1QGAA

Pea fnr y308w mutant in complex with nadp+
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
308
structure length
308
Chain Sequence
QVTTEAPAKVVKHSKKQDENIVVNKFKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGEVPYREGQSIGIVPDGIDKNGKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVYTNDAGEVVKGVCSNFLCDLKPGSEVKITGPVGKEMLMPKDPNATVIMLGTGTGIAPFRSFLWKMFFEKHEDYQFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPENFRLDFAVSREQVNDKGEKMYIQTRMAQYAEELWELLKKDNTFVYMCGLKGMEKGIDDIMVSLAAKDGIDWIEYKRTLKKAEQWNVEVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FERREDOXIN:NADP+ REDUCTASE)
publication title A productive NADP+ binding mode of ferredoxin-NADP+ reductase revealed by protein engineering and crystallographic studies.
pubmed doi rcsb
source organism Pisum sativum
molecule tags Oxidoreductase
total genus 94
structure length 308
sequence length 308
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1999-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1qgaA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1qgaA02
3LO8A 4RCZA 1QVGB 4DQLA 4C0SA 1W2BB 1QUEA 2XNJA 4YAFA 3CW2A 1XB2A 1ZM3A 2BMWA 4M2LA 1QFYA 3CCMB 3MMPA 4RD4A 3G4SB 1IB0A 1VQLB 1JA0A 3WYAA 1QG0A 2VZLA 4B43A 4RD1A 3CCJB 1E62A 4ZGQB 1VQ6B 3CCRB 4LBWA 2BVNA 4G1BA 1Q7YD 4LC0A 4PC6A 1EP3B 1CNEA 1S72B 1G7SA 1F20A 3CB4A 2OTLB 4NCNA 1KC8D 1TVCA 4HE5A 1KK3A 2EFGA 4BPRA 4RD3A 3AGQA 1EFTA 2CRVA 4PC2A 3QSYA 3MHPA 3JQQA 1VQOB 1GR1A 3CCLB 3I55B 3CD6B 1BX1A 2QA4B 1G7CA 1M90D 1N0VC 3U6KA 3OW2B 3CMEB 3MCAA 1W34A 3OZWA 1QUFA 1QFJA 3W5UA 2J7KA 3OJXA 2RC5A 4Y9RA 4YALA 3ZZ0A 2RC6A 5FA6A 1YI2B 3B78A 3CC2B 4PC7A 1KRHA 4B3XA 4C43A 4TMZA 1AMOA 2BGIA 1TTTA 4P6VF 1YITB 1Q81D 2FX3A 1JJ2B 3ZZTA 1H42A 4PC1A 4K1XA 3OZUA 1FNMA 4G1VA 2QN6A 2PLFA 3W5HA 3WY9A 1CNFA 1E64A 1YHQB 3G6EB 1FDRA 1D2EA 3WBKA 3W2FA 1GO2A 1NDHA 5DSZA 1ELOA 1SM4A 4R71A 1JB9A 5EMNA 2C78A 1K8AD 1OGJA 4AF6A 1VQ4B 2YWEA 1A8PA 3AGPA 1GJRA 4PC3A 3CPWB 4B48A 1D8TA 4M0LA 1GAWA 2BV3A 2VYQA 4IW3B 3CCUB 4H9GA 4RJLA 2HCJB 1OB2A 1BJKA 3W2IA 1QH0A 3AVUA 3CCVB 2VNHA 3CC4B 1VQ8B 2VNIA 1QGAA 2E1RA 3VNUA 4ZV4A 2DEUA 3AVXA 4FN5A 5TR9A 2R6HA 5AN9A 2QMUA 4QHYA 3J81k 2BGJA 1BQEA 1KK0A 1B23P 1DDGA 2DY1A 1OGIA 1IJFA 1J9ZA 3QFTA 1YJWB 1KQSB 4M1KA 1BX0A 4Y9UA 4RD2A 4YHBA 4EH1A 1VQNB 2C77A 3A1FA 2HDNB 1E63A 4TMVA 2ZITA 3W2EA 1W87A 3CCSB 4ZCIA 4ZGNB 1EFUA 1DG1G 1EWYA 1DARA 2B5OA 4AC9A 1K73D 1ZM9A 4RCYA 3I56B 1QVFB 2OTJB 1R5OA 4MYUA 3W2GA 5TY0A 1FRNA 5H59A 4QFMA 3CRZA 1YJ9B 1B2RA 3ES9A 4M4SA 1VQKB 3CCEB 1S0UA 4ZCLA 1I7PA 3CXCB 2XNCA 1KJZA 2AHOA 2BM0A 3VNVA 1DDIA 4F7DA 1G7TA 1N8RD 1NJID 3QFRA 3W2HA 1W35A 1EXMA 1AIPA 2QTZA 1H85A 4WQMA 5THXA 5TV2A 2NPFA 1GVHA 2X3UA 4TMWA 3VMFA 2BF4A 1UMKA 1KK1A 3P26A 3WBJA 5JBQA 1JNYA 1TLLA 3FJOA 1K9MD 1VQMB 2DCUA 4G5GA 1EFCA 2GPJA 4RD6A 3AVWA 2DETA 4TMTA 1QFZA 1VQ5B 3V76A 1Q86D 5KSWB 2BM1A 1TUIA 2EIXA 1EP2B 3ZBTA 1Q82D 1QX4A 3AVYA 1EP1B 1ZM4A 3I1FA 4HE6A 4RD0A 1OB5A 4B44A 3JQRA 2BN4A 1ZM2A 5GV8A 3AVTA 1G7RA 2PMDA 4TMXA 4LBYA 1CQXA 4LBZA 1VQ9B 4N3NA 4UAJA 1QGYA 3ZC3A 3PENA 4B47A 2YWFA 3ZZUA 4YAUA 1FNCA 2HMAA 3CC7B 2D74A 3SJZA 1HA3A 3OJWA 3P27A 4YAWA 3ZBUA 3VO2A 1R5BA 2QTLA 5GV7A 3E20A 1FNDA 4YAOA 4ACBA 4M53A 4MYTA 4FWTA 1R5NA 3AVVA 2PIAA 4FK8A 3WNCA 1KD1D 4ZCMA 3WNBA 1XE1A 1F60A 2QDXA 4P3YA 3G71B 4PGOA 3QFCA 4ACAA 3E1YE 1WDTA 5HXBA 3VO1A 3LYUA 4DQKA 1QGZA 4LBVA 1ZUNB 2YWHA 1GAQA 1YIJB 2XEXA 4NBSA 1FRQA 3B8HA 2CNDA 3W5VA 3WNDA 3QE2A 1FNBA 1VQPB 3U2QA 4N3GA 2GQFA 2DERA 3LVBA 2YWGA 2OK7A 3JQPA 3CCQB 4Y7CA 3B82A 3CMAB 1JA1A 3OZVA 2VNJA 1YJNB 3FPKA 1SKQA 2B7BA 2BSAA 3WXMA 1KTVA 1IJEA 4AF7A 1VQ7B 3LRXA 1N0UA 4J0QA 4TN1A 2VNKA 1M1KD 4U9UA 5H5JA 4B4DA 1U2RA 2OK8A 2BPOA 3U6BA 4Q7JB 1D1NA 3QFSA 2B7CA 1KK2A 2QEXB
chains in the Genus database with same CATH superfamily
4GKKB 1VDZA 2XH8A 1NN5A 1UWKA 3LWBA 4HDQB 5HF6A 1W36D 5M3BA 5FIUA 2ZYHA 3WGQA 2DBQA 4KRXA 1DL5A 4CCAA 2ZE7A 3IP8A 4WLUA 2QZZA 3MCTA 1T8RA 3N76A 4HUQB 1GZUA 2F90A 2B9EA 4WZEA 4UOZA 1ZH6A 2WJWA 2SKEA 3DM9B 4MKZA 2NUBA 2HC9A 3AESB 4N9WA 1BNCA 2MSCB 4TLBA 5DKFA 3AFIA 1GGFA 2E21A 2JGEA 1X1RA 4XCVA 1PL7A 4ZYWA 1QIMA 4XPIB 4QVJA 4M88A 5DWDA 2C3UA 3A6FA 3WKAA 3RU3A 2OV3A 1UJBA 1NXOA 4F6RB 4G7XA 1JQBA 4IPTA 4WOCA 4A27A 4H6WA 1UBNA 3TW0A 5CW2A 1TEXA 5FLEX 1VQ6B 2O05A 5AHRA 3H11B 1SVMA 3E23A 3L6BA 3PNPA 4MUYA 1KYVA 2IF0A 3P45A 3RO7A 1JNXX 3PA8A 5C8YB 2JG3A 4N7BA 1GSOA 2DUMA 3KZNA 4HGOA 1Q44A 5KDOA 2GSWA 1CNEA 1YKGA 4EGJA 1PNQA 4B76A 2D3NA 2IDZA 4PZDA 3ZDAA 1A9TA 4YRIA 3W8FA 4P38A 2Q6LA 4BZZA 5K8VA 3Q5EA 1DU4A 1TYZA 2JLBA 4F96A 3HDQA 5JD3A 5ENDA 3KHTA 4DMUB 4OOXA 3M83A 4E12A 5LM3A 2X6TA 3OPYI 5HIMA 4AN4A 3FPSA 5I5EA 2CRVA 4RK0A 1ZY2A 5CIWA 4PC2A 2B69A 5AKXA 2GXAA 3OZEA 4UVHA 4ED9A 4FS3A 3WWZA 1EWQA 4A0QA 3JYOA 2DUNA 5C52B 1MV5A 3E2IA 4X8HA 1FMTA 2QGGA 3AIIA 3EXEA 4L57A 5T6BA 4RHTA 1SXPA 2GBPA 3ZY4A 1EX1A 1KSJA 2XSZA 1KYXA 4JD5A 1IB6A 1U4NA 3STUA 4ZI7A 3B70A 3EPKA 2QMEA 2WAYA 3CWZA 3FMVA 3EGXA 2Z58A 4OD0A 2XZOA 1MOSA 2XCUA 2ZB7A 2AG6A 4BNIA 4HNAA 5KOJA 3TG8A 1UKYA 3KDAA 4MGYR 3I6YA 4QUHA 3VV3A 2RH4A 5IC4A 3JD1A 4V0LA 2SKDA 3GCZA 1XZEA 2ENUA 3ZQ4A 3NWOA 2A2ZA 1YCDA 2J09A 3DDNA 3HV2A 2NSLA 2WZQA 2CFOA 3CY6A 3PGMA 1OI2A 3SDZA 2ZPTX 3S0JA 5BW5A 1BVHA 1UWCA 3I4CA 1UKVY 4EL0A 1EJ6A 3TPCA 1UM8A 1FU8A 2GRAA 1C0LA 3AEXA 2GHTA 2BFCA 2PUWA 2ONCA 4TS1A 5HE9A 1LCIA 1TA4A 4QELA 1PJ2A 5C34B 5I7OA 3R5TA 1Z16A 2DUUA 4OLHA 3DE2X 5AM4A 3QUCA 1Q81D 2BCJQ 3NYWA 1FEZA 4A91A 4CKEA 1CIPA 4CV3A 3CO0S 2HQBA 1O57A 4UCFA 5GZ6A 1HO3A 2ZBDA 3IBGA 3PV0A 2B4TO 5AVOA 5LVAA 2M98A 3VSDA 5IBPA 1X80B 3P2IA 3PWZA 4LVUA 2QRKA 1EJBA 2ZRDA 4MWOA 3LWDA 4K1XA 2XAAA 1IY2A 4DIBA 1FNMA 4G1VA 3LNTA 4YMSA 3GF4A 3W5HA 1Q1BA 2JIZD 3HMQA 3LC2O 3H94A 1M67A 3HVIA 5LA6A 4AQ7A 5K0GA 2GK3A 2B6HA 2W8BA 1QPZA 2O8BB 2ZT5A 3C3XA 4LE0A 3HYNA 4TLMB 1VKZA 1WHTA 2XVAA 3S2GA 3U80A 1FDRA 1M2JA 3NIFB 1EA5A 2AC2A 3GVCA 4INZA 5BUZA 5JARA 5FTJA 5TS3A 3LPAA 4OUDA 5B57C 1Q12A 2PGNA 3OTOB 1T6YA 3RUHA 4DCSA 1SCBA 1QH1B 4F6LA 2OVFA 4YCMA 1T43A 3DD1A 4JAVC 5KYYA 5DGIA 1V35A 1RQ7A 2IH5A 9ATCA 2B1GA 3T7DA 3UATA 3WDMA 1ZW1A 2JHAA 2HUPA 4KOAA 2W58A 5CW1A 4A0GA 2Q41A 3LL4A 2DR2A 4DG8A 1SG9A 4IFIA 1V47A 4GGPA 1VG9B 2OD2A 1W0JA 4YECA 3T4PA 3INRA 2ZJBA 2UYCA 1OE0A 5IDQA 4FKMA 1MORA 2IT1A 3PEEA 4PCUA 2Q6VA 2WLTA 1EB9A 3C48A 3DEZA 2G8LA 3HN6A 1V8OA 1W8IA 2XE7A 3CCUB 4ZOLA 1YCHA 2DQKA 3ENNA 3T9BA 1A8SA 1VCNA 1P1RA 3W8DA 2J3KA 2XGMA 4P33A 2AGVA 1QH0A 2MTBA 4UVIA 3BMCB 2PBZA 2MYPA 3FLAA 5CNJA 3EXHB 4TZTA 1CQPA 3C3PA 4FJ2A 3FCEA 4GZ5A 1B14A 3RH0A 4KXWA 3UJ7A 5ECYA 2GM4A 5CT4A 3TDNA 3B9RA 3ER9A 1XWIA 221PA 2FZEA 4PHCA 4YH1A 2Q62A 4I4TA 3AVXA 5H81A 1V3UA 3TXYA 1CY6A 2PZJA 1C0PA 2G72A 2Y1FA 4N82A 2NU9B 3ZUPA 2GNOA 1DAOA 5TR9A 1K97A 3EDMA 2PRSA 5DYGA 5A0VA 1KZLA 3Q41A 2DJIA 2QMUA 1XA0A 4W6ZA 1RNLA 2YHBA 1MH9A 3V1LA 4EDHA 5KTTA 5IVIA 1CBUA 3DBOB 3CUEF 3DDCA 2JVIA 3MTQA 2YMMA 1NX9A 1P74A 5TMEA 5C18A 2JJ2A 4JBYA 4ZYZA 1GKKA 4JLUA 2OBYA 3BZUA 4M0DA 4MH0R 3QFTA 5KTPA 3FFTA 4OP1A 3EZFA 2ZLBA 2NUPB 3ZHBA 4LK2A 5ADUS 4I6GA 5BN3A 3FCXA 3IRVA 3EXHC 4JU9A 4E5SA 4QBHA 4WH0A 2B4QA 2JFQA 3KDSE 3QEOA 3T7TA 4AWXA 1PJZA 3AM5A 2O19A 4YJHA 4RD2A 4LIPD 3UO8B 4IIVA 2OOSA 4RV9A 1ORRA 3VZRA 3LX6A 4A2PA 3A1FA 5CT8A 1MC1A 3HYLA 3JRWA 3OLVA 4I1OA 4CHTA 5BR7A 1J0CA 2FQXA 4H3KB 3E9ZA 2BCGY 1WUJS 3H2KA 1SBCA 5AXAA 1R9JA 5KNBD 2H9AA 4MAAA 1R1DA 1W87A 2OXFA 2W90A 5FXMA 3CCSB 2IPNA 2ZRPA 3THXB 5F23A 3B36A 2RARA 4KNWA 5IN5A 2JGNA 2WNHA 4WVLA 4OG2A 1RJWA 6ADHA 1Q21A 4XLLA 2FMHA 5DTRA 3QRWA 4P98A 1BXGA 2WILA 1E69A 4G41A 1R0YA 2HLPA 2XXJA 2BTQB 8LDHA 5K8IA 4M0UA 2V4ZA 5K8LA 1KKUA 1VL6A 2B5OA 2Q3FA 3BRQA 1YH3A 3K1ZA 4FNGA 3QU5A 3Q0EA 4DUYB 3GH3A 4DDVA 1ENZA 1ZXLA 2R8BA 2XMQA 2Z3ZA 2ES4A 3IJ5A 4F2PA 1XVVA 5IT9A 1X19A 1C3LA 3B38A 3PVZA 5LOVB 2XT0A 4D5EA 5J1TB 1Q16A 2O0JA 3IDFA 3KXIA 1ZD8A 3PUYA 4NJOA 4Z1OA 1IXSB 1Z5GA 3T4EA 1GZSA 3TTYA 4QFMA 2EW2A 3NIBA 4GMGA 5CXSA 5FQOA 4PTYA 2OCKA 2Z6AA 1Q7CA 1GN9A 2YZKA 4OY3A 1XRMA 3GOQA 1PR0A 2M6LA 4YT2A 4C7XA 1WU7A 1O0BA 4UFOA 1LVUA 2C5SA 3NBKA 1I7DA 3E3OA 4JJAA 1X1QA 3OF5A 4OV6B 4IQ4A 2RKOA 2CYAA 1YUBA 4BZQA 4TLAA 2FP3A 5JASA 5L6LB 4PYNA 3OAAD 4ZIRB 1N2XA 5DULA 4HAYA 2JRCA 2IXFA 5LZ5A 1IWPB 4MIKA 4MI3A 1XQVA 2A1UB 1V9LA 4GNKA 3D4BA 3ASTA 2HLHA 3RF7A 3WAKA 3ZNPA 5K0BA 2I6GA 1XVUA 3OC0A 4XQCA 5IU6A 1RWVA 2AFHA 3QUQA 3ONUA 4WT7A 5F33A 5F2EA 1R4MB 2HA2A 1P45A 3GROA 3OIWA 2WG0A 4MUBA 4GOJA 1T1JA 3AI3A 2ZL7A 4NR0A 4H7PA 3NAGA 1C0EA 4QUIA 2V5UA 1ORWA 2AEEA 2ZE8A 3ANLA 3HLKA 4G07A 3LBNA 3B6JA 3FF4A 4UFPA 4WQMA 5THXA 1H85A 1JDNA 4A3SA 2ZP1A 3KTFA 5JG7A 1N6HA 1P1IA 1SULA 3RVDA 2RHRA 2IELA 1GVHA 3ESXA 3HACA 2ACWA 1PX0A 1DNPA 4IQFA 4BWVA 1ZYUA 1N77A 3L7YA 1U9CA 3LBYA 1NVTA 5DH9A 2VT2A 5BY2A 3GLFA 1E8MA 1JNYA 4KR9A 1IM8A 4HYEA 2NVWA 3DE5X 4HBZA 3INYA 3DW3X 2BBWA 2ZVQX 1B0UA 3IXQA 5DW3A 4IF4A 4URWR 3H83A 2F3QA 3FI0A 1UDXA 1RWKA 4JMQA 3VVMA 1O94C 1BH6A 3OTWA 3COJA 1PYDA 3GK3A 1VTKA 2AVDA 3KFVA 4Q21A 5EHXA 1JU4A 2PCLA 3UYKA 2WIDA 1ZVQA 2N1MA 3WLQA 2O3UA 3DP7A 3IVXA 3QOFA 1SUDA 4Q00A 4UVDA 3AVWA 3KT3A 4TL7A 4NTZA 5F7XA 1M76A 2WJPA 2PJZA 4TMTA 4RIIA 3UA4A 1K7SN 2IOQA 4Q1CA 4YRAA 2AA3A 2BMDA 5DJ5A 4PPNA 1H2AS 3O1JC 1B26A 1ADFA 4KB5A 4MUFA 3T7RA 2A5YB 1EU1A 1EP2B 1A9QA 1P7ZA 2SECE 4XFKA 4LFBB 3O8RA 4JN6B 3PDIB 3BXXA 4XX0A 1UMBB 3NHUA 3QPVA 1OLOA 1UKZA 5K3DA 2EDAA 4DWVA 2QNRA 1ZUWA 2XRZA 1VL1A 4GLJA 5EIFA 4ZGWA 2C3YA 3GA7A 2XUFA 4NMMA 2FW7A 3AVTA 2W2MA 2OMKA 1P29A 4QASA 1DZIA 4G7WA 1VQ1A 2CVQA 2D1FA 1MGOA 4F46A 1SGWA 3PFGA 4XE5A 1SXJE 4TMXA 2QTCA 3W9BA 1OYYA 5C51B 2XHEA 1Z5WA 3UMGA 6GPBA 1QU2A 3DT6A 2CHFA 2AE1A 3K0AB 4LNHA 3PENA 1VHQA 1VPVA 2JIMA 1Q6YA 1X87A 3BBLA 3OEYA 2VJQA 4IXTA 1RWMA 2GBLA 2R00C 3KAPA 1RFGE 2FFHA 1DC7A 4IQ8A 4WZAE 1HTTA 1TNDA 2OFFA 4HDRB 5K0ZA 5J63A 3L93A 5TMBA 4KH0A 4UUAA 1MJ5A 4EG0A 3COYA 3EA4A 3PRHA 4MVJG 1JAIA 1KSHA 3P2KA 3I52A 3UOWA 5KOHB 4JXJA 2QX9A 4C20A 5G0VA 5JO9A 2FVGA 5K6AA 5J4LA 1WCIA 2CLSA 2JA2A 2OG1A 4PNEA 4KMSA 4DLTA 2WOJA 1HTWA 2WUEA 4U7HA 3RS0A 3LXXA 5KKNB 2PAFA 4WAUA 4BXOA 1USIA 2IUSA 1M8FA 1TADA 4ENSA 2O8FB 2HMWA 3FB4A 4IG4A 1IQ0A 3P0HA 4BO9A 3SC3A 3ADPA 5BW4A 4R69A 4DLVA 1PJ4A 5T3UA 2PU7A 1DPGA 3LLCA 4FWTA 1RWWA 1ID1A 5JSFA 2YZGA 2CUKA 4A0HA 1G19A 3ADBA 1EJ2A 4MUXA 5DGCA 1CY7A 3V8QA 2FE1A 4K0KB 1DEXA 2P3LA 1P0IA 1NVEA 4JUIA 1QWSA 5E1MA 5LP6B 2O2EA 3U7IA 4Q93A 2ZETA 5K0FA 2ZRCA 5K0CA 1CRZA 5GM1A 3IHKA 5LIPA 2I62A 3FWHA 2JFZA 3WIVA 4JLSA 3FTDA 3SS7X 1GPH1 4JLJA 4PLTA 3E7XA 2G1KA 1ZUNB 2YWHA 5K1ZA 3MGCA 4NOLA 1SZPA 1XRPA 2BW0A 2I03A 3HYTA 2SICE 5AIAA 2B37A 5K3FB 5MGNA 1RCUA 2PXAA 1QKKA 1U3WA 1XXHB 2ZYRA 3CBQA 2Y9PB 3AIOA 1K7FB 4EVQA 4MW6A 2NZ8A 2ARKA 2PSDA 5I9TA 3FOZA 4DYDA 1U0EA 3PLRA 3IP7A 3OLQA 2ENWA 3LQ6A 1SXHA 1U1FA 2H11A 3GPBA 3DPUA 4L5AA 4ND6A 4QDTA 3WLPA 1UBKS 2BKUA 5LMZA 1YULA 2X6YA 2WM3A 3JQBC 4MHSA 4J76A 2IDKA 1WLSA 4LY3A 2DRIA 2YZNA 3UY4A 4CQJA 5CFNA 3LVBA 1TRHA 5GGYA 4JROA 9GPBA 3KVYA 1N06A 2HV9A 1JEAA 1TFUA 2B61A 1ZBDA 2QAIA 1UPAA 5LP6C 1MPTA 2E6KA 2P79A 2Q07A 3EBLA 5LLSA 4EUFA 3JQEA 3FYSA 1OKKD 2H2FA 3LCMA 3LRPA 1S2GA 4L0MA 1AK2A 1KEUA 1BN6A 3CZMA 3DZIA 1XU7A 3IPCA 3KZKA 1ZNYA 3AQ4A 1Z82A 4IJKA 1T0PA 1FS5A 3TR5A 1RI3A 1BCSB 1R15A 4IGFA 4ZDKA 4N40A 1GV1A 4FGSA 1V7ZA 4Y1GA 1T0JB 3EDOA 1JYFA 3BH0A 4JUAA 4DJDC 1VQ7B 1DRWA 5BYJA 7YASA 4ZDIA 4I5GA 1ZGCA 2AZMA 1CZNA 1QOQB 2ODPA 4QPJC 4XUEA 4F2DA 1B6TA 5SY6A 3LYLA 1RLTA 4XM3A 2G8NA 2H07A 3IXLA 3N8KA 3TKAA 1AHHA 3U7RA 1ORTA 3PUMA 3IQWA 1IPFA 2HSEA 1PR9A 3DVAB 3QBJA 4BRZA 4QM7A 2AW5A 4GI5A 1L2TA 5PNTA 3OF3A 4NATA 1YJBA 4JT2A 2J5QA 2N1BA 3ABQB 4IDOA 5BR8B 2OV6A 1H4QA 1P1KA 1TTQB 4EMSA 2EQBA 3GY0A 3QVOA 1SR8A 3R5HA 5ULLA 3VXKA 4BMCA 1F2TA 3UVEA 2CJPA 5BQ3A 721PA 1RQXA 1JHPA 4HX2A 2J0UA 4M9QA 5JAZA 2ATXA 4IDDA 2EHDA 2C7RA 1DAKA 3WADA 4GIBA 2QX8A 3VZBA 3KXLA 2R4QA 2C95A 5ARCA 4U00A 5J2TA 1L8OA 2HIMA 4OH1A 4A8TA 4BP1A 3NHPA 4CT4B 1ACLA 1GILA 1PGOA 5JFOA 1U0JA 3HXPA 4JNCA 5TF0A 3IESA 3Q7RA 2ZJFA 2ZBQA 2OV2A 4XZ3A 3UW3A 5ICSA 4YAFA 3MWYW 1EX6A 4TLDA 4B6OA 1N36B 2Y93A 2WJIA 1K8RA 3CCMB 1NR1A 4HQRA 4LRQA 4M86A 3OU2A 1T3HA 1EHYA 1QP8A 4MVJI 2ZRKA 4BFYA 5JSUA 5KCZA 2IHZA 3JALA 5CG2A 3WTBA 3N2EA 1DIAA 1RMYA 5J3OA 3IE0A 3BMQB 5FI1B 1JWLA 1OBVA 4F9GA 1O6ZA 3H6GA 4YDHB 1WW2A 4FFWA 2F4VB 4F3TA 1T5OA 3VU8A 3LF2A 4B6SA 2G25A 4BGDA 2OXEA 4HQ0A 4AO6A 4X1OA 1Z47A 3NW9A 1NW9B 3C6KA 4ZT3A 1PG5A 2QZPA 3DTVB 1VJTA 1R0ZA 1P3DA 3G8YA 3N87A 3QVLA 3LO5A 4L4UA 1C3VA 4C4ZA 1QRTA 5DLDA 1SU6A 2QSZA 2VDVE 1ZITA 5C5EA 1QLWA 1NQWA 4DC0A 3IKTA 3OD5A 1XVTA 3S2YA 3MA0A 3ABZA 3QPUA 3GG2A 2WZNA 4IHQA 2A30A 5D1NA 1JI0A 2BT4A 1PWHA 1T6NA 4GI2A 1NJSA 2FFAA 5G4KA 1B7GO 4UM9D 3CWQA 1E2HA 3RTEA 2AJDA 5JCJD 5H3HA 3TOSA 3ZQJA 1U9YA 2CJWB 4R9UC 1XZHA 4KPEC 3OT1A 3NATA 2C61A 4BO1A 4RGQA 1M2OA 3KCQA 2PO7A 4IKEA 4U7JA 4KL8S 3X44A 1F5SA 4B1FA 4W8HA 1Q0QA 4AULA 2WIAA 1ONPA 5I4CA 3C70A 3UMYA 1J00A 2QM8A 2GBCA 1T24A 3FGPA 1U7ZA 3GDHA 3FRJA 2W11A 5HZMA 4LMPA 1LVGA 3L8CA 3D0RA 1FOEB 3CLSD 4OU4A 2E0IA 3GMTA 4XYMA 1J90A 2NU6B 3MAAC 1GZDA 4AY5A 4LJLA 3EDYA 4ZCTA 1T1GA 4WESA 3R44A 6YASA 1C9EA 4GWKA 2NADA 4KOEC 5K0JA 4FFLA 1HE3A 4IIHA 3B3JA 3B78A 1NMYA 4I3GA 1TU3A 1Y80A 5KJ1A 1KRHA 3S2ZA 4QSMA 3UMMA 1QYCA 5JSHA 4M1ZA 1Z37A 1P0CA 2WYHA 3D2AA 5CEEA 4JJ4A 5IM5A 5JFTA 5KZMB 4MAFA 3PVCA 4LMAA 1VE1A 4CM3A 1Y7LA 3QU4A 1QK4A 5L3SA 1GNTA 2QM0A 4YEDA 2QTNA 3OEED 1I32A 3A32A 1WMEA 1FP4A 3H2ZA 4FONA 4C3OB 1U04A 3AUAA 3E9YA 2VNAA 3G2NA 4FJ0A 4DIOA 3HA3A 1GAXA 3DUFA 4WOPA 1W47A 3GLGE 4YUZA 7MHTA 3TRFA 1TKAA 2C9ZA 4K9QA 2XNSA 3LT1A 3GVLA 3HP1A 3A1NA 4G9BA 3TX2A 4CKWA 1M0WA 3WYFA 4KK4A 4K8RB 2FV8A 2HHHB 1UXOA 3P9PA 4ND4A 2MYNA 2JW5A 2NV0A 3TLBA 5BSEA 3SJBA 3MAJA 4FDTA 1DKUA 2QMYA 4K9PA 5C53B 4MWSA 1EE1A 3MTDA 4ZQBA 4O4LB 4W4TA 4PZPA 1DV1A 3ANTA 4EI9A 3FNQA 2JAOA 1HYQA 3QI7A 3CB2A 3EZ2A 4KX5A 4OI4A 4NIMA 1T9CA 4QVKA 5TQVA 5K8TA 4XB1A 3K1JA 4UXHA 1K5PA 1CWUA 2D5LA 2GRUA 2WU3A 5COQA 3UKDA 2A0UA 1WQ1R 5BR1A 2BHNA 4E07A 4G0PA 4LXQA 4R2KA 5DHUA 4CIYA 4JQZA 5KHOC 4G5RA 1GJRA 1IHDA 2H2DA 1PFWA 1S2OA 5C8YF 5GIOE 1XEAA 1YOVB 4HQOA 3L0OA 3AM4A 2H2WA 3NANA 2I1WA 1VPDA 2QW0X 2WY2D 3OAAA 3WYCA 2VP9A 3PICA 3TZHA 4M0LA 4DMGA 1GAWA 2ZI9A 2JH8A 3L92A 1ZSVA 5EEGA 2VYQA 4MUGA 4C01A 2OGUA 3FM9A 2QTAA 3WSVA 3DFKA 4HYQA 4G23A 3HDJA 1W5BA 3WO1A 3KB6A 3F9IA 3L8HA 1NXQA 4I2NA 1BXRB 3IP1A 1JQAA 2P2ZA 4JLAA 3Q0IA 3MUFA 1T9HA 4B3JA 1N1EA 1BQ4A 1Y8QB 2EXXA 3RRMA 1CJMA 3VKFA 4XDHA 4R8MA 4OL9A 1XD2A 4HDSA 3GXOA 5D7BA 4KPYA 1OYVA 3C1TA 4HN9A 1FFCA 1TCCA 4Z7QB 1YA6A 5CM2Z 2CMFA 2LKCA 3OWHA 4X85A 1D2HA 2XTAA 2LUOA 4BTVA 5ENZA 1W1UA 4EYEA 2J6BA 4ENPA 3NBUA 3H5WA 2JGRA 5F52A 4GSKA 2Q3JA 3ZPNA 4N6NA 4TKMA 3I45A 2HEGA 2WWXA 3VZCA 3T0FA 2KM1A 3NOQA 1PZFA 1YE3A 3NIWA 4M1WA 4AICA 1PT9A 5A4AA 1P3JA 2RSLA 1N2CE 3E61A 4ND2A 2YFYA 4PLCA 4YR7A 3ZZ1A 1VJGA 3JRXA 4XW2A 5G1NA 3T9CA 3HJAA 3HJBA 2VEDA 1JR3D 2XV1A 5CH3A 5JWHA 1ZU4A 2RGXA 3TUZC 4RDIA 4QT4A 1EWKA 1CYDA 1ZEJA 1RD4A 2BGNA 5ILQA 2VPTA 2ZATA 2RMKA 3ZK8A 3IEXA 2ZYDA 4FLMA 2OXCA 3IR5A 2TS1A 3RU2A 2VFAA 3ZD6A 2QMOA 1PSWA 3PXXA 4RHFA 5E9AA 2ZRIA 3C14C 2FWMX 1OJ7A 3D6UA 1N3BA 4X6UA 4ZAFA 1W52X 5HA5A 4Z2AA 2D62A 3DOEA 4EH1A 1QANA 3G85A 3HP7A 1EVQA 2QU7A 4X94A 2OCBA 1ZXBA 2VQ3A 3OZRA 3IUEA 4US1R 3FIJA 1CE8B 1VHEA 1UKEA 3SSNA 3E3NA 2YC4C 4KO4S 2GS9A 3I1IA 4MLZA 2GZDA 5FJIA 1DIOB 2KBFA 3AF0A 1PR3A 3KZ1E 4RVHA 3H5OA 3D2CA 1MVLA 4GECA 5ALIA 3VYVA 1IN7A 3GFOA 4QPDA 4MPDA 3QEAZ 2BZSA 4HJXA 2E4UA 4MB6A 1ADBA 4HZGA 5BOVA 4OQZA 2P27A 3LQ1A 2J32A 2WV7A 2E87A 2PFKA 2Q2WA 3C6QA 3G1UA 5G4LA 4PXSA 5B3LA 1QVFB 1IOVA 1ECJA 1QC5A 5AIBA 3UK6A 1D1TA 1PTKA 3EYWA 1KNQA 1Q6ZA 4MYUA 3DMGA 3AWIA 3QITA 1GPAA 1FLDA 2X13A 2ETXA 4K9LA 4NX2A 3TI7A 3CVUA 4L72A 1OZFA 5EJAA 1IDN1 2FPIB 3ZE8A 1AK9A 5ED4A 3AY3A 1UIRA 2HRZA 4HZIA 3NPMA 3SDSA 1YJ9B 5CAEA 3KQOA 3GUYA 3KWMA 3QLUA 4MCJA 2Z6QA 1KZGB 2PT9A 4M0FA 4RU1A 3O0DA 3RS7A 3F74A 3F7TA 4UJ5A 1SD2A 4X20B 1HT2E 3MTJA 3O2JA 1XD8A 1JF8A 1QFSA 3UFXA 5JZVA 5KO2A 2VH5R 4DC9A 1SBTA 4P4UA 2JLCA 3ANXA 4QQRA 3USES 3V1YA 2XNDD 1XCGB 2JBHA 1OAOC 5TQ0A 1JILA 4EQZA 3ETHA 2E37A 4DPKA 1FJ2A 1SIWA 3GJ3A 4G4SP 1XEXB 4M7RA 4UC0A 2WP8J 5DSTA 3UK7A 4RTNA 3LDAA 1JLRA 1O1YA 4WA7A 4V2IA 4QJ5A 3L04A 1RVV1 3WK4A 3UWOA 3T4UA 2P30A 4NCIA 5IAKA 2HJSA 3O73A 1VXOA 1EI9A 3CT4A 3HJTA 4UHKA 1LLUA 4D26A 4RH3A 1ZIPA 4UNSA 1SXJB 3AH8A 3UIEA 4V24A 1KI3A 3TQSA 3CIOA 1GFSA 1N6OA 3I72A 4DV2B 1ZK0A 2XVYA 4URYR 4X0CA 3ANMA 4PWYA 4PZ0A 4AXBA 1U8EA 3M0EA 4WFKA 4XFDA 1O5OA 1JB1A 3CRNA 3F8TA 4WZAB 4YBZA 4US2R 3OTGA 1OXXK 2FZVA 1WY7A 3OKPA 4Y6SA 5JSKA 3WG9A 5HW0A 1GNQA 1CUZA 3ZCQA 5C1BA 1C7JA 3ECCA 1SA0B 3T7EA 4EKNB 3RRZA 2ONJA 2A9QA 2V7VA 1GSAA 4R1OA 5I7SA 5JHGB 1ZD4A 4Q1AA 1YVEI 4BBPA 4RHCA 4O4JA 4B9AA 4JYZA 1YS4A 4JLVA 1G4UR 3GRPA 2DSNA 1NULA 1T2UA 4Q4AB 1IYZA 3G1TA 3R0QA 1MD9A 2JIQA 4EEKA 3SR3A 1IL0A 5DIFA 3WLKX 3ZCVA 1T8SA 2X0EA 4QPNA 4JEIA 2VUIB 1SXJC 3OZIA 3VVBA 5KYUA 2EKPA 5YASA 1OZHA 4AQYB 1Z7EA 2UVPA 3MTIA 2O8EB 5DX8A 4RSHA 4WINA 1DLJA 1T3SA 5C31A 1VRCA 5EESA 3U81A 5B12A 2K2QB 2EFCB 3A6EA 1U5BA 3CW9A 5AJZA 3EZYA 3W3AD 1N9KA 3IEVA 2AVNA 2BN4A 4U3JB 5GV8A 1D0VA 1MEJA 3MWDB 1BO6A 3MRVA 4HADA 1ECFA 5CBPA 4MYSA 3PJGA 5BUSA 2H00A 4Z4UA 3Q11A 1FFAA 1YRBA 4UEQA 1S2LA 1GNSA 3SFTA 3R6DA 1ULBA 3PRKE 5LZ7A 1IG3A 4DA9A 4ZYTA 4CM4A 3HWRA 1TZKA 4RORA 2OFPA 4NYMQ 4BQEA 4WGFA 3HFSA 5IANA 4JLKA 5JC1A 3KJZA 4FYJA 3ZGLA 4FR5A 4DRZA 3H6HA 1BW9A 3JSXA 2D54A 4MIYA 2EV9A 3UJ3X 4X7DA 4K6MA 2CXNA 3C8ZA 2Z8YM 5DEIA 3RAGA 3CVWA 1UIMA 4PYJA 5DISB 3G0OA 2VJPA 2FI1A 3FPJA 4J0FA 2XMRA 3KTAB 4KGXA 1DI0A 3ZBUA 1TT7A 5AVKA 2WAXA 1ZGHA 4Q7MB 4C29A 3FMIA 1GTJ1 2QQ0A 2RH5A 3KYDB 1H5UA 2PZAA 3TIFA 3T3IA 3W34A 3PRJA 1G8AA 4MB0A 1Z38A 4Q47A 1U28C 4RA9B 3CRRA 1U2QA 4KDEA 4MWGA 3TAXA 5DNCA 4V1CA 5AWFC 1VMKA 3H8VA 2HD4A 1QU3A 3AXSA 5IJ0A 1D2NA 1XRLA 5TE9A 4QUJA 1B6RA 4R0MA 2XCIA 3LUDA 1EZZA 2IODA 4OGKA 3FPHA 1EKXA 2M9MA 4TKLA 3EVAA 4H08A 1KD1D 1F6DA 4ZCMA 2Z2KA 4P7JA 5EINA 3V7NA 2D4HA 3L02A 3D3KA 1V8BA 1VE3A 5G53C 3ZWMA 3G71B 2BKXA 1IY1A 1AKWA 1DBQA 2P9TA 3N8IA 4UAGA 1TTHA 5AJWA 5K2OA 4XRRA 1WB9A 1I7NA 4FR2A 4N47A 2EBUA 2ZROA 1Y8RA 2AH5A 4G97A 4LSMA 1YIJB 3HCRA 4J1TA 5JCJA 1S8OA 3A3NA 4BIIA 1I13A 3RI3A 3OJLA 2GETA 5DPMA 2V59A 3PT9A 1PP4A 3S55A 3UYLA 2X7JA 1T9GS 4P9SA 3OMXA 1UZNA 5LXTB 2V0NA 4TXNA 4EB8A 1EWTA 1KDPA 2WWWA 1W4BA 3BWBA 2OHGA 3PHCA 3UMSA 2CL5A 3OX2A 3HZZA 2GF2A 1NWCA 2VUTA 4BS9A 4QDJA 2Q46A 3I9FA 4QTZA 4JA2A 3LZ6A 4ITRC 1U4OA 1IJKA 2ZI3A 1NW3A 3G2KA 3WK6A 3ZW9A 3HNRA 2L17A 4D99A 2XXAB 5DT9A 1QV9A 1OOEA 3MIZA 3TLYA 2JIPA 1GTSA 1FYXA 1ULAA 1PDVA 3O4IA 1EUQA 3NBQA 4XGIA 1BRTA 1EXWA 2JIDA 3EVGA 5LWQA 4AMZA 2NXCA 1BQ3A 5F7OA 2EKQA 5BQFA 3DZCA 1K8QA 1K3FA 2ILVA 1XC7A 4Q39A 4QYTA 4BNGA 1SKQA 1XDSA 3R77A 4Y1FA 4IICA 4ESHA 4Q7QA 3JD0A 2B7BA 5FF9A 4F4HA 4II7A 4LOLA 1ZI8A 4R9VA 1G5FA 3ESQA 3OPNA 4G3XA 4PYLA 1B1AA 1IUKA 4Y9DA 4ADSG 4P80A 3UJ8A 3OEEA 3JATB 1RWOA 2RB5A 2P6PA 3K0FA 3LZCA 3X2SA 2GTIA 2W2OA 1TT5B 1MGPA 4RE6A 2IPOA 2IOYA 2CVOA 2Q3MA 4GR9A 4RPKA 4X0EA 4AJJA 4EJ0A 2VOEA 2W6ID 1K9SA 3VJLA 3LQ2A 4G0OA 4KVZA 2W2QA 1UFKA 1NW6A 3UGTA 2R6CA 3EMVA 1T1RA 2UYQA 4RQAA 3B1JA 4U9UA 1IBSA 1RI5A 5C7LO 3QEBZ 2FPWA 1YD7A 1RJFA 4BVHA 4O6VA 2ZW9A 2JLZA 5L3RA 5EKUA 2HJVA 2ZRLA 4CI0B 1GYRA 4H3SA 4EJSB 5TB5A 3HY4A 1NVWQ 3VPXA 1DRVA 3R74A 3E1KA 3TEFA 4O5OA 2HJWA 5KQRA 4DV3B 2UXDB 5HZBA 1S1CA 4IRXA 4NULA 1AGRA 3WZMA 4ERXA 4QTYA 1TM2A 1HUQA 5JCOC 4ZMBA 4Y6LA 4QUAA 3EPJA 5D3MB 4DR2B 2AJBA 1RLMA 4BB9A 4Q24A 1Z83A 3RSSA 1DIRA 2PRJA 3C85A 4IIJB 2VYFA 1JQEA 4XKWA 4D0RA 1CEXA 4PX2A 5FP0A 5CYGA 3V2IA 5JYBA 4QA9A 3AHGA 1XDGA 3BF7A 1G9SA 3DDOA 1B0PA 1L8XA 2V7QD 1QFYA 4WNAB 2FUNB 5FA5A 4UOEA 4MB2A 1X77A 1JW9B 1V4VA 1JKIA 2R2GA 3KLMX 1IONA 1VQLB 5HCNA 3BCFA 3G79A 3GEMA 4L2IA 5E38A 5D85A 4Z1MD 5BNWA 1H22A 1KRWA 2ZIVB 3U39A 3EVFA 4TUYA 4U7PB 1LW7A 4PQRA 2DFKB 4EJSC 3C98A 1JG2A 2O2HA 3S99A 1I0ZA 1YTUA 1G63A 5F12A 1Q0RA 1W85B 3AP1A 4G1BA 4E4RA 5FWDA 1JP7A 1I1QB 2P2LA 3PGLA 4AVYA 4B81A 5B7QA 4U1RA 5L45A 4Z4WA 1HG0A 3HKBA 1RWPA 4ZVTA 2IHKA 3GLGB 2GXQA 5JAMA 2ZSDA 3CB4A 2V6FA 3AOEA 4C4YA 3CEPB 3D4OA 4C04A 4DCTA 2BRUA 4RQUA 3T53B 2A78A 3GT4A 2IYRA 3C0KA 3UBTA 3AOGA 2G6BA 3OIVA 4WN3A 4CIBA 2A59A 1Z63A 3WIOA 3FFBA 1A0OA 4BEWA 4QLOA 2XE8A 3W6OA 4M55A 3R9KA 3FUCA 2J6IA 2LZ0A 2XWBF 3OU7A 1AOXA 3FPPA 1QQTA 1JEYB 3PR3A 4PLGA 3ZY3A 4HRVA 2EERA 2CCJA 2H1WA 3PKZA 4WTOA 4H7KA 3WQRA 3PPVA 4C2UA 2AB0A 1SOAA 1C41A 2XMCA 5IWCA 2C1XA 2RK6A 1VCHA 4V0RA 5BWBA 2Z57A 4DZZA 3U3XA 1PX2A 2NW6A 1R6DA 1BE6A 1E3QA 3DJFA 3K8ZA 1U3VA 4HXYA 3U3OA 1C8KA 3G49A 2G71A 3OA0A 3VDMA 3N0XA 4BO3A 5JSZA 3WAGA 5AH0A 3EODA 2J30A 4YAIA 1BWQA 4BWGA 4GSYA 2Y1GA 1M7GA 4GPD1 1YASA 3L9WA 3ZZ0A 2BFNA 3T7IA 2PUBA 2H1FA 2I7DA 2Q5CA 2Q8QA 1ZGBA 5EJ6A 4LXHA 4BWFB 1KXJA 2CNBA 3SE7A 1P7WA 3PFBA 4L9WA 2EC5A 4QU5A 4JBHA 4JZYA 4NAUA 3HJNA 4FFDA 5BSWA 5JAHA 4NZYA 2AR0A 3AUTA 4G0WA 4IVPA 4OXQA 3WLEA 2FMTA 1W88A 2X9LA 3W5AA 3H2SA 4KIGA 1C4OA 2RBKA 4NJMA 1ICIA 2FE4A 3SKYA 4PYRA 2I2CA 3A0RB 1HORA 3DVQX 3PNQA 3U7FB 1WRBA 2B2XA 2V45A 3ESDA 3QK7A 3FPFA 4RMGA 5LL6P 3H1AA 4LA4A 1YS6A 4S1NA 8ABPA 3SFZA 4C0JA 2GCPA 4ZI2A 2GJAA 2DFNA 2NP6A 1H2XA 1JHOA 1NNLA 2RHBA 3EEQA 4WADA 3BERA 2J9XB 5HM8A 5JT1A 3HJCA 2FPOA 1WMBA 1SRRA 1YBAA 4JK3A 2DCMA 4HGPA 5DI3B 4ARCA 3RODA 4ENWA 3MN1A 3W2FA 4ZQCB 4ZVPA 1SBZA 3PG5A 4B31A 4C3VA 4QU9A 3ZGXA 5K09A 1EGAA 3VH2A 3LP8A 2FY8A 2FLVA 1N2CB 2CUTA 5ESRA 1I4DD 2P41A 2HR1A 3QVGB 3TBHA 1ISMA 4XTRA 3D02A 1E98A 3BHJA 5EXPA 1JJAA 3HBMA 1ZFNA 4JJIA 3OZFA 2KSQA 2OM6A 3E0XA 3K8YA 4YXFA 4XGNA 3BREA 3AESA 3D5EA 5HZKA 2XNDA 3FNIA 1V1RB 4BAZA 3U9TA 2UZ1B 4XPIA 5EZSA 2O50A 3RUIA 3TTXA 3CRW1 2JLXA 4YIKA 2FF7A 5ESWA 4ALJA 3EIFA 3CXUA 1O4WA 1M1YE 1P0PA 2JZOA 3GCXA 2IHYA 3NC4A 1CG6A 2YQ4A 2I3DA 3P2JA 4KFSA 5C8YA 1JFSA 2DH5A 4Q1EA 4LTNA 1K06A 2D1QA 2I0FA 2ZRQA 4HL6A 3WTCA 2ORWA 3ACDA 2WQZA 4ENQA 2VNIA 1VYHA 1Z39A 3FDZB 4RKRA 5EHQA 2HSGA 1M7HA 1QIGA 1NVGA 2EGHA 2FPMA 2DPGA 4YMVA 2XMSA 3WKEA 1MEEA 2BFEB 3G68A 2VJLA 1UBRS 1E1RD 4D9EA 2CCGA 2DQ4A 2C7VA 4M60A 3NIGB 1YSCA 4DIUA 3FSGA 3C3KA 4WJZA 1B74A 2J9GA 3V6MA 4C5AA 1BJTA 3A31A 2MSKA 3QPWA 4DADA 1VHOA 1A9ZA 1P5HA 2R6HA 3QNWA 4DLSA 4EY6A 4Z4GA 1SVOA 5IP5A 4JL6A 3OT4A 2UYHA 2PMFA 5GJWC 4P7BA 4CG1A 1LNQA 4XR6A 1G16A 1RYEA 1CR1A 2ZT7A 4DV1B 5E6SB 1GZ6A 4MV5A 2W37A 1PT6A 3NUZA 3NJ8A 3V46A 1N3LA 1NPDA 1YIAA 3NHJA 1MRSA 3M3PA 1RWXA 3OEHD 4FJ1A 2WWTA 3GVJA 3ZUGA 3RRYA 1UAAA 3EARA 2AIRA 4INOA 9ABPA 3SZGA 3PFKA 3AUFA 3SYMA 4KYUA 1N2SA 2PGDA 3GFPA 3JWHA 1CUCA 4WXHA 3CR8A 3OMLA 2RD2A 4OM8A 3ONVA 2OCPA 3QKIA 1KH3A 1SY7A 2NV4A 1JHYA 1LJ8A 5HK9A 2PMCA 2Q3CA 2FWJA 3Q9UA 5FTNA 1LY1A 5GINE 2ZEJA 3R7DA 2DB3A 2RONA 2WWRA 4PXYA 2UUBB 3PD7A 3FSRA 5BW6B 3ZHXA 2HDNB 5A5FA 3AR9A 5IYRA 1BMTA 2E7ZA 3D4IA 3ZVRA 1I5OA 3W3AA 5IG2A 3U60B 3QVTA 5K3AA 4AS1A 2IS1A 3I2GA 5JDCC 3I05A 3BL5A 3HUTA 3FMOB 5CDSA 1X86B 2C8LA 1QH8B 3L7AA 1NQTA 3LQFA 4GS5A 4L6IA 2E49A 3FMGA 4O4LF 3P0FA 4AKIA 1RPAA 1UJCA 1X80A 2EP7A 4RLQA 1PL6A 1UXKA 1AV7A 1YO6A 3AHDA 3TO5A 5ALGA 1Y7IA 2ECQA 4RK4A 4ESVA 4UEJA 2YJNA 4Y0VA 4DA6A 1WZ2A 2C98A 5BVHA 1Y5MA 1Q2XA 4H4DA 4TSRA 2YH2A 3A11A 2F3TA 4MWDA 1J39A 4DWJA 1XRQA 2A1IA 1UD8A 4BVAA 2WFZA 3MRSA 3I56B 3SBXA 5B2ZA 1JECA 1GP2A 2YW9A 1YZGA 3TLGB 5KTKA 3EOAI 2BBOA 3BKXA 3H9UA 3MBOA 4QICA 1QB7A 3O8CA 3NDRA 1RZRD 2ZIUB 1VKRA 2FEXA 1QH1A 4MVWA 1V2GA 2JGFA 4L8GA 1FP6A 1ZCJA 4BJ6A 3U1VA 5DCYA 2F43B 1KE2A 4D9CA 4YV0A 1ESMA 4N4AA 1D1QA 1TZCA 1XNHA 4C9BA 5EC8A 5HOEA 2WF5A 4YLEA 3CNOA 1UUFA 1Y1KE 2BIFA 2FJ0A 2NSDA 2BEJA 2GZSA 3CCEB 3GJRA 1LSUA 1E6CA 3L49A 5AJHA 5I4IA 3BCSA 1II0A 1NZJA 4ETMA 2ZUTA 2QR3A 1CZHA 1M73E 3DDWA 3O4GA 1P81A 3RRJA 1GV0A 5F7JA 3P9IA 1Z07A 3Q3EA 5JZSA 4E2WA 5FQNA 1NG9A 3EY4A 4RPDA 4GNRA 4OMFG 5G3ZA 5B36A 1J22A 2AKYA 3H9NA 1KVQA 3DZJA 3M1IA 4D9JA 1DSSG 1XG5A 2BJHA 3BMCA 5DBHX 5BWCA 2IP2A 3RYIB 3T6KA 3HJRA 3EXHA 3KOWA 2ZPUA 4NE7A 4TXMA 5K51A 1N5MA 3SQNA 2AF4C 5CT9A 5ECWA 3ZGYA 2WKWA 1YA4A 4BVKA 4BLSA 1W35A 2PKXA 3IX7A 2JCBA 1F4PA 2YVLA 4F45A 3Q8WA 5CLHA 4ZO7A 1QG4A 2NU9A 2ZYIA 3JVEA 3MS7A 4BNWA 2Y77A 4A0FA 3PA2A 4EKEA 4L28A 3LDFA 4J9UE 1U8ZA 3FH0A 2EZTA 3SY8A 2GAOA 3DM5A 2ZS8A 2O5VA 1HE1C 1PNTA 4ZQHA 4CMJA 3WJAA 3IKMB 1FDWA 3T15A 4FB4A 3N7TA 1A71A 2DG2A 3E3MA 1K0UA 1QYIA 1F12A 5BNIA 1SBHA 3L7BA 3QE9Y 4IYJA 4G5GA 4BNKA 2W70A 2HX1A 2ODWA 4X6XA 3WIDA 4D25A 2W93A 4DS3A 3UC9A 1BVRA 2DETA 3BDIA 4J0EA 4RSRA 3ZHVA 4DLXA 4BV3A 5IAEA 1S2IA 2IYFA 3LY7A 4G0YA 1IQPA 5D84A 4CLRB 4BHTA 1OSNA 3G89A 5F5XA 3BXZA 2N42A 4LJ9A 4Y6OA 1GG8A 4PY2A 1E3WB 3KZXA 1I4TD 2E6UX 3KYIB 1ML4A 1N6IA 3ZBTA 4IHJB 5CM8B 3I2FA 4YAGA 3AVYA 4DMHA 4FGJA 1D3AA 4G36A 1BE1A 2NUTB 3A9CA 3TB6A 1U0GA 2JGJA 2NT4A 4LCBA 3ZQKA 3AJAA 1HE4A 3I3OA 4I66A 2C7BA 3NT2A 2W6IA 1K2WA 5L6MB 1UEJA 2FZWA 2VT7A 2UUOA 2XOEA 1YB2A 2Q49A 1PQYA 2YBEA 1TK3A 3I37X 1N8NA 3L1JA 3KVVA 4DV5B 2XW6A 4X45A 3V7FA 1OVMA 4BMPB 4EAQA 1PJ8A 2DFDA 3L7IA 1RLOA 2WK1A 2WJVA 1P91A 1QRDA 2ISCA 3RV3A 3OSUA 3WJ1A 3BGOS 3ISVA 1ZA2A 2HNKA 2VYVD 1RRKA 2P0YA 4K9OA 4FKBA 4PCAA 4WL0A 5EZ6B 1B0ZA 1XNQB 4BKPA 1Q1GA 1Y1TA 5K20A 1QONA 1FTNA 4LBZA 3R0XA 2BTQA 4NL4H 3KOOA 3G1WA 3ONNA 3QSGA 1K5DA 3HRIA 3L7DA 3VI4B 4QNNA 1R0KA 2ZGVA 1ZN8A 2PFGA 5DN6D 3QW4B 5LOVA 1MDBA 2DR0A 5FPPA 1UD4A 1WXWA 2PQ0A 3EXIB 2AJCA 3E35A 5FUWA 1P80A 1A3CA 3DE6X 4FOTA 1SKYE 2G5GX 1U4SA 3VO2A 4QHSA 1MCZA 1GGKA 1VECA 3OCVA 4DILA 2QP3A 2RG1A 2KX7A 3KYBA 2ONZA 4KHZA 3AVQA 2I4TA 2V7QA 3AR4A 1GDHA 4RZUA 1E6KA 1M8JA 4AYXA 2FSGA 2WSSD 4Z1MA 4ZCRA 2H1OA 1DGQA 5L4SA 5KQPA 3IOBA 2PX4A 4FMBB 5B1YA 1OCEA 1EUYA 1T2EA 4OJYA 1TLTA 4KN6A 3UOAB 2I29A 1O94A 4ZIRA 5AVYA 3T1TA 2AYYA 1L4BA 1T9AA 2BFFB 5HILA 2A1UA 4ALIA 1Z4IA 2VRWA 1RJ9B 2IX9A 1HDIA 4G4SO 1WXQA 5FUQA 3FOWA 1V45E 3JQ7B 1YGPA 1ZCBA 4QJ4A 2NYAA 2YXPX 1MTOA 1L7QA 1R4MA 2QB5A 3TLKA 1J9GA 2ERCA 1E7SA 4KACA 4RCVA 5ALTA 4MYDA 5HXBA 1THZA 2JIRA 3IOEA 3L6RA 5FT9A 2HPZA 2H59A 2NQTA 2P0EA 2H5EA 2A5JA 2JIOA 1KY4A 1L5RA 3C1UA 3DZKA 3ZU5A 4B7XA 2J5XA 1FXWF 1RXUA 1YHZA 3AR5A 3VOBA 1FUYB 3IMCA 1V0JA 1DT3A 4CDNA 5J1SB 3X1JA 5COBA 3PZRA 3LHFA 3SEJA 4B34A 2R8YA 3QE2A 1DOHA 1UDAA 1XZJA 2VA9A 3DXXA 4P2GA 4WJKB 2J6HA 3LGSA 3P4YA 2FX2A 2FXIA 4OHFA 2X9NA 4PV7A 4RXTA 3VOAA 1YZNA 4WBNF 2YWCA 4DLZA 3K0EA 4QUEA 3CF4G 1VLQA 3CXRA 4LMBA 2NZWA 1A4RA 4BTEA 1Q7BA 1VHDA 1GGEA 5FBLB 10MHA 3IFSA 3KZMA 3MERA 2FJUA 2PUJA 3EVNA 1WZEA 2NOAA 3ULKA 3ZWOA 3CMAB 3IUPA 1EXDA 1TEHA 4PZYA 3VU0A 1HM5A 2H4JA 3JYNA 2R00A 1U9IC 5C8VA 4OIFA 1T3TA 4IJMA 4MVJH 4WK2B 3TLEA 1ZQ1A 2PY6A 3AR3A 2I3AA 4DV7B 2BH2A 3P7MA 1KORA 3WRXC 4HMQA 3WMFA 4EZIA 1NXWA 2BGGA 3BGIA 4OAOA 3PDIA 1U0HC 3ORQA 1UMBA 4E13A 4EHFA 5K7SA 2I4RA 5TPWB 1N07A 3L3BA 2QROA 1SFRA 2P5TB 4KLAA 4LXYA 3INTA 2FEKA 2RBGA 1SUBA 3DLBA 1CJTC 4EHKA 5FOWA 3IUYA 1VGQA 3BTOA 4Q34A 2CV2A 4BGVA 1U2TA 1M1KD 2EG5A 2ORVA 2BY4A 3SF0A 4B6QA 4Y0NA 2AZTA 4OOVA 1WZIA 2EJWA 1X0VA 2AX3A 3ROFA 1JT2A 1T25A 4EUKA 4RLZA 1FNNA 4Q6WA 3NM6B 3U6BA 3K0AA 4I46A 1Z4LA 4Z0PA 1KDRA 1VSVA 3IJPA 4E11A 1SCAA 4AD8A 4HWGA 3WMXA 4RZQA 2QR5A 3A4NA 5BWMA 3JW8A 2QPAA 4HDRA 3HVJA 4GZMA 1QR6A 5CCDA 2PEZA 1IK4A 3I0NA 4XLFA 4R8KA 2TMKA 1RACA 1YK0A 4AS3A 2D1RA 1FYVA 4NI5A 1KE1A 3A4IA 4V0KA 4EI7A 2Q5HA 1KFCB 4KIUA 5IXYA 3ETNA 1SMKA 4J7UA 1NYTA 3AEZA 3M81A 1XYYA 2OB2A 1GLNA 4BTLA 1KEEA 1T2NA 3THWB 2WHEA 3UJBA 2XNKA 5JOQA 1NVDA 1Y37A 2PU5A 1V8FA 3O3NB 5EAIA 2Z98A 2VTKA 4N5IX 4NKRA 1FUKA 3A0UA 1V4NA 3ROXA 1EDZA 2PLNA 3D6MA 2P69A 2Z3WA 4JKYA 5DWQA 4DCNA 4E1VA 2W22A 4B43A 3JQBA 3PJFA 3FZNA 1T4MA 4EO9A 2XQFA 3RIYA 4QO7A 1JQDA 5ES3A 5LP6A 2HF2A 4H27A 4JBWA 5ALLA 5CDGA 4Z3KA 3IOYA 5J4YA 4LC0A 2AN4A 3IBTA 1NNSA 4BMNA 5JXWA 5K45A 3UJDA 3PUKA 4BQPA 1F06A 1MMFB 2CHVA 1FA9A 3K6RA 4WI1A 4P3IA 4FGWA 2W4MA 4UDYX 1E1RA 4I8XA 1ZUNA 3ABOB 4QOSA 2ZBGA 1E77A 2YY7A 5BSMA 1OH6A 5AKHA 3S5UA 2PPVA 4BPRA 1SXJD 4RACA 5KYWB 1ZBQA 1VZ2A 1XAIA 1XLVA 2AOTB 4GLLA 3E9DA 4YDQA 1RKUA 1Q91A 1TCUA 1XXHA 1SKBA 3SVLA 1XMXA 4GT1A 4B74A 3TJZA 4E33A 1XP5A 3O5AA 3PIDA 5H1YA 3GEGA 2QUKA 2X77A 3MHPA 1FFSA 1VQOB 1CZOA 3N53A 1KS9A 3V5NA 4F92B 4TXLA 3PUWA 3CFYA 3VDRA 3QVSA 4D3FA 4ZYLA 5I7WA 1FF9A 3QGMA 3OEHA 3EWIA 3SEQA 1UDRA 3C5EA 1YB4A 1G6HA 3OW2B 3FPGA 3FWNA 1FL9A 1FSZA 1J2EA 1YDWA 3CMEB 1KO8A 3MCAA 1KJWA 1O2DA 3NHZA 4GO1A 4B0PA 2NVUA 3M6LA 5H82A 1G8YA 1L1FA 4JVLA 2ATEA 2RAVA 3U17A 1CJKC 1R8XA 1MW8X 2RGWA 2BC9A 4MK4A 2Q2QA 3MWGA 4UE6A 2B8WA 4X7CA 1YE8A 3OIFA 1SD5A 4KQFA 4D57A 3WGLA 4DG9A 3Q3AA 4GXNA 2V4MA 4B3XA 1P2FA 1FQKA 2BDEA 3C6ZA 1CY2A 1PTJC 3W6UA 3DEHA 1BCSA 4NABA 1AV6A 5H7XA 5B3JC 3W4IA 4ZDWA 2C59A 3ASQA 1M1YB 2NTEA 5JD4A 1LRJA 3QX3A 5JNLA 3ZCRA 5AW6A 2HQ1A 5FHRA 4V02A 3PNVA 2XDWA 2UUPA 3JYPA 1LPBB 2FN8A 4C6RA 3ZZTA 1QFMA 2CE2X 2Q9AA 4IR7A 2OB1A 4K7JA 4GP7A 2G3YA 5HDQA 2FMKA 3HADA 4C4AA 3K9GA 5F73A 5FI0B 3D8TA 3RU7A 4CKBB 3DVAA 2XZPA 1NX6A 2CLKB 1ICEA 2Z1NA 1JZSA 3QYAA 4ANFA 1QZZA 4MV0A 4NH0A 3MT7A 1TVEA 2CLOB 3PIRA 1L1RA 4GL2A 3N2KB 1E1QA 3ENWA 2CNWD 4ZWNA 3LUFA 3JV7A 3H5VA 4DOMA 1AK1A 4TQ9A 3PQ6A 2H08A 2JHPA 2RG7A 3NCHA 2Z2YA 3R3UA 3U3MA 5DNWA 4KE9A 4NBRA 1RZRA 4FNMA 2I2DA 4XJXA 4HB3A 3R23A 1Z2PX 3IA7A 2X1MA 4L5IA 5T8KC 3ROPA 3SX2A 2YJ6A 3DKVA 2BGMA 2YDYA 1IBRA 2HLDD 4YLYA 5B55A 5KWJA 2I9KA 5EPOA 5H3LA 1JKFA 2B99A 3F3YA 4XXHA 3ZU4A 2TECE 4ZHQB 5AUPB 3B52X 1VQ4B 1Z3IX 4RMHA 1D07A 5ISMA 2OXIA 1GPWB 3RUCA 3T3NA 2YIMA 4JU8A 3PLAE 4N41A 4KO1S 4RJIA 3RG8A 3A58B 1JJVA 5TLSA 5FEMA 1LD3A 2R44A 2OYCA 1B73A 1T2VA 2IXDA 4ZC1A 4AY6A 3EQ8A 3WLNA 5HHTA 2HYDA 5EMMA 3K4HA 4CE6A 1NFRA 4D43A 3BMQA 2H4YA 3RUAA 4A15A 1YONA 1UOPA 4H9GA 2VDKB 4N7RA 2IZ0A 3FE2A 4RJLA 3L46A 1O54A 1OB2A 1D7AA 1ZIOA 5IM4F 1MC8A 4C0LA 2GAJA 2IW3A 3DTVA 4KUEA 1CUYA 3E1SA 1LDYA 1LJLA 1QQ5A 2VPWA 3DLPX 1RYBA 2ZUDA 4PINA 4E5UA 3KZCA 5BORA 1BMDA 2MSNA 1MHTA 1VBKA 2W83A 2YRFA 1XQ6A 5CTAA 3U1TA 1YOBA 3P9XA 3OE5A 1QOZA 1IN1A 2ZDHA 4HD8A 5SZKB 5EVCA 3RREA 3C3CA 2B4KA 4G89A 3WHLA 1X2EA 1BVYF 2D5AA 1GXSA 2JGDB 3LFHA 2CMKA 3CR3C 3H8JA 4L22A 1RS0A 2EG9A 3ZDZB 4A8JB 1I3OA 5HFJA 4LDPA 1KU6A 2PXXA 3E5RA 3V8NA 4EG5A 2XODA 4QIHA 2P1ZA 1YDHA 3DAOA 3NHSA 4IIDA 1V0EA 5BRJA 1J09A 4P7KA 3AU8A 2IIVA 5ELLA 5SYMA 4MR8B 1BQEA 3VC2A 2NYVA 1O6BA 1RLIA 4GX2A 5A88A 2OYSA 1YK1A 3EAFA 1RXSA 4Y2GA 3M1YA 4YPVA 2NU6A 2XA1A 1XQ1A 5JSYA 3GD7A 3NV9A 4C6HA 2G83A 4C4XA 1D0IA 1JPJA 4C0XA 1E1YA 1OTYA 2REOA 2IHBA 3K35A 1AHNA 4JMPA 3JPWA 1TYBE 3IERA 2I5PO 3MS2A 4ZV7A 4AZTA 4DG5A 2RFLA 3Q3HA 5E3JA 3BRSA 1G5RA 2NSYA 4QATA 5JXGA 1V39A 4UMFA 3AK4A 4MEJA 1H3EA 3TIIA 3V1KA 2XBMA 4BNFA 3KEOA 1TEZA 2QVYX 1Z5OA 4A8JC 4RDLA 3SS8A 4JVNA 4OCZA 3A9RA 1J42A 3W2EA 3OM8A 4D82A 3CLHA 4C5CA 3NUQA 1UC8A 1R0XA 2VP0A 3OOJA 1JTFA 1CZRA 3BHNA 3IJRA 4KFRA 3ZXYA 2Q29A 4TWAA 4DR5B 1WXHA 4H7HA 4NMWA 5C8DA 4FXPA 2F1OA 3T94A 2Z2ZA 3OMWA 3NHMA 1KEPA 2CZGA 3LLSA 1E66A 3LW7A 3Q6MA 3SX0A 2N46A 2F17A 2EFEB 4X84A 2QW8A 5K6RA 2CDRA 3PL1A 4I0WB 1GL9B 4Z49A 1OU0A 3PP8A 1LDEA 1BA3A 3MWEB 5HKKD 3RSCA 4IILA 2XT9A 3DT8A 5DN6A 1DXHA 1T3GA 1YJQA 2W6OA 2PD4A 2ZFUA 4O4LA 4C0WA 3Q2IA 2PL9A 1R5OA 3GJXC 4IMPA 3PKJA 2HDWA 1IN4A 2GD1O 5AW5A 2OHXA 3INNA 3KQTA 2XYPA 3V3KA 3UH0A 1WS6A 2XPCA 2J3QA 5J5CA 1ZJYA 2VPXA 4YQYA 3Q5DA 4BE4A 3D6NB 3F47A 3J81A 5EWLB 5KEIA 2WSSA 5FFMA 2COKA 2PGAA 2WYVA 4AJNA 3GSIA 4BVGA 1NVMB 4AAYA 4F1JA 5A1TA 2VOJA 3P9CA 5CFRA 1P2TA 2B1QA 3I6ZA 1YOVA 4JA0A 4LW8A 1Y4SA 4K9MA 1NYQA 4D41A 5DM60 2E4ZA 1JEQB 1Z8NA 2XEDA 3C6BA 4ZCLA 3GFRA 3ND7A 2R6ZA 2CD9A 4IX1A 1G1AA 3ZD9A 3ZWCA 4G0MA 5ITWA 2BGKA 1YIOA 4MW0A 1P9NA 5LR6A 1ZN7A 2V3WA 2RB4A 3HNOA 4FWIB 1WXDA 1IEQA 1IDOA 4BO8A 4BV9A 1ZICA 2MR6A 1E7QA 3MG9A 1SQ0A 3NBZC 3AMVA 4YJGB 4HFJA 2Y0EA 2HADA 2FRXA 5J3JA 1FRZA 1G64A 3LQRA 1Z8DA 2QN8A 4Z4SA 3O8LA 3OQNA 3E3AA 4QXRA 1BG6A 4RHEA 2ZI7A 4R1MA 1N8RD 1Y8QA 3CINA 1LWNA 3QBDA 3QFRA 1PLKA 2DZDA 2FMIA 3ELYA 3G0GA 3M70A 1XTPA 3OPXA 1VPWA 2AZXA 1BDMA 1JKJB 2OD7A 3PZBA 4Q4DA 2HXYA 3QWHA 5I9NA 4I14A 3QWFA 2BMVA 2W6PA 4NNPA 2HGZA 4F4FA 2FW0A 3BM5A 2P9GA 1DAMA 1IAVA 2PRKA 3H97A 3O9MA 1QZ3A 4HAIA 3UK1A 1AX9A 3FCOA 1L7MA 4WLVA 2HSWA 4XIIA 5FKJA 1U0LA 5G0SA 4EVIA 2WM8A 4GEKA 2A7QA 5CB0A 4E2FA 2XMPA 5F2NA 4QNRA 1X9IA 4PAGA 3ZHZA 3C1OA 2I66A 2M1ZA 3N59A 3C5HA 1PQWA 2YXLA 2FRVA 5F64A 1GD1O 3R0VA 4MQFA 3I53A 2C54A 1GZ7A 4BLUA 1QHHB 1PEYA 4YEJA 3EQZA 2DECA 3DF9A 1J8YF 3WYGA 4MV1A 1I1HA 1RKBA 5JECA 2R62A 4X97A 1PYOA 3I1JA 4CG3A 1EMDA 3TVTA 3P9SA 3HCDA 3GN2A 2WIKA 4O1MA 5H9VA 5EWJA 1Q82D 1QX4A 1VLOA 3KR9A 2VKQA 4D6YA 1ZMBA 3H9EO 2ST1A 5TEWA 1LPNA 2FETA 2QY6A 1W9MA 2VHJA 3AP3A 4GMFA 1CE8A 1AKEA 2TMYA 3ECAA 4EIWA 1K1EA 2ZBUA 3EQ7A 2A9OA 5CBKA 4UJ3A 1R9MA 4C03A 1SQSA 3DE1X 3OZTA 4L6CA 2L18A 1E1DA 3NG1A 2JAHA 4PNHA 2C42A 3PHLA 4X00A 3LOQA 4P4LA 2KB0A 2VP4A 4KLCA 3FPCA 4JR1A 3C2QA 1SCKA 4U6SA 4Q3BA 3WSWA 1H9BA 4NYMR 1OAOA 1KAQA 2G08A 3UXYA 3MWLA 3RK1A 5BV2P 5CXQA 4N3NA 4UAJA 1QGYA 1L7EA 2P7IA 1XVLA 3PCXA 4EENA 4IGEA 2IL1A 3O4FA 1LK5A 3Q7IA 3B6EA 1W94A 3DWGA 4C30A 5A3SA 2PL5A 2HM7A 3ZHSA 2EHJA 4X9XA 4E4YA 1SIUA 5JQGB 4HEHA 4P3NA 2BFMA 4XQEA 5HKOA 3TCNA 4NYJQ 5L46A 1VZ3A 1VC2A 2XD4A 2BZGA 4CTNA 1XPJA 2FPIA 4ZANA 4FE4A 3S2UA 2C83A 1Z4QA 2BJVA 1PS9A 1ZISA 3S2FA 2FG6C 3UUGA 2C5EA 9LDTA 3AY7A 5KQLA 1NQOA 2WTUA 1BXZA 3EWNA 2GN9A 2DWPA 3KS9A 1P73A 4Q01A 3VHLB 4DJTA 1FNDA 4X06A 1QIKA 5IT4A 4X20A 2OYRA 2ZK7A 1NW8A 2B92A 1L4FA 5LB2A 3RKUA 4AZWA 4CWAA 3GUZA 1WW8A 5IJ9A 3FAKA 1U3TA 3FOBA 2CJXA 3GFFA 5C37A 4RC9A 3HV0A 4H0FA 1TU4A 3PXCX 4N7JA 4E30A 1YHNA 1RWBA 1DO8A 1U7WA 3R0JA 4G24A 4IOMA 1XHLA 1UDWA 1QG6A 4TKVB 5DGHA 4YN3A 1XTVA 1VJ1A 1IXKA 1ISPA 1JIJA 1GUYA 1TUEA 2MT9A 2OBXA 1WUHS 2AD5A 2VHYA 3NGXA 2IV7A 3SHWA 3EHDA 1QHEA 3P32A 2WV9A 3QFCA 3K73O 2Q5LA 2ZAIA 1CQWA 1IM2A 3WQZA 3IODA 3ESCA 4K40A 4K9RA 1F0YA 4PNPA 1YB7A 1SXJA 2R3SA 3RSLA 3K9FC 5F98A 2G40A 1FW8A 2FWIA 2V74B 4TL9A 3PGKA 1VG8A 2VCHA 3F9RA 2OWEA 4QGHA 2OLEA 3R4CA 4HGNA 4DSTA 4XRGA 3KQVA 3ZBPA 3SXUA 4WZAA 4YRQA 1WCYA 2L19A 2GLXA 1KEKA 3M34A 2QUHA 1FUEA 1E2MA 1DQSA 3R3SA 1TGYA 4C07A 3GH1A 3HKDB 3OQPA 2WQ7A 3HB5X 2I78A 1RLJA 5THKA 2ZI5A 4N3GA 16PKA 3PK0A 1DZ3A 1M8GA 3GEDA 4PG5A 1QHXA 3EXAA 4IHJF 2C9OA 2WKSA 4YUAA 2JJ1A 3CCQB 3TNYA 4CV2A 1XPRA 1ACJA 4Q4AA 2IYOA 3TBKA 5KNDH 2Q7DA 3KQSA 2ZL5A 2IYVA 4K05A 4PHGA 4CQMD 4QFCA 4O0LA 4ER0A 3VR5A 2UVDA 1L7OA 2CLEB 3ZNQA 3IE1A 4WE3A 1VE6A 1H3NA 1ZIDA 2RGBA 5D00A 1PFYA 3REQB 3WK8A 3MT9A 1QK3A 2PZEA 5BSYA 3M7IA 2A4MA 4JJ8A 2D2XA 4TZ0A 2GZHA 1BE8A 1RQGA 1VIDA 1YWGO 2H2GA 3KAJA 1I6MA 3W0LB 3WGZA 1A50B 2J31A 4HNHA 4G9GA 4AF7A 2P6NA 3B5JA 3GIRA 1BTOA 4NDAA 4DT1B 3A04A 1OYWA 2QL7A 3O21A 3HXMA 3CLTC 4KWCA 3Q40A 3TQRA 4U3JA 4FHEA 2DBVO 3MWDA 4XVHA 4DMRA 1T2AA 4EKDA 1NVXQ 1U28A 4ZP1A 2VNKA 5FOTA 2OBFA 1NQXA 4I81A 4YRCA 821PA 1M8KA 1OI3A 3G59A 3H13A 3N0TA 4TKOB 5DRTA 3CM0A 2CNWA 3KQMA 3QFFA 5F4ZA 4BVLA 2AMYA 1UBLS 2F64A 2NVOA 4OLFA 5A2GA 5DCLA 5JRDS 4M7PA 1P4AA 4Q7JB 2X4DA 3QFSA 1C1DA 4LZNA 3EPPA 4FYWA 2IEIA 1I01A 3IP3A 4TS9A 5HS4A 2JB9A 3WV4A 1KZ4A 3L6EA 4UEOA 4LOJA 2W2XA 2IUFA 4CMHA 1T15A 2HLDA 5K3CA 3RBAA 5L4LA 2VHEA 3ZV7A 3FCSB 3SQOA 3PGXA 3DNPA 1JEOA 2Q28A 2QMQA 1YNOA 1GYPA 1G66A 2WU8A 2YOFA 4RQBA 4AWBA 5CA0F 5TIIA 1W2BB 3I0MA 2QLFA 3AZPA 3D7MA 3WL4A 5CLFA 1A7UA 2AOUB 4JXKA 4TLLB 3KYDA 5CH8A 4ERNA 3ZJUA 1NT2A 1C7QA 1TW3A 3MGKA 5ED0A 1HX7A 1M6WA 2JFVA 4Y1RB 1OC4A 1J0AA 2P91A 2G9NA 1V71A 1Y42X 1PJ3A 2B1JA 1G5HA 2HRQA 1ZC4A 2ODNA 3C3DA 4I9NA 4RA9A 1M6NA 2XYVA 1UOQA 5KPJA 1NRJB 2AI3A 1PVDA 3ZWYA 5J47A 1GTMA 1VB3A 3COSA 1BGWA 1BYUA 2VZLA 4RD1A 1YHYA 4V0ME 3JZDA 4LJ4A 4ZGQB 1BCRB 2A33A 3A4LA 4AMUA 3D8BA 1G9XA 1ULZA 2B25A 1WKCA 2ACVA 2PT7A 4GOKA 4MUJA 2F48A 4WOKA 4CLXA 4O02B 2QQ5A 2WVGA 3Q2KA 1IBLB 3VSCA 4NU5A 3RSOA 2X5KO 1EDOA 3R0IA 4M9SA 4B3DA 3D43A 1IATA 1E89A 1HYBA 4GWGA 4NU6A 1VI2A 4RY0A 1L7XA 1N5RA 2F1HA 1KK3A 2PUVA 3EH2A 1NUQA 3GU3A 4YJ2B 2FW6A 3SZMA 2WZDA 5C35A 1H3FA 5AHXA 4QQ8A 2OZVA 3A6LA 3H2IA 3GCGA 3BRWA 3F7OA 2GVDC 2NO9A 4MVCA 3MTAA 1VP9A 1OWLA 3NB0A 4V1CI 1AG9A 4ENRA 2H4FA 5LYJB 3HM9A 4EARA 1KPIA 1MKYA 3TQIA 4KRFA 3CCLB 3GJTA 3A1DA 1KGSA 1DQYA 4IV0A 1QF6A 3H5AA 3CD6B 3NBFA 1CRPA 4JC8A 4OXYA 5JTUA 1E6MA 2XKAA 3KR0A 4KLRA 3RDPA 2E85A 4ZXFA 3A3BA 3L0SA 3CUSA 1XTIA 4NU8X 3AUKA 4B5KA 1WD5A 2NZXA 2UYGA 3E81A 4EMTA 2AX4A 1QV7A 1QOPB 3W5UA 1GSIA 1J7JA 1T8WA 2R7KA 2GJ8A 4P5PA 1KQ3A 4P3PA 5HWSA 1O9GA 4Y67A 2FSSA 4JR0A 2FZ5A 2GAFA 2XHZA 4OATA 1S9DA 5JCOA 4AQDA 1U8UA 4EZBA 4V0QA 1Z7YA 4FX5A 4K1LA 3QPBA 2GAAA 2V7PA 2O1SA 2W6NA 3JATA 2OUIA 2JH9A 5CR9A 2E4AA 3ZNNA 4B7ZA 1QGUB 1TT5A 1BMFD 1XZMA 3E8MA 5K2MA 3I8SA 1LSSA 3AL2A 1PGJA 2X4GA 1JJ2B 2GA9A 4WCDA 4L51A 1DXQA 3AC0A 1GADO 4OOEA 4H2DA 2CE7A 1WMDA 3ECSA 4PLPA 1N6RA 1ZSYA 3GQVA 3H87A 5DOZA 2AMJA 3TZBA 2EJVA 3HXOA 4FEAA 1JXQA 1NVAA 3A3KA 4OQ4A 4R2JA 4V0OA 4XDZA 2QN6A 5HKKA 5JAIA 4EJSA 2R2AA 3VQTA 1I9GA 1PEDA 1ZGJA 2GYWA 1N0IA 1YHQB 3BSFA 3FG9A 4XIJA 5LC1A 3ZKWB 2QBYA 2AFIB 2IRWA 5NULA 3HL4A 4Z4CA 2F4NA 2R6R1 4RF5A 4KEAA 1BHO1 3HRKA 5L7YA 2WJ4A 3EVBA 4DM7A 1N0HA 2WAAA 3TZ6A 4ER5A 1ZH8A 3QEJA 1Q7EA 5D3MA 1U1DA 5IC6A 3W7BA 2XZTA 4HXEB 1W7AA 3RC8A 4K86A 1EAMA 4R98A 4IIJA 5LUBA 1R4NA 3EW9A 4CETA 3W1VA 1I2ZA 3RADC 3E9EA 2JK0A 1A8PA 3EEFA 1D6NA 3BXOA 4WNAA 1KY5A 5ERGB 1HL3A 5HQ3B 2O8FA 3KUUA 4XR9A 5LCXA 1FQWA 1P19A 4X8IA 3LT5A 5KUTA 1DBWA 4Q1DA 3GRZA 2A9PA 3MJTA 2BM8A 2C2OA 2ZTLA 4AY4A 1UZUA 2XZLA 3G2QA 1RYZA 4ARVA 2Z9DA 1UPFA 5KHAA 4AS2A 2WM9B 1IHUA 1N57A 1SUCA 1W85A 2DKNA 4PO9A 3SQXA 1O9BA 3I2HA 2C2GA 1QO7A 3M4YA 2AUNA 3GC6A 3MQFA 5JS2A 4BASA 4BFCA 1FFXB 3R2JA 1E9EA 4YRKA 5IF9A 4YROA 3GLGA 3AT1A 3E4DA 1JSCA 2XB9A 5IDWA 5JQWA 4OLJA 1P61B 2BFOA 4H17A 3GGSA 4PGHA 5AW9A 3KVRA 2FQYA 4I1IA 3N2IA 4R54A 4Z53A 5IM4A 1U81A 1D5CA 3A3PA 4TV8B 3PFHA 3UXEA 2FLWA 4JFAA 4DA7A 4E6PA 1APBA 2V03A 2VATA 4KC0A 3LF1A 1JKXA 3QX8A 1XKTA 2G0TA 2ZWAA 1LEHA 3ROZA 1SUSA 1E2KA 1JE1A 3MLEA 2OPHA 1JEYA 1N6NA 1E1LA 2FW1A 4H16A 1FU4A 1XZAA 5ALWA 3VSBA 3L4JA 4LXTA 4EJ2A 4DUGD 3VO8A 1JHDA 4IZHA 3ZCPA 1VL8A 3RJTA 1JU3A 2YWJA 3GUUA 3TW4A 2ANBA 2C3MA 3PDJA 1I1NA 1JQ5A 1NP6A 4Q4LA 4ZVRA 4FDMA 3FCCA 4IIUA 3WB2A 2Z8YA 1IC6A 1XPOA 2EP8A 2DTXA 3ON5A 1U0SY 1H8HA 3PS9A 4UQOA 1NBIA 3L0CA 3QF4B 4RGBA 1JDUA 4DEYA 5FL7D 2FWNA 3DMRA 2JATA 4FGZA 5EIOA 1Z56C 3PIIA 2IX3A 4IOJA 1YMUA 2ZAMA 4MW4A 2GYVA 2G0NA 2O7RA 3O8DA 1KYYA 1WV0A 4RPBA 3OIYA 1PEKE 3ME5A 4I1RA 2H4WA 5B5SA 4ZVMA 4CLOA 1E63A 1GFWA 1E0KA 3H4TA 1AUPA 3H9GA 4YT8A 5B2EA 3RS9A 4ITVA 4M49A 2QTMA 3CZCA 3LDGA 3SBEA 4ZCIA 1E1KA 1Z2DA 2QXUA 1F9AA 2K5UA 3VV2A 1I33A 1NMXA 2FOLA 5BXYA 4MHTA 4BNNA 2FFJA 3KHSA 3PNYA 4C7VA 4JC0A 5KVQA 4KIJA 1ZP6A 4G1UC 1KOGA 5DNEA 4WZBE 2HK6A 1WHSB 4OP2A 4FYIA 4ZARA 5DI3A 1R9NA 4EZEA 2UZ0A 4PM4A 2HRRA 4AUKA 4YPOA 3HCNA 5KYXB 1C3XA 3E5NA 4MEBA 4X3PA 2HCRA 3WLHA 1L4GA 2BZ1A 4A1FA 1PW5A 8AT1A 4D1YA 1N2CA 1JHRA 4GM4A 5EERA 5LMUB 4IDNA 4MJLA 1GEGA 1QO9A 3QVGA 4PGFA 4X6YA 5CH5A 2XECA 3OQ6A 3GEHA 1HZEA 3HCEA 3CF6R 1NVFA 2WD9A 3WRYC 3VZSA 5I47A 1UD6A 1PJCA 2XBLA 2H51A 2CFIA 1Z0IA 4QLAA 3WMEA 1NBEA 3DFZA 2VDOB 3KTDA 4EHDA 4DKXA 1WDKA 3PCTA 4ZAZA 1DRKA 2QX7A 4RWZA 5DCUA 1V1RA 3V8MA 1I4EB 2UZ1A 4NESA 3EN0A 2IWHA 4N6OA 5EMHA 4II2A 1OI4A 2XWPA 3UB4A 5KPDA 1UWVA 1RYFA 1O96B 4H0CA 3WL6A 4DXAA 3E2MA 3G02A 4LOKA 3T0GA 4WY2A 3R5FA 3RWOA 2WTAA 5I7HA 2I8AA 3EVCA 4A2CA 4EFNA 4U7FA 4YQEA 4NXNB 1UC5B 1Y9AA 2FSIA 3A70A 1P0QA 1G6OA 2GZ3A 1DBSA 2DWCA 3ANNA 3O38A 5KOJB 4GBJA 2OZPA 3FDZA 3QU9A 5SYAA 1KDVA 3GT7A 4S0XA 2ZUWA 2GUWA 2ZREA 1N75A 2BFEA 1AIPA 1GG2A 1QLHA 3EFOB 4G0NA 4YPFA 5CX1B 3W6ZA 2NPFA 4LRUA 3H5IA 1BLIA 3CP2A 4XA8A 3V32A 4IXMA 2D7DA 2O48X 1WABA 4KO2S 1LWOA 4RY8A 2O23A 3CH5A 1WIWA 3IVMA 4AJ2A 2B98A 2ID9A 2JD0A 1VJ0A 2R8XA 4D98A 3C39A 1BXKA 5JDCA 3WBJA 1CUBA 1VP3A 2AHRA 2GPWA 3LKBA 3ZU6A 4E6EA 4BV8A 1O6FA 4YB8A 3CX8A 4IIFA 2PUAA 1KQNA 2PK3A 3K3PA 5E6SA 5ERXA 1TAGA 3G8BA 4G5OA 2KLHA 4LECA 3TW8A 2W2LD 2YN4A 3LCJA 4TYNA 4IVNA 1RE1A 1N7JA 5G0TA 1J6UA 3GO4A 3UT0A 3ZHQA 3BFJA 2E55A 1Z0UA 1T1EA 4O2AB 2BGTA 1RDFA 3JD4A 3ZGZA 3KLNA 3KAQA 1SHUX 1F17A 2EZ9A 3X1ZA 3STVA 3CMMA 1FS6A 4NBVA 4B4WA 2XMZA 5EXSA 1ZS9A 4NZNA 1TUIA 2OMEA 4BO7A 2EIXA 1DT5A 4YAEA 3TINA 4N54A 2ZM6B 1O8BA 2WHQA 2MINB 3I2IA 1BKSB 2DIEA 3GGDA 5BSTA 3V4ZA 2QLJA 4OXXA 4C21A 1C9NA 2OCYC 2FOXA 2H65A 1BS1A 2FF5A 2Y6UA 2IU6A 3MQ4A 4IRMA 5ECDA 3F4LA 4IFTA 1N2EA 2PG3A 2G70A 3LA6A 3GRUA 2BGWA 1QH8A 4G86A 2CXTA 3IP6A 4Q9HA 3RNOA 5B64A 4YXWA 3ZK7A 1NC1A 3QI2A 4G5SA 5IKPA 3MPOA 1SC6A 4DSZA 3GVXA 5EIXA 1JMYA 1YQDA 4AJHA 3GWGA 2JPDA 1OAKA 1Y6GA 2CLLB 3OSZA 2JFHA 4IS2A 1SELA 1H1TA 2QSYA 2X22A 3ROEA 4O1IA 2UYOA 5TT1A 1AQYA 1ND6A 4OHUA 3IV6A 2C2XA 3FWZA 5DHRA 4LRSB 4YAUA 2K7FA 2W2KB 3TLGA 5AXBA 5AOBA 4IEIA 1ECCA 4HR7A 4E15A 4YP6A 3KB2A 2G5PA 1G8PA 2YMPA 3O82A 4EMUA 2RCYA 3ONDA 3T38A 2IYQA 1MF7A 3L43A 1H5NA 4Y0AA 4AUEA 2ECPA 2I55A 4N49A 4ZCPA 3PHIA 2F43A 1CY1A 3M2TA 1SCNE 3X1MA 4CFYA 4OYLA 2O2GA 4DQVA 1U90A 1O03A 2PS3A 1DS6A 1XQ9A 3MMSA 1MQ8B 3DS8A 1ZOOA 5GV7A 1X3LA 1OLUB 1SC4A 3A4YA 3JX9A 4F8YA 3NEJA 3SK0A 2YOGA 1OLXB 1SWVA 2NO7A 1C9YA 2OE2A 3KT8A 4J29A 4LHEA 1VB5A 4QXAA 1WTAA 3S8YA 2M6SA 4W5RA 3M6IA 1Z3CA 1VA5A 3N0RA 1GQOA 1C7EA 2DULA 2BM9A 2FVYA 2OGSA 5KDDA 5DTJA 2C2HA 1ZVKA 1OIXA 3KWJA 3QVXA 3MM4A 1E3SA 1J56A 4PO8A 3HBLA 2WVHA 4DVGA 2QGFA 4UZUA 4J90A 1JAXA 5K3SA 2IXGA 3QKSB 4KZPA 4L4SA 3PA1A 3VGJA 2JCVA 5KINB 3RAFC 1AKVA 3RYIA 4KVGA 4PEVA 3UB2A 1PD0A 4F9TA