1QG6A

Crystal structure of e. coli enoyl acyl carrier protein reductase in complex with nad and triclosan
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
257
structure length
257
Chain Sequence
b'GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ENOYL-[ACYL-CARRIER PROTEIN] REDUCTASE)
molecule tags Oxidoreductase
source organism Escherichia coli
publication title Kinetic and structural characteristics of the inhibition of enoyl (acyl carrier protein) reductase by triclosan.
pubmed doi rcsb
total genus 92
structure length 257
sequence length 257
chains with identical sequence B, C, D
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 1999-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1qg6A00
2DLDA 1HF3A 3UW3A 1XYGA 3L07A 4LW8A 3TZKA 1Q7GA 4E5YA 3AUTA 5K6AC 1LDEA 1ZJZA 3DO5A 1C0IA 3MWEB 5B12A 8ADHA 1EMDA 3H9JA 1U7HA 3BMNB 2PZKA 2JHGA 1OBFO 3ZWCA 4OYRA 3RUCA 3BHMA 4MO2A 4CQLB 3JQAD 3PFWO 1UJMA 4U0KA 2VOJA 1GD1O 1T2EA 3NJ4A 1PX0A 4H7PA 1M76A 5F3RA 2W8ZA 1O9BA 3NYWA 5AXAA 3C7DB 3GRPA 4Q3NA 2FP4A 3HE3A 2EGGA 1WP4A 5KKCA 1U1IA 3D1LA 5K0ZA 5JAIA 5A9SB 1D7OA 3WLEA 1GEEA 2VHXA 1JDJA 4XCVA 5L7TA 2FZEA 4YTEA 2C54A 3JQ6A 5TQVA 4E33A 5TT0A 4LCEA 1F0YA 4JK3A 4AJ4A 4UEJA 3R3JA 3RROA 3GGPA 2OGUA 2V7PA 4PRLA 1H6CA 3JQ7B 3HN7A 1IE3A 3ANNA 2GN6A 1HZJA 1ZCJA 3GPIA 3ZV5A 1C1DA 2NVWA 1LDYA 1R37A 3PHHA 1FDSA 1KIFA 1N8KA 1U8XX 4BGIA 2EP5A 3AU8A 3P7MA 1BXZA 1EFLA 3NGLA 4CLXA 1PJQA 4YJHA 2C2YA 3TJRA 2AEMA 4EJ6A 2IEDA 4M55A 4PG7A 4YR9A 2I3GA 5KJCA 3DMYA 4ZQHA 3HFSA 3OSUA 3IIEA 3AI2A 5FF9A 1DDOA 1X1EA 2XF8A 2EKQA 3RU7A 1XSEA 5GZ3A 1TT5B 1YL5A 4BO0A 2BI7A 4B8ZA 5DCWA 1L1FA 1ZK3A 2FMUA 4ZQFA 2OP1A 4CM4B 4ALJA 4LCJA 3ZV4A 5CDSA 1YS4A 2Q1WA 2AQKA 4GI2A 3KEOA 3FR8A 4RF3A 4OHUA 1EQ2A 1KEPA 4KZPA 1ZK4A 4CMEA 2AW5A 3KETA 1KEVA 2Z1MA 4MPDA 1DPGA 3VAZA 2YQ4A 3GEMA 3O4RA 5C3MA 1DFHA 2NVUA 2PZJA 5F1OA 4CMEC 1TA4A 2ZCVA 3HZZA 3VHRA 1ZK2A 1JA9A 3PTZA 4RV9A 1MX3A 3D3WA 3ROMA 4CM8A 1PQWA 1NHGA 2NACA 3E5MA 3ETEA 4D46A 1HXHA 4FR5A 5AYVA 4YACA 3H9QA 3PYLA 1HDGO 4YRBA 4ITUA 3WXBA 1YOVA 2VUTA 4L0QA 1BTOA 4DTIA 4MVJG 3CINA 1QYDA 4LISA 3ZN2A 4L76A 1P1FA 3ROQA 4HFRA 1MA0A 3ETDA 4K28A 3R6DA 3I9NA 4ZQEA 3WWZA 3ZU3A 5KTKA 2VUSA 2HKIA 2HO5A 4L4XA 4RJTA 1PJSA 4XD2A 1YONA 5KJFA 2Q2VA 3G17A 3LSYA 4JJGA 1GYQA 1E5LA 4EJMA 4WLOA 4H15A 2HAEA 3AI3A 1R0KA 4MVJP 1E6EA 2YV3A 2ZK7A 4DC1A 5FEUA 3DC2A 3OEYA 4BNIA 5CPFA 3E9MA 3WOHA 5TX7A 1NQAO 2XPCA 1G0NA 4L74A 1NAHA 4DUPA 4CLOA 1PGJA 2HRZA 5T67A 2NVBA 3PRJA 3H9GA 3V2HA 2AQHA 4E30A 3UVEA 1B8UA 4UULA 2R00C 2EXXA 1H93A 2GASA 1E92A 3RKUA 3KHUA 3W8FA 2CF6A 1MC4A 2CVZA 1E1NA 4CMGA 4BO8A 1P33A 3KEQA 5JXWA 4AJEA 3KV3O 5ER6A 1SAYA 3FF4A 1F8GA 2HU2A 3NGXA 4IDCA 3UFXA 5C7OO 2A9FA 2ILTA 1HYHA 1LRJA 1WNTA 1QP8A 3DOJA 2ZYGA 1UR5A 2VN8A 1AGNA 4RLSA 1DRWA 2H1SA 3WYCA 4WLUA 3OM9A 5T57A 3EY4A 3RUDA 4ZA2A 3DTTA 4HP8A 5TF4A 1O95A 3DBLB 3VZRA 3HG7A 1UZLA 3JCZA 1BMDA 3HB4X 9LDBA 2JJYA 2VHWA 4BKUA 1QRRA 3GRKA 4FS3A 3FSRA 4KUEA 4UVGA 2W2LA 2VTEA 3L77A 4IJUA 4PFJA 5I9MA 1D1TA 1LC0A 4WOJA 4DPKA 4A10A 4Z9YA 2J8ZA 3AU9A 2P68A 4DRYA 1PGOA 5HS6A 1N9GB 4IUYA 5A1TA 5KJ1A 1LI4A 4IIVA 1F12A 3WX0A 3EAGA 1X7DA 4G65A 1ZK1A 1GFSA 1GL3A 5FWNA 1EE2A 2PGLA 1T4BA 2VYVA 3EVTA 3L4BA 3RCBA 5TT1A 2Z5LA 3I9OA 4RDIA 1WW8A 2WD8A 5C7LO 3G1TA 1Y5RA 1VM6A 3KBOA 2J3IA 3RIHA 2CY0A 1LDNA 1AN9A 1TT5A 3K5PA 4J9VA 2WYVA 1UAYA 1Q0HA 1XG5A 1OAAA 3VH2A 3CTMA 3ABIA 5CEFA 4Z3KA 1YKFA 5FYDA 4IDFA 4FGWA 1EK5A 2BFOA 4BV9A 3WGOA 3OJOA 1LSUA 4NR0A 4QECA 3DHEA 2HMSA 5JPIA 3UICA 1E7WA 2YY7A 3PQEA 4BMSA 4IBOA 2GSDA 3K73O 2B69A 4MP3A 4CR8A 4A03A 4XQCA 3DTYA 1HE2A 1PGNA 2O50A 3ZV3A 3ENNA 2NTJA 3VPFA 2QQ5A 4BNZA 2OBYA 4J4TA 4XYGA 2Y1DA 5TRTA 1JWBB 1U7TA 1XU7A 3TN7A 2C59A 2WWRA 3ZWBA 1N7GA 3WMXA 1G6KA 1ONPA 1YE3A 1W0CA 5KIAA 4N5LA 1JKJA 1RM5A 5MDHA 4GPD1 1XELA 3WFJA 3LVFO 2QRJA 4EITA 3L9WA 5IFLA 1LQUA 3UUWA 3DL2A 3G1UA 2EKPA 3HFGA 4RCVA 4BO3A 1T4DA 1U8FO 4I08A 1HDCA 4L4SA 4BKQA 1ZKMA 4WLVA 1LA2A 1PS8A 1E3EA 4J3FA 4A2CA 1TEHA 4UVIA 2X5OA 4QFDA 4JP3A 3PHJA 2YV1A 3OJLA 4ALMA 4OXKA 4EI2A 4KWIA 4YJDA 5L3ZA 5ICSA 4IPTA 1FK8A 5JY1A 4FOOA 4OXYA 1JN0A 1FMCA 3TOZA 2P4HX 3ZWMA 4DQXA 5IAAA 2GN4A 1J5PA 4YAGA 3IOYA 4QQRA 5KJ6A 3OIFA 3RBZA 3ULKA 3PVZA 4CL8A 1VI2A 1VSUA 2WMDA 4FOSA 5L7YA 3KM0A 1GV1A 4RO0A 2Y1EA 5ILOA 3ONFA 4FFNA 1I30A 2H6EA 3FR7A 3QVXA 2AE2A 2CUKA 4MKZA 4FFRA 2Y1OA 1KVQA 5JS6A 1X7GA 5HRUA 4JIGA 5DULA 3V8BA 2WE8A 3OBBA 3E82A 3OF2A 3BMOB 1E3IA 2P91A 2VWPA 3CMMA 2HSDA 3PWZA 2WEKA 3PLRA 3JQ9A 1NFQA 3L9XA 3DZHA 4RF4A 2HRBA 1I36A 2EW8A 4Q3AA 5L51A 4AJKA 1IB6A 2VT3A 1XIVA 4R54A 3MJEA 3INRA 3JSAA 2JD1A 4FSHA 1QV7A 3U49A 1XU9A 2FWMX 4R4JA 4IXTA 4TRJA 3GLQA 3VKVA 3ZGYA 3JYNA 3AY7A 4W4TA 3H8VA 1N2SA 1N9GA 1O0SA 5A9SA 5CDUA 4XIYA 4YAKA 1I2CA 4JLWA 1YL7A 3KSZO 1A4IA 3I4CA 5CFZA 4UUOA 1DHTA 1V3VA 1SEVA 5KVQA 3QWIA 3AWDA 2RHRA 4WASA 2QRKA 3DAGA 4ZRNA 4HFNA 1H9AA 4FB5A 3I9JA 4DYDA 2DVMA 4MVJF 1C1DB 4FJ2A 3ONDA 4RZHA 2NU9A 3KXDA 2VYNA 1E7YA 3RASA 3IQDB 3TSCA 1NYTA 1KC3A 3KTDA 4CMCA 4XRRA 3MOGA 4PG8A 5T8KC 3WLFA 3KVOA 2IXAA 3DONA 4IIUA 4ID9A 4G2NA 4U6QA 2AQ8A 1X14A 1LEHA 3I83A 2X4GA 1R16A 3KOUA 2UAGA 4WEQA 4KOAA 5DBIA 2YFHA 3B20A 2O3UA 4YPOA 1P0CA 1C3VA 4LMPA 3VZQA 4CM1A 1B8PA 4II3A 4LRTB 4RPKA 4TVBA 4DBVO 1E3WA 4ND1A 4NJOA 3MJTA 4B7XA 2C07A 1VL0A 3OA2A 1GV0A 2A35A 1E7RA 4TRRA 3TFQA 5A03A 1QORA 4B7UA 4WKGA 2D2IA 3OHSX 3SJ7A 1YBMA 4UVHA 2HK9A 4NIMA 2VHZA 4C7KA 3JQAA 3GPDG 4GL4A 3RUEA 2JAHA 2JCYA 2QRLA 3NX4A 5KOIA 1IPEA 2EHDA 4BB6A 4IGEA 4P8RA 4AL4A 3O9ZA 4ND4A 4OGWA 4ZJUA 3LT2A 4OSOA 4Q39A 2IZ1A 5LCXA 3TOXA 5JBIA 5F1KA 3TZ6A 3JQ8B 1HRDA 3E9NA 2DBQA 3WJAA 5L4SA 3RC2A 1KVUA 2ZCUA 4I5DA 4XR9A 2Y68A 2H9IA 4ZD6A 1H6AA 1Q2XA 4XB2A 5EL0A 4BNMA 4CR7A 3TZQA 1E6UA 1WDMA 3F9IA 4BNXA 3VZPA 5L9AA 4HXYA 3I23A 4JJFA 1YBAA 3OMLA 4UREA 1XQ1A 1E7SA 4U7WA 4NHEA 3T7EA 4KUGA 5JCJD 4CMJA 3MJVA 3OQ1A 5ER9A 3V2GA 4B3IA 1JAXA 5FI3A 4URFA 1RJWA 2ZTLA 3VPHA 1KOLA 4HFJA 1E1LA 3JQBA 5CG2A 1EBFA 1GZ4A 1QYCA 1DFGA 4PZCA 3F4LA 3MTJA 3K9QO 3P2OA 1RM0A 4XYLA 4L4RA 1U3VA 3DXFA 4Z9FA 3UGKA 2Y99A 4W99A 2EJWA 2YDYA 1ORRA 5EPOA 3TWOA 2HMWA 4NFSA 2GF2A 3K30A 3ZNOA 1UZNA 3F5SA 1UZMA 4B8WA 5IZCC 4RGBA 2E82A 4MVJE 3VPSA 1EVZA 2RIRA 2HUNA 4FJ1A 4N7RA 3R3SA 3WBFA 3WG9A 4XWYA 3GFBA 3LF1A 3ZNPA 2GN9A 4PLVA 3KSUA 4W9NC 1A7AA 1O5IA 2Z1NA 4CODB 1GTMA 3EGOA 3HB5X 4J90A 3JV7A 2GLXA 2O23A 4IMRA 3PJGA 4JGBA 4IJKA 1GPDG 4MINA 5LDGA 3N58A 3UHAA 3GK3A 4U0JA 4K9DA 3CE6A 2CDAA 4ZGWA 3LT0A 4PLPA 4GWGA 4BV8A 2B4QA 4DREA 3TPCA 4Y9DA 4QXMA 4UEKA 3ZHZA 4BIIA 2PLAA 5A9TA 3CIFA 4RVUA 1DFIA 1XQ6A 1FXSA 1EZ4A 2HJRA 1NXQA 4E21A 1IL0A 1B14A 3TL2A 3AY3A 5DF1A 4PZDA 1LNQA 4LN1A 5ADHA 3PDJA 4INAA 3EZLA 5G0VA 3PHGA 4M87A 2P2SA 1EEHA 2D59A 3FI9A 2GO1A 5DZSA 3AI1A 1PZEA 1Z73A 4E6PA 1MFPA 3L6EA 1NWHA 1RPNA 2HK8A 3S2FA 1BDMA 5JLAA 5A04A 2XXBA 4ZVVA 1UP6A 4IJWA 1T1RA 2UUPA 2QZ9A 4KDFA 2PKQP 5A5FA 4H16A 4YAIA 2QG4A 4OKIA 4J1SA 4YDRA 1SEPA 4ALIA 2VHYA 3RFTA 7MDHA 1HSZA 1XGKA 5EJ2A 4R9RA 1RM4A 4WCFC 2I5PO 1CIVA 1UAGA 3BTOA 4FQ8A 4TKMA 2BGKA 4JN6B 4NZ9A 3LT1A 2WD7A 4J9UE 2OUIA 4XGKA 1RYEA 2GDZA 1NBOA 4IQ8A 1DSSG 3W4JA 3PGJA 1SB8A 1WWKA 1U28A 2X1HA 2O3TA 4DPLA 1P74A 4Q3DA 3P19A 1ONOA 4IDAA 4M1QA 1M6HA 5L95A 4NG5A 3KYDA 3RD5A 5KVCA 3H65A 3ICCA 5TJ9A 3VDRA 1W8DA 2YUTA 3UOGA 1SBYA 3EYWA 2DM6A 2OOSA 1U4OA 2X9NA 3K92A 3VC7A 3ORFA 4PVCA 4DQUA 1I33A 2LDBA 1NPYA 3NRCA 1BXKA 2NU6A 1QKIA 4PVDA 3FWNA 3EMKA 2AEFA 1DOHA 1UXIA 3FNHA 2Y1GA 4WCDA 1JW9B 1NQTA 2JHFA 2ZTVA 3ENKA 4MKRA 2DTDA 1GZ3A 1Q0LA 3IC5A 3LF2A 4AJHA 4CM5A 3EDMA 3AUUA 2DTEA 5COQA 5JC1A 5J23A 1HETA 2Q4EA 3AFNA 2OHXA 2D8AA 5CHEA 1MG5A 4AJ1A 2JCXA 1LU9A 1PJBA 2BF7A 4FBGA 1B8VA 1H6BA 1P1JA 1YJ8A 5EQDA 4Z0HO 1PIWA 4HY3A 2B5VA 4QO8A 2AQIA 1JKIA 1P9LA 2CD9A 2O3QA 3ANMA 3B6ZA 2Z95A 3QY9A 4M89A 4LGVA 3VTFA 3B1FA 4BOYA 3JQDA 2WJPA 1B0AA 3AW9A 4YQYA 5BNIA 5L7WA 3HN2A 3VPXA 1O89A 1C0LA 4KWHA 4HV4A 3L6DA 4XQ9A 4YVFA 2XOXA 3MCVA 1U3UA 3U4DA 1WDKA 5AXBA 3G0OA 1KY4A 1KVTA 4GX0A 3WICA 4TQGA 1WPQA 4OAQA 1YRLA 4TRNA 5T5QA 2NSDA 3NJ8A 3OH8A 4N18A 5CEEA 4O1MA 4O63O 2W2KA 5DNAA 1PU2A 2X0RA 1DAPA 2DPHA 4LVCA 4J0EA 1DRUA 3U9LA 1A71A 2BLLA 2Y05A 3DBHB 1Q0QA 3P5SA 5C7IO 1NQOA 3IL2A 4S3MA 2NU7A 5AOVA 2PD3A 2W2LD 3BMNA 3A4VA 3BMQA 4XX0A 3MJSA 4W82A 4ND2A 2J5RA 2PK3A 3JQEA 1VL8A 2GYYA 1SO8A 1WAMA 4F46A 2Q45A 1LDMA 3LQFA 3OA0A 2NNLD 5C37A 2QHXA 1BG6A 1HWYA 1UH5A 1P44A 5JAMA 3PJDA 3CPSA 2WTBA 1PJ4A 3RUIA 3W1VA 4CJXA 3ROKA 1EVYA 3RBXA 3L4SO 4MVJI 1U5CA 5DBFA 3W6ZA 5IG2A 4Z6KA 4UVDA 3DZFA 2DBRA 1GU7A 3HUDA 3PXXA 5BNFA 1OI7A 2BI8A 3W8EA 3Q9UA 3JQ7A 5ENDA 2ZYDA 2DPGA 1E3LA 2YZ7A 4FDAA 2C82A 4R1UA 3ZI0A 4DYVA 1M66A 1BDBA 3OJEA 4YRDA 4O0LA 1K0UA 2FZWA 3U3XA 3C8MA 3HADA 4CLEA 5KNLA 3JQFC 4RF2A 5TLSA 1ISJA 2VZ9A 1FDTA 3JD0A 4BS9A 1R0SA 2R2GA 5JDCA 4QSMA 3TF5A 4HKTA 4NU6A 2EGHA 5I7FA 1TB4A 1NVGA 1L7DA 2SCUA 4BO9A 3O38A 4R5HA 4P4LA 4D3DA 5EESA 5IZCA 4IDEA 1VRWA 3OECA 4ALNA 3OICA 5JYEA 5DCUA 4CM4A 1KVSA 2G1UA 4GVXA 4OM8A 3T4XA 5IN4A 1YB5A 3TFOA 3WGIA 4Y98A 5EN4A 4BKPA 4W9NA 5H83A 3QJ5A 3ZDFA 4NMHA 3WNVA 1H9BA 1I0ZA 4E31A 5BSHA 1JVBA 3GNSA 1KEWA 1OC4A 5U4QA 1BW9B 5BSFA 4FFLA 2GERA 4QT0A 4D3FA 2Y0EA 3F6YA 4EJ0A 5CDGA 6LDHA 1R4MB 4Z0TA 4JBGA 4E5KA 1Y8RB 1NR1A 3FD8A 3OP4A 4EUEA 1X0VA 3Q2KA 4J7UA 2YJZA 4EUHA 1Y8QB 1LLCA 1BWSA 2B35A 3WB9A 1ZFNA 4GX2A 4I9HA 3PLNA 2FSVA 4FFMA 3CUKA 3JYLA 3PHIA 3O8QB 3C85A 1HE3A 3GVPA 1PZHA 3IDSA 4JBHA 4CLRB 3PHLA 5A02A 3G79A 4E2ZA 4FCCA 4E12A 1I01A 3Q2IA 1PSDA 3SBOA 4R51A 3C7AA 5BR7A 4WGGA 2VQ3A 4GLLA 2P5YA 2IRWA 1U2GA 2I67A 1YXMA 4IQ0A 1UP4A 3WYEA 1C14A 4DIBA 3JYPA 4ALLA 3F4BA 5B1YA 3ADOA 2VRCD 2CVOA 2CDCA 1Q7CA 2OMEA 3GR6A 4WJZA 1B26A 4NU5A 2CMDA 4YA6A 1P45A 4DLLA 1Y6JA 3VZSA 4G81A 2WYUA 3F5QA 1T2CA 4OH1A 1YDWA 3N7UA 2W2KB 2NTVA 1W73A 2PWZA 3GAFA 3NEPX 1QYVA 3ON5A 3C1TA 2E49A 5JDIA 2HMUA 4UEOA 2EW2A 4Q3CA 3SLGA 3SXPA 1Z82A 2PGJA 2X5JO 3K8ZA 3U4HA 4B4UA 2NU8A 3JYOA 1JLLA 1C0KA 5HBRA 2P9GA 4ZN6A 4BO6A 4XJSA 4GX1A 3PQFA 4NK4A 1YB1A 3OIDA 3I6IA 4OKNA 4NK5A 1R4NB 3ZU5A 3BTSA 3C24A 3S2EA 3ZWXA 5I8WA 4E2XA 3EZYA 5B4VA 2X58A 1GUYA 1DHRA 4YJGA 4YCAA 4XGNA 4N5NA 1PWZA 5F21A 4EEXA 2AE1A 1K2WA 4NQZA 1QMGA 4D41A 8LDHA 3DHNA 1YGYA 4AJLA 2GNAA 3RJ5A 4PGFA 5C5IA 3AOEC 1ML3A 5HWSA 3U5TA 3H5RA 1F14A 5AVOA 3RQSA 1IZ9A 5ILGA 2PY6A 4YRAA 3FHLA 2QYTA 3WTBA 1BXGA 2J6IA 3GMSA 4MIOA 5HS4A 1ZEMA 2PGDA 4XDYA 4BNLA 2IYOA 1YB4A 5JCXA 3GEGA 1QLHA 2B4RO 1B3BA 3DFZA 4J6FA 4TMFA 4D0RA 6ADHA 2B5WA 2NV6A 3B70A 5DP1A 3QV1A 3VH4A 1HEUA 2Y1FA 5JMWA 1DXYA 4MVJA 3IP1A 4EEZA 4OO3A 3G3EA 4CUJA 4BKRA 1IULA 4K26A 3RBVA 5K6AA 4DLAA 1VL6A 3W8DA 4IS3A 2Q4BA 3D5QA 4Y6SA 2O3SA 3E5RA 2P9CA 2VHVA 1OZAA 1CRWG 5F5NA 3UH1A 4PCVA 3W4KA 4I9NA 2W90A 4CL3A 4CQMA 2O2YA 4QFCA 3K96A 4IQGA 2BMAA 4WOKA 3WS7A 4JXKA 4A27A 1H2HA 3DZJA 3TNLA 3CZRA 2JD0A 4CR6A 1B7GO 3SX2A 1WZEA 3DAFA 5A06A 3ITKA 3NT5A 5JDIC 2I99A 4GAEA 3ZH2A 1MC5A 3DMTA 2ZB8A 4B4WA 1VLLA 5HM8A 3FCOA 2D1YA 2AA3A 5U9CA 1U5AA 4RDHA 1R6DA 4KDEA 1XWFA 1HE4A 1HL3A 4M54A 3BA1A 4NNJA 5LC1A 2FHSA 2VT2A 3ZW9A 4TSKA 3AK4A 4GQAA 4Y8VA 4J1QA 1ISFA 4UAGA 4TVOA 4RLHA 5GY7A 1W4ZA 2RBEA 1ISMA 4XGIA 1QR6A 1UP7A 1IHXA 1SC6A 2GPTA 4CV0A 4CLRA 1F06A 3ZWNA 4ZQBA 4BNHA 3Q0EA 2X23A 3F3SA 3NDRA 3QLJA 1M75A 3JD4A 3WSVA 2C0CA 3IKVA 2HCTA 2OP0A 3NTRA 2GZ3A 4M8SA 4OJNA 4C4OA 2NM0A 1T26A 1NFRA 3LDHA 5I7SA 5JFOA 3ZV6A 4J91A 1KC1A 4BQRA 1ZZEA 1QSGA 1F8FA 4MJLA 2DBZA 3KO8A 3QWAA 3R0IA 4WNCA 3I5MA 4XDZA 3S1LA 3DBRA 1K3TA 4U6SA 1EUDA 2HJSA 2H63A 3KRTA 4CMIB 4P4NA 1I3MA 5G0WA 1DC6A 5JW6A 2YHIB 1PTJA 4E0BA 4I5GA 1PQPA 2DAPA 5JYDA 4CMAA 1Q7BA 4PLWA 1GUFA 2BFPA 4J43A 3LT4A 5TS3A 1X15A 3UXYA 1PJ3A 3GG2A 3DWFA 1PL7A 2H5LA 5F5LA 1VKNA 2J3JA 3H5NA 3OQBA 4RQUA 3GT0A 4W6ZA 3ZWYA 4OOFA 1AE1A 4P4GA 5I7EA 1AUPA 5JSFA 5JO0A 5CP8A 4J4BA 5B37A 4NBRA 4NDNE 1ZIDA 1BVUA 2BFAA 4QUKA 3RC9A 3I6QA 3BIOA 1UXKA 1AHHA 2C2XA 3AM4A 2X5KO 4NJMA 4DVJA 5L45A 2OL4A 2Q1SA 2YQ5A 1IYZA 2OO5A 5THQA 5GZ6A 3VH3A 1MGOA 4D7AA 4LSMA 4BNNA 4Z9XA 5JAQA 4MOWA 3VPGA 1ZH8A 3DMTC 1WLYA 1QG6A 3WNQA 2IODA 4JJIA 2DFDA 5T6BA 4J0FA 2GRAA 4CMBA 1SZJG 1PL6A 3M2PA 4BO2A 1LBEA 2EWMA 1T25A 2X22A 1LSJA 3A1NA 4AG3A 4XEHA 4Z0PA 3NTQA 1AHIA 1WMBA 5THKA 2W98A 4RPJA 5AXDA 1SMKA 1DC3A 4NFYA 4BO5A 2EKLA 2X7HA 2O4UX 3DHYA 2CNBA 3GN2A 1ZO8A 5DBGA 1MV8A 2JL1A 3PPIA 3ONEA 3IP3A 1SCUA 2C20A 2QIOA 2PTGA 3QVSA 4PLGA 4W7IA 1JKFA 1CF2O 3ZW8A 1RYDA 3V1UA 1MG0A 2FPPA 2EEZA 1K6XA 1HDOA 1GADO 2V6MA 2XAAA 1ID1A 5DCYA 4YAJA 1RM3A 4R69A 3X2EA 1YVEI 3M1LA 3O03A 4S1VA 4XYMA 3GFGA 3H3FA 1Y81A 4Y67A 2VYND 2PFGA 2P5UA 3IUSA 2PV7A 4I9UA 1K6IA 1NAIA 1PJTA 1U3WA 3BAZA 1VSVA 3DZGA 4RPHA 5A05A 3VKUA 5A5EA 1P77A 1QXSA 3CSDA 3PEFA 4LRSB 4OIMA 4IZHA 5ITVA 1MXFA 3QWBA 5EIOA 1XEAA 1HLDA 2E4AA 2HK7A 2NVUB 1E3JA 3UF0A 2ZYAA 5IDQA 4JP2A 4TZTA 3FNEA 2O48X 3H6KA 3PI7A 1P3DA 2P9EA 2YW9A 4QO7A 4FN4A 5MGBA 3AOEA 4NI5A 1YWGO 3A14A 3DOOA 2AG5A 4MIEA 2VUUA 1P31A 1BW9A 1NNUA 4DGSA 5GZ1A 2VNSA 3V1YA 3HSKA 4RPGA 3ETGA 2GGSA 4O59O 4J2HA 1LRKA 3NV9A 3BTUA 4HNHA 5AXCA 1ZK0A 1NP3A 1N1EA 4Y6PA 3K2EA 4XYBA 1Y8QA 1XA0A 3INGA 2DUWA 2FR0A 2YHUA 3GVCA 1ZW1A 4WCFA 1E3SA 1PR9A 2DUUA 2Y67A 4A7PA 3FTNA 1E5QA 1HDRA 1PJCA 4BKOA 2EV9A 3NAQA 4BO1A 1DBVO 1HTBA 1NTOA 3JD1A 4FIZA 1KERA 4E5MA 3OJ0A 2FPGA 4AJOA 3H4VA 2I9PA 3G49A 1T24A 2WM3A 4CLOB 1GEGA 3CEAA 1LSOA 3FPCA 3SVTA 4W7HA 2D0IA 3I9LA 4XZ3A 1P1IA 4BNVA 5IXYA 2FN7A 1F17A 5COBA 1S7CA 1NFFA 4AJIA 3ASVA 2NWQA 2D5CA 2VWQA 1CYDA 4J7CA 2PR2A 3T7CA 3JQGA 3PQDA 4YT2A 3L4BC 3GZNB 3QQPA 4ZHSA 2ZTMA 1T1SA 1IY8A 3GUYA 5IZ4A 4AFNA 4IXWA 3JQCA 3JYQA 3CZMA 1MXHA 2I66A 4NJMB 3ITDA 1CQJA 3DFUA 4R9SA 1CDOA 2VOEA 3GDOA 4DPMA 1D1SA 3DBLA 3GVIA 4DMLA 1HZZA 1WMAA 2AMFA 3PK0A 4ND3A 4A26A 5KWEA 1HE5A 3WIDA 3BXXA 1Y7TA 5JNLA 4OL9A 1E7QA 1ARZA 3E48A 3MZ0A 1FDWA 1ZVMA 3UCFA 2Q3EA 3K2BA 1ADGA 4GSKA 1E77A 1CQIA 1YO6A 1J0XO 3DAPA 2V6FA 4D3SA 1D8AA 2I65A 3QA9A 3BMOA 4I5FA 3LK7A 1DLJA 3VDQA 1NR7A 1DIHA 3JTMA 4D0SA 2C5EA 3GNTA 4MDHA 4HX5A 2BKAA 4EW6A 1EUZA 2GZ2A 4KMSA 1NPTO 4P22A 2WDZA 2DT5A 3WGHA 4BNGA 3GVXA 3IJPA 4DLBA 3HDYA 1I3LA 1X1TA 3I52A 3RU9A 2EG9A 2LDXA 1P0FA 1N5DA 1JVSA 3ADPA 3QE3A 3S2IA 4E32A 1GQ2A 3AJRA 1RWBA 1VE9A 2EERA 1I5RA 3CMCO 1ULSA 4YJHB 3GZ4A 3ST7A 1N1GA 1GDHA 3HDQA 1H2BA 3LC1O 2B0JA 1HDXA 4PLCA 1NASA 5CPBA 3WSWA 3ZNNA 3B1JA 3NUGA 4CQMD 5KVVA 1IHYA 4TRMA 4CQMB 1ZXBA 1ULUA 2E37A 1T2FA 2AEJA 4PLYA 2BHLA 4XIJA 4ESOA 1SOVA 2V6GA 3ICPA 4B79A 1EK6A 3I9MA 2Q2QA 3NDJA 3B1KA 2O3RA 3WGGA 3QW2A 1Y9EA 5I9NA 5JE8A 5IDXA 3KB6A 2Y1CA 5ICMA 1Z74A 2GR9A 2WE7A 3IJRA 4GKBA 5IF3A 3WMWA 3VOSA 2CZCA 3LU1A 1Q1NA 3GQVA 4IS2A 1GCOA 4RZIA 1XCBA 4MP8A 3U09A 1SNYA 2ZB4A 4YQZA 3HDHA 1ZUD1 2IZZA 4FC7A 4BNJA 1I3KA 3SLKA 5K9ZA 1FF9A 3KUXA 5ENVA 1KBZA 2FSSA 1I10A 3D3WB 5IDWA 3L6OO 4D45A 4PG4A 4ZU3A 3C7CB 2HLPA 4E5PA 4KP7A 1VJ1A 2OFPA 4OXNA 3PGXA 3RJ9A 4G5HA 1GQYA 3JD2A 2C7VA 4EBFA 3QSGA 4CM6A 4BB5A 7ADHA 4BGUA 1XR3A 2ZB3A 2DKNA 4YEDA 1ZMOA 3WQRA 1ENZA 4A73A 2J5KA 3K6JA 1GY8A 3GN1A 4CM3A 1R0LA 3H9UA 1V9LA 5DT9A 3GDGA 4BNFA 1PWXA 3V2UA 3N74A 4F6LA 3SJUA 2XXJA 3GUCA 4M49A 4JROA 4OSPA 3JQ8A 2ZB7A 4L9RA 5IXSA 4RVFA 5B4TA 4RL6A 3TZHA 3ASUA 3H9EO 2Y66A 2YHIA 4R01A 3SC4A 5G0UA 4GSLA 3OIGA 4E5NA 4WECA 4OOEA 4DA9A 3I3OA 1ZMTA 2Q50A 5BSEA 2D3TA 4RVGA 1L7EA 2DFVA 5EQFA 1Z7EA 2G76A 2J3HA 4ZRMA 1VKOA 9LDTA 4KTVE 1LQTA 1V0JA 2O4CA 2QX7A 4ZICA 4L75A 1WZIA 1T2AA 1UXHA 2X9GA 4II2A 4RPLA 4Q3BA 1XHLA 1YQXA 4RORA 4YT4A 4E13A 1GYPA 1N7HA 4TZKA 1GR0A 1W6UA 2ZKLA 4CLHA 4BO7A 1A9YA 4YT5A 5LDHA 4UUPA 2ZJ1A 4JCOA 1OOEA 4JX8A 1Y9AA 1TI7A 4BNKA 2VCYA 1D3AA 1T2DA 3EVNA 3U0BA 1Z75A 4XA8A 3FNGA 4FD3A 4J7XA 5G2OA 1NM5A 3S2GA 2GD1O 3D4OA 4J4HA 1A27A 3RC1A 2RAFA 4J16A 3NDIA 3WWYA 4R16A 3GA0A 4CLDA 3RSHA 3ROPA 2UUOA 1TXGA 4AJPA 3GNQA 4RVDA 4XKJA 3EHEA 2X0JA 1O8CA 1LJ8A 2NLOA 3UCEA 2I3AA 1SB9A 3K31A 4WEOA 5T64A 2PD4A 1ZXLA 4A0SA 3GHHA 2O3JA 4X54A 3VVBA 4AVYA 4J49A 4RVHA 3ZU4A 2PD6A 3QIVA 1JTVA 3R1IA 4LSWA 4MIYA 2Y93A 3QHAA 1LDBA 4J1TA 4K6CA 4WLFA 4PG6A 4DXHA 2IXBA 4CM9A 4DL9A 3EK2A 2FOIA 4DIOA 4XR4A 3T4EA 5A9RA 4AJ2A 2HMVA 3IUPA 1O94A 5CEJA 1M2WA 4D79A 2ZQZA 1SPXA 4TKLA 2NTNA 1B3RA 3AOGA 1YJQA 4FPXA 1DEHA 3PWSA 3I1JA 5H82A 1Y5MA 1R15A 3UAGA 2VRBA 2IZ0A 5JAZA 1U2DA 3RC7A 1LDGA 1DO8A 4YJFB 4MVJM 1NQ5A 1WDLA 1BVRA 4CPDA 4P38A 5IN5A 1EDZA 5L40A 1FDUA 4QEDA 4FC6A 5TSDA 1K5HA 1U9JA 5BNTA 1ADCA 3TQHA 1HLPA 3PIIA 3FRJA 4QX6A 3F1LA 3KZVA 1FDVA 3OEWA 4H3VA 4GKVA 4YBZA 1WVGA 1H5QA 4CV1A 4CV2A 2FRDA 1R66A 1HDYA 3DOCA 2VNAA 4PLHA 1IPFA 2EIHA 3OETA 4MVJD 5G4KA 1IUKA 1ISIA 2Y0DA 1EE9A 1NVMB 1U3TA 2JKVA 3PZBA 4NBTA 5IJZA 3WBBA 2QW8A 1Y1PA 3D64A 1EUCA 2YDXA 3MOIA 4N54A 3H2SA 2JCVA 3ZWAA 1IOLA 3W6UA 1H0KA 1DJNA 1PR3A 2WD7B 3LLVA 1ZBQA 1MP0A 4L73A 1E1KA 3GEDA 3FBTA 1XLTA 1DAOA 3DZKA 3RVDA 1GPJA 4BVAA 2W4QA 4YB8A 3E18A 3D3EA 1AXEA 1B16A 2BD0A 2DC1A 4GMFA 2CDBA 1E7MA 4GMGA 3DBVO 5HTOA 3PYMA 3FNFA 3BYZA 1QV6A 3H2ZA 2C29D 1YQGA 3D4NA 4GVLA 4HBGA 4O6VA 3KYDB 5JY6A 3GAZA 2VWHA 3LC7O 1PEDA 1OC2A 3F47A 3QVOA 2UVDA 3CKYA 3FPLA 4UUNA 4KQWA 1E0DA 1AXGA 1A9ZA 1B15A 1JAYA 1SOWA 4GGOA 5EMHA 3ZWVA 3TL3A 2DTXA 2RH8A 3AM5A 4QTZA 1EVJA 4D42A 4J1NA 1KEUA 3AUSA 2HMTA 5BQFA 1PL8A 3I4FA 4TWRA 1CETA 4R68A 2CVQA 4GX5A 3PIDA 3C3XA 1HSOA 4U5QA 3JQFA 1ENYA 3MJ4A 3JQGB 3VH1A 4CUZA 2AHRA 3FBGA 3P2YA 1HYEA 4PLZA 1ADBA 2AG8A 2X9VA 1V8BA 1VJTA 2G82A 4IM7A 1DC5A 1C0PA 4NBUA 5I8ZA 3WFIA 2VZ8A 2QZZA 3E9QA 3S8MA 5F1PA 3ZU2A 1A72A 2FR1A 2UDPA 1VC2A 3L0DA 1LX6A 5HA5A 4LK3A 1QLJA 3GG9A 4J2OA 4HUJA 4HWKA 2Y0CA 2FY8A 3AFMA 4MVJH 4NBWA 3HWRA 3GHYA 1GYRA 2IE0A 5G0SA 1I2ZA 3F1KA 2Q49A 1N92A 3PJEA 4ZQGA 5A3JA 2PH3A 1LSSA 3KLMX 2GN8A 2YYYA 3EW7A 5KKAA 2IEBA 5T8KA 3KYCB 1DIGA 3E03A 4E4YA 3ZWWA 5KCZA 1X0XA 4OQYA 3VVCA 1J6UA 3Q6IA 3ZCXA 1K6JA 5CAEA 4F45A 5I9LA 3DEYX 2V6BA 2GCGA 4LMRA 4MKXA 3GMDA 2JFGA 3H5AA 5G4LA 1EFKA 4CUKA 4ONEA 5L4LA 3A9WA 5ITWA 2J5QA 2X6TA 3U4IA 1ENPA 1V35A 2PKQO 3C1OA 4EGFA 2PZLA 3WR5A 2RCYA 2I6TA 3BTVA 1TT7A 1BRMA 2BH9A 2QYSA 1GZ6A 3MJCA 4DBZA 4IMPA 3MWDB 1YQDA 4FFPA 4IDBA 3IAHA 4BUCA 4GWKA 3IS3A 4D44A 3Q3CA 3V1TC 3DBHA 2DQ4A 4OMUA 2HQ1A 4WLNA 4FW8A 1ISGA 3WQQA 2EJVA 3HDJA 5GMOA 3BMQB 1IZ0A 2X0NA 4E2YA 4M86A 4HADA 1HDZA 1JU9A 3GY0A 2TMDA 3UN1A 3WGTA 2B36A 4GGPA 3TDKA 4WUVA 3JQ9C 3TZCA 1V3TA 2VYVD 1J49A 4B4OA 2I76A 2A94A 1E3WB 3D7LA 4YWJA 3RFXA 1J4AA 1K89A 1ZJYA 3GOHA 3QP9A 4A5OA 4BQPA 3M6IA 1V6AA 2AXQA 1C1XB 1NHWA 2G5CA 4NBVA 4BGEA 3RUHA 1OFGA 3Q11A 1EVIA 1NPDA 1YDEA 1ZSYA 3DDNA 4GH5A 5A3VA 4YYZA 1QYWA 2GUGA 4B3JA 1CEQA 3I9KA 3QWHA 3CH6A 3NKLA 4WPGA 1BHSA 3JQAB 1DIBA 1PGPA 3OFSA 1QYXA 3PP8A 3JQBC 1JWAB 4CM9D 5DN9A 1UDBA 2ZQYA 1ONNA 1ISHA 5B4UA 3RAJA 4AICA 1P1HA 1HKUA 2BELA 4I5EA 3HQ4O 5DDIP 3QVTA 2ZTUA 1LLDA 2X8LA 3SEFA 2B37A 1LLQA 1OMOA 2IDZA 3KLPX 5TC4A 5JC8A 1P1KA 4B7CA 4E3ZA 4HNGA 2RH4A 3OJFA 5DP2A 3RWBA 1MB4A 3WGQA 3PDUA 3FN4A 2JD2A 4DWVA 3DQPA 3DR3A 4LVUA 3HHPA 5L4NA 5I7VA 2ZIZA 2YV2A 4BGVA 3AY6A 1VJ0A 3HJAA 1XKQA 3ZHYA 1CJCA 3X2FA 3M2TA 4ALKA 1YL6A 1UUFA 3C1AA 2O7QA 3GDFA 1TLTA 1S6YA 3A06A 4GBJA 5H81A 4JQCA 4BO4A 4BHTA 1KYQA 1E1MA 3E8XA 2A92A 1UXGA 4RF5A 4D43A 1GCUA 4EDFA 4MP6A 1A5ZA 3BMCA 4XJTA 5DOVA 5JMPA 4XQEA 3RI3A 3W4IA 1B2LA 3PJFA 1I8TA 2A4KA 2POQX 5EERA 3WYBA 4R1TA 4R41A 2F00A 1YOVB 1EBUA 1Y8RA 3PZRA 3LYLA 2D5AA 5TIIA 3S55A 1LRLA 4PG5A 1KVRA 1V3UA 1DIRA 4RQTA 2CFCA 2OZPA 1MFZA 1HT0A 3COSA 1ADFA 3M1AA 5JO9A 4F6CA 3GF4A 4PLTA 1BSVA 1G0OA 4NH4A 3WGZA 3ZWOA 2BFMA 1MUUA 4BNWA 1A4UA 2E48A 4WNIA 3RKRA 2NQTA 2NUAA 3O8QA 5JDCC 1LC3A 1NX6A 1KY5A 3DBRB 1PJLA 3HNPA 4GLOA 4K1LA 4R3NA 3WJ7A 2WYWA 4KQXA 1P1RA 4CMIA 4JBIA 3KYCA 1LXCA 3NTOA 4NFHA 4N5MA 1NVTA 2B4TO 1DIAA 5KJEA 1LUAA 2JAPA 1ZEJA 4ND5A 1X13A 2EP7A 2O2SA 5COAA 5ES3A 4YXFA 4K6FA 3O26A 1I2BA 2ET6A 4WE3A 1I24A 2J3KA 3RUAA 3ZNQA 2RHCA 3SC6A 4IY1A 2IYPA 1LTHR 4I1IA 3IMFA 4OQZA 5TNXA 5L53A 3D4PA 4YAEA 4IDDA 2VRCA 4R1NA 2G0TA 4IGFA 2CF5A 4B4VA 2DBVO 3RUFA 3KSDO 5BT9A 3FTPA 5CG1A 2TMGA 2C7GA 1TVEA 5AQ1A 3OQ6A 4JNKA 2PZMA 4BNTA 4C7JA 2BRUA 5G0TA 3UKOA 3E6AA 4KTTE 1ZSNA 2FPIA 4CQLA 3GGGA 3H3JA 1E6WA 1PJ2A 3QWFA 4XYEA 1DLIA 1KS9A 3ANLA 3GVHA 4ILKA 3D5TA 3BHIA 5CDYA 4YJFA 3MTGA 5JCJA 1D4FA 4FJ0A 2C5AA 4PZEA 3ZWPA 3AM3A 1KETA 2X0IA 2EF1A 3Q9NA 1M67A 4BL5A 3E1KA 3ZHBA 3LZ6A 4PIVA 1C1XA 3GGOA 2ZATA 1PS0A 2OORA 4F3YA 1RKXA 1Z45A 3WDSA 4AJJA 1MLDA 2B83A 1DC4A 2JFHA 1BXGB 3LC2O 2R6JA 3UCXA 4I8XA 4O5OA 2D4AA 3BZUA 1I3NA 2PH5A 2Q2WA 4Z3DA 1VPDA 3DB2A 4UVEA 1H94A 4DMMA 3NT2A 4U8GA 4FGSA 1BGVA 1GQQA 1G1AA 1UDAA 5G4KB 4RVSA 4B3HA 4CMKA 1CWUA 2VTDA 3U4CA 2HDHA 3D0OA 2WSBA 4BMVA 4BMNA 4NPCA 4IINA 5DOZA 1DJQA 4DQVA 3ZZNA 2Q99A 3GC6A 4PRKA 1UXJA 4BNUA 2PKRA 4EYEA 3JD3A 4XQGA 1R12A 4Q3EA 4AJNA 1PS9A 1X7HA 3PFFA 2PA3A 4KUHA 1YBVA 3WQSB 3MEQA 4YT8A 4CMHA 1CERA 2E6UX 3BHJA 3EUWA 1R4MA 4HFMA 5TGDA 4XRGA 1XDWA 2VWGA 4ROSA 5FI5A 4XB1A 1A7KA 1ENOA 2UV8A 4FFOA 3EC7A 3IKTA 3CXRA 3VTZA 1U4SA 3INTA 5U1PA 3AUAA 3GH3A 1WXDA 1EDOA 5CDTA 1DRVA 4DIFA 1YH3A 2DU8A 3BMCB 1Z6ZA 2FR8A 5FFFA 1NWCA 3PYXA 3TRIA 1Z7BA 4IZIA 1O6ZA 2OBNA 5BSGA 4PLFA 1UDCA 3V5NA 1EQUA 4R5MA 2GZ1A 3Q1LA 2JFFA 4IDGA 1PZGA 4PN3A 2NQ8A 3H7AA 1DB3A 2CSUA 4E2WA 1I32A 2Q46A 2V65A 3RFVA 4CM8B 4WCFB 4CV3A 4R1SA 3WIEA 4R3WA 4BNYA 4CM7A 5TJHA 4DC0A 1H6DA 1ZNQO 5A4DA 3U62A 2NADA 1LLUA 3DZBA 2ZJ0A 1GAEO 2G17A 3PWKA 3STHA 2X86A 4Y6RA 5EINA 3F46A 2P4QA 2Q1UA 2OXIA 1GUZA 2BGMA 2PNFA 1PZFA 1HYGA 1ZSVA 3FWZA 4EZBA 1PGQA 2VZ0A 3QRWA 2BGLA 3NT4A 3DZIA 1JQBA 4IJVA 4Q9NA 4TROA 3KYBA 4WK6A 2F1KA 2R00A 3WTCA 2O7SA 3WGYA 4WLEA 5IDYA 3GZNA 1M6WA 4L8VA 1FJHA 1R4NA 3A28A 2YFQA 2UYYA 4EUFA 2Q1TA 4UUMA 4YJGB 3LLSA 5KVSA 3QVWA 3ZHXA 1PQUA
chains in the Genus database with same CATH superfamily
2DLDA 3Q7EA 1HF3A 3KXLA 2CHUA 1XYGA 3O31A 1W87A 1FX1A 4LW8A 3SF8B 3TZKA 3TPFA 3WKBA 3A31A 1D07A 5T4EA 2XKAA 3MWEB 4CFZA 3LY5A 8ADHA 1EMDA 3P1JA 4DTCA 1J0AA 3BMNB 4LYEA 1J5XA 2HXSA 3QLEA 3OF5A 4B3RB 1JDPA 4GFDA 1UT8A 4H7IA 4ZARA 4NH0A 2ZRIA 1W76A 4MWGA 2IA5A 3RUCA 1Z38A 2O9JA 4K6HA 1YQQA 4UCQA 5LBUA 3T0IA 5KYWB 3W2FA 3NC1C 1TQ6A 2V74B 4DIMA 3HPRA 1ZGGA 1GAXA 1Z88A 2P62A 1ECLA 4YDQA 2ZBPA 3HE3A 3SN6A 5ECYA 3T7RA 1OUMA 4I81A 5KKCA 1MTOA 2GF0A 3IP9A 4LC9A 3DAHA 4LE1A 4OI2A 3GCZA 3U17A 5ALGA 1A8SA 2QXYA 2ZRCA 3DOIA 5IUJC 2I0FA 2AI2A 1JDJA 2IHKA 2NTEA 1FFAA 4OH7A 1SZCA 4LHZA 3UAWA 5L7TA 2ADMA 1IWPB 2JB9A 3C8ZA 3JQ6A 4H7JA 4UE3S 3U7FB 4LCEA 4HNAA 3VM6A 3SFZA 5B6IA 5LZ9A 1IQRA 3CIOA 3RROA 1DAHA 3CKMA 5FTMA 4PRLA 1XHEA 2W6IA 2XUIA 1IE3A 2PSJA 4AD8A 3I2FA 1ZCJA 1AVTA 1W1IA 2JGMA 5EZ6B 2JJ1A 1YU6A 1VIVA 2P90A 4HGYA 3ZV5A 1R37A 1Y6GA 2I7CA 5D84A 1ID8A 3P7MA 2CV0A 1BXZA 1G3MA 2WK1A 1ILWA 1N7JA 4PF1A 4FDUA 1TD9A 4YJHA 3TJRA 4EP1A 5DW0A 2X7XA 4YP9A 1G1MA 4UEWA 3BFVA 2VRWA 2XNCA 1SJ9A 3HFSA 4ZOLA 3K7EA 4ZQHA 4BCDA 2X7JA 1KQNA 3AKCA 1DDOA 5DYWA 3OU7A 3RU7A 3PNLA 2P1ZA 5GZ3A 1YL5A 4MS1A 2Z3WA 4ZYVA 2PWPA 1OKKA 1Z0KA 1ZK3A 2FMUA 2PVCA 1FSSA 5K1ZA 1Y82A 2O2ZA 2OP1A 1GTJ1 1WD7A 1JBQA 1T4GA 3OTGA 4JKOA 1TFUA 2QORA 4IJ6A 2VDOB 4LCJA 3RM3A 2A0FA 3DFKA 4R2IA 2FDRA 2VAVA 4HC4A 5DM2A 5LZ8A 1L9XA 3T7KA 2IS6A 1MQSA 3M83A 4KZPA 3IQXA 3R40A 4QNRA 3V33A 4CMEA 4HI0E 5LP6A 2UYGA 3VAZA 2YQ4A 5C3MA 3O4RA 4MGYR 3O93A 4DFDA 2XMDA 3I2HA 5EWMA 2CXRA 3G85A 4DZRA 5CW2A 3PQ4A 2E85A 4J0JA 1JA9A 3UWSA 1KFCB 3PTZA 2QD1A 4GPIB 4XEUA 1GRQA 3BULA 4P3OA 1PQWA 3ACBA 3N6XA 4QOSA 4TV8B 3VFDA 4CM8A 4CIYA 1U2PA 3ZX4A 2M2IA 1J24A 2RBKA 3E5MA 3G1WA 1TQ8A 3S29A 3UPTA 3O8RA 1XXHB 4E4RA 4ZCMA 1HXHA 4OF4A 1HT2E 5HZHA 3W5DA 5AYVA 1GRRA 4CYMA 3PYLA 2C5HA 2R87A 1U6KA 1LBSA 2AG6A 3WXBA 2OPBA 2VUTA 5DLEA 1XZBA 1NUTA 4V0QA 1RXWA 3G2NA 3CINA 4LISA 2QVBA 1X8LA 5LUBA 4DMFA 1MB3A 1P1FA 3E2IA 1C7ZA 1M8JA 2A88A 3R6DA 3ZU3A 3QXSA 2R751 4ICIA 4JQSA 1AZTA 2FSGA 4BLTA 1RE1A 4CFSA 4Z7JA 3ZJTA 1OXXK 2VYCA 3B7GA 1YONA 1JSZA 3JVDA 3G17A 4YBRA 5EEGA 2AOWA 4W5JA 4DS3A 1E5LA 1YCFA 2Q5LA 2VBIA 2X1MA 3IVCA 3TVYA 4R6WA 3HCCA 3ELBA 3A1WA 3VMMA 3COPA 3AUFA 4OI0A 1CQPA 2GCEA 3COYA 2IW1A 1RAGA 3OUZA 5IPFA 2FE1A 3B9QA 3E9MA 3KTAB 3WOHA 4EA9A 5TX7A 1H65A 2XPCA 2KX7A 4NOJA 1DNPA 1L4YA 1NAHA 1W0JA 1M1ZA 3DOUA 4LWOA 4OHPA 3RW9A 3T6KA 2QZSA 2NVBA 3D0KA 3PRJA 1KI7A 1JEOA 4DG8A 2AQHA 1OX5A 4PYRA 3SEZA 1H93A 2DWQA 2GASA 3E7WA 1VHTA 3KHUA 4ZFNA 2CF6A 4Y2JA 1C50A 2CVZA 3TM4A 4PS1A 4KQKA 5ESXA 3ICQB 3LO8A 4CI0B 3R6WA 3MINB 4BO8A 3KEQA 5LA6F 3R7WA 5ER6A 3UFXA 3FF4A 3MG9A 5BWLA 4L9SA 4IFTA 4O4JF 4D98A 3TLBA 3TCNA 5KNDA 3QBTA 3CNBA 5AW9A 5K8VA 5CLFA 3DOJA 2QLLA 3HL0A 1F60A 3EPJA 2YV5A 1X6VA 1ZJ4A 2R9VA 2XYVA 4S1NA 1DG3A 3DLBA 2OM2A 4PHTA 2IIQA 1MOZA 1V11A 5A6SA 5HRAA 1SKYB 4EYGA 4ZA2A 1JDVA 3AETA 2G9RA 3ZS8A 5IJ9A 2MJLA 4J0DA 3C3DA 2L19A 4ZYUA 2SECE 1M2FA 3NNSA 3E9YA 3HB4X 2JJYA 2C57A 1BGWA 4BKUA 1G3QA 4R8SA 1QRRA 3GRKA 1E2UA 3FSRA 1V5FA 3PFGA 4FS3A 4KUEA 5CA1A 1MX9A 2W2LA 3ZLVA 4EO7A 5I9MA 3E5HA 3IAFA 4UMFA 3DJYA 2R8XA 3W5IA 1O8BA 4Z9YA 1LK7A 1DC7A 2C2MA 2J8ZA 2P68A 3A9VA 5DNVA 3TXXA 1PGOA 2DCMA 5C80A 1G3IA 1QONA 1T4CA 1NVKA 2MCFA 1NXPA 1EESA 1EWQA 2WUDA 3GUZA 2G3YA 2PX6A 2B7BA 2NSYA 3LYHA 4R8VA 2JBHA 2E5FA 4IIVA 4W8OA 4DARA 1A2KC 3WX0A 2QRQA 3CVJA 4AM8A 5EZYF 1X7DA 2W2NA 5NLLA 4FZRA 4QJ3A 2XRYA 1F9AA 5AKHA 3TNJA 2VYVA 1EH5A 3C87A 4REQB 1CUXA 2W93A 4DHEA 3AIKA 1Y5RA 2ZT5A 4C0JA 1JLKA 3KBOA 4F3NA 1B6SA 2WA1A 1BA2A 4G25A 4MW9A 3USZA 4C9BA 1VLVA 3M6UA 1HE1C 1M0WA 2OHFA 1RKBA 4D8YA 2WYVA 3IELA 2YXBA 1CLEA 1OAAA 2FLKA 3CTMA 2YHAA 5CEFA 1P1CA 1KWGA 1THGA 4PYMA 9MHTA 1FP4B 1EK5A 2A1UB 1RXVA 2BFOA 3S1AA 4FYWA 3BE8A 1T35A 3GJRA 3QQ5A 2I6UA 3OJOA 1LSUA 4EHJA 4QNMA 4QECA 1CVIA 2YFYA 4F7WA 4P82A 2HX1A 5JPIA 3ZGLA 3UMSA 2I87A 2IXGA 3H1FA 1KFJB 3PQEA 3R0XA 2OCYC 4LV6A 3K9NA 3UICA 3WSTA 4DCUA 2AN9A 2NO1A 2J9FB 4EA8A 2GSDA 5LWQA 5AJWA 4N82A 4A03A 4RAOA 3T5PA 3ZDQA 3ENNA 3GWZA 4TTAA 5E1DA 4N3NA 3VPFA 2OHIA 1LTKA 1OXSC 2OO3A 2JJ8A 2QP4A 4J2TA 4J4TA 4ZQCB 4MI3A 3SKYA 4B3XA 1JWBB 1U7TA 3EISA 3F6PA 3OOWA 4EGSA 4RK7A 3OPYA 1DMRA 5IAKA 3SZ3A 1N7GA 4HH0A 3F8SA 3CF4G 3RK4A 2AZXA 5NULA 1KAOA 4B6SA 2Q3FA 2Z57A 1TCAA 1U8UA 2WV9A 4KV7A 4N5LA 5DHSA 4QIHA 2B1GA 4X20A 5J43A 1RM5A 1XNRB 4V0ME 1E6MA 1GGFA 3Q0TA 4JU9A 5BXQC 1W36D 3FGPA 3UUWA 4N0MA 1F2UA 3DL2A 3BERA 3G1UA 4H3KB 2RMKA 3K0CA 5FBWB 1INLA 1I7PA 2REQB 5HIAA 2CMGA 4I08A 1T1IA 1V6SA 4WLVA 3FDJA 4KQMA 2H7YA 2VO1A 3MS2A 1S3GA 1ZD8A 1B00A 1TEHA 5FOXA 3U80A 5H5JA 4A2CA 4QFDA 3EF0A 3V4LA 4HWSA 4B47A 2P8SA 2YV1A 3QBEA 1KI1A 2BM8A 5FH9A 3OBIA 2RI6A 4EI2A 4KWIA 3ZHRA 2HF2A 1TA9A 1WCIB 3H5TA 3OTIA 2H48A 3THYA 4BBZA 1FK8A 4R0MA 1S2OA 4KVFA 1FMCA 2P6OA 3ZWMA 4ZRDA 4DQXA 5A0TA 3KLNA 5IAAA 1K7XB 5DGTA 3HB0A 1QE3A 5TEVA 3IOYA 1TAHA 3HUTA 2VDWB 3P2JA 4FX2A 1XA4A 4L15A 4QQRA 1L5LA 4B75A 5JRJA 5BOSA 1BOOA 2X77A 5LR6A 3IVAA 3M9XA 1Z62A 2V96A 5EJGA 3PVZA 1J56A 4TLDA 2WF7A 4CL8A 4UM8B 2GK3A 4FOSA 2A5JA 5DI3B 3L49A 2IKSA 2KB0A 4RCZA 2JS7A 4PAMA 4MS4B 3K8OE 3NWOA 1FX0B 4RLFA 5AKKA 5LIPA 5ILOA 3OAAA 3F9CA 1U31A 1WULS 1I30A 1X38A 2R2AA 5CFNA 3TIXB 2YXDA 1TCCA 3ZV7A 2PDAA 1LBQA 1DDGA 3H05A 4IDNA 4LJKA 5CB4F 3EOBI 5JSUA 1X7GA 2XAUA 1M0SA 3G0HA 3LUJA 2P7IA 1IU9A 5BQ3A 1NJ1A 2NSLA 2R66A 1CEYA 5BR1A 1UIMA 3OBBA 3DQZA 1Z4MA 2QK4A 1YR2A 3E82A 3EVAA 2ZBDA 3BMOB 1EXWA 5CB4A 1XMJA 4UHBA 3WL8A 4GNRA 2J5BA 2GJAA 3GI1A 4NABA 4QARA 2GPYA 3CCCA 3G8BA 1AKQA 3FXAA 3PUWA 2FSPA 1JJAA 3PNKA 4A0FA 4TGLA 1NFQA 3VJKA 4UDYX 3OZFA 3JWGA 3DZHA 3NVMB 4TMWA 2ZW9A 3SR0A 1E5XA 4YFVA 5JSQA 1IB6A 3Q3IA 4R05A 4UAJA 3A1FA 4C7MA 1FFGA 5EIFA 1F8XA 4QNNA 1QV7A 2VJOA 1XU9A 4IILA 3BHNA 4LX8A 2Y4NA 5DBEX 3ZGYA 3VKVA 2ZIFA 3EGEA 4E11A 2C0QA 2Q62A 4YLGA 5FULA 1N9GA 1O0SA 2IQ5A 4QQFA 4XIYA 1FFXA 4YAKA 1C3LA 5TY0A 5FLKA 4GEKA 5CAEB 3AEQA 4OHVA 1NC1A 4N7BA 3WK7A 3F5FA 1YR6A 1ANKA 4K8RB 1YIOA 4YUVA 3HCRA 1MX1A 5A3SA 3OEEA 5FFNA 4ETWA 4KPYA 1GZDA 5AHOA 3VPBA 2NYRA 2PQ2A 4MW1A 2RHRA 1UDRA 5EKTA 3NUQA 4Y0VA 4WASA 4ASUD 4HFNA 4LQCA 3TW8A 4FB5A 2AYZA 3T9DA 5JVDF 4UNQA 1Q16A 1XPOA 4JC4A 1G4AE 3LFUA 3AG6A 1XXHE 4FJ2A 2GWRA 3O3OB 3IVXA 4JC0A 3PIRA 2Q5HA 2FWIA 1PJZA 1O6GA 3NNDA 4EKYA 2P6MA 1KYYA 3C3AA 4K9NA 1VHDA 5I4BA 3EBLA 4B1FA 2Z09A 3L82B 2H0QA 1JMVA 1D2HA 1TUIA 3LH5A 3AUKA 1S9HA 4IIUA 3I2IA 2GTPA 3PA8A 3ZTTA 4OK5A 4ZYTA 1X14A 2C1XA 4IVQA 3IIKA 5KSPA 3HGMA 5JFTA 2X4GA 4DNPA 3KOUA 2I8CA 1VCNA 3ILVA 4OYHA 2G77B 2KQUA 1A5AB 2O3UA 3PXAA 4IXDA 3TD2A 3OFND 4EUSA 3O1JC 4FYMA 1GFWA 4LFBB 2J9RA 3I9V6 4II3A 4RPKA 5CVVA 2WTUA 2ACVA 2YC2C 2VYFA 4R40A 4BY9E 4KNWA 2JGJA 4WZBA 2C07A 1JS1X 1GV0A 1ZN9A 3IFSA 3C4JA 2HIMA 3OU2A 2G0NA 3TFQA 4NE9A 1E62A 3KD3A 3G8AA 3PDIA 2DY0A 1A9QA 3OPMA 1KARA 2ZRAA 3SJ7A 4V03A 2IY9A 4LK2A 1WXHA 2NZ2A 2BF4A 3IHWA 5AM4A 4UUBA 1XDZA 1R0YA 1M2VB 2VHZA 4RMIA 1EP2B 3AR2A 3ESYA 5LQNA 2C5LA 5FR1A 2C9YA 2PXHA 1GG8A 3GPDG 2I4LA 4GL4A 2CXNA 2QRLA 3BFPA 3SXJA 1JAIA 2ZI3A 1P91A 3CKKA 3WLHA 1IPEA 4RHEA 3G5LA 5D51S 3GJSA 2UXBB 2HN9A 3O9ZA 1OR8A 4H6XA 4BFWA 3ER8A 4LF9B 1UMCB 2ZJ3A 2YVLA 3DCJA 4ZJUA 4IYRA 1CVRA 4MV0A 4R7TA 4Q39A 2RI1A 4YCSA 1EP9A 1NXXA 1WUTA 1ZIOA 2QUIA 1C2YA 2QX9A 4KU4A 5F1KA 4QXRA 3TSOA 4HX2A 1GHTA 3OKAA 1U98A 2R6GA 4XR9A 5BOVA 3Q7IA 3QE9Y 1JDTA 1DG1G 1NF2A 4E6EA 5EL0A 4BNMA 2XUOA 2O5VA 1DJMA 2ZUFA 3TZQA 2QYOA 1GFIA 1XMOB 3HJBA 4NYMQ 2Q3HA 3I23A 4KHPB 2AL7A 5FPPA 5TPWA 5FXMA 1O9HA 3H7IA 3TRKA 3WQHA 4ARSA 5CLQA 2APJA 4Q5IA 3U4GA 4UREA 1XQ1A 4U7WA 4TX1A 1F7VA 4HAUA 2BEVA 2HA4A 3N2GB 5HJEA 5JCJD 5JR3A 3OC6A 3V6MA 3AEZA 3QE2A 4B3IA 4C6RA 2QN7A 4URFA 1IHPA 1RJWA 1Y42X 3CZPA 3IOMA 4QPCA 4U3JB 3AVQA 5FQNA 2Y8EA 1QYCA 1YCDA 3ZXSA 3EFBA 4D9JA 1D5WA 1WF3A 1RM0A 3P0RA 2JCSA 3S1SA 1GT91 1U3VA 2ENWA 1Z37A 3FAKA 2WY2D 1CU1A 4QOGA 2CK3A 4EW2A 3ERCA 3FTFA 4W99A 2YDYA 1CUVA 1OE0A 1WLSA 2B1RA 4TMYA 4BRWA 3OPQA 4FFBB 4NFSA 2HNAA 1XRSB 1GPBA 2WZBA 3F5SA 3KQWA 5IJ0B 4CL0A 3C3BA 2XYRA 2HQOA 4R7GA 3HBNA 2BMDA 1ZUWA 1QGED 2RB4A 1E69A 5IZCC 4KYVA 1HNWB 2XEXA 1Z16A 2CMHA 3WBFA 3EC1A 1G19A 1I7QB 4XWYA 3TG8A 1SUFA 1QOZA 2GTHA 3PFCA 1W44A 5A6SB 3KSUA 5EPEA 1KK3A 1A7AA 3DXXA 2Z1NA 4RSRA 2O6HA 2CDNA 3LUKA 4ZT6A 1P1BA 4KN8A 1ZVVA 3B53X 5D01A 5H59A 4IMRA 4G24A 2IP4A 2BIFA 4P4SB 3KAJA 4LJSA 1C30A 3UHAA 4F86A 2NU8B 1X7ZA 2QPOA 3EARA 3LMKA 4CIAA 1OGJA 3VO1A 3OCWA 5ULLA 5H7XA 4ZGWA 2ZSBA 3V8PA 3TPCA 4QXMA 3OJXA 4D0NA 2N1BA 1V71A 4MR8B 5EXEA 3LZDA 1XV5A 1JH8A 1VCOA 4UTPA 4EIWA 1ECGA 3X1ZA 4EZEA 3EXIA 1FXSA 1JP7A 2HJRA 1NXQA 5PNTA 4BAUA 4IX1A 4PYLA 5HCUA 3KQKA 4KO4S 1B14A 4JEHA 1NURA 4PSVA 1TLLA 1UBNA 2F9LA 5DF1A 1CIPA 4PZDA 4BGDA 3RK0A 4LN1A 1OROA 1TC2A 2DHRA 2X8BA 4R83A 5KYNA 3ZDBA 1O94C 3OIUA 1FLVA 1TMGE 3OAAD 1UOPA 5B1DA 4QU9A 3RK1A 1FW6A 2VSNA 4M87A 2P2SA 3LKBA 1GPLA 3N75A 5A3RA 5JMOA 3VNUA 2D59A 4C0AC 2CLOB 3LHDA 1PZEA 3QFSA 4WY2A 4JI8B 3HTXA 5HE9A 1KDYA 3SQNA 4FIDA 3OE4A 3ANYB 1BDMA 4EYKA 5A04A 4D9GA 1R3UA 2J3LA 2C4HA 4DCCA 3DG9A 1XZEA 4ZJPA 2QZ9A 5AJTA 1TE2A 4K2AA 2QTTA 1ACMA 1LF0A 2BGTA 2V45A 3WJ2A 4YAIA 2FVXA 4N39A 4NZPA 2ARKA 4KC0A 3N86A 3ISVA 4OKIA 3S1AB 4YDRA 1JFFA 2QTWB 1U02A 3CSUA 1Y6ZA 3O95A 4XAQA 1F4LA 3MCUA 4ALIA 5FPKA 1KMQA 4RD1A 1TEXA 2OLJA 4MRNA 4MW5A 5F2EA 2X13A 1XGKA 1AK1A 3PX2A 1FQWA 2CYCA 2EKDA 2FN9A 3E61A 1OBCA 4QT4A 1UAGA 2FPWA 3V4PB 3E9ZA 1SA0A 2J9FA 1JI0A 2IUYA 1XN1A 2G28A 4BVJA 4FYPA 2C4KA 3LT1A 3C8DA 4J9UE 3ZQ6A 3R41A 2OUIA 4FI3F 2ZG6A 2D1FA 2GDZA 3W5AA 2K2WA 3CLTD 3W4JA 2C1ZA 3PGJA 4BJ6A 2QPTA 1EEXB 3KSAC 1Z6PA 2GYVA 2V0GA 3FJ1A 2AN3A 4CEIB 2ZE8A 1TM4E 1H23A 3HCPA 3QW4B 4K87A 4NCKA 2A14A 2H8KA 4YX9A 2O14A 3FTEA 4DPLA 1P74A 4ZMSA 4C04A 1H8HA 3N2KB 5DPMA 5G3YA 1C9KA 1ZP6A 3P19A 1DINA 1UINA 1O58A 2F3QA 3BWMA 4RFSB 4UNSA 5K0FA 3BPSA 4M1QA 3RTDA 4PZAA 5FL7D 3QE0A 3BRCA 3KYDA 4YCNA 1AOXA 5KVCA 4PHHA 4RKFA 3ZDEA 4B3FX 2X4DA 4C4SA 4ZI7B 4OQXA 4ID3A 1MX5A 2VQ6A 2YUTA 2IEAA 1RYHA 1CX9B 3RIMA 2FMIA 4NZMA 3IE1A 1U7UA 3WNZA 2DM6A 3KKOA 4RPCA 5CVEA 1VG0B 3K92A 4DQUA 4KHZA 4WZAA 5LD2C 5LLDA 2HJGA 1SR8A 4X90A 4M36A 4AO7A 4TOIA 4ATNA 2CXOA 2LDBA 3JXEA 1BXKA 4D57A 1QKIA 3PC2A 4MV3A 4ZALA 5EP3A 3J80A 4C2UA 4U2KA 2IXFA 1LV8A 3ELWA 3FYDA 5AVKA 3RHFA 2R25B 3QUBA 3DYVA 1NQTA 1HFKA 4EELA 4YDHB 1ZL0A 1U0EA 2JHFA 5ICCA 3KUUA 4AG5A 3LF2A 1GZ3A 1A7UA 2WF6A 1DTWB 5JI2E 4PAQA 2FG5A 2DTEA 3NRJA 1E99A 1FNBA 3AFNA 2XVMA 4ZO4A 5G53C 5CHEA 1MG5A 3OCXA 1OD6A 3DQQA 2OD2A 3M70A 1PJBA 4DSUA 2EX0A 2P77A 1TYZA 3DT6A 1H6BA 1P1JA 4JQYA 3HYLA 2QENA 3T94A 1JFTA 4MWCA 4YJ3A 3AR8A 3G8DA 1Z7WA 2FPLA 4X84A 1DRJA 1JKIA 4PIPA 1EU1A 2CD9A 3NBXX 2GSWA 5GV8A 3PU6A 4EHFA 4BV2A 3H0EA 1NNI1 2Z2YA 2HA7A 3L1IA 2IYEA 4M89A 1UDWA 4BX2A 4TS3A 3ICVA 4RIGA 1OAKA 2VNHA 1BDJA 4BOYA 3WGIA 2REXB 4DKJA 3RV3A 3V4RA 4Q9HA 3LA8A 4XGQA 1TTQB 3SBXA 3N2EA 3NHWA 5E2AA 4KWHA 5AK5A 4YRJA 4HV4A 5LPNA 1SQGA 2LNDA 2O57A 4BB0A 4QGSA 2G88A 5ITZB 1YVUA 2GBCA 2Y92A 3ITEA 4QOEA 1YRYE 3DHVA 5JJCA 3N6RA 1B2RA 1TGVA 2G80A 1AQUA 1V4BA 1YRLA 1DBQA 4Y2QA 3P9YA 1KYXA 2FQWA 2NSDA 1FUUA 3NJ8A 3Q88A 5CEEA 4RTSA 1CR1A 1XU4A 2VATA 4R9VA 3SFVA 4O63O 2W2KA 4DCOA 3GLGA 4Q9JA 3HFRA 3H1AA 4O25A 4V3BA 1B43A 1OY1A 3P0EA 2WAMA 2Q0SA 5HQ3B 2PUDA 1IOZA 3KFXA 3ZE7A 3U9LA 1XEXA 1NQXA 2BLLA 1A71A 2EJUA 2VJPA 3CY6A 1T3GA 1O96A 3ND5A 1JLLB 1UOEA 4IV0A 3VVLA 1JJBA 1MO3A 4UCWA 2WJWA 3IL2A 4PZ9A 4S3MA 1NE7A 3ZHSA 1PI3A 2OHGA 2W2LD 1RQPA 3CLVA 4QAQA 2VP0A 4XX0A 2QMOA 2NOAA 3MJSA 2ZUBA 4N0DA 2AIRA 3RRBA 4DV1B 1RLJA 1EFAA 4Q02A 3JQEA 2F1IA 2GYYA 4UHDA 2W0MA 4N1AA 1SO8A 4M0EA 1CRQA 4GW3A 1VJ5A 4FMDB 5DK4A 1VECA 4JLPA 4ZQIA 7GPBA 2XODA 4YPVA 1SHLA 2NNLD 4EJSA 1P2SA 1K08A 2EU8A 2YIDA 1G8JA 2H1LA 1HWYA 2WP0A 1UH5A 2LCFA 7REQA 3F0TA 2IPNA 3CPSA 3MT9A 3PJDA 3SYLA 3U3RA 5K0TA 4UAUA 3W04A 3GD5A 4W1SA 4PZ0A 4XVHA 3ROKA 1W5TA 4BBAA 2EEPA 1ORVA 1QZTA 3OZTA 4JEUA 4Z6KA 4DA4A 2XTZA 4JWTA 3PGA1 3KKLA 4PR3A 4YGYA 4M1YA 2BR3A 3DEJA 3LYAA 4NENA 2DBRA 1D6JA 1SVSA 2OLKA 1ZISA 3QLVC 4YAWA 421PA 1N1MA 3O2QB 1Z6TA 2B1JA 5HK8A 2DGDA 3BAFA 1QGYA 3NAMA 1OI7A 1ONSA 2COUA 3AR7A 4OBBA 1GITA 1UCFA 2XZLA 4Q9LA 5ENDA 2X76A 5ECWA 3WKEA 4QTYA 4DB2A 2M32A 4FDAA 3ZI0A 2C82A 2PMFA 3PX3A 4DYVA 1BDBA 3VC3A 5KYXA 4RZ3A 3KKNA 5EVJA 4O0LA 4OYYA 5FI0B 4H6WA 5GQSA 2FZWA 2HNKA 3Q8WA 3U3XA 1FNMA 4JHXA 3GA7A 1J1ZA 1T3TA 2ERYA 1S2NA 1NI5A 1VPTA 1OPXA 4WTOA 2FWBA 3JZFA 3FGZA 3PR3A 2ZBVA 3H18A 3I0ZA 2I71A 4IOJA 2QTCA 2F1OA 3TIVA 3ZZUA 1F1JA 2OZKA 3RRXA 3UFBA 4CBVA 3U7GA 3TF5A 3IHKA 2EGHA 1T5LA 2FEAA 4BO9A 1B6RA 3O38A 5DTQA 2A0UA 1MIHA 4ZVKA 1TPYA 4D3DA 4M0LA 3GJZA 3IVRA 5EESA 3ZCQA 3FY4A 2VDVE 4P4UA 2V8OA 4ALNA 1XZDA 1NW5A 3OICA 5KWVA 3GGSA 1I2DA 1Q17A 3D3QA 4OK3A 5DCUA 5FA5A 1TL7C 3K20A 4DV0B 4GVXA 3U1BA 4RQAA 1P7YA 4Y98A 2YWBA 4W9NA 3NR2A 3SEAA 2B25A 4KFRA 3NWJA 1JSXA 3KC2A 3WNVA 4E14A 4CEHA 5FR2A 3S2UA 3K2IA 3RR2A 1OC4A 3OTOB 3WFZA 2GZRA 4DMRA 2WU8A 1Q0UA 2GERA 4TL8A 1T43A 2H17A 3JASB 5EQTA 5KBYA 3I0NA 4MEJA 2QU7A 4DHWA 3QNUA 2GBLA 4EI8A 2BYTA 3B36A 4R2WA 4CGZA 4NF2A 2H4YA 2NP7A 4JBGA 4PCUA 4E5KA 3HBFA 1NR1A 2POCA 2VKTA 5KHAA 3VQTA 2Q5EA 3OQVA 1QTRA 1RXUA 5CMLA 3G2OA 2X1VA 4WFKA 3EULA 1SCDA 2BEWA 2GFIA 1BWSA 3WB9A 3VC2A 4KPEC 1RYNA 1ZFNA 2X8JA 4K05A 4JLOA 3S5UA 4GX2A 4L57A 3MQFA 4IHJF 4NYJR 4OX9B 1GTVA 4IR7A 3P45A 3CUKA 3ZE9A 3UMYA 3BWEA 4AU1A 5AVJA 3GCXA 3IAS6 3SQOA 4D8TA 1XUOA 5A02A 3G79A 3KZKA 2V97A 4Q7JB 4X1IB 1C9JA 4OLFA 1RC8A 1PSDA 3PNSA 3VNQA 5K8UA 2J0QA 3NYRA 2Q4TA 4FB4A 4IL5A 5BMVB 3HB1A 3EQ8A 3HYSA 1CY6A 2I67A 1YXMA 1UP4A 1C14A 1I13A 1X3LA 3LKZA 5DNYB 4B3TB 1XZAA 2YXEA 5DYTA 1QRDA 2B8WA 2PRJA 1OXVA 1WSDA 1H05A 2O8EA 4MB0A 2NPOA 4LVOA 2CMDA 2ZSFA 1P45A 4DLLA 1A50B 1ZMBA 2PSEA 5MF6A 4G81A 3F5QA 2AI1A 4DLUA 4OH1A 1G6OA 2OCGA 2ZDQA 3IKMB 3FI0A 5A4FS 4D5GA 2NTVA 1YDHA 1URPA 3RSQA 821PA 4UHFA 2XA1A 4MPRA 5LQJA 3GAFA 3DP9A 3FFWA 3NEPX 3ND8A 5JDIA 1IC6A 3LK6A 3PR2B 2RGNC 5IKEA 1XDBA 1M2GA 1TF7A 1W93A 4R31A 3K8ZA 1YMUA 1T2NA 4JLVA 2NU8A 3JYOA 1WOMA 1UBUS 5EXSA 1X7WA 3QFFA 2QW1A 1F3OA 3LWNA 1E2NA 2BBOA 1FA9A 1E4EA 4HDRB 2C3YA 3K6RA 4BO6A 4ZN6A 1W88A 1X1BA 2QRMA 1I1HA 4NK4A 1Y3HA 5F51A 5SYMA 1ZI9A 3I6IA 2XUHA 2WABA 1NUSA 4LJ9A 4RE6A 3OE1A 3BTSA 4JI5B 4X41A 4E2XA 3IQIX 3PNYA 3ZZMA 2HXGA 4C0QC 5B4VA 1DQRA 4YJGA 3SOZA 4BJ1A 1A5BB 3CZAA 4FYXA 4PX5A 3A2NA 2NX2A 1PWZA 4N5NA 4Q66C 5F21A 5F4BA 4D41A 8LDHA 3P4UA 1YGYA 3AFHA 4AJLA 5AVVA 4DWOA 2QT9A 2GNAA 4PGFA 2NPIA 2PA0A 3IHLA 1E3QA 1I6MA 3D8RA 3HMKA 3S2ZA 4UU1A 1GSIA 2KBEA 3IXLA 1EFDN 3PQ2A 3RTAA 3FVQA 4B80A 1RDFA 1V9SA 3C7TA 3GBPA 3I01M 2EYQA 5EJ4A 5TGTA 3UOWA 2QZ4A 1G21E 2WJGA 1BMQA 3QMMA 3PPWA 3BSFA 2BSAA 4H08A 1BXGA 2J6IA 3VO9A 1CB7A 4MIOA 4AURA 4ZDJA 5C18A 1ZEMA 4LHYA 1O5OA 1UK9A 1Y5NA 3ETJA 3PGLA 5IC5A 3STTA 4C1NA 3G5TA 1RXCA 3HKCB 4OQNA 1FZQA 2BUAA 1JR2A 3GEGA 1SKYE 2B30A 1B3BA 3KPWA 4J6FA 1BEUB 4JT4A 3DH0A 5BPHA 5CA0F 2H08A 3SOPA 5J63A 3QV1A 5HF6A 3IO5A 5JWOA 1VXOA 1JHUA 1E0AA 1QGAA 1HEUA 4ZU6X 5JMWA 1DXYA 2XDAA 2QE6A 3AERB 5HCIA 2AWOA 3LE8A 4EEZA 4C21A 3ET4A 3UAXA 1B8NA 3IIJA 1D2GA 3S2YA 1YR3A 1T91A 1VL6A 2OO7A 2COEA 1Q1EA 1XJCA 3W8DA 1CY0A 1L8LA 1XQXA 1N8TA 2RK4A 2P9CA 3E5RA 1OZAA 4O8ZA 1NX9A 2F1JA 2W90A 1U0TA 3WLRA 4ZO9A 3M3HA 4QFCA 3BXFA 3CUUA 1DBPA 4IQGA 3C98A 2VNKA 2O5EA 4BX8A 4C0WA 5HM6A 3KXPA 2JD0A 3N2KA 3WAJA 1A5SB 1B7GO 3SX2A 1NBHA 5A1JA 5JD4A 1GGJA 2O8DA 5CFOA 1KEZA 2EW1A 1DQPA 3URKA 1K8QA 3G5AA 3HH8A 2ZITA 4GAEA 1JTFA 1ZD9A 4J0GA 1KP9A 2E6KA 5E9AA 4BU1A 1IHDA 3RU3A 5HM8A 4D8VA 4IFBA 1OU4A 2PT9A 4OB8A 2I91A 1IVNA 5FHQA 2XGJA 1C7QA 4KDEA 3VTAA 1FDRA 5IBPA 2IH4A 5HKLA 4M54A 4NNJA 4N3BA 4DEYA 5KYKA 1YJBA 1BE8A 1W2HA 5C8VA 3AK4A 1ISFA 2F4VB 1IH8A 1JEAA 3AEKB 5TMDA 4ZGGA 3QZUA 4RLHA 1OFTA 3G68A 4OQ4A 2WKRA 4JUFA 4XWOA 2Q0XA 4LOLA 3A1VA 3CF4A 3MWFA 4CLRA 3ZOKA 1F06A 1G64A 4BNHA 1TZJA 3VDMA 1SOMA 4QUAA 2X23A 5EWMB 3U6BA 4U7DA 1M75A 1T8WA 2VC2B 1R5NA 3MPUA 3WSVA 2A86A 2BHRA 5KTYA 2GZ3A 2VG8A 2GMWA 1VE7A 1M1NA 2QL7A 4E1BA 3FOZA 4OJNA 2GCNA 2ZRNA 3H9BA 4V0KA 1AQLA 1AKRA 1T26A 4MAAA 3LDHA 4FWIB 5BMVF 5I7SA 4OBWA 5LQRA 1I4DD 1GA6A 5IFKA 1ZZEA 2B94A 4MCIA 1QSGA 1ZJ5A 2P5TB 3KO8A 3QWAA 4MJLA 1JQ3A 1E89A 4XDZA 1APBA 1H2YA 2OCBA 1K3TA 2OTCA 1VXRA 2WVGA 4G8BA 4KIGA 3HBAA 4QRDA 3HJNA 3KRTA 4P4NA 1V5GA 3R09A 1NQWA 3K6KA 3AEXA 4I5GA 4BLQA 1AURA 4EAQA 1NZDA 4L4YA 4F1WA 4REMA 3PPXA 1CS0B 3RJMA 2GK4A 3SR3A 4ERNA 3NIGB 3T7JA 3E5NA 4R98A 5TS3A 2HRQA 4LF7B 1O54A 3OEED 3GG2A 2Z9CA 5KX5F 3DWFA 4JDUA 1LK5A 1UFVA 1VKNA 2KW5A 2Y6VA 2PH1A 2ZEJA 3JWJA 3QPCA 1K7EB 2IX3A 3OQBA 1NIJA 4GHWA 2XUQA 4RQUA 1WOYA 5LB4A 2WC1A 1HMPA 3NASA 1P39A 3DVQX 3VYWA 1QQ7A 3O9VA 2ANCA 5AVTA 2PLRA 2OBLA 4ML3A 1K63A 3KELA 5B37A 2PL1A 5ICGA 1ZIDA 4TT3A 4TV9B 4BX0A 2GZDA 5FOTA 3I6QA 3M9WA 2XE7A 3PQ6A 4MI6A 1DADA 1MENA 4JUDX 2O2JA 4YLYA 2QJWA 4NJMA 3QFCA 4DVJA 2P9QA 2OL4A 2VTVA 3FFTA 4H7HA 4WACA 5THQA 1O96B 4HQ6A 4BLPA 4Z9XA 2ZIEA 4MOWA 4BECA 3W7AA 1O08A 3QTTA 3DMTC 4AIIA 5EHNA 1QG6A 1G3UA 2VAXA 3FSEA 3UAOA 4Q4HA 3MBKA 2BGUA 4JJIA 5ERXA 3ZXXA 2OXEA 2GRAA 2Z9BA 4W8HA 4CMBA 3BD9A 1SZJG 2YBEA 3M2PA 1UBGA 2ZRLA 3IAS1 1SBQA 2EWMA 1XTIA 2OHVA 3OEHD 4RC9A 3VSEA 3VSCA 1LSJA 1G8AA 1GKLA 1QFXA 3A1NA 4XEHA 1J2RA 4FBMA 3Q7TA 3M8KA 1R0ZA 3NC0C 3T9CA 4AKEA 2CJWB 2OG1A 4LJAA 3DMGA 3GOQA 4PSUA 5F33A 2IYXA 4MRPA 4OA8A 4EI7A 3U37A 4UOZA 4GOJA 2DULA 7REQB 1VGRA 3HCNA 3H83A 1J8FA 3IEPA 3Q15C 4EY7A 3UHFA 2DP4E 5LDDC 2VNJA 1MTZA 1PJ8A 1BE0A 2AJTA 3CVUA 2FMHA 5DLPA 4W7IA 4NENB 4E08A 1JKFA 4MQ5A 4LOIA 4P0TA 3NORA 3GQBB 4UM9D 3PFKA 5IJAA 2KPOA 4P9NA 1WP9A 3V1UA 5AI8A 3L4KA 1EJ6A 5D5PA 2EEZA 3P2IA 4Z54A 4L51A 4I1PA 2YJTD 4C2TA 4P34A 1KJQA 3ZZ0A 3PFBA 4H18A 5DCYA 1RM3A 1Z25A 3ND7A 4R69A 1J0DA 1R6UA 2FWNA 1DKPA 2XUDA 3ORRA 4KDRA 1YVEI 3OQOA 1Z8FA 3H3FA 3NAGA 1ZD3A 3WRYC 2I2BA 3CONA 3LX4A 2PFGA 5MN6A 5C81A 2PV7A 3QITA 4DR3B 2OXFA 4ND8A 2V1UA 3AY0A 1N5KA 1R1DA 1WXEA 5BSUA 1C8LA 1UBMS 3DZGA 1WB5A 2B9VA 1ONBA 1MB2A 3T5DA 1RHUA 1P77A 1QXSA 1SXJD 3KWLA 3PEFA 4OIMA 5ALJA 4CKXA 3NVKI 1MXFA 4KACA 4QUBA 1KYVA 2ABWA 5EIOA 1JPUA 2FRXA 2YYZA 1E0SA 1TYDE 3EG5A 5D5QA 4L28A 4YS6A 3FKSA 1E3JA 1Q19A 1VIMA 2ZYAA 3WYAA 3L5KA 4RL4A 4O2LA 3W6PA 1IN4A 4YMGA 1IXRC 4JCCA 2O48X 5ADVA 1Y7IA 2ETVA 2FUNB 2RJ3A 3ESCA 4HLUC 4Y2GA 3WRWA 2ZSKA 5L6LB 4LV5B 4CEHB 1M2KA 4EA6A 3A14A 2AG5A 2VUUA 5AO9A 5TPZD 2VYQA 3SZLA 1NNUA 3OX1A 2VNSA 4XW2A 1Z0AA 1IPHA 1FFBA 2WWGA 3WGLA 1NI4A 1DKMA 1OV6A 1M5TA 4M7WA 4MRVA 4X71A 1JV2B 2OXRA 3LIIA 1L7QA 1ESMA 2H0AA 1LRKA 4F2GA 3NV9A 4MGIR 1ZH2A 3PF9A 2I9KA 5AXCA 1Z4QA 1JR4A 2V0NA 1TUBB 3U39A 4MR9B 3ZDRA 4QSHA 3PWTA 3O6VA 4M2LA 3ZHCA 1UBRS 1E3SA 4GXRA 2Y67A 3LKDA 1PLJA 4B46A 3SEQA 4BWYA 2E89A 3UPUA 2PCJA 4QQNA 3U3KA 3S7TA 1GZ5A 3TKAA 4S2EA 2G63A 3NAQA 5IHPA 3I62A 2AB0A 3BJMA 3PD7A 2FLWA 3JD1A 4RA9B 5IJXA 3ZVLA 1S89A 3I37X 5EUCA 5K3EA 3R3VA 4RH1A 1PNVA 2EKBA 2HPHA 1VHWA 3OJ0A 1PG2A 4AJOA 3D1JA 4KAJA 2YMMA 4EUNA 2ZP1A 3RYCB 2FNAA 4CLOB 4X8MA 5EGSA 5BMVA 1LSOA 3GBSA 1F8UA 4W7HA 2D0IA 1JEQB 2JCGA 2SNIE 3STVA 5IXYA 5IEBA 4XH9B 4FEEA 5ISMA 2FN7A 4FVTA 5L3QA 4MA4A 1SKUA 2EP8A 2YTZA 5K4HA 3PFIA 2D5CA 1Q7TA 2NZ8A 2VWQA 3UB3A 5CITA 1QH9A 1L4HA 1Y1SA 4B6JA 5K05A 3T7CA 1NXWA 3JQGA 2QN3A 3M5PA 3QQPA 4L7QA 4HJXA 4RZSA 5KINB 1W96A 2H9YA 1SU4A 1QFJA 1FFCA 1T1SA 3LGXA 1NDUA 3EPKA 3EE6A 2GPNA 3IEIA 3JQCA 3V7WA 1W52X 4FYYA