1QG6A

Crystal structure of e. coli enoyl acyl carrier protein reductase in complex with nad and triclosan
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
257
structure length
257
Chain Sequence
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ENOYL-[ACYL-CARRIER PROTEIN] REDUCTASE)
publication title Kinetic and structural characteristics of the inhibition of enoyl (acyl carrier protein) reductase by triclosan.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 92
structure length 257
sequence length 257
chains with identical sequence B, C, D
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 1999-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1qg6A00
1GUZA 4XQCA 3DXFA 3ST7A 4AFNA 3OA2A 4XX0A 1U28A 1FDVA 1C0KA 3RC1A 1ADGA 2IYOA 1PJQA 2OMEA 1LSJA 1P9LA 4Q3DA 4R1SA 3JQCA 4PG5A 1ZK1A 3ZI0A 7ADHA 1SAYA 3QVXA 5EPOA 2IZZA 3RKUA 1SO8A 2AMFA 3GDGA 4IY1A 4CR7A 5BSGA 4TZTA 4WLNA 4J9VA 2GDZA 4XYEA 4PLHA 5I9MA 3A1NA 1MLDA 3AM3A 2Q45A 4NPCA 1U3TA 4ZA2A 4YR9A 4ND5A 2V65A 2Q2VA 5B12A 3IP3A 2OOSA 2Z1NA 4EJ0A 3U62A 3EMKA 3PZRA 4IIVA 4L73A 3PXXA 2BELA 3SLGA 4LVCA 4YYZA 5A9SB 4J7CA 2PD6A 4HFRA 4Y8VA 2ZTUA 4FGSA 4CMEA 2JAHA 3FPCA 3SVTA 4DPLA 4I5GA 3ADOA 2ZYGA 4DPKA 5EJ2A 3WJ7A 3VAZA 1F0YA 4CUJA 1EFKA 4CLOA 3B70A 1GUYA 4BMNA 4OH1A 3CXRA 2BMAA 4CMIA 1Y7TA 2PA3A 1LI4A 3P2OA 3CZRA 5G4KB 2I66A 3PDUA 4A10A 1LX6A 4Z0TA 4JNKA 2YY7A 2DPGA 1BXGA 3PYXA 1F17A 2E49A 3VZSA 1P1JA 2DLDA 1WWKA 3ENKA 5ITVA 1FF9A 2D1YA 1PSDA 3CMMA 4N7RA 4Y6SA 5IDXA 4Z3DA 3L07A 3GPDG 2ZB4A 2C07A 2DAPA 2Y1GA 4PVCA 4U6QA 2DUWA 1GDHA 2O3JA 3O03A 3OBBA 3JSAA 5A05A 1B26A 4CMHA 4E12A 5HRUA 5DCWA 4YJDA 4G65A 1KIFA 3BTSA 5A3JA 1DRWA 4LISA 4B79A 4U5QA 2R6JA 1A27A 3R0IA 1CYDA 1YDEA 5LC1A 3ZWAA 1E3SA 2BGLA 5B4UA 4PRLA 4E30A 3BAZA 4NU5A 6LDHA 2GERA 2VZ8A 3ZCXA 3MTGA 4TROA 2OHXA 1JKJA 5AVOA 5G0TA 5HS6A 4QXMA 1LC3A 2JFGA 2H63A 1Q0QA 3GVCA 1SEVA 2PD3A 3OFSA 3WNVA 4GH5A 2Y1OA 1XIVA 1ZIDA 1GL3A 4XR9A 2IXBA 3HUDA 2B36A 1LDEA 4HV4A 2J3KA 2WSBA 1GYQA 4IDGA 4R1NA 5H81A 4XEHA 2LDBA 4HBGA 3PHGA 4FR5A 3ZV4A 2X0IA 2FZEA 1JN0A 2PGLA 5L45A 4JGBA 5CG2A 1PGQA 1QLHA 1WAMA 3F1LA 4DLLA 1DDOA 3GVHA 3I9LA 2EG9A 3L9WA 3QRWA 4CLDA 2NACA 4J1NA 2NLOA 1HETA 4ROSA 1FMCA 1AHHA 3RBXA 4MKRA 1TVEA 3HN7A 1NM5A 4BVAA 4XGKA 5CPFA 3ONDA 4PFJA 3BTOA 4TRNA 2DTEA 1LLQA 2P2SA 1ARZA 5AQ1A 3OQ1A 4WCDA 4OMUA 3DBRA 2NSDA 1V9LA 3F47A 3TZQA 1U5CA 4R5MA 3ASUA 4KMSA 3GUCA 2NTJA 1NR7A 4ONEA 3ROQA 2GZ1A 2J8ZA 3VHRA 3OA0A 3Q3CA 4BNWA 5C7IO 5CG1A 1HE3A 5JYDA 3PVZA 1GAEO 2EKLA 3LQFA 4J1QA 3FNFA 5HS4A 2C2XA 4D0SA 2E6UX 2I6TA 2O3UA 1PS9A 5ER6A 2EKPA 3AU8A 4TMFA 3Q1LA 2JHGA 1NAIA 3BHJA 3JQ7A 4GGOA 3VPFA 3WIEA 4E2YA 3FWZA 1ZMTA 5TSDA 4CMGA 3ZDFA 3CMCO 2CNBA 5CPBA 4XCVA 5DT9A 1Y1PA 4BKQA 1H6BA 1W8DA 2BI8A 2FR0A 2GZ3A 3ZWXA 3KSZO 3NGXA 2YUTA 5JCJA 4BNIA 3PJFA 3LF2A 4OYRA 4U0JA 3ZWVA 3JQAD 4IJVA 3SBOA 4M54A 1MP0A 3MWEB 4BO3A 1DIHA 2IEDA 1PL8A 2VN8A 2YYYA 4ZGWA 4D46A 2DFVA 1E1NA 4KUHA 5ILGA 3RUCA 1BRMA 1NQ5A 4RVFA 1O9BA 2X22A 4GX2A 4JJFA 4FIZA 3DO5A 4JP3A 1F8FA 1O6ZA 1EVJA 3OIGA 2HQ1A 4BB5A 2ZK7A 3DBHB 3QLJA 5JDCA 2O23A 3DHEA 1UDAA 3UVEA 3E48A 4F6LA 1VJ0A 2NU9A 1NASA 4BNNA 3RU9A 1N92A 2PZLA 3BMCB 3NUGA 4E5YA 4BV8A 5F5LA 4ZQGA 4Z9FA 3JQ8A 4J2HA 1Y5RA 5C7LO 5EMHA 1MB4A 2EV9A 1ZUD1 1W6UA 3U5TA 3ZWWA 1EVZA 4RORA 5GZ6A 4LRSB 4CQMA 3UN1A 3RFXA 4CODB 1V3TA 4WNIA 4BS9A 2X86A 4W99A 1AXGA 4CM3A 5BSEA 1YKFA 3WTBA 3C8MA 4CL3A 1I3MA 3O9ZA 3K9QO 1UP4A 5HTOA 4RVDA 4IDBA 3D4OA 4HP8A 2Z1MA 2C7VA 3AY6A 2PH3A 4O63O 5FF9A 5JPIA 4BGUA 1E7RA 2VWPA 4QQRA 4IJUA 2V6GA 1CF2O 2D4AA 4MVJH 4BGVA 3DBRB 4GSKA 3VC7A 2QZ9A 4DPMA 4IJWA 4XYGA 3JQGB 3PIIA 3BMQA 1LEHA 1XLTA 3ZHBA 1B8PA 2F1KA 5FI3A 1Q7GA 1ZW1A 4N54A 5JDIC 4PG7A 2JAPA 3S2GA 1OBFO 3AJRA 4LK3A 3RBZA 5GZ1A 1H6CA 3M6IA 3OMLA 5COAA 2QQ5A 3B6ZA 1DRUA 3QVSA 4KDEA 1TT5B 2B5VA 3RUAA 1DC3A 3H5AA 4J4TA 3VVCA 1TI7A 2ZTMA 3VZQA 1AE1A 4NFSA 5ENDA 3HADA 3AM4A 2GLXA 1JDJA 5F5NA 4CM4B 1D3AA 2OO5A 3F46A 4FN4A 2UAGA 3PQEA 4JXKA 1E1LA 3G3EA 4DIFA 2EP5A 4MVJM 3WIDA 4BO0A 5TNXA 4ALKA 1P0FA 4YJFB 4FJ0A 4AJ1A 1PU2A 3AFMA 1P33A 5IAAA 4IBOA 2WDZA 1B15A 3LK7A 5KJCA 3JQ9A 5I8ZA 3INTA 1N9GA 3FSRA 3DTTA 1KETA 1YRLA 1UXJA 2YV2A 2R00C 2TMDA 3RUEA 1XG5A 1B0AA 4RPGA 4KWIA 5L53A 4MP8A 1NWHA 1WMBA 3I9JA 3T7CA 2WD7B 4DREA 1X0XA 1V8BA 4DTIA 1UR5A 4NMHA 5F3RA 1GTMA 2BKAA 4BIIA 2AG8A 4JBIA 4MJLA 3Q2IA 3I9OA 4WEOA 4S1VA 1V6AA 4EUHA 1GADO 4W6ZA 1WW8A 1UH5A 2AW5A 5DOZA 3D3WA 3KVOA 1MGOA 1L7DA 1ZK2A 4RQUA 4FC7A 3JQ8B 1UXGA 5I9NA 3A9WA 3K8ZA 1M6HA 3GGPA 3QJ5A 1MXFA 1E77A 1O8CA 1IZ0A 3NJ4A 2B4RO 5B4TA 1HXHA 4EZBA 3ZHYA 3H3JA 1EDZA 4CM9D 3PQDA 4G5HA 4KQWA 2CSUA 2PZMA 4DMLA 4K26A 3RC2A 3DFZA 4D3SA 4ZRNA 5BNFA 5IZ4A 1SB8A 2DTDA 2VHWA 4LMPA 1VSUA 2JHFA 4HFMA 1T24A 2QHXA 5T64A 4BGEA 6ADHA 1T2DA 3SEFA 1IPFA 2X1HA 4L9RA 3V2GA 4YRBA 5G0WA 1B7GO 4D3DA 1G6KA 4GX5A 4RLHA 1P1KA 3MTJA 4XD2A 1JAXA 1NQTA 2B83A 2BI7A 2V7PA 2CF5A 1U3UA 1CJCA 3ONFA 3UHAA 3W4IA 3HE3A 2E82A 3BIOA 1MFZA 3DOJA 4B3JA 2POQX 2Y1EA 1ZFNA 4WLOA 3P7MA 1E3IA 3GC6A 4YRDA 3F6YA 5IN4A 3IC5A 1G0OA 3INRA 1GR0A 2TMGA 3PPIA 2P9EA 5ER9A 3OM9A 1OC4A 1BDMA 3R3SA 1Z6ZA 4ZQHA 1EE2A 3WLFA 3JQAA 2OBNA 4GLLA 5KIAA 3ANLA 3BMOA 5GZ3A 3H6KA 1JU9A 4ID9A 3G1UA 2FR8A 2JJYA 1I10A 1T4DA 1DC6A 1XELA 3C1TA 4RQTA 3D4PA 1FDTA 5TGDA 4YB8A 1B3BA 3WXBA 2H1SA 5ICMA 3F4BA 1ZXLA 3HQ4O 1XSEA 4WGGA 1DC4A 3D4NA 1C1XA 1N9GB 1GUFA 4YT4A 2OXIA 3W1VA 1QP8A 4MO2A 4MINA 3N58A 3HJAA 2VHYA 3X2EA 1PGNA 1KBZA 2R2GA 3IUPA 2SCUA 3GH3A 4GQAA 4ND4A 3PWZA 1ZH8A 1LDYA 1UAYA 4G81A 2AQ8A 4M89A 4DYVA 3QVOA 2BRUA 3L9XA 3RROA 3W8FA 2OGUA 5I7EA 1ZJZA 3BZUA 3ITKA 5DN9A 1PS8A 1U8XX 2C59A 1UDBA 3KEQA 4IDDA 3QWHA 3P2YA 2NVWA 4KUGA 4RPLA 4CJXA 4BNUA 4UUNA 1EMDA 1O89A 1ZSVA 1W4ZA 5CAEA 4OXNA 1FDWA 3Q2KA 1H6AA 3CPSA 1EUZA 2X5JO 3HN2A 1PR3A 1P3DA 2YJZA 4E6PA 5JMWA 1DIGA 1SNYA 1O94A 4J3FA 4N5NA 3WYBA 3SJ7A 4P22A 4B8WA 8ADHA 4PLCA 3PYMA 1A5ZA 1YL5A 2WYWA 3ZU4A 5JAMA 2VHZA 5ITWA 1BGVA 1Q0LA 4Y6PA 1HDCA 4MVJF 2GSDA 1X7DA 3WQRA 3RIHA 3TZCA 2JCVA 2OZPA 1WMAA 2IZ1A 1I0ZA 1KVUA 3C1AA 3IJPA 4B7CA 4QT0A 1K89A 1NBOA 3QWFA 3AUAA 1HYGA 3U0BA 3ZWYA 3KV3O 4AJEA 1MFPA 1NAHA 1OAAA 1JW9B 4NFYA 2VHVA 3A14A 3FN4A 5DP2A 1M6WA 2O4CA 2UUPA 3FD8A 3AY3A 1YB5A 3QWAA 4JQCA 5JC8A 1O0SA 1OI7A 1HTBA 4B4VA 3MWDB 4NK5A 1FJHA 1PQUA 3D64A 3EAGA 4XA8A 4C7KA 1JKFA 3FWNA 1EE9A 4BO9A 3NAQA 4KTVE 1LTHR 1H6DA 2J3JA 4GBJA 1C0PA 3AK4A 4EEXA 2ZQZA 3U3XA 4OGWA 4TVOA 1D1TA 1DO8A 3GVPA 1GPDG 3JQAB 3LVFO 1LRKA 4IJKA 3E18A 3PDJA 4PLPA 2X23A 3A06A 3E03A 2NUAA 1Z7EA 3DL2A 4O59O 2O48X 3D1LA 1VC2A 2HO5A 4RVSA 5JBIA 2Y1DA 4MVJE 1NHWA 2DTXA 4I9UA 4CUZA 1ADFA 1ZNQO 4CMBA 1HDRA 4BKRA 3ENNA 2J5KA 1OFGA 3KUXA 3PJEA 1QYDA 4W82A 1GY8A 4FFRA 4YJHA 3HDJA 4B7UA 3ZU2A 1C1DB 3JYLA 1HZZA 3B1JA 4XR4A 1GEEA 1G1AA 4CM6A 1MUUA 2HKIA 3LYLA 4DA9A 1TT7A 2Y0EA 1HDGO 1PJLA 1WZEA 4Q3BA 1U2DA 1SBYA 2UVDA 3PFWO 5EN4A 1XEAA 3OEYA 4CM9A 1SOVA 3GHHA 4QECA 4DQUA 1P1FA 1XYGA 4E2ZA 2OL4A 1DJQA 3ABIA 3WQSB 1RM3A 5CDSA 1EK5A 4N5LA 4YQYA 3WMWA 1KYQA 1YOVB 4CLRB 4DUPA 3I52A 2DPHA 3D5QA 4DBZA 5KVQA 4FDAA 3S1LA 1QKIA 1NQOA 2PFGA 1YB1A 5JC1A 1BW9A 4M49A 4NG5A 3U4IA 4FJ2A 2D5CA 3UGKA 1JLLA 1XU7A 3VOSA 5H82A 1SPXA 3WNQA 4MP3A 5IF3A 3KM0A 4ZQEA 2GN4A 3WTCA 3AM5A 1JVSA 3RBVA 3DAPA 4ALJA 3LT0A 2JFHA 1E5QA 3DAGA 4UVIA 2OORA 4PZEA 5KTKA 5ILOA 1FDUA 1F12A 3K2EA 4ZQBA 1P74A 3HG7A 5L95A 3JD1A 3ZN2A 5I7SA 3BHMA 2NU6A 4RVUA 1E6WA 3H9UA 3NDRA 3S2EA 5AXBA 5IDQA 2YQ5A 1GU7A 3R6DA 3ETDA 3H3FA 4CPDA 2QRLA 3QV1A 2AE2A 1A4UA 3ZNOA 4CR8A 4J49A 1HLDA 4P38A 5B1YA 3KRTA 8LDHA 5DCUA 1GD1O 4CLXA 2RAFA 4Y9DA 4E5PA 3RUDA 4QSMA 1WDKA 4AJ2A 2I67A 3ZU3A 3H2SA 2R00A 1KERA 1DHTA 1I3LA 1RYEA 2VUSA 4E0BA 2EERA 1ISHA 1I33A 1UXIA 3ZHXA 1XR3A 2Y66A 4R3WA 1LLCA 1MC4A 5I7VA 5TT0A 5K0ZA 2GN9A 2EF1A 4PG6A 4B7XA 1AHIA 4ND2A 3PI7A 3RU7A 1BG6A 4D0RA 1CRWG 3LF1A 3MJTA 2JCXA 1UAGA 2CVZA 3PLNA 2EEZA 3EUWA 1EVYA 2BGMA 2Q99A 2CDCA 4MDHA 1PX0A 4TKLA 4EEZA 4XQ9A 1DLJA 4BO6A 1ML3A 4DYDA 4BNTA 3ADPA 3PHHA 4FD3A 3CUKA 4R1TA 1CWUA 1U3WA 4K6CA 3KYDA 4F6CA 5CEEA 1EDOA 3RC9A 1AN9A 1YJ8A 2GPTA 5JXWA 1LLUA 4NIMA 4J90A 2DBRA 2AEFA 1HYHA 4CQMD 4LCJA 5KVCA 3HB5X 3VH1A 1PJTA 1ISJA 2JD1A 3WGGA 1U7HA 4LCEA 4R3NA 4XGNA 2FZWA 4R9SA 4BGIA 1S7CA 4QX6A 5IG2A 5F1KA 1GZ4A 1J0XO 4TQGA 3I83A 5GY7A 1YQXA 4DQVA 2DBVO 5DP1A 3M1AA 1SMKA 2GN8A 2WEKA 3RAJA 4CV0A 4JJIA 4RPJA 3JCZA 1N5DA 1DXYA 4GKVA 1Q7CA 1Z45A 2VQ3A 3TOXA 3KYBA 4DMMA 2NWQA 3HWRA 1ENPA 3S55A 1HSOA 3KO8A 1YQGA 3I23A 4GVLA 1VI2A 4IM7A 4YAGA 3I5MA 4NJMB 3W6UA 5BNTA 1TA4A 5BSFA 3D7LA 1N7HA 4E13A 4JN6B 3RUIA 1UDCA 5DNAA 2PK3A 4ND1A 2UDPA 4CM8B 1Y8QA 1N1EA 1QORA 2WYUA 3ITDA 3QWIA 1BVUA 3EVNA 2F00A 3U4DA 1U4SA 1VJ1A 3BYZA 3WWZA 3B1KA 3W4KA 5JAIA 4AG3A 3KXDA 2GASA 3BMNA 3GLQA 4BV9A 1GPJA 2JD2A 3H5NA 3GZNB 3NTRA 4CM5A 2Y0CA 4U7WA 2RHRA 2Y93A 4LN1A 1K3TA 4RF5A 1YBMA 4QUKA 1VE9A 5I8WA 1MG5A 3IL2A 4L4RA 5A02A 1HZJA 2FRDA 3U9LA 1EK6A 4MKXA 3RD5A 3ZWPA 4IS2A 3QSGA 4Q3NA 5T6BA 5KJFA 2YHIA 2OP1A 3WGZA 4A7PA 3L77A 2ZATA 5I7FA 1E0DA 4ALNA 3KYCA 4YT2A 3VDRA 1KS9A 4YAKA 1YB4A 3F3SA 1PZFA 1F14A 1WXDA 5COQA 4PG4A 3ZWNA 2W8ZA 1I2ZA 1QLJA 4GMFA 1H9AA 3DZBA 1UP7A 2O4UX 1NVTA 4HNHA 2C54A 1YONA 2NU8A 2NU7A 3FBGA 4XJSA 3KYDB 2C2YA 1TLTA 1R6DA 2HCTA 3ONEA 4YTEA 3ANNA 1K5HA 1EFLA 4DXHA 1X1EA 1I24A 1LDMA 2EIHA 3SJUA 2UYYA 5A06A 1E3JA 1E1KA 5L51A 2BHLA 3HDYA 4QO7A 4BO2A 2ZQYA 3DR3A 2HMWA 2YV3A 4B3HA 2QG4A 2ZB7A 1RJWA 4CLOB 1B3RA 1NP3A 1QYWA 2X6TA 1QV7A 3ZWMA 4CMIB 1DIBA 2X0JA 4XQGA 1K6IA 1CIVA 4LRTB 5L9AA 4WPGA 1P45A 4CUKA 4E31A 3VTFA 1BXGB 2PGJA 1ENOA 4YCAA 1E7MA 3KLMX 4FFPA 2RH4A 1LJ8A 3KSUA 3U09A 2CY0A 4JCOA 4WCFA 1HRDA 4PZDA 4R16A 3S2FA 3MJSA 5KOIA 1E92A 4OSOA 3UCXA 1Y8RA 3H4VA 4RZIA 3JQBC 2IEBA 4JROA 5L40A 3TSCA 1PJSA 3DOCA 1GV0A 3M1LA 3WOHA 3GN1A 5JS6A 1KOLA 4PZCA 3NGLA 5TT1A 3OQBA 3C3XA 1K6XA 1R0LA 1HE4A 4M55A 1DIRA 4OL9A 1P44A 4PLWA 4OJNA 3FR7A 2GNAA 1IZ9A 2AA3A 2WYVA 3WICA 4GMGA 4JIGA 3GVIA 1XA0A 1YL7A 3JQFC 1WP4A 3JD0A 4WLFA 3FR8A 2A35A 3I4FA 2YHIB 4RDHA 1H0KA 5L3ZA 4RJTA 2VOEA 1CQJA 2ZCUA 3L4SO 4C4OA 2OP0A 4EYEA 1CERA 4DC1A 3KYCB 1B2LA 4Q3EA 5DBGA 4DLAA 1BHSA 1ZEJA 5F1PA 3AI2A 3HNPA 4XZ3A 5K6AC 1DB3A 2Y68A 4OKIA 3OIFA 3ROMA 3K2BA 4MIOA 4IZHA 4MOWA 4HADA 1GEGA 2FSSA 1KC1A 4EW6A 3GEGA 3C7CB 2C20A 4GLOA 2FY8A 3UOGA 4IGEA 4GX0A 3A4VA 4ZD6A 2YW9A 4P8RA 4MKZA 3FCOA 1D1SA 1RM4A 4YEDA 3VZRA 3GT0A 4XGIA 3WYEA 4KZPA 3Q11A 1SZJG 2CUKA 3PJDA 2WTBA 4LSWA 4FOSA 1ISIA 1R0KA 5DCYA 4LSMA 5THKA 3VH2A 1DPGA 3RUHA 4FB5A 3RKRA 5KJ1A 1BTOA 4FFLA 2AE1A 2PLAA 4QFDA 5ENVA 3GAFA 5IXSA 1RKXA 4MVJD 2IZ0A 3OSUA 1UUFA 4L8VA 3AY7A 4QEDA 4PGFA 1PWXA 1R66A 3U49A 1LC0A 5EQDA 4EJMA 4R54A 2V6BA 3CSDA 1ID1A 4TWRA 4DIBA 4U0KA 3RFTA 5IDWA 4O5OA 3JQ7B 1Y5MA 5JAQA 5KJ6A 2ET6A 4YT8A 1X15A 3WS7A 1ZCJA 4UVDA 2GUGA 2CFCA 1YVEI 1I2BA 1NQAO 3DHNA 3ROKA 1ZJYA 1UJMA 2FWMX 4HX5A 3F4LA 3RJ5A 1JTVA 4AL4A 1PTJA 4WLEA 4AJOA 5JFOA 2H5LA 5HWSA 1S6YA 4I8XA 4CL8A 4NDNE 1Y6JA 1A72A 1DLIA 1MC5A 2VT2A 1I2CA 1IPEA 2YFQA 3LC1O 2CDAA 3I6QA 4IDAA 3P19A 3E8XA 3LSYA 3ZNPA 5JMPA 4XDZA 3EZLA 1RWBA 1QXSA 3F5SA 2XXJA 2Z5LA 3MJCA 1WLYA 2CMDA 1X1TA 4B4UA 3HFGA 4FFOA 3H65A 3I9KA 4WLVA 4Z9XA 5DOVA 1XGKA 3CH6A 2I3GA 5KVVA 3NX4A 5JAZA 2G5CA 1V3UA 3HFSA 3L6DA 5DDIP 2DVMA 3GK3A 3H8VA 5EIOA 1GYRA 2PY6A 1ZXBA 4H7PA 3JYNA 4GGPA 3EDMA 4CQMB 5TLSA 4D79A 1A7KA 1ZSYA 1Z82A 2H9IA 3LC7O 3DZFA 5KKAA 3TWOA 3KLPX 4A27A 3DZHA 3RI3A 3Q9NA 1UXKA 1BSVA 2I3AA 2IE0A 4JJGA 5DULA 2VYVD 3ORFA 5KJEA 4J43A 3VPSA 2Q1SA 1Z74A 4B3IA 4CMAA 5CDGA 3D5TA 3GG2A 3QHAA 1A9YA 4AJIA 2XF8A 2X7HA 4YDRA 3WGOA 4IDCA 3BMQB 3DMTC 1YDWA 5B4VA 3KZVA 4CM1A 3PYLA 1CEQA 4GX1A 3GNSA 1EBUA 3ZH2A 2G17A 2J5QA 1J5PA 1X14A 4W9NC 1XDWA 3R1IA 4AJHA 1W73A 3IDSA 2HUNA 2YZ7A 3K73O 1QYVA 4A5OA 3GGGA 1NPDA 1OOEA 2Y05A 1IY8A 2V6MA 2NM0A 1F8GA 5H83A 1DBVO 2VWHA 1KY4A 2PH5A 3E5RA 1HSZA 1UXHA 5JY1A 2EXXA 4AVYA 3ZZNA 5ADHA 2VNAA 2EW2A 2QIOA 4N18A 3FTNA 4F3YA 4PLVA 3U4CA 5TIIA 2IXAA 5A1TA 3RWBA 3H5RA 3RQSA 1A7AA 5BQFA 1ULSA 3TQHA 3TJRA 3H9QA 3QWBA 2D59A 3SX2A 2WE7A 1DJNA 4LMRA 1HDYA 3LZ6A 2ZJ0A 5CEJA 4J16A 2QYTA 4I9HA 2Q2QA 1R4NA 1XQ6A 3WX0A 4J9UE 4RDIA 4DRYA 5A04A 1YE3A 3DZJA 1KEWA 3JD4A 5IDYA 1VL0A 2W98A 3D3WB 2GD1O 1Q7BA 2BH9A 2C29D 2ZB8A 3KSDO 2P4QA 3SLKA 2HMVA 3Q6IA 1E7WA 3I6IA 1K0UA 1R16A 3P5SA 3JYPA 2B4QA 4JBGA 4XWYA 4NBUA 3WQQA 2XOXA 2DM6A 3ICCA 4BL5A 4D3FA 1U2GA 4MIEA 3NRCA 2Q1WA 4GWGA 4HFJA 5AYVA 3TF5A 4XJTA 1MXHA 4BNKA 2D3TA 1HE5A 3DC2A 3JTMA 4M1QA 4WEQA 4MVJA 3TFQA 5G0SA 2AG5A 3CE6A 1BMDA 1CQIA 4ZU3A 4W7IA 4NBWA 4XIYA 4I9NA 4IDEA 4J7UA 2B37A 3GY0A 5I9LA 5CFZA 3L4BC 3OJLA 4IPTA 4IS3A 5JCXA 4J7XA 5JSFA 3CEAA 3VDQA 3AWDA 2X58A 4NFHA 1P1HA 1X7GA 1PJ2A 3I9MA 1M67A 1LDGA 3IMFA 5C3MA 1H93A 1YXMA 3DMYA 1D8AA 4WCFC 4NBRA 4NBTA 3FF4A 5MDHA 2FMUA 3KHUA 3EVTA 1I3NA 4BNYA 4DWVA 2C0CA 3JQBA 1GV1A 4XQEA 4OO3A 1T2FA 2AQKA 4RVGA 4YJGA 4F46A 3BMOB 3ROPA 1ISMA 2AXQA 2GGSA 1WDLA 3KOUA 4NK4A 4U6SA 5AOVA 3WSWA 4A03A 3AU9A 3OQ6A 4OIMA 2DT5A 3E6AA 1PEDA 1E7YA 3JQ6A 4RV9A 1P0CA 4UREA 1LSOA 1EEHA 3BTUA 4IXTA 5KWEA 2UV8A 4EGFA 5JNLA 2BFOA 3AFNA 1C1XB 2VCYA 1M2WA 3UUWA 3E5MA 1N1GA 3JQFA 1EQ2A 4QTZA 1YGYA 4XYBA 4NH4A 1M76A 5L7YA 3ZV6A 2I5PO 1E6EA 2FP4A 3VH4A 5IJZA 2OBYA 2Y0DA 4A73A 5L4SA 5L7TA 2A92A 4W4TA 4RGBA 1R4NB 3PWKA 3E9MA 4M86A 2HMSA 4YACA 4RF4A 1R4MA 5FI5A 4BNHA 5K6AA 3ULKA 4CM7A 5T5QA 2Q50A 3DZIA 4YAEA 4A26A 2YQ4A 4W7HA 4CV1A 4IMRA 4FCCA 4J0EA 3K96A 3V2HA 3JYOA 2ZIZA 2Q49A 5KNLA 2P5YA 3O38A 3TNLA 3O26A 5KKCA 4MVJP 3V5NA 3CKYA 4OXYA 2VYVA 1HEUA 4IMPA 2BFAA 1F06A 3A28A 4ZICA 1UZNA 2NQ8A 5EINA 3VPHA 4E21A 1EBFA 3RASA 4GL4A 4DL9A 1GFSA 4ZJUA 4J4HA 2AEJA 3VKVA 3V8BA 2O3SA 1ONPA 1EZ4A 3E9NA 2HK9A 4BNZA 1VLLA 2PKRA 2VHXA 4MP6A 3TOZA 1XU9A 3DQPA 5L4NA 3GRPA 4UULA 5A9SA 4WE3A 4YWJA 4UEOA 3EZYA 3ZWBA 1E1MA 2BGKA 4IINA 4N5MA 5TJ9A 3NDJA 2NADA 3WWYA 1J49A 3WJAA 2HMTA 3NJ8A 5THQA 5C7OO 5EL0A 1LNQA 1H2HA 2WWRA 3FRJA 5G4KA 2JFFA 1Q1NA 4LGVA 1PIWA 2BLLA 1CETA 4AJKA 1T2CA 2Y99A 1ZZEA 1D7OA 1HDOA 1KC3A 3GQVA 3PZBA 2QX7A 5IXYA 4UUMA 4E2XA 1PZGA 4ZRMA 1R37A 4WUVA 5A03A 1LQUA 4UEKA 3IKTA 2P91A 3ASVA 4YAIA 4BO8A 3WGYA 2DBZA 3VPGA 2NV6A 3GRKA 1YJQA 2PNFA 4A0SA 2QRKA 3DHYA 1HYEA 4RO0A 1U9JA 3NTQA 4RPKA 1J6UA 1E7QA 3SC4A 1LLDA 1RM5A 4I5EA 3ZW9A 4WOJA 4EBFA 3WFIA 2Z95A 4XKJA 3PTZA 3PHLA 3ZWCA 1T4BA 3C24A 2XXBA 1E3EA 4XRRA 3LT1A 4AJNA 4K28A 5FYDA 1I5RA 1WZIA 4YJHB 4HFNA 4II3A 4EDFA 2PD4A 4INAA 3W6ZA 3MOGA 5F1OA 3DBVO 3C1OA 1DC5A 1PL7A 2EGGA 3ETEA 3G79A 4OOEA 4B4WA 1JQBA 2X9VA 4S3MA 1R4MB 1BXKA 4YXFA 2XAAA 2UUOA 3CIFA 2RIRA 3UKOA 4J91A 4M8SA 2C7GA 1QG6A 3RUFA 4Y6RA 1T25A 1VSVA 3PEFA 4E4YA 4HY3A 2C5AA 1B16A 4Z9YA 3OHSX 4H3VA 4ZQFA 2YFHA 4J6FA 4I1IA 1HT0A 4PLYA 2PGDA 3TFOA 4EITA 4R41A 1DAOA 2NVBA 1NFQA 3QE3A 1C14A 2EP7A 2FHSA 3HDQA 1PGPA 2YHUA 1YBVA 1B8UA 2BF7A 4UAGA 4AJ4A 3DDNA 3COSA 1BW9B 4J2OA 4OXKA 4EI2A 4YBZA 5EESA 3DMTA 2X9GA 1LUAA 3TPCA 2QRJA 3PHIA 5C5IA 2WJPA 3RJ9A 3AUSA 4H15A 3OIDA 4CV3A 3H9JA 4BOYA 2VUUA 2HAEA 3ZW8A 1ZKMA 2H6EA 4W9NA 3CINA 4BQPA 4FW8A 5TQVA 4BMSA 2ZB3A 3F9IA 3WGHA 5IFLA 4WKGA 1I01A 3GMDA 1TB4A 1XQ1A 1EUCA 5DF1A 1W0CA 3G17A 2O3RA 4BKPA 1T26A 3PFFA 3V2UA 4D7AA 2FN7A 4MPDA 3B20A 2JCYA 2B0JA 1M66A 4BNXA 1RYDA 5FFFA 1FDSA 4WOKA 1HLPA 3GF4A 4L4XA 4E5NA 4E32A 5HM8A 1M75A 1ISGA 2NNLD 3S8MA 1FK8A 1NNUA 3PLRA 3WB9A 3RVDA 3GHYA 5U4QA 4KQXA 4MIYA 5T57A 2VWGA 3DB2A 3C85A 4ZN6A 2O2YA 1E3WA 4L76A 4LW8A 1B14A 4GI2A 1ZEMA 4YPOA 1PJBA 1U8FO 3JD2A 3QW2A 2DU8A 4Q39A 1HDXA 4Z0PA 3VPXA 2IYPA 1NPTO 2ZTVA 2YV1A 2X5KO 3ANMA 4R4JA 4RL6A 5BNIA 3BXXA 3MJEA 4JLWA 1AXEA 2DKNA 5BT9A 2Q46A 4R1UA 2P9CA 1IB6A 3OJEA 4FFMA 2X9NA 3OETA 1GCOA 2VTDA 3GFGA 3NTOA 1WNTA 5G0UA 4L75A 5CEFA 3DBHA 3FNGA 3NT5A 4X54A 5TC4A 4WLUA 2NVUA 2D8AA 2AQHA 5GMOA 1OZAA 2VOJA 3BMCA 3OJFA 3S2IA 2FPIA 3GGOA 3IKVA 1Y9EA 1SCUA 4K1LA 5TS3A 4QFCA 2A4KA 4OM8A 4XB2A 4XYLA 4NZ9A 3AOEC 3E9QA 3QIVA 4KOAA 4DLBA 1VKNA 2G0TA 2IRWA 2C5EA 1V0JA 3E82A 4FC6A 2X4GA 1VRWA 1QRRA 4NU6A 1LSSA 2XPCA 1KVRA 5JO9A 2JL1A 1VL6A 3GMSA 4AJLA 2ZCVA 4RF2A 1BXZA 1PQPA 3IAHA 3BHIA 3LDHA 4XIJA 1E6UA 5T67A 1TXGA 3VH3A 2RHCA 1KEUA 3L4BA 1IULA 1NWCA 4PLGA 2EWMA 4HKTA 4PIVA 4E3ZA 1FXSA 2AEMA 4FFNA 2WD8A 3AI1A 4HUJA 4PLFA 1K6JA 4BKUA 1I3KA 3JQGA 4FGWA 2IDZA 1PJ4A 1YS4A 3L6OO 4R9RA 5CP8A 2X8LA 3WDSA 4BO7A 1YH3A 3IS3A 1Y8QB 4RPHA 1X13A 4KDFA 1IOLA 4WNCA 3WSVA 1TT5A 4GAEA 2GR9A 1KVTA 1DRVA 3JQDA 4CLHA 1DHRA 1LDNA 5HA5A 1QSGA 1OC2A 2GYYA 7MDHA 4ND3A 1DFIA 1HE2A 1R12A 3DWFA 1T1RA 4CM4A 3BMNB 2B35A 2PR2A 3NYWA 3O8QA 3Q0EA 2EKQA 1J4AA 2JKVA 3WLEA 4RLSA 2BFPA 3CZMA 1DFGA 3N7UA 3PP8A 3T7EA 2X0RA 4XB1A 2HLPA 3QVWA 4YJFA 3ETGA 5T8KC 1VJTA 4ILKA 4KWHA 2X5OA 4FPXA 2O2SA 4PRKA 5BR7A 5IN5A 2HJSA 4P4NA 4DGSA 3ZGYA 2NTNA 3DTYA 4PLZA 4PLTA 5LCXA 1E3WB 4EJ6A 5U1PA 5J23A 2CVOA 1IE3A 2P68A 3ZU5A 5L7WA 3C7DB 3MZ0A 3DONA 5AXDA 4JK3A 5B37A 3WYCA 3NT4A 2W2KA 2E48A 3GPIA 1A4IA 1H94A 1RM0A 2WD7A 5LDGA 3B1FA 4TVBA 2GZ2A 3LU1A 5A9TA 5JO0A 5K9ZA 3EC7A 4HXYA 3PGJA 4YVFA 5MGBA 5IZCC 5CDYA 2GN6A 1ZK4A 1KVQA 4NHEA 4NBVA 3UF0A 3TRIA 3OJOA 1PGJA 2NVUB 1LQTA 4BO5A 1PZHA 1XCBA 2RBEA 4IQ0A 1ULUA 1R0SA 1NHGA 1GQ2A 3ICPA 4YQZA 3DAFA 2WE8A 5TF4A 2W2LD 3IOYA 1UZLA 3HSKA 3K31A 3GZ4A 3AUTA 5L4LA 1ZO8A 4Q3AA 1SOWA 2V6FA 3EW7A 4D44A 3GEDA 4DQXA 3E1KA 1LDBA 1YQDA 3MCVA 2D2IA 1T1SA 2VWQA 4L74A 2D0IA 3IQDB 5KCZA 1DIAA 3NV9A 1KEPA 4E2WA 1PZEA 3TZKA 3DZGA 3TZHA 4XRGA 3DBLA 2AHRA 3PGXA 3UFXA 2G76A 3I1JA 3L0DA 4FS3A 5TRTA 2P4HX 2DC1A 4O0LA 1BVRA 1BWSA 2VRBA 1GQYA 4KUEA 2FPGA 3OECA 4J1SA 2P9GA 3VVBA 4Z6KA 4ITUA 3HZZA 5COBA 3WG9A 2PZKA 4L0QA 3FNHA 1AGNA 2FOIA 3EHEA 3K6JA 4R51A 1ENYA 4FJ1A 4JX8A 4L4SA 4R68A 3RC7A 3QVTA 4WCFB 2C82A 3MEQA 2E37A 3MJVA 1Y8RB 4BNFA 1NTOA 2NQTA 2OFPA 4OQZA 4UVHA 4D45A 5EQFA 4IQ8A 1GCUA 2VYND 4I5DA 4E33A 2Q1TA 4PG8A 3DEYX 4GVXA 4GKBA 3EK2A 1BDBA 2CVQA 4HNGA 4Y67A 2CDBA 5A4DA 2HRBA 4TRJA 2FPPA 4AJPA 3MJ4A 3O8QB 1Z73A 2J3HA 3ZNQA 1U3VA 2G82A 4WECA 5HBRA 4PCVA 3GA0A 1PGOA 3AOGA 1JAYA 4WK6A 1E3LA 3UICA 1MV8A 1IHXA 2Q4BA 4H16A 2GCGA 4O6VA 4Z0HO 4FBGA 3TL3A 1L1FA 4CMJA 1ZSNA 4E5KA 2EJWA 3GAZA 1LSUA 3LT4A 4BO1A 2Q2WA 2RH8A 3PQFA 2I65A 2W2KB 1Y9AA 1A71A 4AJJA 3V1UA 1LRJA 1ZK0A 3GG9A 4EUFA 4FQ8A 3GOHA 4K6FA 1ADCA 3TDKA 4BUCA 2O50A 4TZKA 1T2EA 2O3QA 1EUDA 1Z7BA 2WM3A 4M87A 4CMKA 2LDXA 3ZWOA 3PK0A 4PVDA 3WMXA 1ISFA 3D3EA 3G49A 2HSDA 3AW9A 4J0FA 1PWZA 4CLEA 3WR5A 1JKIA 2G1UA 3K30A 2B4TO 4XYMA 2HDHA 5G0VA 4J4BA 1DAPA 2PTGA 5TX7A 2ZKLA 1H5QA 2O3TA 3JQEA 5JLAA 3KETA 1U5AA 1HL3A 4YRAA 2X0NA 3UXYA 3VKUA 3EGOA 4HWKA 3H9GA 2FR1A 1C0IA 1EVIA 2OUIA 3I4CA 3UAGA 3W4JA 3GNQA 3WFJA 3IP1A 1Q0HA 4UUOA 2YDXA 1I8TA 4CMEC 2IODA 3DBLB 2D5AA 4BNVA 1DOHA 1XWFA 4JP2A 4OHUA 2A9FA 4P4LA 4Q9NA 4R5HA 2NTVA 1D4FA 5CDUA 2Y67A 3IIEA 4BNLA 1NXQA 2BD0A 1JVBA 4OOFA 3TL2A 3X2FA 4NI5A 4BNMA 2J5RA 1QMGA 4IDFA 5CHEA 3FNEA 3OF2A 4YA6A 1GQQA 4DVJA 2I76A 3F5QA 1VL8A 1GZ6A 1YO6A 2VRCD 1IL0A 4II2A 3MOIA 1MA0A 1Q2XA 1HF3A 9LDBA 1K2WA 1DFHA 2Y1CA 1ZMOA 1NPYA 3L6EA 1AUPA 3H2ZA 3WGQA 4OKNA 1ORRA 1KEVA 2VT3A 4Y98A 3BA1A 3QA9A 1ZK3A 2CD9A 4IUYA 3JV7A 4GSLA 1PJCA 2GF2A 5JE8A 4BMVA 2B5WA 3O4RA 4NQZA 3DOOA 5G4LA 2RCYA 1NVGA 3T4EA 5KVSA 1Z75A 3HHPA 4P4GA 3NKLA 1T2AA 2E4AA 3N74A 5A5FA 1ZVMA 4U8GA 3AI3A 3HB4X 3TN7A 3PIDA 4ALMA 3UCFA 3STHA 1IHYA 4ZVVA 1X0VA 1I30A 3R3JA 3UW3A 4RZHA 1DEHA 1UZMA 1C1DA 4K9DA 2PKQP 4UUPA 5JYEA 3SXPA 1X7HA 3WBFA 3OICA 1O5IA 2W2LA 4KTTE 1NFFA 4B4OA 3ZV3A 2HJRA 3FBTA 1E5LA 4TRMA 1NR1A 3C7AA 3GNTA 1YBAA 2PWZA 3KBOA 3G1TA 1WDMA 3UCEA 3AOEA 5A3VA 2Q1UA 3WBBA 1SC6A 2HK8A 4CQLA 2Q4EA 3SC6A 4CR6A 2GRAA 1E7SA 4D41A 2DUUA 2DQ4A 4URFA 3OEWA 1YOVA 1C0LA 5TJHA 4CLRA 5JY6A 1KY5A 3TZ6A 3UH1A 2YDYA 1GYPA 3QY9A 1R15A 2AQIA 4OAQA 5CDTA 4FSHA 3KTDA 1DSSG 1ONOA 1JWBB 4JBHA 4DBVO 1JWAB 1PJ3A 1L7EA 5AXAA 3GR6A 4UVEA 2GO1A 4TKMA 3ON5A 3K5PA 1IUKA 4D43A 3U4HA 3V1TC 4I08A 4OQYA 1HWYA 1A9ZA 4CV2A 1LU9A 1QR6A 4EUEA 3WGIA 4O1MA 5DBIA 3GDFA 4LVUA 3ZHZA 2VYNA 3HDHA 2DFDA 4I5FA 2VZ0A 3LC2O 4IQGA 3QQPA 5F21A 3INGA 3ZV5A 4ALLA 1VM6A 4E5MA 2A94A 2VNSA 2J6IA 1LBEA 4DIOA 2EGHA 3V1YA 3NEPX 2EW8A 4B8ZA 3JYQA 4BNJA 5ES3A 1H9BA 5FWNA 1U1IA 3PHJA 5T8KA 3GFBA 3M2PA 4GPD1 1WPQA 4IIUA 1G0NA 1Y81A 1ONNA 4WASA 1YL6A 2HMUA 1CDOA 1U4OA 2W90A 3BTVA 3F1KA 5A9RA 4IGFA 1HDZA 1ZBQA 3I3OA 5AXCA 2DBQA 1NFRA 1XKQA 4NR0A 4NJOA 1VPDA 1ENZA 3GVXA 4G2NA 4UVGA 1RPNA 3IUSA 4F45A 2VUTA 3NT2A 4ZHSA 5LDHA 2BFMA 3VTZA 1P1RA 1YWGO 2VZ9A 3VZPA 2W4QA 2VTEA 5IZCA 4YAJA 4J1TA 4RF3A 2EJVA 3PWSA 3G0OA 3KEOA 3DFUA 3W8EA 5JDCC 3EYWA 5BSHA 2CF6A 1VKOA 3EY4A 2O7SA 1TEHA 1U7TA 4CMCA 3FPLA 1ADBA 3H7AA 5ICSA 1H2BA 1HKUA 1WVGA 4OSPA 1NYTA 3M2TA 3CTMA 1N7GA 1PR9A 3PRJA 1SB9A 1P1IA 2PKQO 3JD3A 4IZIA 4BKOA 4D42A 3GDOA 4CQLB 4C7JA 2HRZA 1C3VA 4RCVA 1QV6A 4BB6A 4TSKA 4BHTA 1I36A 3QP9A 3OJ0A 3RSHA 1MG0A 1UP6A 4MVJI 2WMDA 4GWKA 9LDTA 2ZTLA 1PL6A 4IXWA 4UEJA 4Z3KA 2ILTA 4Q3CA 4BQRA 3DZKA 1MX3A 4ALIA 3GUYA 3IJRA 5DBFA 1QYCA 1PS0A 1V3VA 5DZSA 2VRCA 1V35A 3PJGA 4FOOA 2HK7A 5JDIA 2Q3EA 2EHDA 3KB6A 4AICA 1N2SA 3FHLA 3OP4A 2PZJA 4NNJA 4BO4A 3FTPA 4BNGA 4RVHA 1O95A 2ZJ1A 1I32A 1PQWA 4YJGB 4NJMA 5U9CA 1KVSA 4QO8A 1B8VA 2Y1FA 3W8DA 1GZ3A 2O7QA 4ESOA 4A2CA 3GN2A 5FEUA 2I9PA 4DC0A 3OH8A 4CM8A 3D0OA 1OMOA 1LA2A 2HU2A 3RFVA 1EQUA 2P5UA 4KP7A 4R01A 1IYZA 1P77A 1JA9A 2I99A 1NVMB 2FSVA 4R69A 4WJZA 4XDYA 3T4XA 3GEMA 1LRLA 3ZNNA 2ZYDA 3LLVA 3Q9UA 5JW6A 3GZNA 3K92A 2PV7A 4PN3A 1N8KA 1NX6A 3FI9A 2B69A 5G2OA 1QYXA 3JQ9C 5JCJD 1SEPA 4YT5A 3RCBA 1LXCA 1XHLA 2CZCA 3NDIA 4TRRA 3LT2A 5A5EA 4MVJG 2QYSA 3AUUA 3I9NA 3LLSA 2QW8A 2J3IA 2ZYAA 1P31A 5EERA 3H9EO 2QZZA 3WGTA 5C37A 2JD0A
chains in the Genus database with same CATH superfamily
1CG6A 2E21A 3O8DA 2JW5A 1US8B 3JAKA 2Q21A 1CCWA 5FR1A 3FKJA 3LUBA 4DLSA 2BM9A 4RKQA 4JV5B 1LSJA 1P9LA 4NAHA 1DKPA 1P75A 4CHTA 2W43A 7ADHA 2H4XA 2IZZA 3WVNA 4C3ZA 1Z25A 3GDGA 1C7JA 3B3JA 1M2NA 4DA8A 3VQTA 5AIAA 1YZKA 4JGIA 1WOMA 2J0EA 3S2UA 1UPXA 2ONCA 3A1NA 1RACA 1WCIA 1MLDA 1Z34A 1JE0A 2RGAA 1NLMA 3BD7A 1U3TA 3PI6A 2XQKA 4KN6A 1KZYC 3EXEB 2V65A 2Q2VA 4DIMA 5A6SB 3IJ5A 3JVEA 2Q3HA 2XIJA 3DE2X 4TXLA 1PLLA 4UNIA 2OOSA 2Z1NA 2RK4A 4JT9A 2H5IA 4TMYA 4D6XA 5A4JA 1GTRA 4IV8A 3MUOA 3SLGA 2BELA 3IMKA 4BFCA 3K71B 2WK1A 1SHZA 4J7CA 2FSUA 5HP4A 1AUXA 4HFRA 5KYYB 2ZTUA 3I6ZA 4FGSA 3WRYC 3GUVA 4CMEA 3GX1A 2AKEA 3CUVA 1CXZA 2ZWMA 3ETHA 3SI7A 4AN4A 7AT1A 4L50A 4I5GA 5H3HA 2M32A 3EIHA 2FOXA 4QTYA 3QUQA 3V4OA 2NAPA 2EWWA 4P3KA 2VL7A 3VAZA 2WPDD 2B1RA 4CUJA 2HTEA 4CE6A 5LZ4A 3B70A 1UQRA 4JC0A 3O3NB 3R6GA 4HVAA 4PC7A 4CMIA 3IVMA 3K1JA 1LI4A 1YS7A 3HVUA 3P2OA 3Q7EA 2ZJ8A 2QL7A 4OV6B 3GLFE 3CH5A 3KXKA 3HXQA 1MW9X 3NAGA 4UU1A 1RJ9B 4JNKA 1HQCA 2DPGA 2D00A 4IIEA 2WP8J 4DYHA 4ZDWA 1F17A 5EZSA 1P1JA 2M1XA 3ZDQA 3JATB 3OZWA 4G1FA 5K8CA 4R9NA 4JFAA 4QPCA 4PQRA 3T7IA 1WWKA 1H5NA 3EZGA 3H11B 4RY9A 4ZVTA 2HZ7A 5IWCA 5LWHA 1PSDA 3CMMA 5IDXA 2AI2A 1A9QA 4OU4A 2FN3A 3GPDG 2PANA 3KQMA 3RIGA 2CD7A 1LY1A 1LK5A 1R7RA 1XKTA 5T4FA 3RYIA 3N0WA 2C07A 1N6NA 4PVCA 5AOBA 2O8BB 4KITB 2O3JA 2K7FA 1F9EA 3JSAA 2IDJA 1K27A 3Q87B 1OB2A 4PO8A 1BQEA 2HNAA 5A3JA 3EPPA 1DRWA 2FG6C 3F6SA 4KR2A 5J47A 1YJBA 3CZ5A 2IBMA 3IAXA 2Z83A 2HPZA 3R0IA 1XN4A 3BWVA 2QD2A 3Q5EA 4O33A 4N8EA 4PRLA 4OMCA 5DTMA 5HOQA 3B6MA 1D2AA 2GERA 1EVQA 3ZCXA 2OHXA 2JPDA 2Q8NA 1JHOA 1JKJA 2V7UA 4P83A 5G0TA 4QXMA 4KQIA 3ZGNA 4HDAA 4QOIA 1OGYA 1FFYA 3L1UA 5ALMA 4BQEA 5JNRA 4MWGA 3K0AA 4HWPA 3PL1A 3SNHA 3OFSA 3WNVA 1EP9A 1FVHA 5EGNA 4C6HA 4US2R 4CEJB 4IDOA 4EG8A 1DP4A 1NBMD 3C3YA 2QMQA 3N2EA 3ILSA 1VL1A 4PZ0A 2B36A 4MDYA 1Z7WA 3PC8A 2H0AA 2J3KA 2I6GA 3DVAA 4S1NA 1MB2A 4YCMA 1GYQA 5IF9A 1E0KA 2PFSA 1ZGGA 1Y3CE 4IJ6A 4R1NA 2WU3A 3C3EA 5H81A 2BKXA 4M7PA 3MTBA 2I87A 1AKUA 4Q1AA 4G0ZA 4ZJZA 4JQZA 2XW6A 4V02A 3PRJA 3LX8A 4DLLA 4U7HA 6NULA 1DDOA 2EG9A 1XRSB 2NQ2C 3L9WA 3QRWA 1IVSA 2NACA 1USWA 3DE1X 3V33A 1R3DA 5IYZB 1NVXQ 1SC3A 2Q6TA 4QPDA 3JRWA 2ZROA 3M83A 3T7DA 4ER5A 2Y9MB 1L5HB 5BSUA 1X6VA 2WBLC 1Z37A 3KC2A 1LS1A 5TPZA 2JLYA 4XGKA 3ZOKA 3ZY4A 3B13B 4KLAA 3CZ9A 1P7ZA 3BTOA 3MCAA 2DTEA 2GZHA 3ZLBA 4F04A 1ARZA 2CGEA 4RTJA 3OQ1A 3NBUA 2NSDA 4ZAGA 5LQAA 3SQDA 3WGKA 2C83A 4X63A 3LYAA 3TZQA 1MIOB 3ES9A 4CTJA 3I73A 5K0TA 4KMSA 2EQBA 3FY4A 4QOEA 3QFHA 4QG3A 3VHRA 4BNWA 3OA0A 3B51X 5J4KA 4LE1A 4IR7A 1HE3A 2XUFA 4L5YA 3DT6A 4AMVA 3I04A 2QP3A 1XTKA 3VNAA 2OO3A 2C2XA 2ZZMA 4YMLA 3DBOB 4JHLA 4RFSA 4D0SA 2O3UA 3URMA 1YI1A 3BB1A 3DZ8A 2BJWA 4K46A 5P8WA 4TMFA 5ILQA 1EDEA 5J4VA 5DYWA 2V45A 2Z6UA 4QM7A 3JQ7A 3WIEA 4GGOA 2NXNA 2XH8A 4PTYA 1O97C 2C95A 1P81A 3BK2A 1KFJB 3G9TA 3JAWA 5GJVC 1T0BA 3AKEA 3CW2A 3QM1A 1Y1PA 4G0QA 5IKEA 2C7PA 2BI8A 5HZHA 1WV0A 1QCYA 1CW2B 1I7SB 3KSZO 3EGXB 3NGXA 3ZLTA 1WXXA 2YUTA 2QJWA 3E84A 2DYKA 2QUKA 3M5CA 4FW9A 3PJFA 4BNIA 4U0JA 3KSAC 4P3OA 3JQAD 3N59A 1J0CA 3SBOA 4DUZB 1E1RA 4CTNA 1MU0A 4P7BA 1UM9B 4GPZA 5BUSA 3G7SA 2HC9A 3Q40A 2AF3C 1YCDA 2I6FA 4F1WA 1W9HA 2FUCA 3QKRA 3BOSA 1C81A 3ZR4B 2D4HA 4WXPA 1LVGA 4UHDA 1VE7A 3AHDA 1NQ5A 3JWPA 3LPAA 1O9BA 3WP0A 3ZCQA 1QZ3A 3LQQA 3TQCA 3ZDDA 4Q4AB 2WTXA 4GX2A 4LPKA 2GPAA 3PRKE 2GPNA 4R2JA 5CU7A 1PL0A 5IK2A 3U40A 5FPKA 4DDKA 4JP3A 2FLWA 4U02A 3OIGA 4BB5A 5JXHA 2ZK7A 5JDCA 3DHEA 4EK9A 4BQNA 2PUAA 3HXKA 4QTXA 4C21A 4RZ3A 2HK6A 3RU9A 1N92A 3MHPA 4RA6B 2PZLA 3BMCB 3M6FA 4BV8A 4UAUA 3BL8A 4TTQA 2LCFA 1COWD 1M34A 3LCVB 5CX4A 5F5LA 1WCWA 1Y5RA 2I2WA 1YRAA 2ZJBA 4H7EA 5ARDA 3CEPB 4B5LA 1R3UA 2XTMA 3L1HA 1ZUD1 3L79A 4H18A 4CT5A 2D1QA 1G60A 3PR2B 4LRSB 2C4VA 4OHKA 3RHSA 4DLPA 4EFMA 1N2ZA 3JVVA 4BRSA 1H0RA 1OGIA 5DLPA 2R5FA 4NEQA 4XE5A 2VS1A 2H2HA 2X86A 2D06A 2XDAA 5DHQA 5E95A 1W1WA 5KNBD 4P1ZA 3IYLW 5AW3A 2CCKA 2XCLA 2ZBEA 3S81A 1GA6A 3ZU6A 3AUYA 2Z1MA 2I8CA 4B76A 2EKDA 3AY6A 4J75A 5LBTA 3WKEA 4AZ0B 1E7RA 2EKBA 1A9SA 2VWPA 1PR6A 3ILHA 3QLUC 4IMJB 4QQRA 2G40A 2OGTA 5BR4A 1EUQA 1I6KA 3BSSA 3I0ZA 4EX6A 3VC7A 1UBLS 2ZR8A 4ITRC 1W5AA 2PG3A 3DE4X 3PIIA 2WSMA 5F2OA 3M6XA 5AVSA 2B94A 3F5MA 1I9CA 1IUOA 4MA4A 4MYRA 1JZQA 2HX1A 4TYQA 1OBFO 2YICA 3RBZA 3TVDA 3T35A 3L6UA 1GNLA 5GVSA 5GZ1A 4F8YA 2P6OA 5BW5A 5COAA 2QQ5A 4CCWA 3QVSA 5E4TA 5E1OA 2I4LA 4X71A 1ZH0A 3RUAA 4LGYA 3D6HA 3TSYA 5CDHA 1GQRA 2HDNB 4HNRA 5FNVB 1AE1A 2CB0A 2A84A 1HFEL 2GLXA 3TUJC 4FGUA 1D3AA 3EZXA 4KPUA 4KJZA 2UAGA 3T9CA 1E1LA 3G3EA 4CKYA 2Z4RA 5TNXA 1E0SA 1QGUB 4FJ0A 3TW4A 4AJ1A 2BHNA 4QDXA 1JEYA 5LQRA 4TLDA 1P33A 3T3OA 4L5JA 2VBIA 1B15A 3LVRE 4EY3A 1ODSA 1R64A 2C1XA 1WF3A 3VM6A 3VHQA 2OILA 3W9SA 3HNRA 4IP0A 2XUHA 4L8WB 2GLTA 2OCAA 2HPAA 3IVGA 3C97A 3BT7A 2X76A 1WMBA 3BX1A 4PHTA 3T7CA 2WD7B 4BPBA 5EYPB 4KACA 1N4DA 4DNPA 1H05A 1QE5A 2P9TA 3KOXA 3P96A 1SUWA 5ALRA 4DTIA 1JQEA 4HAOA 4LEIA 3C16C 4PBTA 5J58A 2IUTA 6CHYA 2BL4A 2FEAA 5DTEA 4OJKA 5E0KB 3EIXA 3THYB 1V6AA 2X5NA 4PO1A 2O52A 1MPXA 4GICA 4M8NE 2VP4A 3RYCA 1XHFA 2CLCX 2WABA 3LCRA 4FU0A 2JAQA 5EMMA 3A31A 3I9FA 2QRZA 4C7OB 3OTOB 2IZ6A 2QN2A 2RJ3A 4WFKA 2V4MA 3FRHA 3LO8A 4EHBA 3DKKA 1LH0A 3IQHX 3KQSA 2YZ2A 5D86A 2FF5A 3A9WA 1L5FA 4P7JA 2C78A 1IWBB 5I9NA 1B1CA 4URHA 1QF6A 5LU9A 1MW8X 3QJ5A 1E77A 5TDHA 1L4YA 2B4RO 2IZ5A 1I5OA 3KZMA 1R2QA 4AN0A 4C3OB 4CM9D 1CR2A 5CLHA 4G5HA 4KQWA 3VYWA 1U7WA 1Q0UA 1ZM9A 1AB5A 2F17A 4DMLA 2C4MA 1X1RA 1MVOA 3RC2A 4M1WA 3WKBA 4EHNA 1SB8A 2GB4A 4RD3A 3CNBA 5ALXA 1VSUA 3OLYA 1DQYA 1XMSA 3NIWA 4HFMA 4KWCA 2QHXA 3B1VA 3CNOA 4JB3A 1CVLA 5T64A 3IURA 4U9UA 3VDNB 3QOXA 5JBNA 4HDRB 2X1HA 4L9RA 1E9DA 2FPGB 3DCJA 1KMHA 1VYVA 5IBPA 4RLHA 3GLIB 4KR0A 4QVGA 4MUGA 1FU4A 5KHLB 1PYDA 3HVIA 4N6NA 4OAOA 2IVZA 2ONKA 1UKEA 2QTFA 2CF5A 2V7PA 2R8YA 1V4VA 5CH8A 3ASZA 1MFZA 2P6RA 1QV9A 1FSSA 3IEIA 3RS2A 3SIPA 2Y1EA 1ZFNA 3SSNA 3P7MA 4OUKX 5B64A 2GS9A 4PPYA 4MLPA 4YRDA 2XGJA 1UBHS 3D3QA 3H5OA 1E8MA 1LQ2A 2ZIEA 3IXLA 3KQQA 1X1SA 1E4EA 1OC4A 1BDMA 2C9OA 3IPCA 4KIFA 4QYSA 3AEUA 4BQFA 5K3AA 3MQ2A 4ZQHA 1EE2A 4AIRA 4C6TB 5CBPA 4RACA 2VSOA 3BZBA 1U0GA 3N6VA 3NORA 4JJAA 4Y6OA 5GZ3A 1VHWA 3JZAA 1PNTA 2FPPB 4ID9A 2NG1A 3G1UA 3CLRD 1XELA 4RQTA 2HGSA 3D4PA 3MLEA 1AHPA 3L8DA 4XVHA 4IX1A 2BC9A 4GP7A 2H1SA 3EARA 4GVPA 2H2WA 2AXEA 1T9GR 2QY6A 2Z3ZA 1H66A 3EWIA 3LWBA 4XM0A 1YB6A 3EMVA 4I55B 1TVKA 2BTQB 4ENUA 3KB8A 2P3OA 4C6RA 1N9GB 1GUFA 3C4QA 3AR6A 4DSTA 4CEHB 2OXIA 1QP8A 2RKWA 3HBAA 4MINA 3HJAA 1A8SA 2ADMA 1PGNA 1HOTA 2W2PA 5DMXA 3EIQA 3KYJB 1ZLYA 3W05A 1T9HA 4OATA 1WG8A 4ND4A 1ZH8A 1VECA 1UMCA 1UAYA 4G81A 2A2ZA 3C6KA 1GTZA 3CG0A 4C08A 2BRUA 3D7MA 3L9XA 3NC4A 1GCAA 1P5RA 3OPXA 2WU4A 1ZJZA 3BZUA 4HTFB 4RETA 4X8MA 4WK4B 1PS8A 4TM7A 3TVTA 1XT6A 4AXXA 4C22A 5LZ9A 1Y0BA 4IDDA 4WT7A 2NVWA 2ZIXA 5JS2A 4WHMA 3HEBA 4CJXA 4DCMA 4BNUA 2ZS7A 3ZXYA 1ZSVA 2XBMA 4ZI3A 1EP3B 1TX4B 4OXNA 2VKQA 2ZM6B 3A1DA 1H6AA 1ZD2P 1NOJA 2G72A 2X5JO 4R05A 4YAOA 3W8RA 1NXTA 1RBQA 2H3EA 3H8WA 2FWJA 5FBKA 3ZUPA 2IYVA 1ADYA 1XTRA 2YJZA 3OLXA 3RRNA 4EO7A 5JMWA 1SNYA 2A0WA 1T2UA 2CFOA 1T9GS 3WYBA 1Y6FA 4RVCA 1TK2A 3KKZA 4N65A 3PYMA 4IV0A 5GVRA 4DC9A 3U7HB 2VHZA 1PG5A 3KG2A 1TTHA 4I1OA 2X40A 4MR7A 4QULA 4Y6PA 4B35A 2GSDA 3RIHA 2JCVA 4W1QA 2IZ1A 4B7CA 3HJGA 3SPXA 2MINA 4WK2B 1WZNA 4E5DA 2W6MA 1HYGA 2GAIA 3CUSA 2M98A 4JBYA 3U5ZB 1NAHA 1H8HA 2VHVA 2H4JA 1NG9A 3FN4A 2PRYA 1JHVA 1HFJA 2VZEA 2NP7A 2IC5A 2XZDA 3AY3A 5AM3A 2XCQA 1DAIA 2VNKA 4JQCA 3ACCA 4LBYA 3EVCA 4L78A 5JVDB 3UC5A 5JC8A 1OI7A 2G1KA 3KE8A 4GI3A 4Y6LA 1SBHA 3JRNA 3RKSA 4B4VA 2HHLA 2FK7A 2XUOA 1Z22A 2I3DA 3D64A 3EAGA 2BFCA 4LOIA 4EB0A 5KVAA 1DJMA 1G7SA 3OG9A 4GC5A 3H4IA 3VJMA 4BO9A 1SY7A 1YRWA 2YTZA 4C5BA 4GBJA 2CMKA 1G59A 3PC3A 1WZ2A 4WBSA 4WOCA 1U0HC 1TA9A 3A2LA 2MSNA 1E9VA 3BH6A 3GXBA 4TQAA 5DSZA 1P9OA 2ZQZA 5EVJA 3TSZA 4EEXA 5KU7A 4KU4A 4TVOA 1D1TA 4O2AB 4TWJA 4I0WB 2F3TA 3KALA 2VAVA 1EEXB 1R8JA 5AD1A 3FYDA 2HXYA 5CD9A 2EIXA 3VUEA 4OJTA 1B0ZA 1EZ1A 2AUTA 3TOVA 3DL2A 1Y98A 2QAIA 4U39A 4DNXA 3HWX1 4NCAA 3C15C 4FSDA 1ZA1A 3EZ6A 3VR0A 5JBIA 4A0HA 2DPLA 2Z3WA 2IYUA 1NHWA 1EXMA 1ODFA 3L0CA 3X0DA 3ZY5A 1HDRA 1FC0A 1L9KA 1YE8A 2A9OA 4LZJA 2JRLA 4BKRA 2ZR7A 3IUEA 1WD7A 3HL4A 1EWKA 1KKMA 2AVNA 2J5KA 1OFGA 3IBSA 5AI4A 3U17A 5GTDA 1L5MA 3D2CA 2A1UB 3PJEA 1VCMA 2ZM5A 1JJFA 2HJGA 2HQSA 2WJ4A 4YJHA 4DVGA 1M74A 2AZDA 5D1NA 4EKNB 4D9FA 1E2GA 1GUAA 1PEKE 3V34A 2VDJA 3IQZA 3FSEA 1XAGA 1HZZA 1QO9A 3VMMA 5F35A 1GEEA 1G1AA 4CF7A 2Y27A 1O57A 1JEJA 4RK4A 2DERA 1NJ2A 1X7XA 4IIDA 5KTNA 3EULA 4ND8A 5C5DA 5FL7A 2VP5A 3OHPA 1VL5A 1Z5NA 3O4VA 2DY0A 4NZPA 4ZICA 5IS2A 1JMVA 1TQ6A 3BSYA 3AB3A 3H1EA 3W1EA 4IYRA 2OL4A 3KJIA 2OQ2A 1ILWA 1GLNA 3PR1A 3ABIA 4PX9A 4C14A 3JALA 4AS2A 1Y6GA 2XZLA 1RM3A 2LNDA 1EK5A 5AKHA 3OM0A 1RC0A 3GJ3A 4KE7A 4YQYA 3LFHA 1QHNA 4I1UA 1G3RA 3LBNA 3WMWA 4UNPA 4Q7MB 4WDRA 2VF4X 3A1EA 5HJ7A 1SZCA 1NQOA 2H1RA 2IOFA 2OM2A 4UHHA 4XWGA 5KYXA 4M9UA 3DEIA 3Q72A 1TFRA 5JC1A 2LWIA 4M9QA 5EXPA 1W29A 4KGVA 4QQ8A 4R81A 1BHO1 1W49A 1XU7A 3AIKA 4R8VA 3UGKA 1R1DA 1Y3IA 4C0BA 2CDRA 1W36C 5F3WB 1GPNA 5H82A 3VOSA 2C97A 4MP3A 2HWXA 1RLTA 4GZ6A 3IV7A 1AV6A 1CUSA 5JJKA 2CE2X 2GN4A 2YJ5A 5ALFA 3WTCA 4BMYA 5ICGA 1DTSA 3FCCA 3LT0A 2EZ9A 2JFHA 2R60A 1L8LA 1G7RA 2QM3A 2GAAA 3PGA1 1OIVA 3C3WA 1G8YA 4C0HA 5CA0F 4ARCA 1FDUA 1SBQA 1P74A 3A6KA 3HG7A 4ACAA 4BU0A 2JLCA 2F62A 4FQ5A 3JD1A 3ZN2A 1R0BA 1Y3AA 4QGBA 1AIPA 2O9JA 2C2MA 4U7PB 3RVNA 1V37A 1JJIA 2P2LA 3H9UA 4BU1A 3U4QA 2WQ7A 2PTHA 1WUHS 4IXMA 2JGDA 4HGQA 5AXBA 1GU7A 4ZFNA 3R6DA 3ETDA 5BRAA 4HDKB 1FVFA 4NWIA 2QRLA 2H9AA 3QV1A 1D9XA 5JAUA 4KO2S 4J49A 4P38A 3ZBUA 1UMKA 2BONA 4KXLA 1GD1O 1YR3A 2PSHA 2RAFA 4FGJA 4Y9DA 4NARA 2ZSHA 5EJIA 2YXDA 3RUDA 1HQYE 4EKEA 2RHLA 1QMPA 3JZFA 4QNMA 1K7EB 4RWEA 1FRFS 1WDKA 3PFCA 3GZJA 5F51A 3DLPX 4F56A 4JWKA 4YCLA 2JHPA 3C43A 1W5SA 3H9BA 3ZU3A 6PFKA 2R00A 4DQ0A 3M3HA 2JEYA 4TYYA 3HKEA 3KR0A 1Z3CA 4DA4A 2C3YA 4ZMRA 3DGEC 1ISHA 3RS0A 3N5CA 1ZH6A 3ABQB 1NT2A 4R3WA 5EFZA 4UKDA 3QJGA 1ZHOA 4MXDA 2EF1A 4XFKA 3AI7A 1APBA 2GFQA 1XXHB 4KSYA 3ZI7A 1N2JA 1CRWG 1TYAE 2ODNA 2JCXA 1UAGA 3BFJA 3MJTA 4X3CA 5FYQA 2EEZA 3VOAA 3K8OE 4OI2A 3S28A 3DKIA 1PX0A 3NPAA 2XNDD 3HKDA 4FOLA 4PBSA 1ORVA 5E7JA 4B6OA 1K06A 2QL9A 1Q1BA 4AJ9A 5HMMA 4BO6A 4B34A 1ML3A 2J4CA 4RK6A 4BDSA 1YJAA 2QUZA 1V5IA 2D1FA 2FZGA 2O0MA 2WUVA 3GJ7A 2Q1YA 4BNTA 3HTXA 2OBBA 3PHHA 3CUKA 2VK2A 4XOIA 3UFBA 5IVKA 4K6CA 1XVAA 2QTWB 2D0DA 2IH2A 3OTGA 3RC9A 1MABB 4C20A 1JFVA 3T7JA 5CFLA 2GPTA 1HFWA 1LLUA 4P86A 1NE7A 3RC3A 1V6CA 3PPVA 1HYHA 3QJYA 4NYJR 1O6BA 1PYGA 1UMDA 1X7ZA 3W9YA 3X1DA 3HB5X 1A5BB 4BB0A 4ZT4A 5D3MB 4RZXA 4P4TA 3Q41A 2ORVA 4JP8A 3VAYA 1NQUA 2KBFA 2PO5A 3E53A 5IYZF 3GLSA 4BGIA 4G85A 5AWFC 4NATA 2H3HA 3TI9A 1H1LB 3S29A 1TMOA 1B23P 3RAJA 4JJIA 4C78A 1YZNA 1RCUA 3R5XA 4HYQA 4G5RA 5K3BA 3WL7A 3HJBA 3OCZA 2HO4A 4HNTA 3SHVA 4YAGA 1VI2A 5KNCH 4LFBB 2W0SA 3W6UA 1OX4A 5BNTA 1TA4A 3JASA 3ZW7A 3D7LA 1SGWA 3K2QA 3OPYB 4JGGA 5AK0A 2V4UA 3RUIA 3QMWA 1UBNA 1BEEA 3KT6A 4HN9A 4I6GA 5DNAA 1EVKA 1KRWA 2NU6B 1Y8QA 3ITDA 4DQLA 1FYEA 1SN7A 4C7BA 3K0CA 3QWIA 3K6SB 4IKPA 3LKBA 3MRVA 3EVNA 4RNCA 3U4DA 3VXKA 4HAVA 2I22A 3CUEF 1K2VN 1VJ1A 3GJXC 2IEAA 3D3NA 5DHAA 2NGRA 3BL5A 1BH6A 1A8UA 5BN3A 1EZZA 4DM7A 2GASA 1S8FA 4HVCA 4KFCA 3EXFB 1KZ9A 2PRJA 3V4ZA 2JDIA 1G8MA 3NTRA 3VI4B 1RCFA 1X74A 2JZCA 2WILA 4HQLA 1JMYA 1OWNA 4CM5A 3R0XA 2Y93A 4M1YA 3T5PA 4JQSA 2ONYA 1S3GA 1TIPA 3OSZA 4HJXA 4INOA 2E2WA 5JSKA 3QY0A 4DOMA 5IVPA 5JFGA 4D74A 1VE9A 3QX3A 1MG5A 2B1QA 4E4RA 4PSKA 2ZSKA 1NF8A 4DWOA 4N6OA 5ALLA 5CLLA 1K68A 4ZAWA 1RWKA 3QSGA 3URKA 4YPVA 3NBFA 4IV5A 2GPJA 1SCKA 2YHIA 2XGSA 3TNJA 4UMEA 1H2EA 5DW3A 3WL3A 1VFNA 3FLAA 2YXEA 2ZATA 5FL3A 4HX9A 3KJFA 4ALNA 4RYDA 3R76A 3AB8A 4L9SA 1JYFA 2R6GA 2HDWA 2A3RA 3LGSA 3CYFA 4FDLA 3TOSA 2C1EA 1SKAA 2R6CA 4PG4A 3R7AA 4CHGA 1TMYA 4ZZIA 5ITZA 1GPAA 2A9KA 2HU8A 4JL6A 2QSZA 3KWLA 4LOLA 5IEJA 1TAQA 3H6HA 4Y2UA 4ESHA 3LPNA 3GIWA 3QVGB 4ZHQB 3DZBA 1WM1A 2O4UX 3HZHA 3ACDA 2UVPB 4PYIA 4NNOA 4EAAA 1NIJA 2GTHA 1JIUA 4HRYA 2NU8A 3S1AA 3UAWA 3B7PA 1TLTA 3AR7A 1R6DA 2B8EA 3ONEA 1T8SA 1OKKA 2I6SA 4PPNA 4F6RB 4QHTA 1NJFA 1XI2A 3K20A 4GR9A 2BGGA 1YVDA 4QT4A 2X8WA 3LFTA 1L5NA 1DXOA 4AQDA 1QTIA 1I0IA 2OFWA 5TV2A 5TVGA 2X4DA 4M9RA 3BS4A 3KD2A 1E3DA 3R7WB 3QUBA 5ALWA 4E70A 3CT4A 2RHDA 4W1RA 4PV7A 4WZAA 3EVGA 5E1MA 2W6JA 4B3HA 2R25B 3ZGZA 4Y2VA 1KFBB 3VYSB 3WKCA 1NP3A 5AI5A 3B53X 4XQGA 5JSZA 1DPFA 4P7KA 4LRTB 5L9AA 3IHWA 1T5DX 3FMPB 4BMCA 2GM3A 5K4GA 1CZNA 1K8QA 2PXXA 4G24A 1FFGA 5IVDA 2VP6A 2BSXA 4REOA 1UIRA 4YCAA 1KSGA 4EJSC 3KLMX 3P2KA 4FS8A 4L5CA 2RH4A 4L8FA 1MRZA 1LJ8A 1P5ZB 2Q7OE 2CY0A 4BMZA 4AY2A 1Z0IA 4INPA 3ZPXA 4PXYA 5SYMA 1X2EA 3DV0A 4YXWA 2W48A 1J42A 2WT9A 3MJHA 4BLUA 3MJSA 5AFSA 5KOIA 4OSOA 4PM4A 3UCXA 4I6EA 1BX0A 3H4VA 1A1SA 4EY7A 2CVPA 4JBNA 2FSFA 5LQDA 4RZIA 1ZCAA 2IEBA 1L7PA 1XV5A 1NW3A 3LVBA 5EIWA 5L40A 4PC2A 2QSYA 4HYTA 1EJ6A 1PJSA 1S89A 2OKGA 3DOCA 3LHDA 5HOEA 3U1BA 4EWLA 1NJ1A 5JS6A 2G67A 1PVDA 4REQA 1DU4A 2ZBQA 3R3VA 5ESDA 1RLMA 3WJ1A 1G3QA 3C0KA 2B20A 5FTMA 4Z4QA 1K6XA 1WULS 2CBGA 1R0LA 2ZU0C 5CFOA 1HE4A 1G4AE 1DIRA 1ICEA 4OJNA 4P33A 1DADA 1IHDA 1Y7IA 2GNAA 2JFYA 2Y92A 2X0KA 1UC5B 3MJDA 2J9GA 4DHWA 3UMRA 4JIGA 4AZVA 5C5EA 5CK5A 1A8QA 1YL7A 3M0EA 1WUIS 2RH9B 1KI1A 3ZHQA 1CJBA 1E98A 4U9HS 5J9FA 1T3ZA 1EIZA 2DKOA 3FR8A 3SOPA 1KYTA 1MC8A 2A35A 2OZEA 3FBWA 2M9MA 1ZN9A 2PT7A 3CH4B 4IGKA 4OTZA 4F84A 2VOEA 1CQJA 2ZCUA 2P5SA 2KBEA 3NBXX 1F0NA 2YASA 4M99A 4EYEA 1CERA 1RVDA 2L82A 5LXTF 3T9EA 4JT8A 4DLAA 4RIIA 1AV7A 3FROA 4QLAA 2H0QA 4E1BA 4V0QA 1CVRA 4IHJB 1A95A 4CIWA 5K6AC 3O2NA 3O82A 5LXTA 3CFYA 4IGAA 3REQB 3K6SA 1OLXA 3C5CA 3HKBA 2IPOA 1A9RA 1A9TA 1CR4A 3NHUA 4I6JA 3WK4A 4IZHA 2EX1A 1AK2A 3FKQA 4GKJB 2BKLA 2WJVA 3DDOA 3VU0A 2R5WA 3J7AC 1XTJA 3RREA 2VSYA 4JI1B 1RPJA 3QEOA 2XKAA 1Y3BE 5AVWA 2NU7B 4F1KA 4LSZA 5BVGA 2WMYA 3CT6A 2BGWA 4P8RA 4JS0A 4Z4IA 3FCOA 4GQBA 1RM4A 1XTPA 1LBIA 1X3SA 4K9QA 4NYJQ 3LHFA 1M9NA 2HN9A 3CKKA 1IAVA 1MQSA 1AS2A 4CCYA 1N34B 4LSWA 4FOSA 1Q84A 5ECDA 1KBOA 1UBCA 4FB5A 4P31A 4K87A 2QMHA 2ZSAA 3AX6A 4QOFA 4DLTA 1BTOA 2UZIR 5KJ1A 5FTLA 4DLNA 1L1EA 4FFLA 5B53A 3PL5A 2YWCA 3NWOA 5DM0A 1P60A 2AFHB 2OD7A 3T7RA 4DDTA 3LTNC 3HK2A 3HDVA 4NICA 4L8VA 1AKRA 1AJEA 4G07A 1XQWA 1PWXA 3OFVA 2DX7A 3E15A 3KV1A 1GG8A 4EJMA 1H8HD 3D6AA 2V6BA 5CVVA 4DV0B 2WJWA 5KNCA 3RFTA 5DNEA 1WKBA 1HQDA 1MT0A 1YHNA 2HIMA 4O5OA 4WXYB 4X45A 1FVOA 3W3AA 4CKCB 4R2XA 4YT8A 5JPDA 4XWWA 5BURA 2A9PA 3PQ7A 1CUGA 2Y1XA 3WS7A 4EGAA 5AVZA 3OTHA 1J0BA 2CFCA 4WTOA 1YVEI 2DRIA 1NKSA 3U9SA 3V3KA 4FFBB 3DHNA 4MITA 4DT1A 4FX2A 1MDBA 4R8KA 4CTOA 3F4LA 4G09A 1S2GA 1JTVA 2HMAA 3EOBI 3R5HA 2FEMA 3FI0A 1W19A 1PTJA 4X1IB 2UXDB 1QO0A 1KP3A 2YS7A 4N03A 1L7BA 1N5RA 1S6YA 5EE1A 5JV5A 2H8KA 3C7KA 3IVAA 3NALA 4M60A 3QTTA 3R3UA 2ZIAA 3BWEA 4UNSA 4AG5A 2CUNA 1YUBA 2GPWA 1A72A 4TV8A 1OU4A 1I2CA 1JDBB 2EF0A 1IPEA 2YFQA 5JD6A 2RHOA 2E55A 2NZYA 4F4IA 3Q1KA 3EX7C 3LC1O 1A04A 2WFMA 3NZEA 3OLVA 3AHCA 4IDAA 3WWDA 3NM6B 1N0IA 3CO5A 2RC6A 2B2CA 3M1IA 2XTZA 3ZNPA 5JMPA 4I55F 2ZRMA 2CLMB 4FHFA 3GRVA 1HX7A 2FUEA 3P9RA 3I12A 2GWHA 1X1TA 2PT9A 5H70A 4MQ4A 4KIUA 3DDSA 1RNLA 3WNBA 3ZX5A 4WVFA 1IJFA 3I9KA 2OK7A 2GEBA 3GP5A 5DOVA 3AILA 4TL8A 1Y4UA 1Z28A 2D54A 1ACJA 2VYQA 3CH6A 3LY7A 4FNOA 4Q9HA 5CJJA 3V7FA 3WHPA 3E8MA 2OZLB 4CKWB 5IANA 1FIUA 5EHGA 4MQFA 2G5CA 1V3UA 2JAWA 3EFOB 2FE1A 2WMNB 4S2UA 5HG0A 2XDWA 3D8TA 2G3YA 1SXQA 2WLTA 3EDMA 4CQMB 5JMOA 1XZKA 3FUWA 2GK6A 2FQ1A 4EPWA 1Z82A 4Q82A 2H9IA 2IPLA 3DZFA 3DZCA 1JIVA 2PKYX 3KLPX 3T06B 3MBOA 2R44A 5F77A 1UXKA 1UT5A 1GRNA 4JJGA 4NCIA 1U02A 1Y6ZA 4UNNA 2AWNA 1E5VA 4JOBA 4JOQA 4RHUA 1B6RA 5E9AA 5FP0A 3SS7X 1D0SA 1VE5A 3NETA 3BF7A 4ITVA 3ZK8A 5KC8A 5I4BA 4EUSA 1K92A 2XMDA 1GSOA 2R6R1 3N2ZB 4Q3KA 4WKNA 2X7HA 1X70A 2ZE7A 4C0QC 1N5MA 3N8IA 2O5RA 3GV0A 3PITA 5AKGA 3OWOA 5DI9A 2QVXX 1Q3TA 5ERGB 2F90A 2AV6A 2LCIA 3W3ZB 1F2VA 1O5TA 1YDWA 2I0FA 3BD6A 4I4TB 5DRYA 4DRZA 5JWRA 1H4VB 1UK7A 2PAFA 5AJWA 3PYLA 2QE7A 1PW7A 3G2MA 1N77A 1VDMA 1NMSA 1YMQA 3IMCA 1DOAA 1J5PA 1X14A 3WXMA 5C4IA 1UDWA 1XDWA 1LNSA 2PYIA 2OQRA 3R1IA 1BA2A 1EFVB 2IZOA 3PC4A 1W73A 1Z5WA 4US0R 4OA8A 1RYBA 3FDXA 4KNVA 4QQKA 2WWVD 2FW6A 4A5OA 2BV3A 3GGGA 1NPDA 2OBXA 3OQHA 1KEEA 4YAUA 2NM0A 2IF2A 4PZYA 4IF4A 4C0KA 1F8GA 4IRXA 2AMVA 3ZDAA 4OX9B 1DBVO 4HEA1 3CN9A 3ZVNA 2Y9PB 3FUTA 3CCBA 1HSZA 1NG1A 1JR3E 1MJ5A 1VBNA 4AVYA 3H2GA 5BWLA 3IAEA 2Z30A 1DWQA 3EAFA 4QDJA 4N0PA 1O96A 1P61B 2EW2A 2QNRA 4HK4A 4N18A 2ZUVA 4NDZA 4O2AF 1B42A 1JF8A 1LKZA 2XB8A 1XCGB 3R44A 3U4CA 1SXIA 1NQVA 1VI5A 2ZIFA 1PP4A 3RWBA 1A7AA 2I7CA 1PUJA 1SK8A 2V59A 2V74B 2FLKA 2AUNA 5EIBC 4GZ3A 2IU4A 4GYWA 2AYZA 4AW9A 2WE7A 2G63A 1IRXA 2F48A 1J0EA 3KJNA 3LZ6A 3FSGA 3ZXUB 4JUDX 2HIHA 4M4SA 1PRYA 3ZKWA 4I9HA 2Q2QA 1R4NA 5EI5A 3B1XA 3GNLA 2G09A 4LNUA 1U2ZA 3HSSA 4RDIA 1XEXA 3QMPA 3ZWKA 4HDSA 2VHEA 4FZRA 2JIOA 2Q5CA 1Z7YA 4HPXB 4MV3A 3RG2A 1NYQA 2A0XA 3UOAB 1X7YB 1ONSA 3T9AA 1II9A 2OCGA 2W98A 3D3WB 4WN9A 2BH9A 5J5VA 2C29D 3L4EA 4Q24A 1WU8A 1NJSA 3HRIA 1P8AA 5AM0A 2C4NA 2MSEB 4N49A 5HZMA 4KO1S 3Q6IA 1HT1E 4OLJA 4D9HA 1E7WA 2YUIA 4IXNA 3G0DA 3B6EA 1GAJA 3BCRA 4KXQA 4JODA 5FBRB 1J1IA 4DG9A 4ZOQI 3ICQB 1ZNYA 1ZN7A 5ISMA 5BV2P 3STUA 2XOXA 4S0XA 3AZPA 5J63A 3S99A 1U2GA 2A1TR 4O4JF 2XY4A 4I4IA 4U3JA 3TF5A 4XJTA 1MXHA 2J7PD 2DG2A 1HE5A 3DC2A 3S4YA 5HZKA 3UB4A 2ZI9A 2H51A 2ZRGA 1SZDA 4H1UA 3TFQA 2C2KA 3WC4A 1AT1A 4EKDA 3DLCA 1J9ZA 1BMDA 3E7XA 1OXXK 4F97A 2F3QA 2XMZA 1SBNE 4AM8A 4FMDB 4I9NA 4IDEA 4JJKA 1SHKA 3TYXA 2R97A 3DPIA 4J7UA 4BC1A 5E3HA 5J2UF 1O0CA 3PX3A 4CFZA 5JCXA 5I4CA 5LU8A 5JEDA 3O84A 2A78A 1TF7A 1UBTS 3QNWA 1P1HA 3QKUA 1PJ2A 1LBHA 1M67A 4U7DA 4X6LA 3IMFA 3F6EX 5C3MA 1H93A 4EA7A 4ZXFA 2Z1DA 1YZTA 1KDOA 2BFFA 4WCFC 4GI5A 2ARKA 4NBRA 4NBTA 1WX1A 1X8XA 4B7AA 1XZNA 3U7QA 3G5MA 3KHUA 2XUPA 3LKDA 1M2VA 4RV5A 1F2TB 3TIFA 2CWWA 1WSBA 1GV1A 3JQBA 4MQUA 1Z08A 4XQEA 3F6PA 4G0UA 4F46A 3GCWA 3SF8B 3EPHA 1AX9A 1QZZA 2O0KA 3C8ZA 3SYRA 4DR7B 2C2OA 5CH5A 2NO0A 4EHLA 1BD4A 4X24A 1RYNA 3PHBE 2N3ZA 3DP9A 4J0GA 5DXJA 5DTJA 3K9FC 3WHIA 3R2JA 1VMAA 4LDRA 3GFRA 5KWEA 4EGFA 2JDID 3IT3A 3LOQA 1ETUA 1FDRA 3W06A 1BJTA 2J30A 4EKGA 4QDZA 3L7LA 3E5MA 1N1GA 2CBZA 4QTZA 1X80B 3K0FB 3RWMB 3RUPA 1EJBA 4MRPA 2O06A 1M76A 3NVMB 3AZOA 2SCUB 1DAGA 1M2OB 2CXRA 4D9NA 5JALA 4M9XA 1IDN1 2P8JA 1OLUB 3RYFB 1XMOB 2ZSIA 4UPDA 2FP4A 2IU0A 3VH4A 3R8FA 2Y0DA 1G5PA 5L4SA 2GM9A 3JQPA 4QE3A 4XD7D 1R5OA 2K87A 1KI9A 3BC1A 3CWCA 4RF4A 1R4MA 4JLAA 3GJSA 5CJ2A 2Q50A 2WWHA 4ODIA 4A26A 3EFHA 5CFPA 3LBHA 4RMGA 4W7HA 1LZKA 4J0EA 4FCCA 4QTTB 3B1ZA 1NI3A 3GJ5A 4UUAA 3QVJA 2R1ZA 5ESRA 2PPVA 5CAEB 4U00A 5BQ3A 4MVJP 4NV0A 2QTVB 2O8EB 5DLDA 4OXYA 2VYVA 1HEUA 2XRZA 1D04A 3DCIA 2BFAA 3MWYW 4PRZA 4D9EA 1KWKA 3VPHA 3T3PB 4KRGA 4GL4A 2MOKA 1XNHA 3N2NA 4ZJUA 4J4HA 2I7XA 2NOAA 3O3MB 4BAGA 2O3SA 3E9NA 1L5ZA 2HK9A 4PYMA 3FDJA 2HJ9A 5JD5A 2XQGA 3DQPA 3RJZA 5EJ9A 5L4NA 1Z56C 3GRPA 4UM7A 3DS8A 3W34A 4V0LA 2MYNA 2MR6A 4WE3A 3W5HA 3BQNB 1P9WA 3EZYA 2PEZA 2VDKB 4UEOA 3ZWBA 4B6GA 2BGKA 3EXHA 3VR5A 4ZYYA 1ISPA 1NXPA 1R18A 5C4MA 2YHBA 1N2XA 5TJ9A 3IUJA 3NDJA 3B36A 4WKCA 5FLXA 1ZJ6A 2VHQA 2DQYA 2RHBA 4EB8A 3CVUA 3WJAA 4I1PA 2HMTA 1O3YA 3NJ8A 3RVLA 5C7OO 3L04A 5EL0A 2ZVDA 3SFZA 5F23A 1XXHE 4CCAA 1PNVA 1ZVVA 3C3BA <