1QGAA

Pea fnr y308w mutant in complex with nadp+
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
308
structure length
308
Chain Sequence
b'QVTTEAPAKVVKHSKKQDENIVVNKFKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGEVPYREGQSIGIVPDGIDKNGKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVYTNDAGEVVKGVCSNFLCDLKPGSEVKITGPVGKEMLMPKDPNATVIMLGTGTGIAPFRSFLWKMFFEKHEDYQFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPENFRLDFAVSREQVNDKGEKMYIQTRMAQYAEELWELLKKDNTFVYMCGLKGMEKGIDDIMVSLAAKDGIDWIEYKRTLKKAEQWNVEVW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FERREDOXIN:NADP+ REDUCTASE)
publication title A productive NADP+ binding mode of ferredoxin-NADP+ reductase revealed by protein engineering and crystallographic studies.
pubmed doi rcsb
source organism Pisum sativum
molecule tags Oxidoreductase
total genus 94
structure length 308
sequence length 308
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1999-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1qgaA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1qgaA02
4C0SA 1NJID 5EMNA 1ZM9A 2E1RA 1GVHA 3U6BA 1N8RD 2FX3A 3CMEB 2BSAA 2BV3A 1E64A 3AGPA 3OJXA 1UMKA 4AC9A 5H59A 4G1BA 3AVXA 3WY9A 1GJRA 2XNCA 3CB4A 3G71B 4RD0A 4TMZA 1FRNA 1KTVA 5HXBA 1OB5A 4Y9UA 2EFGA 4RD4A 1M90D 3VO1A 1W87A 4J0QA 4RD1A 2DETA 2B5OA 2C77A 2B7BA 4B4DA 1YJWB 3CCUB 4ZCLA 2QDXA 3FPKA 4BPRA 1M1KD 1GR1A 1EP2B 3AVYA 4ZGQB 3AVVA 1EFTA 1BX0A 4PC2A 3QFRA 3W5VA 4PC6A 4YAFA 1F20A 4PC1A 1FRQA 1VQ8B 1ZM4A 1G7CA 1OGJA 2BGIA 4WQMA 2DERA 3QFCA 1Q86D 4LBWA 2HMAA 3CXCB 3MHPA 3AGQA 1SKQA 1XB2A 4YALA 2DCUA 4PGOA 4HE6A 4B44A 1QFYA 4R71A 4M2LA 4N3GA 2BN4A 2VNIA 1VQ7B 4Y7CA 3W2EA 3SJZA 2R6HA 1QH0A 2VNHA 4LBYA 4ZV4A 2OK7A 1GAWA 3OJWA 3CCEB 1BX1A 3I55B 4RJLA 1H42A 1E62A 1FDRA 4FK8A 4LBVA 3JQPA 4FWTA 4M0LA 1QFJA 3CCMB 1YJNB 2BVNA 1A8PA 2EIXA 5AN9A 1ELOA 1EWYA 1B23P 3J81k 2HCJB 1K73D 1YI2B 1FNDA 4ZCMA 1VQNB 1TLLA 3E1YE 3CW2A 3WBKA 1OGIA 3ZZ0A 1KD1D 2J7KA 3WNBA 3I1FA 1SM4A 3OZWA 3WBJA 2OK8A 1D2EA 1TTTA 3VNVA 1S72B 1ZM2A 3JQRA 1CQXA 4EH1A 2D74A 3LO8A 4B48A 4QHYA 3P26A 2X3UA 4Y9RA 5THXA 3W2FA 1YIJB 2RC6A 1R5BA 1IJEA 4DQLA 4ZCIA 4N3NA 4LBZA 5JBQA 3PENA 1QGAA 4P6VF 1KK1A 1VQOB 3B82A 1GAQA 3CRZA 4ACBA 1S0UA 2PMDA 3W2IA 4M53A 4HE5A 1XE1A 2BM1A 2YWFA 2QTZA 4MYUA 3W2GA 3AVTA 1KJZA 1VQLB 2GQFA 2YWHA 1YHQB 1DDIA 3MMPA 4G1VA 2VNJA 3W2HA 2VNKA 3U6KA 4P3YA 1EP1B 1EFUA 4Q7JB 2QA4B 1W35A 1ZM3A 2RC5A 1QUFA 3QFTA 1YJ9B 3VNUA 3ZZTA 3AVUA 3CCSB 3CCQB 2BGJA 1QG0A 3CMAB 3CC7B 3I56B 2PLFA 1H85A 4TMVA 1VQ5B 3WNCA 2CNDA 3MCAA 4DQKA 1VQ6B 1R5NA 1KK0A 2GPJA 1J9ZA 1KC8D 1D1NA 1VQKB 4YAWA 3QSYA 4RD6A 3CPWB 1F60A 1ZUNB 3U2QA 1CNEA 1K9MD 1G7SA 4F7DA 2XEXA 1HA3A 3QE2A 3G6EB 1AIPA 3W5HA 4UAJA 1FNBA 1I7PA 4RD2A 3A1FA 1QUEA 2YWEA 3WXMA 3QFSA 3OZUA 2C78A 3CCVB 3JQQA 2BF4A 3G4SB 3B8HA 1QGZA 1VQ9B 4M1KA 1NDHA 1D8TA 4FN5A 3OW2B 4C43A 1N0VC 1KK3A 1W34A 1W2BB 3V76A 4YAOA 2QTLA 2VZLA 2OTJB 1VQ4B 1WDTA 1R5OA 1JJ2B 4U9UA 2B7CA 1EP3B 1KQSB 2QMUA 4B3XA 4K1XA 2BPOA 5TV2A 1QVFB 3CCRB 1OB2A 3E20A 2OTLB 5KSWB 3CC4B 4TMWA 1TVCA 3CD6B 4NBSA 3ZBTA 1G7RA 4H9GA 1EXMA 3WNDA 2PIAA 3CCJB 1FNCA 4MYTA 1IB0A 4RCZA 1N0UA 2NPFA 2QN6A 4RD3A 4G5GA 4IW3B 2BM0A 1TUIA 2XNJA 1QGYA 4TMTA 1KRHA 2CRVA 5FA6A 1BJKA 3ZBUA 3LRXA 3CCLB 1B2RA 4LC0A 4ZGNB 4M4SA 4NCNA 3W5UA 1E63A 5TR9A 1EFCA 4ACAA 1DDGA 2HDNB 3WYAA 2ZITA 1KK2A 1JNYA 1DARA 1QFZA 2AHOA 5DSZA 1Q7YD 1CNFA 4YAUA 3VMFA 3AVWA 1QVGB 4TN1A 4AF6A 2VYQA 2DEUA 1JA0A 4QFMA 4RCYA 2QEXB 1BQEA 3ZC3A 3FJOA 4YHBA 1U2RA 1JA1A 4PC7A 1YITB 3LYUA 3P27A 5H5JA 5GV8A 3OZVA 1GO2A 1Q82D 1IJFA 3CC2B 1QX4A 3ES9A 1Q81D 1FNMA 3LVBA 4TMXA 3ZZUA 1DG1G 1VQMB 2BMWA 1JB9A 5GV7A 4B43A 1AMOA 2DY1A 1K8AD 4PC3A 1G7TA 3B78A 4AF7A 4B47A 5TY0A 3VO2A 2YWGA 1VQPB
chains in the Genus database with same CATH superfamily
1EDZA 2GRAA 5E8RA 1YNSA 3V1LA 4B8YA 1XQ6A 4HI0E 1XOIA 4PSDA 3IOCA 4PR0A 2VLIA 3HG7A 5EA2A 1ZM9A 2G1UA 4QUIA 3DOCA 3DXYA 5KNDA 3DTVA 4X20B 2FX3A 4GOMD 4KU4A 5GJCA 2BM9A 1BS9A 4HFMA 2Z5FA 1R9MA 1WSWA 3FGNA 3FYHA 1L4KA 1Y5LA 3Q40A 1NVTA 5EIAA 1AH2A 3LLMA 4XUEA 5TVKA 1XTQA 4UEKA 2KPOA 3PIRA 3V1UA 2J9XB 2ZXEA 3EDMA 4Q7LA 5DHUA 1UP4A 2DULA 2FJPA 3AWIA 3OH8A 1NQXA 2LCIA 2NO1A 4UVIA 4YI3A 3GDOA 4Q18A 3ANYB 3BXFA 1A8HA 2HHCA 3M4JA 1BGWA 1P17A 3PE6A 1EA7A 4YJHB 3E9CA 1P2TA 3K0CC 1M3SA 1QSGA 2JGJA 5CFRA 1Y8AA 4G1EB 5BUCA 2WMDA 2X9VA 3R6DA 2WOJA 2CF6A 4RGBA 1AY0A 1D1TA 1HNXB 5HIMA 5KTSA 2JH8A 1KTVA 3MJHA 2WM2A 1OB5A 1B3BA 1XEFA 2QRVA 3QEKA 5FUMA 2H0QA 3AHFA 4KXFB 3JWEA 1BMFA 2CVFA 2W6PA 3BZWA 4CL0A 4DA6A 1PEYA 2X85A 1KMIY 2UUOA 2WFAA 3I32A 2H48A 3PD0A 4LK2A 4ZT7A 1F38A 5DSTA 4KOEC 3Q39A 5BYAA 1SVSA 3CS3A 2DETA 3HCFA 4PYMA 2KYRA 2G6TA 2QJOA 1YJWB 1E4VA 1T4GA 4KOAA 1E5DA 4EEXA 1T2CA 1VIAA 5C7YA 3K53A 5DYIA 1GD1O 4Z4IA 3ANSA 4JJZA 4LC9A 2P4HX 5EUQB 3ZDAA 1E89A 1JDNA 2Q1UA 4HQKA 5FUYA 3TNYA 1DJNA 3KR0A 3QVOA 1JIKA 1DQPA 2EFJA 1W49A 8OHMA 1MB4A 4AL4A 2GTIA 2O7NA 4UMFA 5I7HA 4WZAA 1OH8A 4UU0A 1FIUA 3MOSA 4DMRA 1Q74A 5EUCA 1F8GA 4CKEB 1XKTA 4QDUA 5JPDA 3KXIA 2SECE 4RV5A 4B3FX 2O8FB 4W9RA 3EQ8A 4OQQA 2LGJA 3F6CA 1N9ZA 4QLAA 2HW8A 4XDZA 4ZCTA 3DL0A 3AFGA 1WJGA 4MJ7A 4UU7A 5EJ7A 1P29A 4HF7A 2AR9A 5EJ4A 1L4UA 3UN1A 1UD8A 1OVGA 1V8DA 1XF1A 3NQ41 3VH4A 5JY6A 1Z4QA 2FXVA 2Q3BA 5JAPA 5ED4A 2O9JA 2FUKA 1QH1A 2WYWA 1A9ZA 5TPWB 4FKBA 4P58A 1XMOB 3ADOA 2OC4A 4HG2A 5TPZD 2QGGA 5HZHA 2FKNA 4S1PA 5HGXA 3FOZA 5AM0A 4FIDA 1IXSB 1AQLA 1JXOA 3WHLA 3CE6A 5CK5A 4ZJPA 3OOSA 3FKJA 2AOTB 1JHOA 1XQWA 4HNTA 4KPUB 3PQCA 4Z4VA 2HU8A 4OGWA 4JBXA 1SKYB 5FADA 3ERCA 2CT8A 3UG6A 4BP1A 4C3ZA 2VYVD 5L45A 3K5IA 3V4RA 1SOWA 1AC5A 5JFTA 4F4HA 2J48A 3DLPX 3L77A 4G8DA 4LI0A 4ZGGA 2BN4A 4LRUA 5FFFA 3Q2IA 5JO0A 1ZP6A 1BDBA 1RYZA 4EI9A 5FCDA 3C3KA 1EUCB 4C06A 2YUTA 3NNNA 4OQXA 1XFOA 1WOOA 4OLBA 1VHLA 1XZMA 3FYUB 4O0LA 3EIQA 1N2HA 4NFHA 1T4DA 3O1IC 1SBHA 1SRRA 3GRKA 2CUZA 3PR1A 4I50F 5FTWA 3WGIA 2PKQP 1ZI8A 3ZHQA 3EOZA 1VL8A 2I4TA 4WOKA 3AILA 2H3EA 5HIKA 2CXUA 1W25A 1WETA 4F0JA 3R0QA 3VSCA 1M73E 5CCDA 2NP6A 2JJ2D 4WZZA 3ZE7A 5ITSA 3N0XA 1W581 2WF7A 5M7EA 3BSFA 1PK9A 1OW3B 2XD9A 3DMDA 4BBPA 1YU6A 4QOEA 2EQAA 4RHXA 4TV9B 2QMHA 3JQPA 1QG4A 3ORHA 3WYNA 2FUCA 1R9JA 3VPFA 3A25A 3Q0IA 5KWJA 2HLPA 5J2UF 3FI9A 5EIBD 4JEHA 1NG1A 2Y1FA 3TVTA 1MLDA 1SY7A 3OTOB 4QTUB 1TU0A 1UOOA 3G85A 2PXHA 1B76A 1KYZA 2OBBA 4FJ1A 1GDHA 4ZPXA 1JDBB 1A82A 1NBAA 3C6MA 1IFXA 5JD5A 2P9JA 2FSFA 1HNNA 4B4OA 3A6KA 2FHSA 4C3UA 1SUPA 3U7EB 4ZCMA 1G5FA 4YT4A 2WM9B 1XZJA 4PRKA 2BP7A 3QOFA 1SK8A 2GFIA 1RYEA 5AI5A 3UJ9A 3CZ4A 4KQCA 1LJLA 5DF1A 2VSOA 4ZU6X 2GN2A 5E8JA 4HLNA 4N48A 2AG1A 4MLPA 4Q21A 2MCFA 3BM5A 4ARIA 2BMDA 1YL7A 2FV8A 2MYTA 1S4QA 3TECE 4Q9NA 2FPWA 2ES4A 2PUHA 1RCTE 3D3WA 1NW5A 1A2BA 4Q4LA 1CQXA 2RAUA 3L8MA 4L07A 3A3KA 4QHYA 1EFVB 1LZLA 2AFIE 3A1UA 1K7CA 3I28A 2MHCA 5LCXA 3TLGA 4DLLA 4GW3A 5JCZA 5BORA 4MDEA 1HY3A 1MKYA 1MX9A 4BX2A 2OPBA 3E0QA 4WN3A 1FLDA 2PS1A 2OV6A 3GRPA 3UHJA 1R5BA 4ZEOA 2ZIAA 5FPTA 2UUPA 5EFOA 3O82A 3LOUA 5B1DA 1MO3A 3U3MA 1KWKA 2OZVA 1PHRA 2DHCA 2IIBA 2QLNA 2QNBA 3VNSA 3VO8A 3CCFA 4P6VF 2VHQA 3UUWA 4XDHA 4FHEA 1P72A 2XRYA 4YASA 4XOUA 4B8ZA 3WAJA 3WNZA 2JCBA 4O2AB 5BPFA 2I7VA 5FAKA 4ROSA 3PNBA 4OBBA 4AIIA 1L5KA 3EPRA 4WASA 5EYPA 4YRLA 4K6KA 3O8DA 4N54A 3REQA 3HXQA 5DHAA 4YYEA 1IG3A 1Z7BA 4RFSB 3CR8A 1N2XA 5D1HA 4F7WA 4C05A 1ZPDA 3KG2A 1LWNA 4KSBA 4G0UA 1R27A 3P9CA 1QC5A 3ORYA 4WERA 1NURA 3KL2A 3MRSA 2D7CA 2Q8NA 2WJGA 2WWTA 3JVVA 4MVJG 1CIJA 2CFRA 2D06A 3A2MA 5BSHA 3FKSA 1J25A 4MYUA 2ATXA 2JNWA 2O0MA 2ZE8A 4M1WA 2ZRLA 4Z86A 1F8UA 3GY0A 4F5WA 1ZK3A 2DWPA 3QJYA 2JIBA 3EFEA 4GZ5A 2VFAA 2Z2YA 2HEIA 4OH7A 3C97A 2MSEB 3LQ2A 2CV1A 2CMDA 4O8ZA 4OMFG 3B2EA 4L6IA 4AT1A 4IJ6A 1YKFA 3FFXA 1XHFA 3O9MA 4L0QA 1LTKA 3N8GA 3WADA 3DJFA 3FSRA 1TQHA 2LTAA 4D9MA 4KBFA 5F7JA 3BEOA 3B6ZA 4GFDA 3U4CA 4EG6A 4OPVA 1XEXB 3FCAA 1MAVA 3E1SA 1U1EA 1D3AA 1P4HA 4Y18A 4HQNA 4QDXA 3H5LA 1DBPA 2X1MA 4KQMA 5DBIA 3D7LA 2IHYA 1KKLA 3JZMA 4RA6A 7AT1A 5CVTA 2O8DA 4AWBA 3R74A 3GUCA 1IZ0A 5AK6A 2C00A 1ZAKA 3AM3A 2GJAA 3NU1A 1ABBA 1Z7WA 3M0EA 2E3JA 3UJBA 4H7KA 4HNAB 6REQA 4LDPA 4XR6A 1EX7A 2GPWA 1NOIA 2HGZA 3ENZA 1V96A 4FP9A 4GICA 5TQ0A 1W2HA 3EUEA 3MCAA 2MT9A 3O1HB 3R7WA 3JYPA 4B76A 1Z06A 3VU3A 3WGVA 1GARA 1U11A 5IN5A 2J9ZB 2AOXA 2VP5A 3L7LA 4Q9JA 3HU5A 1G5TA 3OEHA 1PZHA 3H5RA 1O5TA 2PQ0A 2CJXA 4HUJA 3NTVA 3OX4A 3RY8A 5CVCA 3HDGA 5ED0A 4EECA 2VT2A 4LYYA 1A4XA 1N4DA 3LIPA 1E3WB 1T5IA 4JP2A 1VE1A 1VCMA 2CMFA 3WX0A 2ZBRA 3IQHX 1R0CA 3GQVA 1FF9A 1H5UA 1G7SA 4EA7A 5K8IA 3ENQA 4DT1B 4GBJA 2HU2A 1FMTA 5KNDD 4FMPA 2ZTLA 1XZQA 2P6NA 3C4JA 1E2LA 1Q83A 1LQUA 1Z5NA 2PR2A 3DTVD 3K0AA 4MEBA 4FVTA 3ZWWA 3IQEA 5FNVB 1NQ5A 3PC4A 2R4QA 4WE3A 3T94A 3MFYA 3M6AA 4MWBA 3FNEA 4A10A 2UUBB 2HSEA 2DE0X 1PJQA 2PBZA 4QPDA 3RRZA 421PA 5C34B 5FWXA 4CKBA 5I48A 4K3VA 2XB2A 2K4MA 3VDXA 2C98A 1SVWA 3MCTA 3EA0A 3MS2A 2ZANA 4JJ8A 4MPPA 1LSJA 2X6YA 4HT3B 2I7TA 2V97A 3RIHA 3DFMA 5DS0A 2VXYA 2BF4A 1XRLA 3G4SB 1QIJA 2HCFA 1HE8B 2X1HA 5J5AA 4QEDA 5CJPA 3ZJVA 4LTNA 4N0DA 1H22A 1FQKA 2B61A 2GBLA 5K0EA 1VMEA 2CXTA 4EKEA 1NXTA 3I6QA 4FU0A 4MUNA 4ZZ0A 3V55A 1W34A 3I6MA 1EWKA 1BMFD 4E3WA 2PL5A 3AUSA 3L1HA 3HBFA 5AI4A 5KDOA 4TTSA 3G7NA 5FD8A 4Y2JA 3K0SA 3L6RA 2PY6A 2V31A 4AD8A 2JGMA 4C88A 4X0CA 3AY3A 2NZWA 1JF8A 4D82A 4J1QA 3D0RA 2QRGA 2NTNA 3AEXA 1U6IA 3HA3A 3ZHBA 2QSJA 1LVUA 4YB8A 2IS4A 3A3NA 3PXEA 1I8DA 4GQNA 3QOWA 3UBMA 2ZIUB 4NXNB 2TMKA 1L0BA 2FJUA 4RX1A 2R1TA 3KQLA 2ZXIA 3CC4B 2M6RA 2PD3A 4LY3A 3WJ2A 1NQAO 1DJQA 1WW3A 3PHHA 1UDRA 4QO7A 2Y9MB 3CPEA 4WWHA 1ZBDA 4J2TA 2ET6A 4ZKEA 4TS3A 3SVTA 4OK6A 3PX7A 2ZSBA 2V7BA 3SC2B 3DFFA 1RJGA 3CVJA 4TLCA 4HGYA 4EHDA 4NYIR 2C04A 3VO9A 4D3SA 4P82A 3NHLA 4MHTA 1Y0BA 4MYTA 4D1YA 1FU7A 1SBCA 3OOWA 1N0UA 5IM4F 1GAEO 1X7GA 1RTKA 2BIFA 3QI7A 4FBLA 4OGGA 2F9FA 3I0MA 4M7PA 4N76A 1PZFA 1GG5A 2I6GA 4FMDB 3RJZA 2CMKA 1IHXA 1PZEA 4BNNA 3HHPA 3K0CA 1L7EA 3X2SA 1G4AE 4QOGA 5F7ZA 1WPCA 2F90A 1T9KA 3CZMA 4EHLA 3EVZA 1X6VA 2W6ZA 3HFJA 3KBOA 4ZWNA 2A92A 1DG3A 2PX6A 4D92A 4U8HA 1MB2A 1YVPA 3QA9A 2FPXA 1Q2XA 3JAWA 2Q3MA 4ZGNB 1RACA 2GPAA 3CQ9A 3DOIA 4IDPA 4S35A 4EY7A 3BIXA 1E4YA 3KC2A 3QEJA 1G3QA 3AF0A 1F8XA 3M5DA 2P69A 4O4HF 3T7JA 2F64A 3MMZA 4DXHA 1XCGB 3FDZB 3RC7A 4BMCA 4IWXA 4J3JA 1EDOA 2Q6OA 1O54A 2YC4C 4P4SB 4X45A 4XYMA 3FIUA 1JNYA 1DTEA 2EQBA 1FQOA 1FSFA 4WFKA 4XLZA 3RFXA 3G6WA 3PDWA 2Y0EA 3LIIA 2BLNA 1GXSB 1FDIA 3A6LA 1M8PA 1NW4A 1AUOA 2AC7A 4EPTA 1P0PA 4D3ZA 5ALTA 3EDQA 1XJ5A 2DHQA 2GZ3A 1QVGB 4KQ2A 2C97A 4QNMA 4TM7A 3Q9NA 3G0BA 2Y4OA 2CXOA 2GHTA 4XD2A 2B2NA 3DAGA 1TX4B 2DEUA 2YINC 1P1CA 3PDIA 4CMHA 1KZ6A 4S1WA 2H4YA 4MSUA 5FR2A 1VHWA 4ZN6A 1ORRA 1YR7A 1FPMA 5GZ1A 4HTAA 4Z7NB 4I5IA 3T52A 3EHEA 4UJ5A 1SUBA 4MWGA 1NBWB 1RHMA 4GC9A 4LWQA 2KBEA 3WA7A 2QUIA 2WHEA 3C85A 3SOPA 3EUAA 5BVHB 1TIBA 2A0KA 2C3MA 2CYBA 3DA8A 3S5JA 4V02A 3E9MA 3ZVRA 1V3UA 1IM5A 4KPYA 2H9IA 1SOMA 1XZFA 1OH5A 3GFRA 3NHPA 5JHHB 3DXFA 2YZGA 3R3VA 4D0LB 2Q4OA 1PWZA 1VPLA 3RK4A 2RAFA 1TK9A 1KFKB 2EL7A 3EAQA 4PLGA 3D7KA 1H1TA 3NIGB 1ONNA 1Y4UA 3LDAA 3K73O 4RXMA 2BMWA 4NMLA 1CVRA 1A04A 3M8KA 4Q1AA 3DMRA 3RS5A 1UT8A 3K09A 1FMJA 4XJVA 2WPDA 2WMNB 4EZBA 4HMPA 1UBOS 4JK3A 3L79A 1VQPB 4ZMSA 2A78A 1XPJA 4N9WA 5F52A 8AT1A 5EMNA 1Y9EA 3FBTA 3K1JA 4AXBA 2A1UB 2HRRA 3IIKA 4H7DA 4L3VA 1N8RD 3O8BA 3CNHA 1XTZA 1ZVVA 4NJMA 1ESNA 2D0IA 1BW9B 5K8JB 1V5WA 2FF5A 6CHYA 3EW7A 2OG1A 4JYBA 4XARA 2VJIA 2PFGA 2W83A 3AKZA 2QVLA 2J5QA 3ONNA 3U56A 5BNWA 1IB6A 1KEKA 4IVPA 3ADPA 5DNAA 2VKQA 4EELA 4AN4A 3VU1A 2V7XA 3TM5A 5EJEA 4Z8XA 4EQ6B 1MC8A 1KQOA 4RK7A 4TQAA 4BTVA 4IHJF 5EC8A 2E21A 3IDZA 2PZJA 3AR3A 1SUSA 2VK4A 5IJ0A 3B9RA 1A5AB 2H0AA 3GLUA 5LOVF 3ZZ1A 2XNCA 5LZ8A 5FTMA 4MP6A 1KI8A 3BULA 1X1BA 3W5CA 1W36D 3V1NA 3SCZA 4JQOA 2OYRA 2B1IA 1H4TA 1X92A 1NMSA 1RJWA 2YIVX 3OLWA 4ZHQF 1WOMA 1BDIA 4CU2A 1K8XB 1IBKB 3ZEAA 1LI5A 4HN4B 1PG0A 2GH1A 3MAGA 2ZSAA 3GA5A 3OURA 1ZGCA 1CVIA 2XT9A 3AIOA 3SBXA 1ZS9A 4AO8A 4DEYA 4YAGA 2W11A 5JJIA 4O8CA 3EXHB 1KPHA 1VCOA 3N58A 4U02A 3AKDA 3I4LA 2C9OA 1E8MA 3OPYA 2MDTA 2C54A 2ZWOA 4B6RA 3MLBA 4LJSA 3RHFA 5GONA 5AHKA 2HIGA 4C5AA 4YXWA 2ZAMA 5ES3A 1T8YA 5AI0A 2FPPB 3I0NA 2JHFA 1ZK0A 1R7RA 4MV5A 4YN3A 5SYNA 1H4QA 1PVOA 2H85A 3NTOA 4QJ5A 2X2EA 1WV0A 2G4CA 1FJHA 2GN8A 3SP1A 1N5MA 1KMNA 2WYRA 2H4JA 3VTKA 3WAKA 4TUYF 4B79A 4FFBB 5CP8A 2ASEA 2YFYA 2AYYA 2GAJA 3FTCA 3I01A 1UKBA 3TS1A 2WZQA 4IH4A 3CW9A 1FYDA 4JASB 4KV7A 4NV0A 4CIYA 1Y4AE 2PFSA 1V4NA 4ZCPA 3ZE9A 1T24A 2QEQA 3BICA 4IDBA 1P1RA 4QYWA 1COWA 1ZGHA 4ZVLA 1V6CA 2VF2A 3EG9B 4FT4A 4QFBA 4XD7A 5CNMA 4X62B 1XRRA 1EBBA 1R88A 2CD7A 2CMGA 1OF1A 2X7JA 1GRQA 1ADYA 1SVNA 1TVKA 2W2PA 4I55F 4INJA 5BWMA 3HDQA 4OHFA 5EMHA 5IBRA 2ZSFA 1FRZA 1E7RA 5CJJA 1HQYE 2YW9A 2OBRA 5GMOA 2OCIA 3OEHD 1P4SA 2WV7A 3TTSA 1FMFA 3BA1A 3DF7A 1V8BA 5F5XA 1C9DB 4YALA 3UK2A 5CJ2A 2B1QA 1K4KA 1BS1A 4G9GA 2VJCA 3JQDA 3QP9A 1VOTA 1FSGA 5COQA 4WLUA 1O7JA 2XUPA 4XIJA 4UVEA 3EEFA 1N05A 3IAEA 4GRAA 4M2LA 1QMGA 2YBEA 3KOXA 1QHGA 2IGTA 5IU6A 3HLTA 2YC2C 1T1EA 1XJQA 2ACEA 3ZXYA 1ORTA 2P9TA 4H2DA 2XWSA 4HBZA 3INGA 2BTQA 1Y3AA 5ENDA 5A3JA 2A9FA 5JJ5A 4MDYA 4RLHA 1TD1A 1DC4A 3MGKA 2M5SA 2YRWA 4QXPA 3RS9A 4WKNA 4DM3A 1EHYA 3DE0X 3MMSA 4CM7A 3ZVKA 1WD5A 4WY2A 4LHZA 1BEZA 3CLTC 3U44A 5BYKA 2BAGA 3EGWA 3OWHA 4GI5A 3WL3A 5HPYB 1VBFA 3D5TA 4XYEA 3OE5A 1E1YA 4REQA 1J1UA 1BVYF 5CW2A 7YASA 1M0SA 1PR3A 4PWZA 4WADA 5FEUA 4WZEA 2Q5OA 2O8EB 1AV6A 3L6UA 1ST2A 2P9BA 5DBFA 1CP3A 3NORA 5K20A 3EVNA 1RBZA 1GA1A 1GZHB 1BOFA 2DSNA 3LKVA 1ODKA 1E62A 3OOHA 4JIMA 4L4RA 5JIBA 4BLRA 3WFZA 5CLQA 4URYR 7REQB 2ZI7A 5ANRB 3GAMA 3B1JA 1U2SA 4AZ3A 3D7MA 2VNAA 3HEMA 3OZBA 2OVBA 2COUA 1GPDG 1C1HA 2Z43A 2L2QA 4G6ZA 3G05A 1ZK1A 4RZHA 3ID6C 3I64A 1Z18A 1UAGA 3B6EA 2X2OA 2IS6A 4QG3A 4DG5A 4PSAA 5JG7A 3FUWA 2P62A 5IYZB 2RH4A 1R00A 3MPUA 1K73D 4WLVA 2H7XA 2IOFK 5EUBA 4ZKDA 1OWOA 1XTRA 3B7PA 4LXHA 1R1DA 3CW2A 3WBKA 2OO5C 1DKOA 2G0NA 2O4UX 4FFLA 3FBWA 4R1QA 2FLKA 4WVFA 3I9MA 2AVDA 4INAA 2XOKA 3GRFA 1BFKA 4JBLA 3V46A 2F3UA 5HNKA 2C29D 2YOFA 5BV2P 3NI2A 4GKVA 4BVKA 3R6LA 1Q92A 1WO8A 2AEFA 2H16A 4L57A 5KTYA 4DB2A 4OHMA 2C9DA 2RHDA 1ILEA 4X44A 1ZGGA 3BDVA 3JATB 1XQ1A 2EBUA 1B4DA 2G1KA 3B52X 1FBTA 4FUTA 1M8GA 4PVDA 4CKWA 2BYTA 1XQVA 2XQFA 2VEOA 4RFVA 4QUKA 5A0VA 5E1MA 4BRUA 5DHPA 3Q10A 1OLSB 4LGYA 2JLXA 2GERA 1EG7A 1NLZA 2GZSA 2I9PA 3O0DA 2R11A 4XSHA 3N2EA 3LH5A 3TLEA 3EIUA 4AYTA 1G3MA 4N41A 1MO6A 4AK9A 1U6JA 1UFOA 3HTXA 3AEQB 3NHBA 1A4RA 3TGLA 1ZA1A 3BL6A 2IZZA 1GTRA 1V8ZA 4QGGA 2B98A 1NIPA 2V45A 3CKMA 3ZV3A 1J06A 4XJSA 3NIDB 1Q14A 5G4KA 5L3QB 3KQPA 3VVLA 4RTRA 2YHBA 4DSZA 3UTCA 4AZ0A 1A2OA 2HF2A 3IP6A 4Z9AA 3NFRA 1IULA 1YONA 3G2MA 4AX8A 5EE9A 4DR7B 1NVFA 1R0KA 4UUBA 5ALZA 1M8KA 1EQUA 2P5TB 3SHQA 1X39A 2O2IA 4N65A 4NMHA 1UOEA 2BTEA 5LA6A 3QPCA 4P08A 5TDHA 5M34A 4Q66C 3QKTA 3DZGA 2W2LA 2EIHA 3V8BA 4BJ6A 4HATA 1ZNYA 4FR0A 4DNPA 1EG2A 1SUIA 3G8BA 3HYNA 4AX4A 3VOBA 1P9RA 1BH6A 4IEIA 3VUFA 3UMFA 5B4UA 3WV4A 1F1JA 2GN0A 4TKVB 4CKCA 2C4KA 1SA0A 3RARA 1J7KA 4P4LA 4EQZA 1LVGA 3VR5A 2OZKA 5FHQA 2XBLA 1B8NA 3EZ9A 3JWIA 2CHGA 1X8KA 4P3OA 1CJMA 1QHIA 1T5TA 3X43A 3WL4A 1XMPA 4I4TB 3EGDB 3ZXUB 4QSMA 4YRQA 4E5MA 3OLQA 3ZVLA 3AIMA 4D9EA 2VT7A 1XI2A 1KEEA 1OA0A 1WLYA 5JAMA 4B3TB 3EX7C 3INRA 4KR7A 2PSFA 2DKOA 3A11A 5HTKA 5SZKB 2QNIA 3I09A 4RDHA 2VJYA 4WZBA 4YDHB 4KR6A 1GYPA 2IDJA 3OHPA 1CUUA 2H5LA 5ER9A 3TLJA 4M9RA 1WSRA 1UPUA 2FLWA 5EZYF 3PR2B 4ZEWA 3S99A 4DW8A 2Q7DA 4JJIA 4LWZA 1C9YA 3UWSA 4EKIA 1VHJA 4GX1A 3SYMA 3WQBA 2EZ8A 2GN4A 3SSOA 3WO0A 3AF5A 4LXUA 1UM8A 2JFVA 4Q1BA 3WG9A 2CNDA 3PD7A 3WL7A 1GVNB 5BMVF 4RM0A 1WOYA 1U2PA 1S02A 4MVJP 2WSMA 1KMCA 2FRDC 2C2HA 4MUKA 1EWRA 3WQHA 2VPYA 5AJWA 5K4GA 3TPFA 1DKLA 1GUAA 2C5AA 3DHVA 4WJZA 1H1LB 4IIXA 3M7IA 1TA4A 1HT1E 4TWBA 2R0QC 1UMBB 2BGGA 1ULZA 1TQ6A 2OECA 3WDMA 2WPDD 1E6LA 1I9CA 2XVXA 2D1QA 4Q05A 1FBNA 1MU0A 2ZWIA 2Z6UA 3RYIB 3TEFA 4RTNA 2V58A 1YB1A 1R0RE 1LW7A 2V6GA 2E9SA 2CNWD 3ETGA 3K8ZA 4QOIA 5G40A 4EY3A 2VHEA 4FOPA 3K2BA 3GG9A 1C81A 1DHTA 1OWMA 3L84A 2JHCA 3LC7O 3M4ZA 3QF4B 2JBAA 3HCOA 4WH0A 1NYTA 4MRVA 3IL2A 4G8CA 4PABA 4R1TA 4IIVA 4NFLA 1FNBA 1NF8A 1I7PA 2Z2IA 1I80A 3EC7A 3G6KA 4NQRA 2KVOA 1AT1A 1X9HA 4ZEXA 2Z6AA 3OT4A 4WFQA 1S1CA 2G25A 4RD2A 5TQ2B 3E9YA 2M6LA 4HGPA 3WWYA 1U0NA 4IGFA 1O1YA 1K4MA 1K0FA 1QK5A 4EI7A 1ZX1A 3G9ZA 4LNHA 2Z3ZA 3H4VA 3ZJTA 1I4LD 4WKPA 3V8EA 4U7HA 2P4QA 3R3JA 1TM3E 3JCZA 2F1HA 2GJ4A 2DYKA 4UPVA 2HO5A 4RL4A 1JHDA 1JHUA 3RVKA 2GREA 3H2ZA 4BZZA 4CV3A 3RC8A 5E3JA 2IYFA 2O8NA 3O4GA 4EYKA 1PZGA 5KTOA 1GRVA 1RKXA 4KUHA 3SEFA 1YZLA 4LIPD 3NOOA 4TTVA 3UOWA 5EJ8A 3LHSA 5LDHA 1JIVA 3A8KA 2O50A 4WNAA 4EL0A 1BXGA 2G80A 5AKJA 3W6UA 4FGZA 4RWZA 3UXEA 3E3MA 4FXPA 1EWTA 3LPDA 2GBFA 4BFWA 2W2XA 5CEJA 1F6DA 2FFBA 2DBQA 4BNLA 4LV6A 3CPXA 2X23A 1RDFA 1KJYA 3OHSX 1A5SB 2OFXA 1JSCA 1RRPA 4GAEA 4MYRA 4YVFA 5GY7A 1SXPA 1S2DA 2PL1A 4W8OA 2BBTA 4LJRA 1ISHA 4N3BA 5AXDA 1V39A 4UQLA 4RHYA 3J7AC 3EVCA 2JS7A 4RDIA 1BCRB 4I2VA 4TZKA 2ZTUA 1C8VB 2P0YA 3GYGA 1VSQA 2BPOA 2OHGA 3T9DA 2CL6X 1Y7HA 3G79A 4Y8VA 3DP7A 3N2KB 4CF6A 3L1JA 1OC4A 1N2CA 2X0RA 1OFUA 1A5TA 2QL5A 3QBTA 5HWSA 2YRXA 1Z0IA 2P4UA 5FBWB 2QZPA 3RS3A 4E5VA 9ATCA 3Q7QA 2WTNA 5F9FA 1VG9B 4MKFA 1HQCA 2YIDA 3B60A 4CN9A 1PD0A 2H0RA 3N39C 4GLLA 2XCIA 5HF6A 4JB2A 5J4YA 3QEAZ 3UYKA 2QG6A 3IDQA 4KR2A 1JR4A 2BM8A 2O3JA 5C8ZA 5LDDC 3J81A 5B1IA 1IB0A 4LY0A 3LU1A 4N7MA 2X5JO 2UVPA 4CMAA 3HWSA 4RD3A 1COWD 1P61B 5CCXA 5EGNA 3L7CA 5AVKA 1RM5A 4NH4A 4IUDS 4ZOEA 4B3DA 3DD1A 3LJKA 4K9SA 3NUQA 1FUKA 3I2HA 4DDKA 3VR4H 3R5JA 4J4TA 1MJHA 2Z2KA 2KX7A 4ZEVA 2I6XA 2XNJA 3GJTA 2D00A 1QGYA 2PE3A 4UUMA 4TMTA 4BVFA 1UK9A 3UAOA 3BY2A 4CIVA 1G59A 2O5EA 3TRKA 5A8AA 1K9VF 2OBNA 5JTTA 1FCJA 1NU8A 2TS1A 5JBIA 2AQKA 2QZJA 2WYUA 2QLLA 1Z0JA 3WP1B 5IHXA 1DGQA 1Z83A 4LJAA 4I50A 1JKJB 1S4MA 1L7MA 3L82B 1P44A 4MO2A 4YJHA 1D7AA 4AUKA 1QOZA 4E15A 3DEAA 4HWGA 3WMEA 2YMQA 1Z6AA 3N2IA 3HO1A 4BKMA 1V1MB 2HJ9A 2PKEA 3BJIC 5HKAA 4CEIA 5K7SA 1AO3A 4CFZA 4B84A 1GTVA 3SEZA 1Q7YD 1JEDA 1DADA 3PTLA 2G1JA 5CW1A 5CMLA 1TTQB 4BGDA 3OZFA 3GLIB 3HABA 1M6VB 4ENWA 3RC9A 1ECCA 4MA5A 2RHTA 5T6MA 4HQ0A 4F4FA 3K8OE 3D7SA 3P52A 4R1UA 4RM2A 1I9GA 1XPUA 2KWIA 3QK7A 3IJEB 4DABA 4OJYA 5KTMA 3K0KA 3FLEA 2JHGA 2KSQA 3RKUA 3QKSB 3R5TA 2CKDA 3U4HA 2JLUA 2HDWA 4DLWA 2PYZA 2YXNA 1OT3A 1HFEL 4XOTA 1KQPA 1KZYC 4JX9A 3E9QA 4Q3CA 3ZQUA 4OA5A 1K1EA 3GD5A 2PR7A 2J9FB 2PZFA 2L18A 2IY9A 1T4CA 1GZ7A 3BHJA 5JS6A 1ZU4A 2PGDA 3KZNA 4R0NA 4CI0B 1FFXB 3GNLA 3HSYA 1I3OA 5K6RA 2WOOA 4FFOA 2MTBA 2REOA 5EKXA 3RANA 4N7RA 3ON5A 4CKEA 4JN6B 2QVCA 4MW4A 4HMOA 4IIBA 4KDRA 4UUOA 2OOSA 2JGKA 2YDYA 3EXG1 2QXYA 2R62A 2OHHA 4NZNA 5G02A 1QIEA 4L5BA 3VXKA 1WMDA 2CV0A 4Y1EA 1WSBA 5T41A 3ZKWA 5C1PA 1VPTA 2AXEA 3BWXA 1JSZA 2O0HA 2XB9A 4JELA 4RMJA 1DPGA 3EIOA 3FNIA 3B1KA 4WAUA 5CVDA 1FTGA 4MUHA 4WECA 4ALNA 2BL4A 3K70C 3GIWA 3KWMA 3PCTA 1JYEA 3GLFE 1CZKA 1LV8A 3GFGA 1KU6A 2VBUA 4QASA 3E35A 3V8VA 1J0CA 4JB0A 1AF7A 5HF9A 3EWNA 1AMOA 3C3CA 4DNRB 4XTRA 2XOKD 1IZ9A 4EGFA 5JT1A 2RHWA 5AM2A 5ILQA 4ZGWA 2IHNA 1LNZA 3B9PA 4ZT3A 1S8AA 1II8B 1MJGA 1QU3A 5BN3B 2AOTA 3FSGD 2YCBA 3PNPA 2PQMA 1TKBA 4O2BF 3LDGA 4I9NA 3EZ2A 1XRPA 4IDQA 2E18A 3E9NA 3ICPA 3ZGNA 5IJAA 1NMYA 3CH7A 2O8CA 3GLGB 4BV9A 1GNSA 1CQJB 3TOZA 1IJKA 1WV1A 4ZXFA 1V7CA 4RIFA 2B8JA 5TF0A 4B17A 4L0DA 1N2ZA 5A5GA 5E3IA 2R3SA 1FP7A 4JR1A 4UFOA 3UGTA 2NYRA 2FVYA 3JZAA 5I9LA 5E4TA 1ZZEA 3G2OA 1HO3A 1X9IA 3WY9A 1KAGA 1WY5A 4PIPA 5D3QA 4RF3A 5A3RA 1V7QA 1PYDA 1N9GA 3PYXA 4NU6A 4W5WA 1T9AA 4X1OA 4A6XA 1FRNA 2FUG6 2A5FA 4PGAA 2ECOA 4BKRA 5JISA 4L5IA 4X0EA 1P2FA 1QK3A 3ESRA 3PT9A 3MAAC 4R40A 4JLDA 2YY6A 4D8XA 2X6TA 4Q1FA 4J1SA 1URPA 5FP0A 1ZOPA 3BREA 3LBNA 3OCVA 4KRGA 4EFDA 3KJQA 3OOJA 4I1IA 4LSWA 5EWLA 3RD5A 3K32A 3DVRX 3J80A 5BT8A 5D8DA 4Q6BA 5AW4A 1SPXA 3ER6A 3E9EA 3ETHA 2OO5A 2ZQYA 3D64A 5AK4A 1NXOA 1W88B 1ZWKA 3A9UA 3FWPA 2F17A 3M5PA 3VKWA 1NRKA 1DTWB 1GV0A 1UBNA 3CZQA 2C7BA 4EGQA 1E9AA 3UJ7A 3HSSA 5K0SA 1XSEA 1U0HC 2HTEA 3R0XA 1I32A 4L50A 3TTUA 1FDOA 5SICE 1PEKE 2OCAA 4UBNA 3BX1A 3H8JA 2XKJE 4JUAA 2C03A 5GM1A 3DOOA 3I2YX 1ZNQO 2QL6A 5JQGB 2CMHA 4HLCA 4DRXB 4G56A 3GZNB 3HKEB 3O3CA 4GKKB 1R0WA 1ESEA 2VDJA 3G2KA 4BVEA 4IEFB 5ARBA 5CX1A 2AS0A 2I4LA 3OSUA 2FF7A 4YS6A 3UA3A 3BWBA 1T0UA 3AFIA 3UB3A 4CDMA 1GRNA 3I58A 5TMEA 4H0CA 2X76A 2KI5A 2NUTB 2O5RA 4U2KA 5JD4A 1CY6A 1ZZGA 1GUZA 3M33A 4ZVVA 3VDRA 4Q4CA 3A6PC 2QU7A 2AW5A 4DLXA 4MWEA 2JJ8A 3LAWA 3OW7A 2E0IA 2Y1OA 4YMUA 4NV1A 2ZRKA 3EVTA 1FMCA 5DFAA 3B1ZA 3UUFA 1DL5A 4IGEA 1A76A 2R8ZA 4ZDJA 1YH3A 1EESA 1X7XB 1E6EA 2CHQA 3ODPA 3AGQA 5CB4F 1H93A 5CM2Z 3FG9A 3CP8A 3I3OA 3K5HA 3SZLA 3ASYA 5CHEA 3ZWYA 2W9XA 4EHFA 2P3QA 1P8AA 1Y7TA 2FSIA 4HE6A 4JT2A 3TKAA 2ZUFA 1XP8A 2RJNA 4NJEA 2VDMB 1GPKA 3T3HA 3ICQB 4PLZA 1NLFA 3ZGVA 3AHCA 1WNFA 4DQXA 5JXGA 1KQGA 4RH0A 5CU7A 5BW5A 6GPBA 1EKXA 1IHPA 1PV1A 1RWQA 1TF5A 4IPTA 1MO4A 4QULA 4BJHB 1B74A 5HJEA 1B2LA 1G21B 3ANNA 3G2HA 3PEEA 1QP0A 1VI5A 2F3SA 3OQBA 1CJTC 3V4FA 3VSBA 2I4MA 4OSOA 3Q87B 4A0QA 4ZO9A 1RCFA 1NQUA 1KO5A 2NYAA 2RHHA 3DW1X 4MR8A 2WJYA 1V4BA 2FCRA 1TA0A 2ZWAA 4R01A 4ZVRA 1FP4B 1HE5A 4JB8A 3P45A 4Z5XA 1L4BA 4MCAA 5B1YA 3KB6A 1ISFA 1IHYA 1YE8A 4P2BA 2E4YA 4YFYA 3LUKA 3OF2A 4Y1RB 5FNZA 3GCWA 2UUCB 4ZAFA 3OJWA 1UKZA 3RE1A 1KIFA 2OCYC 3KCQA 1BX1A 3ANXA 4H3VA 3ZE1B 2JFBA 4WK0B 4ARZA 2IHBA 4CM8B 1NVXQ 2HDHA 3G1WA 4L4YA 2VPPA 5EZ5A 4GMHA 1LDEA 1OC2A 2R6ZA 2YS6A 4GWKA 5I7AA 1Y6ZA 3BFPA 3EWIA 4HHEA 1ESMA 2QF7A 3CCMB 4GBMA 5BPHA 5ERGB 3GG2A 1IBRA 4K9OA 2EHJA 4I9GA 4GE0A 4NICA 3T0GA 5JH7B 3TFOA 4QGHA 2MINB 2AN1A 1YB7A 4ND4A 5IG2A 1PX0A 3HCNA 2PJRA 4IZOA 4IO1A 1XDZA 2EKZA 2PGAA 2ZBQA 4D25A 3AR9A 4YTEA 2BFMA 1RQRA 1PJ8A 3V4ZA 3P2OA 3KKMA 4EW1A 1AHHA 2IZOA 3HKDB 3LUDA 3G0IA 3RUEA 3LA8A 4CM3A 4FE3A 3JQAB 4LY6A 4UPDA 4TLMB 1D0SA 1AKQA 5ICFA 4BNVA 3FWKA 5ALMA 5JSUA 2WWWA 2AT1A 4HNAA 2W2KB 3BHIA 3ZZ0A 1S3GA 2CLCX 3TRFA 1SU8A 4YWJA 1OASA 1WU7A 3UFBA 3DPIA 5MGNA 1FSPA 4CG0A 3EWSA 1LDGA 2IDKA 4PE5B 3OFKA 4FNOA 3REOA 1THMA 4K2HA 2WWXA 1HT0A 1D6JA 1RQ7A 4RF2A 4X95A 5K8LA 1N32B 2WQ7A 5GJWC 1KC3A 4LKRA 3R44A 4DY4A 3OM1A 5FI1B 3K1ZA 2FW1A 1R4NB 3IALA 3NC0C 4LOLA 1A2QA 4ZZ1A 4QOFA 3L41A 3LBIA 2P3OA 1NBHA 3DEFA 3PVDA 4Y9RA 1KI6A 2GWRA 3TX2A 5KVVA 4J7XA 5JVDB 5BV0A 5IFKA 1H2XA 3OP4A 1RKBA 5WRFA 2HK9A 2R8XA 4XWTA 2H2FA 4D6XA 1G8GA 1V4VA 2X2PA 2EGHA 5FNVA 1JFFB 1QP4A 5IKMA 4ZCIA 4G86A 4PCUA 1R12A 3LOPA 5L3ZA 3Q8WA 2QGFA 3ZD6A 3KZOA 5FXMA 4DDHA 3WLQA 1LBQA 2BGLA 3UJCA 2B8TA 3THWA 1D1PA 3BEDA 1EK5A 5EMMA 3EZ7A 1X1EA 4J76A 1MAHA 1U3TA 5C18A 1T3GA 3L7MA 2G6BA 3RS7A 3SQMA 1GAQA 4R68A 1VZ3A 3MIZA 2XGGA 3IBYA 3KHSA 3I9LA 2GD0A 2B2CA 4O5OA 3NPMA 1Q1GA 4YREA 4C4RA 3RW9A 2ZIXB 4DLAA 2O3SA 5F4BA 1T4BA 3OO1A 5TX7A 4BUCA 1KJ8A 3RVPA 4RETA 5K99A 5F1YA 3GA7A 2G1PA 2X42A 2O07A 4WBXC 2VK2A 1YHQB 2QJRA 2ISCA 1VKRA 1C7FA 1L1FA 1E9FA 1I5EA 3CV3A 3DV9A 1FTSA 1N7GA 5AOAA 1XZ8A 4FDTA 3CMMA 4EG3A 1MMFB 4KFCA 4A6DA 4NCHA 4QQKA 3FZYA 3BXGA 4M55A 1N5JA 1R9GA 5E6SB 3FVWA 3OX1A 4KKVA 4NBRA 5AVTA 3NX4A 1RLTA 3RTBA 3SIXA 1T3LA 3JYLA 1LNSA 2QN2A 5I5EA 3NDIA 2FPIB 3SE0A 1ZXBA 2JD0A 5JZOA 1N6RA 1EYZA 2BGJA 1KNQA 4D3FA 4KX3A 3CG0A 3WR5A 5A5EA 3VJMA 1KKUA 1CUEA 3CVOA 3THXB 5JJBA 4COOA 4NONA 5C1DA 3T3PB 1M74A 2IYZA 4IGKA 5EXEA 1SD2A 4FPXA 2VXCA 1GPMA 1O5IA 1KRWA 2DUWA 5CXXA 2UZ1B 3I8SA 4DTIA 2GPJA 1N2SA 1Q50A 2HNAA 4F56A 4XR9A 2NWQA 4GEGA 3PPIA 1VQKB 1NF9A 2HBYA 4ZOAA 2FFJA 3KLNA 1B6GA 5BSUA 2TSYB 1YE3A 3QSYA 3AB8A 5FO0A 1HYGA 1EFLA 4BTLA 1JWBB 3I9OA 1EZZA 1JR3A 3TNLA 4LHEA 4DUYB 5DTQA 5HQ3B 3Q41A 2JA2A 3QLEA 4EBBA 4W9NC 4BWYA 2JEOA 4MR9B 4OP2A 4YONB 1X13A 2QMOA 4IMRA 2XUFA 1WMAA 3DTTA 3OICA 2GA9A 1U94A 3OKPA 5JFGA 1VHEA 1P5RA 1O9BA 5CTAA 3HYLA 4BOYA 2R00C 1YX2A 3RRFA 1GRRA 1P9OA 3SG0A 1BE6A 3H9CA 3QMPA 3TAUA 3C8HA 5JROA 3VNAA 4P4SA 3KOYA 2GTPA 5I7SA 4X1IB 1S2IA 4PLTA 3W7BA 2XDQA 3L4SO 4P4TA 5P21A 4FI3F 4XOIA 2AV6A 3WLRA 4ZHQA 2NVBA 2HLDA 1DAKA 1M7GA 3BAZA 1GXSA 1YJCA 3PV0A 4CIAA 1ICEA 1QDLB 1W6RA 3DR5A 3KJFA 1V7PC 2J07A 1EFRA 1WTAA 3CF2A 1ZSNA 3SEJA 1NR5A 2AI2A 3PFHA 3GQBB 3OZAA 3Q1LA 4KIFA 3UOGA 4C43A 4BNZA 1IDN1 2FQXA 4FWBA 3N7AA 1LPNA 3P94A 5FBLB 2E4VA 3TTVA 3WJ7A 1A95A 1ODIA 2EERA 1DAGA 2VK8A 4MV1A 1SXJC 4MPJA 4C2AA 3NP9A 5BXQC 4ZAXA 4J6FA 4OVKA 1W5BA 4E5YA 5EP1A 2OTJB 4X93A 4BFXA 2D5CA 4OPOA 3L46A 1WXIA 4O02B 3X44A 3ZWQA 4XRGA 5LWQA 3LWDA 3G68A 1W9MA 4I4LA 5I5GA 5BVHA 4Q00A 5J2UB 3ISTA 3GIDA 3N53A 5K3CA 5IJWA 3WTBA 2P0EA 1OV6A 3IMFA 3EPHA 3WB0A 4YCNA 2Z8YM 1QS0A 4G5QA 1I94B 4TMWA 4M87A 5AJZA 3L6DA 3LQKA 3ELBA 1Y1PA 5G2OA 2SCUB 4WDQA 4M21A 1U8YA 5K3FA 1ZU5A 2GS9A 1AMNA 1G7RA 1D8AA 3WYDA 3GD7A 4GLOA 4EJ6A 2HHLA 3U4MA 3C7TA 3DM9B 2CLOB 1G5RA 2CF4A 1SN7A 3DAFA 3LUAA 4I55A 2PLWA 4J9VA 3O3OB 3SFZA 4DCVA 5M04A 2X53S 1DEXA 2II6A 4PANA 2B20A 4LEIA 2M1XA 4XFKA 2GGSA 1CVLA 1RI1A 3BCHA 4H1WA 1AKEA 3RYHB 5C0OE 4A8JC 1VRCA 1SWVA 5FBKA 3JYHA 3FFAA 3KBBA 3VPHA 2VUIB 1Z28A 2WIKA 3IAFA 2O8FA 2A1UA 1UCFA 3ZGLA 4FFMA 4DLYA 5BURA 1IHMA 3ZHRA 1UADA 5KQSA 1KRHA 4EY5A 1BW9A 4MWTA 3UT0A 3WDSA 5CLLA 3ABQB 1K89A 1ZH6A 3QBEA 5FA6A 3G8YA 3OKXA 4Y6OA 2WJIA 5AUNB 2AF3C 3KSAC 1R6BX 5L7WA 1Z5GA 1NB0A 3GT7A 1H9AA 5D3MB 2C5BA 4BLPA 2VH1A 3H6GA 1Z39A 1CQWA 4GXQA 4LVCA 4EJSC 3O9VA 1G1AA 1QRTA 1P1KA 3PPYA 4W6ZA 4WCDA 1E92A 1PZNA 1W29A 2XVMA 4HSEA 3SDSA 4D9HA 2JI4A 1US8B 1H2RS 3WYAA 2G5GX 2WYHA 3BWMA 3DB1A 2Q6TA 4MVXA 2ACWA 3DDWA 2IHZA 3K8QA 2WF8A 5KQPA 1P4MA 1JHRA 3KX2A 4MULA 2VWPA 4CMEA 2WSIA 3S55A 3GGOA 4IJVA 4V0ME 1E3LA 1UFVA 2X6XA 2FMUA 2QZ9A 3RS2A 2QZ4A 2PG3A 2ZJ0A 1Y3CE 3A37A 3EGEA 1N5DA 2WUDA 1YDFA 2ZJAA 3ET5A 3M4NA 5TMDA 4J3FA 1PQPA 1S01A 2IYRA 1G38A 1SHUX 2A9KA 1OZ0A 5A62A 1NT2A 4TVBA 1U81A 1I0ZA 4QO8A 5AUQA 1LD3A 1UPFA 4FC7A 2QLBA 5K2OA 2PMEA 2W6IA 3JQFA 2QHXA 1FX0B 1KDRA 1SCAA 1AZSC 3ZDXB 4B6SA 1APBA 1ULAA 4FHGA 3R6KA 1SGWA 1Q21A 2A4MA 2HREA 5DCLA 3JSXA 2HA4A 1KL7A 2FPPA 3BCSA 5T57A 3MM4A 4HDMB 3CXRA 2Z1NA 5GV8A 2IYXA 5AVOA 3WAGA 2RG7A 4IX1A 5FIUA 3STUA 3VGJA 4DCTA 2VYNA 4J7UA 1A9RA 1B1CA 4IXNA 1YACA 1WBJB 4BEVA 4OHOA 1Y8RB 4YV0A 1BWSA 4FFBA 1O08A 3S2YA 2FNAA 1Y5IA 5FPQA 3HU1A 2D2EA 3QH4A 2GHQA 3JAMA 4CFYA 4E30A 3DWIA 2Q1XA 4OREX 2P6RA 3OQ1A 2DKFA 3BXOA 4JT9A 2OORC 1YHYA 1JMYA 3IP5A 4KAJA 4YCCA 2C9CA 2BEVA 2A67A 3D2LA 3TW0A 2H4FA 3EISA 1EI9A 4V24A 1E1RD 1G9XA 4MS3A 1Z47A 2PXCA 1Z4KA 3ZY2A 3PC2A 2E4WA 3PUWA 4DA4A 2WK1A 4RPLA 2X8AA 4KI7A 3B78A 4RFLA 5C5DA 5HJ5A 5KCZA 3CNBA 2I6SA 3IAXA 2ZYHA 4NS1A 3ZNOA 2GEUA 3TBKA 4KDCA 1U8EA 3NONA 4BLSA 1LI4A 1QGUA 2JGNA 2WZBA 3QV1A 5KNCD 1N5OX 1RZRA 2C84A 4X92A 1XWWA 3Q0TA 4P7KA 2P1ZA 1NOKA 4R9NA 3HXKA 4HDRA 1DX6A 5LM3A 4MV6A 2JA1A 2HFKA 1QE0A 5AP9A 2CXQA 3IT3A 4F6CA 4JVNA 4B46A 1TJ5A 3NBUA 4LXTA 2WVHA 5BO5A 3AEUA 1F17A 2XVYA 5JWHA 2YXEA 1HM5A 1I4EB 2X6RA 4KIJA 5DWDA 1P45A 2NUPB 2A59A 1SIOA 1W4LA 4OBWA 4BGEA 4HAVA 3BJZA 4EJ2A 5J4KA 1MFPA 2NSYA 3O38A 3EY4A 5DBHX 1N75A 1NC1A 1QLHA 1UPAA 1Y1QA 3OIFA 2A0FA 3MTDA 4OXXA 3TTYA 3MC1A 2NUAB 3KAPA 4B2PA 1KSHA 3AUAA 2XIQA 2OMKA 3X1KA 2CNKA 2ZJ1A 3UJ3X 2C8VA 4GXRA 1EMDA 1S96A 1PGPA 3B51X 2P90A 2XXBA 2Y77A 3C16C 1Q57A 4JUFA 2C7VA 2Z09A 4MUAA 3DHEA 4KWCA 2NXJA 3VO1A 2P1DA 2Q2WA 2Z5VA 3IQWA 3NEJA 3PNQA 1UR5A 4ZCSA 3KT6A 4TLAA 4ETNA 2BGUA 1KEUA 2OHIA 3AR4A 3F5MA 3SHFA 3VYRB 1UQUA 4LVUA 3DL4A 4DV7B 3Q9UA 1NP7A 4TVKA 7REQA 2K5UA 1D2MA 3CCUB 5D7NA 2R9VA 4MV7A 1LLCA 2X8JA 5FLXA 1XVTA 1C7IA 5B1SA 4RY0A 2C59A 3FPKA 4ID3A 1USUA 5T5QA 3AJ8A 1NJ8A 2Z8ZA 2OHVA 4QHSA 2VHYA 4RY8A 4YMWA 3C3XA 3VNBA 2FGKA 1CQIA 1PJZA 2CFSA 1M33A 2XNDA 4MV4A 4DADA 4FOTA 5TS3A 3JXEA 3RVMA 1RAFA 4JU8A 3BGSA 1RRGA 3KFXA 4MVYA 1XE3A 3KFLA 1Z0FA 3FX2A 5HYVA 1DC3A 2V6IA 3AETB 3NS7A 1VQ8B 2QENA 4Q15A 3VH3A 4E4TA 2O05A 3PQ4A 3U81A 3NAQA 2AIRA 1G9SA 3ZGOA 5A1JA 5HR5A 3CH4B 1LSUA 3G13A 5BRAA 2B8NA 3WIBA 5IBCA 3KB2A 1F0KA 1L6IA 3CBGA 1TLTA 1XF9A 3M6WA 3ZHOA 4D74A 5GZ3A 2YYYA 1WVIA 5HG0A 3FPSA 4ZAYA 3TVDA 1MENA 3AG5A 1XFDA 3QPBA 3U4IA 1NRXA 1JX6A 2ZR9A 1CCWA 2VXBA 3B8EA 3JQGB 3JATA 4PZYA 4U7PB 1OWNA 5B57C 3QVMA 4NH0A 3JPWA 4I4IA 4IOMA 4P93A 3FZNA 3QEOA 3DT9A 2D1RA 5F2EA 1XB2A 2A86A 4EJMA 5HKLA 2C5HA 1VF7A 4L4SA 1VJDA 4LOJA 4M1EA 1CEQA 4PGOA 3GELA 4P12A 4LNUB 3ZTWA 5ITWA 3AEQA 4OUDB 1CZRA 3C4VA 2BBSA 3W8EA 5F7XA 3WGNA 1RNLA 2VAVA 3KCNA 1GLNA 2RGGA 2V3WA 2C4VA 4FEGA 1MG0A 3AL2A 1M1YE 4KO4S 3G0OA 5KYUB 1A1SA 3N7UA 3MEQA 3TLZA 2I91A 1G6OA 2P5UA 1HVXA 1XA3A 3QE3A 3W9UA 2WF5A 4GGPA 2FPMA 4DPKA 1XQYA 2VP9A 3E3OA 3M3PA 4KQKA 1E2UA 2OGWA 3CRW1 4QJ4A 3P0EA 2FP4B 2HSGA 3R3HA 3VSAA 4DMGA 1XMVA 4EG1A 5KOJB 4E2ZA 3PQEA 3E9DA 2G7MC 1TUBB 3KK0A 3STYA 4A6PA 1HOXA 4D98A 2HLDD 2BMFA 1Y8CA 3FNFA 1JGTA 2XADA 1UXKA 2QD4A 4YJKA 3H86A 1OJ7A 1EFRD 5E9JA 4E1AA 4UTVA 1BDHA 2C5SA 3TJZA 1JG4A 4RJLA 4JWKA 2DUMA 1Q9SA 3T7SA 4TKVA 1DIBA 1NBEA 3IMGA 4KBGA 4RFSA 3U4QA 4ZD6A 4ESEA 1T91A 3OA0A 5BNZA 1XAIA 1Q7RA 1IZYA 1DWOA 2ATIA 1M8FA 3H94A 2PGJA 5EESA 5T4FA 1KDYA 5C32A 5JAOA 1G4UR 1Z12A 4I4TA 4KR3A 4CEJA 2FWAA 4M36A 2WWGA 1U65A 4A0FA 3ZDBA 3L6EA 3VKGA 1N08A 4PZEA 3LDFA 4HLUC 1T9BA 1YASA 4GLJA 3ML1A 4J9UE 1XTVA 2YNMD 2WHYA 3CMCO 3DEIA 3K70D 2EW8A 4C0KA 1CF4A 2ZUBA 4KG7A 4LG1A 4X94A 3V4LA 3QKWA 4KMOA 5CCEA 1DMSA 3LF2A 1FLVA 2F1OA 3II6X 4L02A 1AE1A 3KYCB 1NM5C 2LDXA 1GSOA 5AHRA 3GPDG 5ALRA 4ZZ3A 1ZGAA 2OQ2A 2IHVA 2WEKA 3L0YA 3QUSA 1KOFA 3ZWOA 4F06A 1GSAA 2B1GA 3U1VA 3LY8A 4IDFA 4BFUA 2HRZA 1SM4A 1PFKA 3RFVA 3M6LA 4HNUA 1L7PA 4JI3B 1D6SA 4Q7QA 5CB0A 2R00A 2Z9DA 3ZJ5A 4WFIA 4YJ3F 1L5NA 4HL6A 4ENRA 1N3LA 2N42A 2WP0A 4MW6A 4RPJA 4EP1A 1KC1A 1Z0SA 1M2OA 1OX5A 1KYVA 4HRXA 4X97A 1ORWA 5FT9A 5B1HA 1O97D 2IYOA 3A9RA 3COWA 4TZTA 4BECA 5K8CA 3RYIA 4GD3Q 2YTZA 3TQOA 5JYCA 3FLAA 3AEKB 3WIUA 1CZLA 4H6PA 4JZYA 4NATA 4OBXA 4LYEA 4FDAA 2QBYB 1F5SA 3MJRA 3MWYW 5DX0A 1SCQA 4GGMX 1FYWA 4MWZA 1HZZC 4NE9A 1KVTA 1XX6A 2WM8A 4JA0A 5A5DA 5JBQA 4DR3B 3O1JC 1JJ7A 1VSVA 4A2PA 4DB4A 1UM9A 3L9XA 1EVZA 1RAAA 3O94A 4L5CA 3UVEA 5E3HA 1M34E 2P2LA 4Y0VA 1T15A 1ZC3A 2WP8J 3DD5A 2O6HA 5D51S 3SJCA 1E7MA 1SXJA 3UC9A 3OPQA 5HCIA 6Q21A 1EVQA 5EERA 5HCUA 2XQJA 4LQCA 3FETA 4N5HX 1TKRA 5ULLA 3ZLVA 4Z4GA 2PD4A 1S0UA 5KNLA 1UJ6A 4IFIA 4A73A 5BQFA 5LOVB 3T1YB 1P3JA 4EB0A 2H63A 3S2IA 1G64A 4DLZA 3B38A 3DCIA 3C5VA 4GI2A 4RPCA 5JDCC 3UENA 3UWOA 4UATA 2B5WA 3HZHA 4PW0A 2ZTGA 1JWAB 2WU0A 1ZD5A 3JRXA 5JDIC 4FYVA 5KYYA 5CNKA 3PX2A 1CB7A 1ZVMA 2IH4A 3TKYA 1M2NA 2GQFA 1WTHD 1X0XA 3O3MB 3ODGA 4KX5A 1B00A 2R2AA 4DKXA 3AL0C 4MITA 5EQFA 1VXOA 1VPVA 1TGVA 1SU4A 1HDXA 1I6LA 1KMHB 1LNQA 1VDMA 2HQRA 1PQYA 1IM8A 3DV0A 4BMSA 5F4OA 2WQ6A 2MSDB 2W6ID 3MBKA 1QHXA 3OPOA 1XLTC 1PBNA 1PJAA 4CQLA 4P3YA 2VAMA 5JXIA 4YT2A 4FD2A 1EFUA 2QA4B 1VHOA 3F96A 2JCYA 1BCRA 2YHIB 1QYWA 4UEWA 3U9SA 1LKZA 4DY6A 4F85A 5C5CA 1QIHA 3COSA 4A8JA 2YW2A 3GMIA 3DE3X 4RBNA 3AUFA 4BNHA 5D6NA 4D96A 4DR5B 4I6EA 3CCQB 1AUPA 5F1OA 3D31A 2QA5A 4UTXA 3SU8A 3I56B 3Q98A 3DDZX 2IUUA 4ASUA 1GAJA 2GXSA 2CBXA 1QO0A 2AX4A 2PEYA 3H42B 4TUYB 3TL2A 4BB9A 3HFGA 3ZWAA 1PZXA 4ES6A 1HI9A 4AKHA 3EMDA 1I3KA 3B7GA 4KTVE 5DIFA 1VQ6B 2P6PA 4KZPA 4QBFA 4QXAA 3VHXA 3RS4A 1A9QA 1N1GA 4H7IA 1NSYA 3Q3AA 3BGDA 5U4XA 5K03A 1QH8A 4JGIA 4JL6A 4RVSA 2P78A 1YOVA 3PRKE 3P96A 1MQAA 3HUEA 1XV5A 2PRKA 1PN3A 4EHNA 1V0FA 3AL3A 4KGZA 1NBMA 3DOJA 1LLFA 3NUZA 4MUFA 2HXSA 1HE1C 2ZPAA 2CN1A 3LPCA 3IP1A 5TQJA 5TE9A 2NACA 3DQZA 2GBGA 3GJ6A 1IXYA 2PVCA 4DQ0A 5E4JA 3RNOA 1MT3A 2YN2A 3LD9A 4OKNA 1AVTA 1FJ2A 1W75A 5CNIA 5NLLA 4D42A 5AOVA 2J5XA 3HUUA 3NOQA 5A6SA 3H5OA 5J2TF 3H84A 3BB4A 2IXTA 4RNDB 3ICCA 1GTZA 2C99A 5KVCA 1NHWA 3SY8A 2FOLA 2Q29A 1OBCA 3G02A 3GRVA 3HO8A 2ILVA 1I3LA 4KWIA 2FPSA 5TF4A 1WBDA 4E11A 1ID8A 3MJCA 2EHDA 4WACA 4CGZA 3V7AA 3TW6A 3P2IA 2YWEA 4E21A 5FA8A 4UZFA 4OFXA 2DG2A 3WLTA 4RF5A 4EMUA 5CA0F 5IW8A 3SN6A 5CAEA 4Z4RA 2FUNB 4J75A 1Z75A 3WNVA 3NHKA 5H9VA 1NAIA 2C4TA 3IO3A 3A3GA 4M1KA 1ZINA 2A14A 5A3SA 3HP7A 2WABA 1K6IA 1C3OB 1JHAA 1GUBA 3LKBA 2AR7A 3HCBA 3U7QB 1SBIA 2YVQA 5D87A 2QG4A 2QSUA 4B34A 1HKUA 1K86A 1EE9A 1R4MB 4XR4A 1TC2A 2L19A 2Q50A 1XTBA 2VATA 3AFHA 3ICWA 2D0DA 2TRSB 4F3RA 3ZHUA 1WUKS 1H2BA 5FQOA 3I0ZA 3V76A 3I3SR 4BJ5A 3F9IA 3FY4A 5CA1A 4EI2A 3FVQA 3W7VA 2CJWA 5CFNA 2UYCA 2JLSA 5JSFA 1CK4A 2OORA 3K0BA 4BDTA 4OLAA 1G6HA 5A06A 5KX5A 4AQYB 3PLAE 3I2KA 1JFTA 4DUGA 3GA0A 2BC9A 3TIFA 3TQHA 3V42A 2H9AA 4Y2SA 2V7EA 2OFPA 2B7CA 1JKXA 2HWWA 2CK3A 1QVRA 1VI6A 1C9NA 4DTCA 1TZBA 1I0IA 3HB9A 4Q3EA 2CDRA 3LCMA 2QTRA 4ZODA 3K0HA 3S40A 3UH0A 2ZK7A 3FZGA 3ONYA 3EG5A 2VP6A 3VR2A 2WHQA 1J49A 5AKGA 3TWOA 5JNTA 3F73A 3EAFA 3DULA 2QRNA 1H5QA 4QPPA 4QVGA 4L22A 2X8KA 3CURA 3HN2A 1H2AS 3FDIA 1P39A 3OT1A 4KO3S 2FEPA 3VU9A 4L8FA 4C04A 4RJJA 1D7OA 3D8BA 1P6QA 2GPBA 3TX6A 3TXXA 1FTYA 5FBQB 2MSWA 2JAPA 2R6R1 2ZU6A 3L7OA 4W1QA 3NOXA 4GMFA 2OAQ1 4ZVNA 1CT9A 2J31A 4JHXA 2HRDA 2YOHA 1A7UA 2B6NA 4RHCA 4LRSB 5KNBD 3BSWA 2H59A 1AU9A 5FWDA 3EVEA 3JV7A 4BAGA 3KPWA 1II8A 1CUXA 4M6WA 1Q0TA 3T7KA 4A7PA 1F2TB 3WLFA 4HAXA 1Y89A 2K2WA 4WOCA 5BOVA 2V9PA 4OIFA 1T2NA 1KGSA 1Y63A 3DS8A 4RQAA 2IV3A 3EFOA 2QV0A 5DISB 3MCUA 1CDZA 4BMXA 1WULS 3KWLA 1H65A 3VM6A 1FMLA 3R40A 1E69A 4ARVA 2QORA 3DMYA 5FV4A 1QRDA 2HIHA 2JRCA 3LGAA 3ZBUA 3TVYA 2X14A 4WK2B 1XNGA 4HXYA 1L5HB 3RRYA 1DWQA 4NCNA 2PZ8A 4YRRA 3JQEA 1JAHA 1N2IA 4MNTA 1EFCA 1Y9JA 2NZYA 1U80A 4M7WA 4WGFA 4YELA 1Z4NA 4YRNA 1Z6QA 2HDNB 3PUYA 4KQ6A 3SXJA 1KK2A 1LFDB 2WUVA 721PA 3T95A 1Y1KE 2C2OA 1R8QA 1AGXA 1EUQA 2PSJA 1W4RA 2CUKA 4KREA 3HDTA 3TZHA 2YN4A 2XRFA 1MAAA 1VGQA 3P1JA 4KKSA 4UFNA 4I5DA 3T38A 2WT4A 4CPDA 5KWEA 4A8HA 4J0JA 3D4NA 1B1AA 4AY4A 4OUKX 4KO2S 4MIEA 3R7BA 2VDUE 3CCBA 4CGYA 4ZYTA 1DEOA 2M1ZA 3ED5A 3VMFA 4PR3A 4BB0A 2UKDA 1R15A 2G70A 3Q85A 1MEOA 4NE2A 3ZWNA 4D9IA 1ODSA 4KGDA 4MYDA 4TN1A 2XF8A 4BWFB 4EUNA 1I18A 4Q3NA 1XMIA 2XZPA 1MA3A 2PSEA 2Q5LA 5EWLB 1XD2B 1CY7A 2VBTA 2Q2QA 2LDBA 5ALXA 5HVNA 4QFMA 1IQ0A 2NZ8A 2WC1A 3OJCA 4IG4A 1YOBA 4P83A 3AERA 2VL7A 3S27A 4E32A 5FO1A 2P11A 5C8XA 1UWKA 3JVUA 3KKZA 4BMNA 3CNNA 1YS2X 5KYVA 4DSUA 1L4FA 1PL7A 4P22A 1PR9A 2RKBA 3S2FA 3LYUA 1YC5A 1JQKA 1YK0A 4YT5A 4E46A 1V16A 4NWIA 2JH3A 3ZLTA 3SGLA 1JDPA 4WBNF 4G5YA 4B4UA 4GPEA 1KEWA 1O6CA 1NY6A 2VA9A 3NXSA 4FS8A 3L7DA 1RAHA 1IRXA 1LPMA 3FRHA 3FZEA 4FW9A 4UW9A 3BT7A 1OZFA 4PZLA 3IUBA 2BFBB 4QU8A 5LQAA 2XQGA 3RVQA 3TM4A 1XHLA 3QITA 2Q0SA 4CNQA 1POWA 3QX7A 3ZZUA 4FQ7A 5LKAA 3ZD7A 3LGSA 2VJKA 2G88A 1TCCA 1TJ4A 1VMDA 4M60A 4OV6B 5EWMA 5SZHB 4NEQA 4WK6A 2NU8B 3CF4A 5EZYB 1IEXA 3DGEC 2PX4A 3EASA 3AM5A 1RXIA 1W8DA 3BD8A 4PNPA 4ZO7A 1WPQA 1TVMA 4MQMA 5DN9A 5EXXA 3GXBA 4TYPA 5D2CA 4OQZA 2YCLA 1CR0A 3BH0A 1XN1A 1G7TA 1Z0ZA 3E48A 3P2JA 4P4GA 2CLSA 5BSWA 4BO0A 3T5MA 1X7XA 1Z5OA 4R3WA 4MPTA 3OAAA 1XG5A 2YICA 1JEQB 4B4VA 1R6AA 4YAEA 5T3YA 1NYQA 4DV3B 1KH3A 1JG7A 1W47A 4YRGA 2IYVA 3LL7A 4CHTA 5HA5A 1OIXA 2VZ9A 1XTTA 3JAKA 5JXWA 1BC5A 2H00A 4A1OA 1RCUA 5GAJA 3CMEB 2AR0A 4ALLA 4C08A 1YMVA 1X7WA 2JI8A 3OPYI 4UQPA 1OH7A 3ASZA 2CVQA 4EB6B 4G7XA 2GBCA 1NY5A 2PUTA 5EGSA 1DTSA 3GLKA 3NHSA 1QQ7A 2HADA 5G3ZA 5J58A 3MINB 3NEYA 3I34X 3CRRA 3I4CA 3QXJA 2C8LA 2EFHB 3OFSA 3MJ4A 1UKAA 1RBYA 1JQBA 2PHZA 3WRWA 3H4IA 2QQFA 4A0GA 2IJGX 3E3AA 1C8LA 4YUXA 1XYVA 2Z04A 3IMCA 3CIFA 5L6MB 4HQFA 2X9LA 2ADFA 3P9SA 2B0JA 2VDWB 2HZBA 5EMJA 1R4ZA 4PFSA 3SKXA 5EHZA 4OOVA 3DZKA 4RY9A 3WWCA 1VJGA 5F4JA 2AFIA 3L4EA 1G3UA 2OTCA 1IXZA 1MV5A 3B6IA 4HLUA 1RXVA 4J0GA 4V0LA 2DOKA 2WA2A 2PSDA 2LD4A 3D8NA 3IKJA 3ZHSA 2UYHA 2YWCA 2X0IA 4M3NA 1A72A 2HV9A 1ZQ1A 3GGSA 5K5EA 3G0CA 2H92A 3V5NA 1XBTA 5AJYA 3NEAA 3FRIA 4GP7A 1T36B 4FYPA 2C77A 4XVHA 4EA8A 4YCBA 2Y66A 3I9JA 2YH2A 4DRYA 3ROPA 2Z58A 4OLHA 1IN1A 5G1OA 1S3SA 2Q9CA 1KTIA 2V4MA 3IIMA 5COAA 2X9QA 3PA8A 1S8FA 1W5TA 4P86A 3OIYA 2PXXA 4Z9YA 2WHRA 4PQEA 4TYQA 2GARA 2J5RA 5JD6A 3AVYA 5BQ3A 3C24A 4G0ZA 1BSVA 3ICOA 3LUPA 3ZI4A 5KNDH 2ZZKA 2XXAB 4GSYA 2O54A 1PTJC 2QTNA 1XRSB 4WXHA 3EMVA 2QD3A 2IPOA 2Y0PA 4YRCA 3TQCA 3AXTA 4JLJA 1C7ZA 3IYLW 1BMDA 5DLQC 3DXZA 4DYVA 3EIEA 2FUG1 2Q21A 3VFDA 1ISGA 2JFQA 4RJIA 1SU6A 4U6SA 4U9IS 3DF9A 5GJVC 2IWHA 1HE2A 3N1UA 3PXBA 3DHNA 1S1MA 1I8TA 1NMEA 1U4OA 2DIEA 1ZOSA 2IL1A 2Q9AA 4Y1GA 3V34A 4ASUD 2HZ7A 4FDMA 1QO0D 1JHYA 4HVAA 4TL8A 4F86A 1HGXA 1HZZA 1M54A 5LQRA 1YTUA 1XAJA 4BO6A 1GPH1 1LX7A 2WZDA 4CCSA 5EHQA 5D7BA 1JZTA 1NDQA 2RIPA 1R4NA 5KWSA 3LP5A 1E0KA 5ALWA 4X00A 4BFVA 5J4HA 4FE7A 1AGNA 1J2TA 3ZD9A 1II0A 4F4UA 1L2TA 1QE5A 4TT3A 1VRWA 1FY2A 1EXVA 1X1QA 4LNAA 5C8YF 1YGPA 5BOSB 4L8JA 2OCBA 4DR1B 1JFFA 1P2DA 5JDCA 2VBVA 5LJIA 3LK6A 4O29A 4BNJA 3VPGA 4CQMB 1C7JA 3C39A 1DB3A 3F46A 2PJUA 4MW2A 1IPFA 2FZ4A 3JZFA 1KZ7B 3OOYA 3T3IA 1JT9A 4F2GA 2D8MA 1Z5ZA 4CXMA 2XCTB 1LF5A 4G24A 4C0LA 5LC1A 2ZE5A 3GBSA 1PJCA 2J6HA 3BWVA 3HWRA 5BYBA 3T7IA 3T9CA 2WD7A 3MWEB 1VJ1A 5A4FS 1GG8A 2IX9A 2CL0X 3PEFA 4OP3A 4EIWA 2FY8A 1TB4A 2OBFA 3Q11A 4HTFB 2V7VA 4NG4A 3QUBA 2LZ0A 2O2JA 1XLTA 2EP8A 4M8IA 4CMJA 3QW2A 1ONSA 2QM3A 1IMOA 1CUIA 2CXHA 2GILA 3TZ6A 3FTPA 3WIEA 4FEYA 4JA2A 4X65B 3RNLA 1E3EA 3BWDD 3M9WA 3RSOA 3SK0A 3JX9A 4WPGA 1GU7A 2PS3A 3OZEA 1FYVA 2QWXA 4GOKA 4GOXA 2VQEB 1B41A 2GFHA 1K4YA 3BMOB 3HR8A 4HXGA 5B2FA 1PFUA 1A4IA 1TYBE 3GARA 2QAIA 4NIMA 3PFKA 4JUCA 4FB5A 1QFJA 4I3HA 1KO7A 1H3FA 2BUCA 1FXSA 2D1SA 1GA4A 3FAKA 2ZATA 1ZY2A 3R7NA 2PV7A 4PSKA 4L16A 4AO6A 1PEAA 4DQVA 4LW8A 3H11A 1VL5A 3MGBA 4R1PA 4DUGD 2QROA 2P4SA 3DZFA 1T8PA 3VRHA 3JD2A 4GX0A 3CM0A 5AXBA 3W90A 3ROFA 4DG8A 4RCVA 4KXVA 1FQWA 3SI7A 1YI2B 2PBLA 5FYQA 3EY9A 4Q93A 3K4HA 3IAS6 3VZDA 4WDRA 3VR2D 1T6ZA 3CR3C 3EBPA 4GVXA 5E7JA 1E4EB 1V25A 1WCV1 3BGOS 4UASA 4CRWB 4TZ0A 3LW8A 4FCCA 3CRQA 5K8VA 5EQTA 5LXTA 4MYSA 4FJ2A 3Q6RA 1R9NA 4UHKA 2FR8C 2A3RA 3QX9A 3S44A 4BZWA 1KVUA 2W2QA 4ND8B 1GP2A 4Q1DA 4EHJA 4F38A 1L7AA 3BDIA 1I5OA 5HFAA 4PZ0A 4Q37A 4AZVA 2ZRAA 3TCKA 3D26A 4P34A 2ZAGA 1K3FA 1L3IA 2GN1A 1GPWB 5HQ3A 1NR7A 1O4VA 3L0SA 4GECA 4EJ0A 1P80A 2BFWA 4NG5A 4PZAA 1DT3A 4MR9A 1XU4A 2OVFA 4YMLA 1XNQB 1KEVA 4XN3A 1H4VB 4JL5A 1MP0A 2E5WA 4FGKA 5EY5B 1RE0A 1R8YA 3BTUA 4MV0A 4LC1A 5AXCA 4O2BB 4TWAA 2W58A 1SXHA 1Y3BE 1J00A 3ECCA 3GGPA 4ZOLF 2VPQA 2XAUA 1HLPA 2R8PA 1E98A 4JLUA 3HYSA 4G65A 2ZSUA 4N3NA 1Y5RA 3GLHE 3VYSB 4B9EA 1JEEA 2B83A 2QZZA 4HDSA 4K9MA 4LOKA 5BQ5A 2LCQA 5DIZA 3ROEA 4X1IA 2D6FA 3AX6A 3CRVA 4IIJA 1KA9H 4JYCA 1X42A 3BJEA 1ZDMA 5CT9A 5DRYA 2G9NA 2ST1A 4X64B 4UM7A 4FHFA 2BONA 1RR6A 4XQ0A 2OKGA 2FE4A 5LNK6 4ACBA 2QB5A 3ILVA 1EK2A 3UYLA 1YVUA 3H1GA 2RJ3A 3IEXA 2VUTA 2W6CX 3O8QB 3PEYA 4JJ7A 1M6HA 3TIIA 3W78A 2C42A 4HE5A 1TAGA 3R41A 3ZUPA 3DBOB 2VJMA 5J35A 1YAJA 4R16A 2QTZA 3VZPA 3OG9A 1QO7A 3BB3A 3AVTA 4Q12A 5K3SA 5CFOA 3G17A 5KTNA 1VQLB 3IBTA 4J0CA 2C9YA 2ZVDA 1XNHA 5DLEA 4MRRA 3JQ8A 1F1BA 3I9V6 1D1SA 4PYQA 3DDYA 4RGQA 1P1HA 1FSSA 2OQIA 4HX5A 4ER5A 5LU8A 4LUCA 1C1XB 1PEDA 1B8PA 5TNXA 3IBGA 2I4NA 3QVSA 3V7UA 1JW9B 1QZXA 1Z8HA 1KJJA 3R77A 4JKOA 2QY9A 4LZLA 4MARA 1LSOA 4TOIA 2QLMA 5FV7A 4BO8A 5CG1A 1PWYE 4LWPA 1KETA 2WUEA 4BX0A 1VLVA 4G5XA 4ZQBA 4RE6A 1SKBA 4PN7A 2CLIB 3QVVA 4KEAA 1KJQA 4MTCA 4DDUA 1J24A 4QA9A 1JPVA 1YZKA 2I34A 4Q48A 4I9UA 4UCFA 3T5AA 3C3PA 3PLNA 2OESA 2SCUA 1T6XA 1FYXA 3FLBA 4M0FA 3T06B 1O03A 4MW5A 4PQFA 3P9XA 3BXEA 3BIWA 3EMKA 3I01M 2O6LA 4HFRA 1CDEA 1CS0A 3PI7A 3PRYA 4MWDA 1ZMRA 1KYXA 2DFTA 3HKCB 3NHYA 1PU2A 4Q7KA 3SKVA 4EF5A 4F4DA 9LDTA 1KMQA 1ZAYA 4YC7A 3G5MA 1D1NA 3DO6A 1ZD9A 4JLVA 1EWQA 3HDHA 4U1RA 2D0PB 2IUTA 2D7DA 4NY1A 4NSNA 3VPXA 4YUWA 2V03A 1NKSA 3H5VA 4OXRA 3V6MA 1CNEA 4NR0A 3RAPR 2Z4SA 1G2QA 3YASA 2QL7A 1SZJG 5DK4A 1V8FA 2R66A 1DAFA 5ALYA 1MJ5A 3ENKA 5DBEX 2NV6A 1DWPA 3N2ZB 2Q8QA 3WIOA 1X1CA 4YLGA 5H3HA 4W6QA 1IY1A 4M1MA 2EFEB 3ETLA 3O93A 5EXDA 5IBQA 2YWRA 5E9AA 1ECGA 3CKKA 1GYQA 3ZNPA 4Z51A 3OUTA 3LKZA 1IE3A 2C61A 1KPGA 2C2GA 5IT0A 1HLDA 3BB1A 2FDCA 4QPZA 3VAZA 1V9SA 4AG5A 2PU7A 3KWFA 4HCJA 3IB3A 4LXQA 4UBOA 4R3NA 1YD7A 2V5AA 5C4MA 3R9XA 4P0PB 2X0JA 1CUVA 3QJGA 3CCVB 2JW5A 5JI2E 2I6FA 1GQQA 1MD9A 3GEHA 1OX6A 4O5AA 5DYTA 1DIOB 3LV8A 4HWPA 5J5VA 3WQSB 1DAPA 3JVEA 2I1VB 3C7AA 1AKTA 4TRJA 2IH2A 3OQ6A 2D1TA 3KEOA 4Q7MB 4BP8A 8MHTA 3Q6QA 4DLSA 1Z68A 4JR0A 4M9XA 4TMFA 3D6TB 3MT0A 2DTEA 1FX0A 1MV8A 4YDSA 3DVAB 5CB8A 3Q12A 4E08A 1BDMA 1PLKA 1SHTX 4G5SA 2WAYA 4DR6B 1OX4A 3CLKA 2QYHA 2FMKA 1RJ9B 1KI7A 2C9ZA 4K6HA 2DX7A 2HSWA 3A6GA 4EB3A 3IEMA 3GDGA 4CMIA 2ESRA 2ZYDA 1UFRA 5EE3A 4ZMBA 3GAAA 2ZZGA 1EX1A 1WUTA 2XVZA 5KSPA 4R9RA 4K9DA 4BKUA 1R8XA 1X87A 4CMCA 1TZJA 2W6JA 4CN8A 3KPUA 1N25A 3CG4A 1Y8RA 4FKMA 2OFOA 5HGJA 3A1PA 1U3CA 2ZB7A 1RRMA 2H52A 3U9TA 1GGHA 2OPHA 1QVFB 1E5TA 1TW2A 4E2FA 1MJFA 1ZMBA 5KSWB 2Q5QA 5KYNA 2REQA 2GTHA 1V3TA 1Y6FA 1WZNA 1E2BA 2EZTA 2VQFB 5EJIA 4B2LA 3JQAD 4JLBA 4XWWA 1IBMB 1EVJA 5JJLA 1VL1A 1Z7EA 3IKVA 4UEJA 2WWHA 2WYIA 2AZDA 1E5QA 1GKIA 1OI2A 4BFLA 2QRMA 1H05A 1B73A 2FSUA 5L3RA 3G2NA 4Y9SA 4KWTA 3GBVA 4MVWA 1GQ2A 2PK3A 3QTTA 4GZLA 5LP1A 3OWOA 4C7JA 1E1KA 1VCIA 2HWUA 4GRIA 1JDJA 4LISA 2D2VA 2IIPA 3HCEA 3QF7A 4UUNA 1B3RA 5A7FA 2YJZA 2QIOA 1XMSA 1PBTA 2NOAA 3SZ3A 2QAGC 3U16A 3PHCA 3HKBB 1Z08A 3RKSA 3S2GA 2XEDA 1QQAA 1WKBA 3PNYA 1T9ZA 4EPXA 1VXRA 1W5AA 3IQXA 5CGZA 4D4GA 3L8GA 4TT3D 4EF4A 2JGEA 4EOGA 2N9UA 521PA 1XELA 3LRXA 4Q01A 3VYUB 1QU2A 5K6AC 4LC0A 2GEVA 4TV8A 1N07A 3ZXSA 3QM1A 4FR5A 3DE7X 3C2QA 4W5NA 3JWHA 3LQRA 3PNKA 4ACAA 4RQBA 3U48A 3TE7A 3EPJA 2GO1A 3PXDA 1FDTA 1Z5WA 3F4LA 3GVKA 4DF3A 5JC8A 1NUQA 4Z7JA 1TPYA 1SQSA 1JTFA 4XUDA 2NUAA 3ISJA 3TXYA 1SUDA 5AHXA 3ABSB 3UJHA 2YY7A 4B71A 2IP4A 1D2GA 3DAHA 1EX9A 4OHVA 2PVSA 4CDRA<