOAA 1WDTA 1EVQA 4U8GA 5EUMA 4COOA 2YMQA 4OQYA 5ILQA 2Z4SA 4A4DA 3GVLA 4YHBA 5DI3A 5A7HA 4DIEA 2QGFA 1PQWA 3MHPA 4N3NA 2DYIA 4M99A 5AVSA 2AA3A 2FJ0A 4Z0NA 3PQDA 4JQSA 5E9AA 2J7KA 1DJQA 4XJSA 1TTHA 2GA8A 2FETA 3E7DA 4JB8A 2PJUA 4I5EA 4MCHA 1PFQA 4MV6A 2GEFA 3S2GA 1G2PA 5I9SA 3ZTWA 4ZAVA 2ZREA 1V48A 2WJHA 3QI7A 3SYTA 1FTGA 2YNMA 1H6AA 2ZJ5A 3NX4A 4HDMB 4NPHA 4TWRA 5TS3A 4BJHB 5IKEA 1U8UA 4ARVA 1SA0B 1NI3A 3IAEA 4R83A 5FA8A 1I2ZA 4BQIA 2VTBB 5CDFE 1CD5A 3ICPA 1B0ZA 4F96A 1O03A 3CCEB 1YJQA 2QM0A 2GTHA 3D02A 3M5WA 3IUQA 4JKOA 4PGFA 1CUVA 4EA6A 5IZCC 2QJTA 2WAMA 4PQRA 3OC0A 1NRWA 1QQ6A 1XDGA 4NR0A 4YJFB 5EKTA 2YY5A 4EECA 3QEBZ 1JPJA 2XB6A 3KB1A 3PYXA 5CDFA 3C5HA 3IS3A 3PFBA 4HDNB 4REQA 1UCFA 5C53B 1URPA 3ZLTA 2E1RA 4L5JA 2GYYA 3TL6A 2JAXA 2WHYA 3AL2A 2RHBA 1FXWA 3LXMA 3KT3A 4LJKA 1YR1A 2C4HA 2DFVA 5BNFA 4S05A 3ZBQA 4ZYTA 1J70A 1HBJA 1NMZA 2M98A 2VTKA 4KX5A 4BDSA 3D8UA 2XUHA 4BMNA 4DSAA 3CRRA 1DRJA 3KSZO 1GGHA 1BJTA 2WZQA 1T4GA 3U3OA 1F8FA 1U1CA 2FZ5A 3N2ZB 5IC4A 1C7RA 4HMPA 1I2CA 3GUUA 4UW9A 3WLOA 4KRGA 4QEKA 5AO9A 4AYWA 1ZSYA 3L1IA 1NLUA 1V5EA 2GK7A 2F43A 4LRSB 4B87A 4MROA 1HMPA 2CL0X 3JYPA 3V3KA 4JJ8A 4B83A 1TQ6A 1FJXA 4LF5B 4FWTA 4CKYA 4A0GA 1E2UA 4DMMA 2RGRA 4CL8A 3MUFA 1G4UR 1IBLB 1C3OB 1V9SA 4E13A 2WJAA 4QGSA 1L4BA 4ZRMA 2RIRA 1YS9A 4L15A 4BLOA 5CXXA 4DWOA 2XRZA 3CLUD 2XBUA 4NCKA 4ASUA 4NU5A 4FUTA 1G8KA 1VQMB 1CNEA 1UR5A 1GL9B 3NTLA 2OFPA 4PLVA 3RHTA 3NP7A 4WFIA 1T6NA 2DUMA 2FHPA 2TRSB 5BV7A 1NTRA 3NHAA 1W9XA 3GWZA 3LA8A 3QU5A 5GIOE 4PG8A 3M5PA 3C5WP 3O3NB 4DEVA 1P7YA 3K35A 2PWBA 3JWEA 3KEWA 2HCTA 1OI3A 4V1CI 4RK5A 1COWA 1OJ7A 3DQQA 1L7RA 4IVQA 2XQIA 2HEIA 2CXQA 1W34A 2J4CA 4UDYX 3QWAA 4DF3A 5D85A 4K8RB 5HF9A 5B1YA 3KZMA 2HA3A 1H2YA 4G0OA 1IXSB 4X5OA 1FB5A 1TX4B 3K0FA 3OZRA 4FOOA 1MMFB 4ZZ2A 4AZVA 5A1TA 5JWRA 4QQFA 4OJYA 1TZKA 2G1JA 2PUTA 5F2EA 1TK9A 1G21A 4OQXA 2EQBA 3DEJA 4G9GA 2H51A 5KYWB 1CY2A 3LGAA 3V48A 5AVTA 3AOEA 2W48A 3E5RA 3NT2A 1U8YA 3W2TA 1GDTA 4A91A 1YS6A 3E9ZA 4Z4FA 4GEGA 2ZYSA 3DB1A 3R8FA 1EM8B 1HTTA 3UGJA 1F2UB 1R15A 1P7ZA 1LVUA 2MSDB 1E3WB 3C14C 3MVEA 4XGKA 3W5BA 1LW7A 4WERA 1SNYA 4CKCB 3U37A 5BUQA 3ROEA 3S0JA 3T4EA 3X3HA 2PYDA 1RSZA 5DO9A 1X1BA 5CIYA 1YZYA 1G1MA 4OOFA 2A94A 2W2TA 2JI8A 2Z57A 3A6JA 4BWVA 3OEED 1XHLA 2FLWA 4EP1A 4XSHA 4WWVA 5BQPA 5JWHA 5IBQA 4O0LA 1POWA 2Q0XA 3RANA 5KS2A 4TRNA 1QPZA 3JU4A 2G06A 4QREA 3NHSA 4HS9A 1XTTA 3KCQA 4PHHA 3HVUA 3AX6A 1Q2UA 4EY5A 5CG1A 2C00A 3EW7A 5IULC 3HBNA 5AQ1A 2EW8A 1EZZA 1ZOPA 1PR3A 5FBHA 1FDWA 3HYTA 1K9MD 1BFKA 3O4RA 3MERA 4FCWA 1IY2A 1RQNA 3BC1A 2EZ9A 3S2YA 3WGIA 1CDEA 1BX0A 1L7XA 1QLHA 3JQGB 2C0CA 4B3BA 4B2LA 1E61A 1QZXA 2D13A 3QXJA 3DMNA 4PHCA 4AB1A 4BFTA 3OTOB 4BNIA 1RFLA 3CEJA 1LK7A 4YRKA 2AOTA 2J0VA 1L7VC 3LQEA 3PWZA 4OKSA 1ZR2A 2C3UA 4BVLA 5BYAA 1R4AA 3KYIB 1ESDA 1YC2A 3M7IA 3ZBUA 4RLFA 2QBYA 1UPUA 1NAHA 4KK3A 4GPD1 4IV0A 1D2MA 2HBZA 1VJCA 2WM2A 3O21A 4GZ6A 2Z3ZA 1JTVA 3GL9A 4PTZA 3WO0A 1DEXA 1Z18A 2HRCA 1BMTA 1XDWA 3ETDA 3LPAA 4RTKA 1KJZA 2WSIA 3WHPA 2K2QB 4MB0A 5KSZA 4J91A 4V24A 4P3KA 2W58A 4ZDWA 5HM8A 5ISMA 1N5DA 3NQ41 4IGFA 2WVGA 3SYKA 2XUIA 1M7BA 3HB7A 2O0MA 3NEPX 4PAMA 3WMWA 1N7JA 1UJ6A 2LBPA 4GRIA 3K6JA 2QL6A 2BTEA 3SDZA 4P35A 2CDCA 1GL7A 3I0ZA 1PDWA 5CM9C 3KYCB 4MR8B 4YRDA 5F73A 3B7PA 4N3BA 1QHYA 3N0XA 3ZVKA 1MGPA 4FYIA 2I4OA 4V3BA 3IEMA 4KOAA 3PCTA 3OM9A 5FNVA 4ZCQA 3EFBA 3VR2D 2HBQA 2QS9A 4WZEA 4B1FA 1OX4A 1RYHA 3AERB 5DIZA 2VSOA 4DA6A 1IPEA 1QRTA 3E9MA 1SPXA 1DBRA 2PT5A 1UKZA 3H1BA 1AKMA 5ICFA 3FDXA 3VC1A 2VK4A 1SU7A 2BIFA 1UH5A 1JDTA 4J1TA 3W78A 1S01A 4E2WA 1KD1D 1M2GA 3ZQ4A 1W59A 1Y80A 4MVJH 4D4HA 4ZIRA 3I01A 5JSZB 4HLNA 4KB5A 4WXRA 5INTA 4Y7DA 2AI3A 1SKMA 3OJLA 2PKQP 1TYAE 4OBXA 4YUAA 4LY0A 5KYWA 3GZTB 1TQ2A 4GMXA 1SIUA 3QTBA 4PANA 1TCVA 3RC3A 1XMJA 3FMGA 4Y2PA 1VBFA 1X2BA 2JGAA 4NH0A 4RAQA 4QXAA 2BWJA 1NUQA 1KU6A 4L51A 4A8JB 4E2FA 1G3QA 2E87A 4QGGA 1DFGA 1RXYA 1CY7A 1WU7A 2BTQA 5DTIA 4QJIA 1XKXA 1LDBA 3I9V6 3ROTA 3V2IA 5IM4A 4BVHA 4GG1A 2JLSA 4KIWA 3UO8B 5BW4A 1O94D 2VS1A 1SQ0A 2PUWA 4KBGA 4NH4A 1G5IA 4JOBA 1NGSA 3W2GA 4JBWA 4MQ4A 1PJ2A 2Q3CA 4X20A 3SZUA 2OFWA 4LDQA 1NI5A 1TVKA 3K53A 3LP6A 3NOOA 3LQKA 4NV1A 1PUXA 5FTNA 3U7IA 1F3LA 1IZYA 2R2AA 2NTVA 4G5HA 2NSLA 5K51A 5J47A 4QOHA 2G6TA 3IT1A 3A31A 4X7BA 5DW3A 3TDKA 1NL3A 1U0EA 5F2OA 2QVXX 5AK0A 2Q3FA 5DHUA 3PV0A 1XAJA 3ZXXA 8MHTA 1PJSA 3KV1A 5H68A 4BO6A 1WCYA 3MUNA 4FNMA 4RDCA 1NB9A 2ADOA 5LIRA 2W8BA 3KUXA 3QF7A 1N9GB 2BDEA 4KYUA 1UC4B 1HOTA 2QKYA 2POQX 1PKEA 3PA2A 2AZ4A 1PVVA 3DBOB 1HK7A 3QELA 1S2GA 1JDZA 2I8LA 3HJTA 1TJ4A 1C3XA 4RWZA 3OX4A 3ZGXA 3R9XB 3B3GA 3GFGA 5BXQC 4P5EA 3PUXA 3CMMA 1P4GA 4CCAA 4FZJA 1CY8A 1VL8A 4H60A 1AGYA 3OU7A 1WCWA 3BFXA 1T9KA 1DB3A 4L5AA 1EXVA 1P74A 3H3FA 8AT1A 4DR6B 3GLHE 5CYFA 1Y5NA 1NW6A 1XPJA 4JEUA 1F5NA 4W9NA 3M6MD 1CV2A 1S3FA 2GETA 2ODWA 4Z4RA 2XODA 3ETEA 4RW0A 3R76A 1NNLA 3S55A 1WXHA 3X43A 3NHWA 1CJTC 4WBNF 5KVAA 1DO0A 1YQXA 1CUJA 1AQIA 4Z4SA 3RLIA 3T3EA 3RASA 2NGRA 1EUDA 1FOEB 2FLVA 4ASUD 4ZC1A 5AW1A 3VR4D 1WB4A 2KM1A 2DFNA 2ZFUA 1QGUB 3IE2A 3LQFA 3KWLA 3R5HA 5E6RB 2GERA 4OHKA 5HZKA 5C1PA 4TLDA 2WF9A 4YJDA 3IEKA 2VBVA 3VM6A 2I6GA 3SC2A 4HUJA 1KVRA 1E5TA 4U2EA 4EPVA 5HILA 4QQRA 1Q7EA 2CLDX 4GZ5A 3H9NA 3G5UA 3MGKA 4HAIA 3LL4A 4KR6A 1GRNA 4F3RA 4NOMA 1Q0TA 2WIBA 4JZYA 4HY3A 4YREA 3NS7A 4Y9DA 2ZBRA 2PTGA 5AVZA 3KDPA 4JBHA 5TPZD 221PA 2Q4EA 3TQFA 1HNNA 5K8UA 3A8KA 8GPBA 4CN9A 4WCFA 5EA2A 3GOHA 2OTLB 4BNUA 1KZHA 1AY0A 3BCDA 2ZXEA 2E85A 3OC6A 4G5YA 4UVGA 2KMLA 4YONB 5K99A 1E1CA 4KYVA 3PGMA 4FJ1A 1AK1A 4LXGA 4D4IA 1Z5OA 2RSLA 4AKSA 2DBVO 2O57A 4CHTA 1X8JA 1JWLA 1MABB 1CZRA 4B80A 1P73A 1N77A 1L3BA 1DFIA 5CT4A 4CNBA 2HMTA 4U0JA 1Z16A 4K05A 2A5YB 2JFYA 4GKVA 1DCTA 2HYDA 1QP7A 1V95A 3CLSD 4WOJA 3UHAA 2V0GA 4LG1A 1XTRA 3ZV5A 3PR1A 3ZDXB 1N4AA 1BXGA 4F5WA 1TIPA 3E3LA 2PQ0A 1FPMA 2VUHB 1NP6A 3ISTA 5JDIC 3FZYA 1EFVB 5CLFA 1CEEA 1E6WA 1T36B 3JZFA 4QGFA 3AF0A 3H75A 1V4NA 1TJ3A 4PZEA 2XQJA 5DLQC 4ZV7A 2XBLA 1EBFA 1RZVA 1TZBA 1ZL2A 5F4JA 3L0SA 5M2QA 3ZEAA 1VPDA 1ZIOA 3P97A 3ZLJA 1MDFA 1SK8A 4D4GA 4DWVA 2IYPA 1OGJA 3DW1X 3F9IA 5K0CA 2PD3A 3VYRB 2GEKA 5DM60 1T6YA 1VKRA 2DR3A 4HRYA 3VO2A 1MA3A 1Q74A 2FP3A 3K6KA 5CLGA 5DU2A 4EG5A 5KJFA 2OB2A 3FHCB 4GR4A 4PSAA 3KE8A 1Q7TA 5KNLA 2XNKA 2XBMA 1SWVA 2JASA 3DDOA 1PBNA 4FW9A 4HI0E 4M83A 5EKSA 3K16A 5KOHA 4MMYB 2OKGA 4QWWA 2ORED 1Y1QA 4OQFA 1CEYA 5HR5A 3LKBA 2IDKA 1KFJB 2I3BA 2X8AA 3JSXA 4RVSA 2CNNA 2W22A 4OIFA 3UJ9A 5H80A 1CQIA 4IJKA 4JLDA 4LVNA 4WZBB 1Z17A 5FI5A 3EDCA 4ZZ0A 2AD1A 4LV8B 4FR2A 2PDAA 4K86A 5KCZA 1Z4JA 2PH1A 3F74A 3LAWA 3HNPA 1PJ6A 4OA8A 3UXYA 2EL9A 2BGIA 5EPOA 1HDXA 1YWGO 2LCIA 3EISA 1C81A 4B84A 3O38A 5AIBA 3I6ZA 1Q1AA 2CUZA 4AQYB 2VT7A 2ZXFA 1M6YA 4TKUA 3LC0A 5FFNA 2W2VA 3N2EA 4FYKA 2AZDA 4LWQA 4RKEA 4A6EA 5GJCA 4CV1A 2VPXA 4MGHA 1NBEA 1T3ZA 2VJLA 1QOPB 4PQYA 2BFCB 3A8TA 4QUEA 2HLDA 3IEXA 5P21A 3KJZA 2RKBA 4NYJR 2JH8A 4XLZA 2PQ2A 4OPSA 1V9LA 3VNBA 2YXLA 3BJMA 1H2BA 1XDZA 4YTEA 5E3JA 3ITNA 5ALZA 1M2FA 4PZZA 5GM1A 5F7ZA 3FPSA 1MIOB 2WW8A 1SB9A 5IK2A 3IUNA 4UHJA 5JSHA 3EEFA 5DGIA 1A04A 1KARA 2JJ8A 3VVLA 3TAHA 4FUQA 3STYA 1XLTA 3IOYA 5IJ9B 4NXNB 3ESAA 1IMOA 1QG4A 4M53A 4E6EA 4KIJA 1N57A 2EDAA 4JQCA 2VXOA 4DSTA 2I6TA 3EQ9A 2CLEB 1VRVA 5ALVA 1FFXB 2BM9A 1JLMA 2J85A 1BEEA 3OKCA 5KX5F 3QV2A 3P52A 2F1JA 2QD3A 4A3SA 3F9RA 3HR7A 3GLQA 4KKSA 4GEKA 4XI9A 3G88A 5LZ5A 4EY4A 1J21A 3VC3A 2OCDA 4IDCA 3RAGA 1E20A 3TNYA 3VZRA 1RRPA 4AX4A 2ZJAA 3O4VA 5IZCA 1UD5A 2AEEA 2QD2A 1H5NA 3LPNA 2VLBA 5HS4A 1WTCA 3CZAA 1QGAA 1QUEA 3DS8A 2JFXA 1NY5A 5D3ZA 3NTQA 1JJ7A 3EULA 3BF8A 1WB6A 2VJMB 5ERGB 3GW8A 4JLJA 4KKVA 2ZZGA 3SEQA 2FMUA 4UBJA 5EE0A 3WYFA 3OQNA 4FFMA 1GYRA 2EZ8A 1CB0A 1Z88A 2JGLA 2O2HA 2OTCA 2YV3A 3CPJB 4FMDB 3IE0A 4UBOA 5JAUA 1QG0A 2C7QA 4UDXX 1F7VA 3MWKA 2AX4A 4WKOA 4ZMSA 4LXXA 1U81A 4Q34A 1XZKA 3EXFA 5IZ4A 3OESA 1UJ2A 4N3AA 3G6WA 5EIEA 5ED0A 4G0VA 3ST7A 3ZHUA 1I14A 2W2LD 4JLWA 2VBUA 2BGTA 4M8KA 5JZMA 4FQ8A 4ALMA 3JQ6A 3RUFA 1PTJC 3NRJA 2PBFA 3A1FA 2A1TR 5HIMA 1ZQ9A 2XADA 5I7VA 3L7JA 2HSZA 4AM8A 2CB9A 1MAWA 3RKRA 4EFDA 3SZGA 3GLSA 2O0HA 5EZSA 2CL5A 1CZLA 1ZJ5A 3L1UA 4CLXA 2EFYA 4OQPA 4QTXA 3QFTA 3MTJA 2NPOA 5EWMA 5JISA 4QYIB 1GHTA 4JUIA 2PXHA 3WMRA 4UD6A 5KTKA 3D54D 4WZBA 1YDFA 2Q6LA 2A57A 3X1XA 1I7DA 2FSGA 1IJBA 3BFJA 4JSTA 1RI5A 4W5NA 4IJMA 4EO4A 2ASVA 1ZJWA 2Z5LA 2PWZA 3QVMA 3DLCA 1OV6A 3E35A 5TQ2A 1GQFA 4N48A 5K0ZA 3UUGA 5CITA 3PA8A 4MPPA 1ML4A 1HQYE 1QRSA 3WYDA 1UP6A 2FSVA 1MFPA 2LGJA 2PLWA 2C9OA 5FADA 3R77A 3INYA 1YJWB 1JX6A 1UMKA 2RG1A 3IPRA 4XVCA 5I7SA 2FX3A 3NHZA 1BE8A 5HKLA 1YRBA 2ALJA 2NX2A 3BSWA 3HY3A 3QXSA 3W4IA 4EUFA 2XVYA 1U5BB 3LX5A 4B3FX 2C3PA 3MT7A 5L9AA 1FJ2A 2JI4A 3ICEA 2N75A 1R16A 3DNFA 3U7QB 4QT0A 4DJ5X 3TD9A 2I7CA 2J9YB 4IOLA 1D1TA 2JGJA 1KY3A 1OFHA 2OKCA 2PMBA 4M0UA 4MULA 1F6DA 1ZOLA 3IDSA 3QVJA 1QS0A 3OMLA 4GQNA 2QT1A 5ECDA 3D4OA 4JYBA 4C3ZA 4RESA 5L95A 4V02A 4ZVTA 3WL6A 3D2BA 2ZRKA 4DJAA 3B2NA 3TQSA 4DZRA 4EKEA 2ZXUA 2W5UA 3ADOA 5J4HA 1AG9A 1XMSA 2K7ZA 1SCBA 3I52A 2LR0A 2ZCUA 5D3MB 4AJPA 2L19A 1BFUA 1CS0B 5AH0A 3RWBA 2GA9A 4O4JB 2A1UA 4Y30A 2JRCA 4Z4CA 3IERA 3HI6A 3ZK7A 3TOXA 3LGXA 3AF1A 3I64A 1NZFA 3W6ZA 2QD5A 3R40A 2WNIA 3FNRA 3R6GA 4LVUA 4N7RA 4Q4JA 1UDCA 3AVQA 2WKSA 4H18A 4DUPA 1E6LA 4EPYA 1A95A 1O4VA 3QGMA 1ZJZA 2G09A 1YB2A 4OBEA 1XZ8A 5K3FA 5ERYA 1OI7A 1JR3A 3BWCA 2QVZX 3CTMA 3HDQA 3KZ1E 5IUKC 4B32A 2Q5HA 3D0KA 3DOCA 3I28A 4U2CA 1M2KA 3CT6A 4RF3A 2FPRA 4MGKR 1MORA 3EXG1 4M0KA 3EVEA 2GN8A 2XRYA 5HQ3B 1IBCA 2JFWA 1Q6ZA 4FMBB 2LZJA 2WTXA 1CF9A 2JA1A 5IVKA 3OM1A 5I4KA 1BXRB 2IGTA 2NO0A 2FFQA 3C4JA 1AZTA 1Z6TA 3COSA 1QSGA 1VSTA 5IAAA 1Y37A 2Q45A 3W2IA 1IL0A 2AXQA 3HTXA 2I1QA 5DTJA 3DV0B 4J29A 1PYDA 1DO8A 2XD9A 4JR2A 4WY2A 4J2OA 4N5MA 3TNDA 1RRMA 3CJRA 2PKRA 2JVJA 1XP5A 4RQBA 2IHYA 4PEVA 5IX8A 5K8LA 2JG3A 1JEJA 3EVZA 1WOOA 2GXQA 1VQKB 4M8SA 4XVRA 4BNFA 4E31A 5CGZA 2Z6UA 1BW9A 5G3ZA 3VU1A 2QSZA 2VOEA 1NU6A 1ECCA 1YE3A 2QLLA 3QMPA 1ZD4A 2V1UA 2Q99A 2X5OA 4XLLA 5G0UA 1LPSA 1GPYA 3LA6A 3OZGA 5AM1A 3BQMB 3PFIA 1T1JA 1HF3A 1ADYA 1E7QA 3P9PA 5ALEA 3A4TA 3BC9A 3QXCA 4MARA 4H4DA 3HGTA 2GD6A 4KK4A 2R5WA 1E9RA 1DX6A 3G2PA 3OZCA 1IBRA 4Y2YA 2VJQA 1M1UA 4OKIA 3ZCQA 4L9WA 3OZEA 2J6BA 1SZCA 5TNXA 1HYGA 3HXQA 3T4XA 3L8CA 3A1TA 2OQRA 5EIAA 2K7FA 5EMNA 1UJ4A 3ZUPA 1Q1GA 3EAFA 3FNEA 4R5HA 3DT6A 2O06A 2QR2A 2BBSA 3IQDB 1P77A 1TQHA 3KHKA 5HXAA 1IXYA 4PBSA 2VZ0A 1QIGA 3PI6A 4ND5A 4MYTA 4OAPA 4MV5A 1QZ3A 2XAAA 3LOUA 4EW3A 3B53X 1L5MA 1VBKA 1SU8A 2I4IA 1FTSA 1DCKA 1T4CA 3DT8A 2F1MA 2FR8C 3QUQA 3DZFA 4IJQA 4X7EA 4XARA 5L51A 2Z6BD 2Q3JA 3KUCA 3ZZTA 1U5BA 3WMXA 3A4LA 4B5LA 3LIIA 2ZYHA 1UQRA 3G59A 1JKFA 4PSDA 3IV6A 4X61A 3FYDA 2WFMA 3HN7A 3W5CA 3JQAD 1NG9A 2FW1A 2ACVA 2ONJA 2WHPA 1C4KA 1T5DX 4I3HA 2VAWA 1I3MA 1BWSA 4FHZA 1Z26A 2HK9A 3BXFA 4OL0A 5FL3A 4UUMA 5T3UA 3TE6A 3ZCXA 5ESWA 1RWNA 2B83A 5D1HA 3NHKA 5DULA 5E6SB 4ZANA 3T99A 4BNMA 4YAIA 4LBYA 4X06A 1ULTA 2N0SA 3ANMA 3A25A 3IPLA 3IAAA 3O93A 2WSMA 3S81A 2B3TA 2IEDA 1U90A 1KI7A 1H1TA 1M6HA 2PMWB 4NV0A 4DV2B 4ON9A 2A8YA 3ILXA 3JQDA 4RH0A 1Z0SA 1M0SA 3T41A 4O4IF 1U3WA 2QRQA 1JB1A 1PUIA 3H65A 5CA1F 1O87A 1G9TA 1V35A 3L0IB 4P53A 4C6SA 4HADA 1NOIA 5DX0A 1CHDA 2XTMA 3T12A 1BPLA 5L53A 1C3OA 2R6R1 4RM0A 1SXJE 4R9SA 1ADGA 1YFKA 2DWUA 4N0PA 4GMFA 3HJNA 4X6UA 5EPUA 3W77A 1EBBA 1L5QA 1AK9A 3BSYA 3KLNA 4N0DA 5ETJA 2JGDA 2X9GA 2QE7A 5FOWA 2OD9A 3EEYA 1I8DA 1PFYA 1A69A 4W8HA 2NADA 4EFLA 5CURA 1BE6A 5C4GB 1SC6A 4EW2A 2RJNA 2GKOA 3HB5X 5ER9A 3PPYA 4DMCA 2HL6A 5KWEA 4WZ6A 4LJLA 5KQSA 2HXYA 1ZQ1A 5C8YF 4Z86A 1XMIA 4KQ1A 4ZO9A 2IZ6A 2YVKA 2PNJA 3GN2A 5D5PA 1DT3A 3O74A 1QP4A 1CP3A 1O5OA 4PG7A 4HDSA 3K3PA 2RFLA 4RDJA 3KEFA 3ANYB 3KKQA 4RH1A 4C6TB 4P1ZA 1NI4B 2C5AA 4ZU6X 3O92A 5H82A 4CQMB 5IN4A 2XOKA 2PCJA 1GCIA 3H2IA 4I8DA 1ZM2A 4YT4A 4Q9LA 1T2CA 1FTYA 4Q3EA 1R5JA 2GLXA 3EBLA 5KBYA 3H6HA 4TWIA 1J8QA 4EMBA 3AM5A 1RJGA 1C3LA 2YQ4A 1E3ZA 3A1SA 3A9TA 3BMQA 4HSEA 4WK4B 1X7ZA 3B89A 1IEWA 4EZEA 4C0WA 4E07A 4YP5A 1QBKC 2JNWA 3PHJA 5DYGA 1US8A 3A26A 1ESEA 1QZUA 1N2OA 3W6PA 3TIGA 3QBJA 2ZRGA 1YIAA 2A59A 2HJ9A 1ZKDA 2RK4A 3HJAA 4KAAA 4QHSA 1IRXA 4KO3S 1JI3A 1LTKA 3RYIA 1JWBB 4YUYA 3TW8A 3ENVA 1VMKA 1NPDA 2E18A 1T4MA 1JNYA 2X8WA 3JRXA 5HM6A 3L7LA 5HJEA 3OM0A 4BEJA 1MEOA 3LOPA 4W6QA 4KX3A 3ZEIA 3UKDA 3M83A 3HCWA 4DA7A 1JV2B 3DBVO 3E5HA 1N2ZA 3K94A 1ZHFA 3KD2A 3LBAA 1VCNA 4K6FA 1GRVA 2Q6OA 1X7WB 4TSFD 2IZZA 3U1VA 1KOJA 2A4KA 1ISFA 4ACBA 3VXKA 2NXEA 3LI2A 5FFMA 2CZCA 3WGHA 4D9EA 1LU9A 5C5EA 2Q5CA 1Z2NX 5JSUA 3K70D 1QFZA 2J59A 1HC7A 2QRLA 1GZVA 1AMNA 3ECCA 4OI1A 1B00A 1U11A 4LSZA 3S1LA 2BKLA 4DSZA 1UZAA 5GJWC 4BFUA 3CH4B 3CY6A 4CI0B 5AJWA 2OUIA 3BXXA 5DBIA 4JROA 4RK6A 3UQZA 1C1YA 3B1XA 5DEOA 1L3IA 3L4JA 3AUSA 3D3EA 4XB6B 2VWGA 3GD7A 1R6XA 2BR3A 2JEYA 4BZPA 1G8GA 3IESA 3MCAA 4M3NA 4WWHA 3VAZA 4EPWA 3AEQB 5JZVA 3KQUA 3LNNA 3DFUA 4KQEA 1YBVA 2R60A 2PUBA 1ZGAA 2FSHA 4Y6RA 3WKEA 2P30A 1GUDA 3LDGA 1WO8A 1HDCA 2GJKA 3GRYA 4UXJA 1F9EA 3FKJA 4AZWA 4BQNA 1Y9EA 2OYNA 2ZDHA 1JEDA 3R6WA 1A5ZA 4M37A 3UT5A 3ZV6A 4MUMA 2XCQA 2ODNA 2CE2X 3BCSA 4D8TA 3LY8A 4FYHA 2ZR9A 1WCIA 1HOXA 1ZH2A 2BEVA 3T06B 5EL0A 4D0GA 4ZOCA 2EBHX 4IPTA 1GTL1 4Q00A 4G1EB 1P1RA 3ZDFA 5JO0A 2Q3BA 2PRYA 3PBKA 1C7IA 3ZHCA 4LDNA 1PQYA 2R48A 3NH9A 1BKDR 1QK5A 2HIGA 2IPLA 2IY9A 4H0NA 4L4UA 1Z4KA 4PHTA 2QTVB 4B6OA 2C29D 2YH2A 2Y71A 3S1AA 2R1TB 3V2UA 1O94C 1X15A 1QHEA 4ZHSA 1RPAA 5HE8A 4Q7JB 5J3JA 3D7SA 3MPUA 4M7RA 4IUCS 3QNWA 4Y6QA 2G17A 3QITA 1ACJA 1C1HA 1D04A 3V80A 3S8EA 2AEJA 2OO5A 2WJWA 5SZKB 1RACA 2ZJ6A 3C39A 4BYMA 2NSYA 1O9BA 4IJVA 2WFLB 4PQFA 4B48A 1T43A 2H2AA 3S40A 3T3MB 3T6KA 3TXYA 3TGLA 3U56A 3HKCB 1UPTA 1HQKA 1TB4A 4G4JA 4M1WA 4AJHA 1UBGA 5GTDA 4M0LA 3OD5A 2IV7A 2X4LA 4D9IA 3KQLA 1HL7A 4C6TA 4MYCA 5GJVC 1BVRA 1R18A 2D5LA 1W5TA 3AP1A 4JJ6A 1CRWG 1J33A 1WDKA 1H1DA 1PW5A 2GJPA 3QSYA 2JI6A 1GLVA 4AJJA 1ICIA 2BDTA 2QXYA 4BMVA 2FSIA 2J0UA 3ENZA 3GLTA 6CHYA 1DWPA 1HM5A 2A0YA 3CZQA 2QSUA 4PAAA 1SXHA 4LE2A 2VPQA 1NXOA 4MZXA 4K26A 4L1KA 3VISA 3ZCPA 2QN8A 4RNDB 2RK3A 2B25A 3PRYA 4AMYA 3AXTA 4RHXA 4F8JA 1K4KA 1YZQA 2QQ5A 1Q0QA 4H08A 4QTZA 4CQLA 5A03A 3JS5A 2GWRA 2OUKA 1ULAA 3BEDA 3ILVA 4WFJA 5LZ4A 1XZNA 2MU1A 3I0MA 5B5SA 3VO9A 1EAMA 1PZHA 2XE7A 3IP9A 5DV9A 3IULA 3RQIA 4DSNA 4XM3A 5BWNA 1X1CA 2I4TA 4PX5A 3SEJA 5IPFA 3FCYA 3CD6B 3CPXA 3PJEA 1T5IA 4CMHA 4MGIR 4HH1A 2Q5JA 4JQZA 1WZCA 2CVPA 3LSTA 4HN9A 3THXA 3OQ6A 3ZVNA 2XXBA 3AR8A 2O5EA 2D3WA 2WFAA 4MEBA 2AJDA 2PL5A 2Y2VA 4N54A 4CPDA 3PNPA 1V11A 1NKSA 2GCOB 1OREA 4F9FA 4OAOA 4U1RA 4H0CA 4RKFA 4Y6GB 4AZSA 1Z7BA 1SK9A 2CGEA 1UD2A 4TSFA 3FTQA 2ISCA 3EGDA 1CB7A 3X1KA 2P5UA 2F1KA 4J1NA 3WYBA 4BB0A 5I48A 1E2JA 2G4VA 4OI4A 4ZVPA 5C34B 2PJDA 2AZTA 3Q88A 1KZ4A 1UT5A 2QZSA 3PHGA 1L5VA 3ZU5A 3OURA 1KVSA 3EXIA 4QNNA 5KNCD 4O5OA 5K3DA 2EL7A 3P2KA 3W0LB 4TYNA 3LYLA 1EK5A 3CINA 1OXSC 1PD0A 2AR9A 4B0PA 4B43A 4LSMA 4HWTA 1P1HA 5T7BA 2QG6A 4IV5A 3OQBA 2PMFA 4LXTA 4WGGA 4TKVA 1WZIA 2ZIXB 5JARA 1G0OA 1V4BA 1Z0ZA 1Z6PA 3GZ4A 5G4KA 5FLEX 4MEAA 4BLUA 2GHRA 3D4IA 2AD5A 3ZH2A 5K3OA 4F45A 5ER6A 4X3OA 1YDWA 2BMAA 3GGSA 1UL1X 3LY9A 4REMA 3RUPA 1DG9A 1EK1A 2Q3LA 2B4AA 3JALB 6ADHA 2P9CA 1LQUA 2I2FA 3B5JA 4ITUA 2H1SA 3BK7A 4HTFA 5GWXA 4I50A 4QUAA 4L4YA 4MNTA 4GLJA 3EBOA 1IU9A 4PY2A 4CMEA 3RVMA 2AK2A 1E94E 4QSMA 4S1OA 4OAQA 5E95A 2Q0QA 4FE4A 3LOQA 2JFHA 1QGUA 3CE9A 4QDOA 3LLSA 1DHRA 3EGOA 3FHJA 1L5OA 2JBHA 3CKMA 2ECQA 1ZN8A 4W99A 3RFFA 3KDSE 2CYBA 3URMA 1QIFA 1VG8A 3BM5A 3TJMA 3LUBA 1Z29A 1XE1A 2VAPA 5LC1A 3DXYA 2GPWA 2ZI6A 4ZVVA 4OIMA 4D4LA 3VHLB 4KGDA 4NULA 3GEIA 3G49A 3TQCA 3P2JA 4Q4AA 3K0BA 2JI9A 1PS9A 1PZGA 1QCYA 4OY3A 3T0GA 1HSOA 4KH0A 5L6LB 4C2TA 3PNSA 1G7SA 2P27A 2ZTVA 4JA0A 4ADSG 4M1QA 5B4UA 2P2NA 2QLMA 1G2QA 1IY8A 1Z4IA 3A6LA 3P9RA 4U6SA 3WHLA 2A0FA 4DT1B 3ZY4A 4OLBA 5I9NA 4BCCA 4GBGA 3QG1A 3UMYA 2V98A 5FPQA 1JLSA 1PFVA 4UEOA 3BTSA 1C8VB 3PQFA 4RKRA 4GE3A 1V9CA 2AOVA 1WQ1R 1N6HA 4O3FA 4YRLA 4LOIA 2ID7A 2HV9A 3F4KA 1YIDA 2NO9A 3ZC3A 4K6MA 5IN5A 4QAJA 2G0TA 3UV6A 2DGDA 2GBLC 4JI4B 2FK7A 5CW1A 1RJDA 1NULA 3IILA 3EGVA 2WILA 4A8TA 2JLXA 2IJGX 4PYQA 1U1EA 3VR4H 5GZ3A 5JNLA 1BIFA 4HGQA 3K0HA 5KHAA 2NSHA 2WTBA 2ZETA 4OX9Y 3DEYX 4OX9B 4QAQA 3UHJA 1AZSC 1JU3A 4TV9B 4D8WA 3PL5A 4EHFA 1ODFA 1JS1X 4OFXA 3DP7A 4UZUA 4K6HA 3G05A 1GCAA 4RKYA 3L07A 2P78A 3KPJA 3OT1A 4MKRA 2IITA 2JGDB 4PNHA 4PX2A 1Z6YA 3OJXA 2TMKA 4G5FA 2JB9A 4JIGA