1QGAA

Pea fnr y308w mutant in complex with nadp+
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
308
structure length
308
Chain Sequence
b'QVTTEAPAKVVKHSKKQDENIVVNKFKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGEVPYREGQSIGIVPDGIDKNGKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVYTNDAGEVVKGVCSNFLCDLKPGSEVKITGPVGKEMLMPKDPNATVIMLGTGTGIAPFRSFLWKMFFEKHEDYQFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPENFRLDFAVSREQVNDKGEKMYIQTRMAQYAEELWELLKKDNTFVYMCGLKGMEKGIDDIMVSLAAKDGIDWIEYKRTLKKAEQWNVEVW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FERREDOXIN:NADP+ REDUCTASE)
molecule tags Oxidoreductase
source organism Pisum sativum
publication title A productive NADP+ binding mode of ferredoxin-NADP+ reductase revealed by protein engineering and crystallographic studies.
pubmed doi rcsb
total genus 94
structure length 308
sequence length 308
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1999-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1qgaA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1qgaA02
4PC6A 2EIXA 5HXBA 1E62A 3WBJA 2BV3A 2DERA 1DDIA 4U9UA 4PC3A 3I1FA 1QFJA 2QMUA 4P3YA 4HE6A 1FRNA 1N8RD 4H9GA 4IW3B 4FK8A 1CNEA 3W2IA 3CB4A 1K8AD 2RC6A 3B82A 3CC7B 2BM0A 4Q7JB 4RD6A 3ZZUA 1YJ9B 1K9MD 1FNMA 3CRZA 1VQ6B 1DDGA 3AGQA 1NJID 1KRHA 3ZZTA 1DARA 4B48A 4ACBA 2B7CA 1KK3A 2YWHA 4RCYA 1Q7YD 4J0QA 3CD6B 3MCAA 4YAFA 3CW2A 4B44A 5EMNA 4PC7A 4ZCLA 4PC2A 2YWFA 3SJZA 2J7KA 1FDRA 3QFRA 2R6HA 1VQKB 2GPJA 3CCJB 2VNIA 3E20A 1VQ9B 3JQPA 3CCSB 2B5OA 1G7SA 4RD4A 2DETA 4NBSA 3B8HA 3W2FA 3CMEB 1Q82D 2BPOA 1J9ZA 2OTLB 3CPWB 1FRQA 4G5GA 1BJKA 1GAWA 1W87A 3MHPA 1NDHA 1EXMA 1EP3B 4AC9A 3CCEB 3OZUA 3LVBA 3AVWA 1QVFB 3E1YE 1A8PA 2PLFA 4FN5A 4ZGNB 1SM4A 1N0VC 2QA4B 1KK0A 3PENA 3ZC3A 4FWTA 4MYTA 2BN4A 3AGPA 2CNDA 1M1KD 4PC1A 3W5UA 2OK7A 3LO8A 1AIPA 1F20A 3AVUA 1YIJB 4RCZA 3G6EB 2C77A 5AN9A 1K73D 2BVNA 3AVYA 1VQMB 2NPFA 1VQ7B 3LRXA 1F60A 1IJEA 3V76A 2ZITA 2BMWA 4RD3A 4B43A 4LBYA 5GV7A 3JQRA 4TMZA 3WBKA 2VYQA 1YJWB 4B4DA 1ZM2A 1Q86D 4M4SA 3P27A 4LC0A 2VNKA 4Y9UA 4QFMA 5THXA 1KQSB 1IB0A 2HCJB 4C0SA 1QUEA 3B78A 1QVGB 4ZCMA 1YHQB 3J81k 3G71B 2QTZA 4YAUA 1OGIA 1BX1A 2PMDA 4Y7CA 4M0LA 5FA6A 1ZM9A 5DSZA 1QG0A 3W5HA 3ZBUA 1EP2B 3CCLB 2DCUA 5GV8A 5TR9A 1CQXA 2GQFA 1GAQA 3G4SB 1H85A 2OTJB 1GR1A 1YJNB 3W5VA 4ZCIA 3A1FA 2QTLA 2VNHA 1QFZA 2D74A 1EWYA 3WYAA 1TTTA 2QDXA 1QGAA 2X3UA 1KK2A 2VZLA 2DY1A 1E64A 1B23P 3CMAB 1TVCA 1QX4A 2RC5A 1VQ8B 4HE5A 1XB2A 4AF7A 4M1KA 4P6VF 1E63A 2YWEA 4MYUA 4R71A 2CRVA 1VQPB 4QHYA 1QFYA 4N3GA 4YAWA 3W2HA 1VQ5B 1EFCA 2YWGA 1I7PA 2QN6A 1B2RA 1W34A 1R5NA 4M53A 1KD1D 1S72B 4YHBA 4RD2A 3QFTA 1QUFA 3WY9A 2XNJA 2C78A 4C43A 3W2EA 1DG1G 1QGYA 1EP1B 1JA0A 3WXMA 4LBVA 3QSYA 3U6BA 1GJRA 2DEUA 1ZM4A 1ELOA 2BGJA 1YITB 3QFCA 1ZUNB 3OZWA 3WNCA 1YI2B 1KK1A 3AVXA 1Q81D 1VQOB 1D8TA 1VQNB 1W35A 4WQMA 1BQEA 1EFUA 1H42A 1S0UA 1IJFA 4F7DA 4LBZA 2OK8A 1G7CA 1N0UA 1R5OA 4DQKA 1GO2A 4TMXA 3CCVB 1W2BB 3FJOA 4RD0A 4N3NA 3ZBTA 1OB5A 3CC4B 2B7BA 4DQLA 3I55B 2BGIA 4B3XA 3ZZ0A 4ZV4A 4ZGQB 5KSWB 4G1BA 4TMVA 2QEXB 1JNYA 1M90D 3WNDA 2HMAA 3OZVA 1G7RA 2BSAA 3CCUB 4EH1A 4LBWA 1KC8D 4Y9RA 1FNDA 3JQQA 2XNCA 5H59A 1KJZA 3CC2B 2FX3A 1VQLB 4TN1A 4M2LA 3VMFA 3OJXA 1CNFA 2PIAA 1FNBA 4UAJA 3MMPA 4TMTA 4TMWA 4K1XA 2XEXA 3VO1A 1JB9A 3CCMB 1VQ4B 3CXCB 3AVVA 3U2QA 4BPRA 3VNVA 3CCQB 2BM1A 3QE2A 4PGOA 3OW2B 1D1NA 1GVHA 4B47A 4YALA 1G7TA 5H5JA 1AMOA 1JJ2B 4RD1A 3AVTA 1QH0A 5TY0A 2E1RA 4ACAA 1EFTA 3U6KA 3CCRB 3WNBA 2VNJA 3VO2A 1R5BA 1XE1A 1QGZA 1WDTA 4G1VA 1KTVA 5TV2A 4RJLA 4YAOA 1TUIA 1OGJA 3I56B 1UMKA 3ES9A 2EFGA 2BF4A 1ZM3A 3P26A 1U2RA 4AF6A 1FNCA 1TLLA 3W2GA 5JBQA 4NCNA 1HA3A 1JA1A 2HDNB 3FPKA 3LYUA 1BX0A 3OJWA 1OB2A 1D2EA 3QFSA 1SKQA 2AHOA 3VNUA
chains in the Genus database with same CATH superfamily
1P5ZB 3TTSA 1O9GA 3M6UA 3ZIDA 4TZTA 2ZATA 2XMZA 3HJGA 4R98A 3SIPA 4NDNE 1ONNA 2FSVA 1PGJA 3H5NA 2A94A 2JI4A 4RLHA 2G4VA 1Y3IA 3RYIB 4D98A 3KSAC 4RENA 2QG9A 4DIEA 4ABTA 1D6MA 2PRYA 3CE6A 1K8ZB 1SBCA 3TQOA 2ZSJA 4LY3A 1Z75A 3A36A 2F3QA 4ZOEA 3CLHA 1FU8A 5HYVA 1HT2E 2N3ZA 3QA3E 5AHXA 3GUCA 4YAKA 3KZNA 1YHYA 4L76A 1G8SA 1ZNYA 2HXGA 2YXBA 1RQNA 3GT0A 4H16A 4RA6B 5A9TA 3I62A 4N0QA 1LRKA 3U4MA 3WMRA 1XKTA 3BREA 3MA0A 1EFKA 3H1AA 4F46A 4JFRA 4REQA 2G1KA 2PG3A 2V98A 4C2TA 1MOPA 3DMFA 2A5GA 3DE2X 3MGCA 4G65A 5BVGA 4LUCA 4BNVA 2A35A 1QGUB 4GW3A 1Q7BA 4PNPA 1MJ5A 1OSNA 2HPZA 2ZR8A 1WJGA 4V0RA 3LE8A 5HILA 3VR6D 2W6MA 1Z6GA 1UZUA 3QJGA 2CXTA 2ZREA 1I7QB 1Z33A 5LQMA 3K09A 1NVGA 2X9LA 3U4CA 3ELWA 1NVTA 2W98A 2GN2A 4FDMA 2BM9A 3B3FA 4Z4ZA 4BGEA 2HWXA 2J3DA 1KZYC 4OJYA 4HWRA 4WESA 3ZHCA 4ESEA 4Z8YA 3KEOA 3RUEA 4UOEA 3H5RA 5LLSA 5ALSA 4JLJA 2H17A 2X1MA 2JF0A 3OZFA 3ZR4B 3PGMA 3PT5A 3WZMA 1J5XA 1V7CA 3V1NA 3SHOA 4YRPA 3F8SA 1EUYA 2FUEA 1VL1A 1NNUA 2J33A 1Z8DA 3Q8KA 2DFLA 2J8ZA 4K9QA 3T7RA 4YFYA 1KU0A 2IEAA 4JVNA 3U13A 1N5RA 1NPDA 1NN5A 2FPGB 1DI0A 3FHJA 3OWHA 4MH0R 3H2SA 2JAXA 2ZYUX 5DH9A 4Z4HA 4MGKR 5B1YA 5FPHA 3L8GA 1GRCA 5C8YA 1LQTA 2ZAGA 3L7NA 3BOSA 4GGOA 5COQA 4CMCA 5K01A 5IDQA 2AWNA 2WNSA 3QIVA 5CK4A 4CN9A 1ZGHA 2WIAA 3MS2A 4XYMA 4EYEA 1SOUA 2CMDA 4MYDA 5EKDA 5G3ZA 1V8BA 5EEHA 3SE7A 1YKSA 2QM8A 4LVUA 4F4JA 1LJ8A 3PFNA 3P9XA 5THKA 5BSYA 8LDHA 3MTGA 2VTDA 4K3VA 2HZBA 1T6XA 3KLOA 3UJBA 4BNYA 1NVEA 3OTGA 2IU3A 4KODA 2UYCA 1RD4A 5ILOA 3HBMA 4RKQA 3E20A 3IP6A 3O4GA 3OSUA 3TJZA 5JMPA 2UZIR 1QO9A 2Q3LA 2XYQA 2VP6A 3PEEA 4M1MA 3RTBA 2HWKA 1T5EA 2H29A 3MUFA 3ZK9A 4OMUA 3WRYA 4EBBA 4CIAA 2ONZA 3GJ5A 3HRHA 1OFIA 3IAM1 3T3PB 3JZDA 2EFYA 3GEDA 3A8JA 2JB9A 4L4SA 1EVIA 2PT5A 2HA2A 3K5PA 3FFWA 4QM6A 3ZU2A 2APJA 3CH7A 3KEWA 3OQBA 4Y3UA 3ETGA 1OREA 5A5GA 1QVVA 1RQLA 1FRQA 3TRFA 3TXYA 3EGOA 1U5AA 3B38A 2MSLA 4RZQA 2KMLA 3HMQA 4D44A 1W85A 2JAUA 1NDHA 3AI3A 1WTAA 5FWYA 2FN7A 5E3IA 1Q2XA 3PUNA 3RBVA 3BXZA 4J7UA 5EE9A 3OZUA 4H18A 2GD0A 3V2UA 4MRVA 3L3BA 4FSDA 2CNNA 2ZZGA 1ORDA 4GYKA 3MJDA 4A2CA 4ARSA 1UPFA 4E12A 1LDMA 4JP3A 5KSZA 3V8EA 2MWMA 3G6WA 3OOHA 1ZUWA 4BB5A 3HDVA 4BO1A 1KP9A 4C4ZA 2XDYA 2O2EA 1RHUA 5DTEA 1A7AA 1EB9A 2HUPA 2JJ2D 2V3VA 3R1IA 2CLDX 1NLFA 2BELA 3OIDA 3R0ZA 4AG3A 2WV7A 4Q9DA 3TD9A 2BDEA 3CCCA 3SS9X 3BIFA 2PS1A 3P0IA 3LPCA 3VR3A 4EABA 1E2UA 1T0PA 2WT4A 4OGGA 4JBGA 2X53S 2G0TA 4UAVA 2PT9A 1J0CA 2OHFA 1KI1A 3VR2D 1SVSA 1A7KA 5FOXA 4W7HA 3NOXA 5JRZA 2YL2A 2H1OA 2FG6C 3LO8A 3R5SA 4JGGA 4MQFB 1OLXA 3TRKA 5CLJA 4HF7A 2WTEA 3ANMA 1JA9A 1MTOA 4IVQA 4XJTA 1NP6A 1URPA 4E32A 5L6LB 1DEHA 3TRHA 1K66A 1Y7PA 5J4YA 1JIQA 4JJ4A 2CL0X 4X7MA 1P80A 4YR9A 1KBZA 2GPTA 2J3KA 3OUUA 3A10A 1F60A 5BQOA 1M1YE 1P4GA 1IOWA 1QYCA 5BYAA 1EUQA 3GT7A 4MGYR 3ZHVA 2KLBA 4LJ6A 3N3AC 4TWBA 3UMYA 2C8LA 4YJKA 1LPNA 1RDFA 2VPIA 2VTVA 2R1TA 3LOUA 2I4OA 5GV7A 1UMCB 3KXIA 4MS3B 4RELA 3RTGA 3WKCA 4RTQA 2HHHB 3C7CB 3PTZA 2VYQA 1YJWB 4B4DA 3BHJA 3BKWA 3UENA 5CFRA 4YQZA 1SUWA 1W4AA 2F9LA 4JI6B 1I14A 2VP3A 3QJYA 4LYFA 3JPWA 3BILA 4PYIA 1R64A 4OFBA 5LJLA 2P4HX 3GP8A 4H1HA 4ZCMA 3UK6A 3LLMA 3T5PA 1A95A 2ZDGA 3FVTA 3IEIA 2GJKA 2AEMA 4NFHA 4PHHA 2XXBA 3EEFA 2CBZA 5BO5A 2PMDA 1IM2A 3JQDA 4PIVA 4GE0A 3QY9A 1M8JA 1MT0A 2L69A 8ADHA 2JGLA 4S24A 2J7PD 5JSHA 1YKGA 2AOXA 3ZBUA 4L3VA 4CV1A 1WWKA 4PPNA 2VCHA 4WBNF 1X42A 1U4NA 4QUAA 5ALLA 5AHKA 1WBBA 2NYVA 4A4DA 5T41A 1M2NA 4HFRA 1NV9A 3CEPB 3GZTB 1QE0A 4XSVA 2B61A 1UKEA 1ZMOA 1F14A 2Q4DA 3H2HA 3PHIA 4BV2A 1AQYA 5JU6A 3JWEA 4BFXA 1QHHA 1T2FA 3DR3A 5DHFA 1NX6A 1YZKA 3VJKA 4A5OA 3L8HA 1U2GC 2WZNA 1M2JA 3I5AA 4Z0HO 1DDOA 4ZIRB 4K9RA 3AVOA 1ZH8A 2YFKA 3BJEA 3GEMA 5TARA 4D0RA 1O6ZA 3NTVA 2W6OA 1F48A 3CUVA 3EQZA 3DMTA 5DXJA 3NQ41 2ZRDA 3SHTA 4Z3KA 1I4LD 1GZUA 5GJVC 1W73A 3HYLA 4ZALA 5BNWA 1X2BA 4GR9A 3DKPA 2O59A 2AV6A 5C5EA 2QUKA 1GQ2A 3IPYA 1E0KA 3WGVA 3PYLA 2WE7A 4ZVOA 3IQIX 4WA7A 1RYHA 3H1BA 5H02A 4CTNA 3CBQA 4N1AA 4OXYA 1P1KA 1YB4A 2FF7A 4LOKA 2QBYB 4R7TA 4KFSA 2XYPA 3E6AA 1ZGGA 1GU7A 2BWJA 2QQ0A 2RCNA 2G5TA 4G6ZA 2NTVA 5TQVA 4P3XA 4Z7JA 3UEOA 2CRVA 5EJ4A 4W9NC 3IPAA 2EXXA 1YS1X 2VYNA 2A0YA 3GB9A 3KQVA 4N8EA 4R05A 5YASA 3UHPA 1NSFA 2PKEA 1M34A 3ROKA 3W2HA 3ZJTA 2DKOA 1WZ2A 4XX1A 2ZDQA 4FFLA 1FX1A 1MC5A 1YRLA 3R9WA 1PR2A 1GNLA 1JPNA 4XM2A 1M0EA 1M2GA 2AOUA 4K0RA 1VA5A 4M6WA 3P96A 4Z4FA 2X15A 1G5QA 4HPJB 1LK0A 2OD9A 1EWKA 1DNPA 1RE0A 2GO1A 3AYXB 3A6GA 3PL5A 3ISJA 3NRCA 1BKSB 1XEFA 3W2EA 1TK2A 5L7WA 5NLLA 1GPUA 2R3SA 3NT5A 3LD9A 3O8QB 2O0JA 1T5IA 2IVZA 4B17A 5JZMA 3FROA 1VSTA 1QLJA 5AUOB 4Q4CA 1AUXA 1XC7A 2P2NA 2Y0BA 1LBIA 1XHLA 3R24A 4KLNA 2OV3A 4TRNA 3SU8A 4YJFA 2QUJA 4ERXA 3MIZA 4D96A 2ZXIA 1GJRA 2EOAA 1ZU4A 1YCGA 2P5YA 2ZFUA 3FFXA 4PG5A 3L0SA 5CXUA 2ZYSA 1GT6A 2DFTA 3VOSA 1NE2A 4NQRA 4V38A 1D9XA 2E0IA 3B6ZA 5JXHA 5D6NA 1YITB 1PJAA 3ZKAA 5HKKD 1MO4A 1ZL2A 4YHHB 1JSZA 1ZUNB 2OESA 2FPWA 1DUIA 3DFUA 1Z0UA 2B21A 3LZCA 1OYWA 1SC4A 2NU7B 2ZTSA 3KV1A 4KJZA 3B12A 1KJNA 1UDWA 2W7TA 1FYXA 3O83A 1XA3A 2FV8A 1EHIA 3GLRA 721PA 2Q6VA 1DX6A 4OEHA 4HVLA 2ZSEA 3FNQA 3O94A 2BBTA 3O4RA 1ZAYA 3ZV4A 1U9YA 2R4QA 3F5MA 4YFVA 1I94B 1MC8A 1RMQA 3ZV5A 1YVRA 1R37A 4EGAA 1B8PA 1WSWA 4XLZA 2EDAA 3T7SA 2XRFA 4OH7A 3GA7A 3P0RA 1J99A 3GSIA 1AQ6A 2YJ6A 2NG1A 5C2JB 4EO7A 4AX8A 4RDJA 1E3EA 2QRNA 1J42A 2C7RA 1RTTA 1SXJB 3QFHA 4RD0A 3AUSA 2XUQA 4V39A 2J31A 1ECFA 4CUJA 1UK7A 1M2VA 2E85A 1M75A 2QQGA 3TLGA 4N76A 3QYJA 4Q48A 1RLTA 1RWQA 1YAHA 3S55A 4AO8A 4BVLA 4BFSA 5IYRA 1WZIA 3QH4A 4I8IA 2QLMA 3OI7A 2NO9A 5JQGB 2I7XA 1LBSA 3PQCA 1G6OA 3KYCA 2OKCA 4YGXB 4G1BA 4OB8A 3SQWA 1M90D 1E5DA 3G1UA 4FMBB 3RASA 4PGHA 2H07A 1GR0A 3G2KA 3UT6A 3GT4A 1EBBA 4Z1MA 1P33A 3KHKA 2PH7A 3GFOA 2XUHA 4QICA 4RYLA 1UD2A 4CL0A 3VZQA 1JDJA 3PWZA 1E3ZA 3OETA 5T4HA 2O8CA 1QH1A 1KC8D 2BEJA 3AZPA 2Y1LA 2YC2C 1EGAA 3TD6A 2NXCA 5D6OA 4BO5A 1KY5A 3VHQA 1HKHA 2UZ0A 4JLOA 3GXOA 3O8DA 2YYZA 3CXRA 3X1JA 2J1LA 4QGBA 3KV3O 2Q4BA 4GPAA 4OP2A 3U56A 1C7ZA 1FTWA 1KZ6A 3GELA 4BGVA 1V95A 2A9QA 4O0LA 3WK7A 4BS9A 3ECAA 4F85A 1HFWA 2YXPX 1QO0A 2WJ6A 4YJHB 4CM1A 1PFQA 3DHWC 1Y3FE 3WNVA 3OM9A 3MXTA 5FBZA 4DA4A 2DOKA 4AL4A 3RFFA 1ZP6A 1G9XA 3DD5A 2GA9A 4KWTA 1JJAA 1K6JA 1PWHA 2ZRCA 5J63A 5JWOA 3A7DA 1ITZA 2B8JA 2ZYRA 4E1VA 5L9AA 2I1LA 1RAHA 4E7PA 4YJFB 2QL6A 3G6KA 1VLMA 1CLUA 1JGTA 1G6HA 1Z8NA 2EWMA 3B1WA 3NTOA 4RKYA 1YNOA 3N74A 1VJTA 1E5LA 5F52A 2VWHA 2BKVA 3SEQA 3HVKA 5LR6A 4LZNA 3QE2A 4D9HA 3EBOA 3JYQA 4GM4A 4XWOA 2JKZA 3PT9A 4QO8A 3FGNA 4OK3A 2QVYX 1WB9A 4RPHA 4GT1A 1MB2A 4DWWA 2MJLA 4FFMA 2FPMA 2R751 1H2HA 4RZSA 5JD3A 7GPBA 2WJJA 2G7ZA 2HA4A 2QNIA 3PYMA 4CMKA 3WTCA 3TFOA 2VBIA 2FHSA 4I3GA 3QLVC 2ODWA 3K0EA 1DX9A 4MUBA 1XD9A 1CHDA 3DOJA 2Y4NA 3NGXA 4LXIA 2Y4OA 2JGDB 1WS6A 3GIWA 5GVSA 2H08A 2GDJA 2YINC 4QU0A 3WNBA 2CT8A 4AT1A 3R9XA 1AF4A 1JFLA 3AR9A 5ALYA 3BTUA 1DOAA 1GQFA 3DDYA 2H51A 2BKEA 3JZMA 2QTVA 3NWBA 4CL3A 5JY6A 5KNDA 1R6VA 1RI5A 1QGZA 1S3GA 3KXKA 5KNDD 3MJFA 4IJ5A 2XNDD 3TMYA 1E3DA 1GWNA 1UPCA 2EKQA 2VSFA 3EEIA 3SVZA 3URMA 2BGTA 1SCUA 4P7FA 4FGZA 3JZFA 4QVJA 4BVBA 2BH2A 2V54A 3REGA 4V0QA 3RB8A 2FPPB 4YJGB 4G0VA 4ASUA 2Z9CA 1CZNA 2BISA 1VTKA 3E9MA 5E6UB 4G8CA 1BCSA 3NPAA 3TLMA 2XB6A 3HP1A 3CF4G 4LWPA 2QR3A 4R6WA 3DUFB 2C2MA 3ESZA 4MIOA 1XFDA 4RW0A 5FR2A 3T1QA 3TRDA 3WL5A 3ZGOA 4B5LA 4X3PA 5AVKA 1FMCA 1NT2A 2YICA 2BLLA 5KAPA 2QXTA 4DSAA 1L5ZA 4J0GA 1A2QA 2NO7A 3AR5A 4N5HX 3PVZA 3GMIA 4POAA 2BFFB 4WZAB 3W5BA 1GTRA 2AHOA 1VPWA 3DMDA 2YZGA 3HDJA 3OIYA 2ISSD 4JITA 1V7QA 3X44A 2EIXA 3H9EO 4NATA 1F2UA 1EA7A 3K4QA 4Y2VA 1OTYA 1PW7A 4KNYA 2OV2A 2XGOA 4KFUA 2JIBA 1YE3A 4TZKA 3LJKA 3QQPA 4AD8A 2I4RA 2CMHA 1GGFA 4YJHA 2AZ4A 1RZ3A 1X19A 3AUKA 4MS1A 2AR0A 4NJEB 2ATEA 2I1WA 2O2SA 5EUCA 5FLYA 1CRQA 3DLPX 4CR8A 5JCZA 1AS0A 3ZWAA 3ZWCA 4ER6A 3HLKA 3IP1A 1U8YA 5J1SB 3DWIA 2IYNA 3KBOA 1SIUA 4OOEA 4OMDA 3VSEA 1T35A 2QAIA 3L0BA 4BTEA 3CMCO 1QO0D 4DPMA 5J4VA 4XYGA 1MTZA 1AO3A 4MDFA 1JECA 1ETUA 4JBWA 3KKKA 4FD2A 5GOTA 3AF0A 3D6AA 3M6IA 1KE1A 4AKEA 2YYAA 1UDXA 3ANTA 1O54A 3FPLA 4RKFA 4BKUA 7REQA 5JRJA 2G70A 2P91A 4J7AA 1BQ4A 3HWWA 4ND8B 4TVBA 3UM9A 3SC2B 4XX0B 5TDHA 3FIUA 3A8IA 4LXTA 4AU1A 3GRPA 5F4JA 4KP7A 2DPGA 2P6OA 1CJTC 3INGA 3DFKA 3N7AA 1PJ2A 2HRCA 1IBMB 3ZZUA 5J9FA 3MJEA 4IILA 4YRDA 5CDUA 5M7EA 2QL5A 1YQDA 4HB4A 1QRDA 4EOGA 3EWSA 5KREA 1QAOA 2XTJA 2PJDA 3OIVA 4IGAA 5JISA 4DLRA 4KH0A 3NFRA 3AL0C 4L28A 4IIJB 1HE3A 1YOVA 2ZS9A 3ZH2A 1U9CA 3C3DA 5CLIA 4JCOA 2NYAA 4C6TB 1E9DA 2VUTA 3QYPA 5K99A 1PE0A 2X8KA 3I92A 4Y30A 1XMOB 3FTEA 1VG0B 1L7OA 2N75A 3AEUA 3ZY5A 4RZXA 1PVVA 4LXQA 1ZO8A 4EW3A 4W8GA 4DZRA 1MH1A 3WMWA 3T7KA 4ATNA 3TSWA 2F4NA 1VDZA 1N8SA 3VH4A 5FIUA 1QHSA 3OE5A 1ZHFA 3I9NA 3HSSA 5KC9A 5JTTA 3BK7A 4Z4SA 2R6ZA 4EWLA 2OZLA 3EVGA 3LBYA 4ZCLA 4RPDA 3VKWA 4PC2A 3ODPA 4Q7KA 3H83A 2YWFA 1VLJA 2YJ5A 2VJBA 1RZRA 4OB6A 4OHCA 3BRQA 4D41A 2H4WA 5KU7A 3ELDA 4NS4A 3NNDA 1X9HA 2OBRA 1BHO1 2D9RA 2WIKA 5JAOA 1XMVA 5JSFA 2GF9A 2FPKA 1U4OA 1BWSA 1I1HA 1Z22A 4KRGA 1E5XA 4HDMB 4KQIA 5ER9A 1R4ZA 1H2BA 2C59A 2GPJA 1W581 5C52B 1UC4B 3AK4A 4URWR 3ZE2B 3D0OA 1ZR2A 1CVIA 5FUVA 2XTZA 3O74A 3TW6A 3EYWA 1MFZA 2H5JA 4HGYA 3OHSX 3DVSX 3IO3A 2MYPA 1TYCA 3MIIA 4DIDA 3FTFA 3LP6A 2PVSA 1QF7A 1RQRA 2O0HA 3KKPA 2PH1A 3PUVA 2XCOA 3NP7A 5DGCA 4CU2A 2DH6A 2W0SA 1KMCA 2X0IA 4O2BB 4PR0A 1GSOA 5EE0A 1HLFA 1U02A 1UBRS 3H87A 1W0KA 4AUEA 4BNFA 8ABPA 5HZGA 1L5WA 4LXYA 5CT5A 4DY4A 4OQXA 1J9ZA 2XTAA 2CLEB 3OURA 4QX6A 5DLPA 2WR8A 1NPYA 1KEPA 1GAWA 3NM4A 1Z5WA 2VA9A 1GUZA 1MNAA 5NULA 5IWAB 2CVFA 2H57A 2PUTA 3F9RA 1VIYA 4UMDA 5HKBA 5JWRA 3LCVB 5WRFA 2J4DA 4KKUA 4DM7A 2AWOA 4MR8A 2OVBA 3V8MA 4DMLA 5K03A 2XE7A 5EWJB 2OV8A 1PCXA 1WXXA 3H0EA 4GQBA 1CW2B 4MVJG 3HU1A 2P69A 3L4KA 4QOHA 4IDNA 2L42A 1XYYA 4NBTA 3HY4A 1FFSA 1G6Q1 1LS6A 1THTA 3O3MB 3SY8A 3ORFA 2R00C 2B82A 1PNOA 2QG4A 3ZC3A 1HOXA 4CQMB 2VUSA 3KWFA 1J09A 2CDRA 4HO1X 1YGYA 4XUGB 5CX1A 5DGTA 1XPJA 1CY6A 1QZZA 3DFIA 3GPIA 4D43A 3KHUA 3DEZA 3AGPA 1NB9A 4RMHA 1NE7A 4GPBA 4A0RA 5JYEA 5I7VA 2OCYC 3JX9A 4P7BA 5LP1A 2R7MA 5L4SA 1M1KD 3DB1A 1S2GA 2QIPA 2ZR0A 1HRDA 3W5UA 4O4JA 3MT7A 5T7BA 2JCSA 1BXGB 4R54A 3R7NA 1E2PA 4NH0A 1GADO 4LY0A 4DMMA 3RAJA 2P2ZA 5F2OA 3QXSA 5CNKA 4Y9SA 3E4CA 2HTFA 3EEYA 2FRXA 2I4TA 4IJWA 5HE9A 2PWBA 3CVYA 2BVNA 2PUHA 1VQMB 4OX9B 4NBLA 4OJMX 1R2QA 2NUPA 2NO5A 4P8RA 3QEAZ 2P27A 4COKA 2QAGC 1I1QB 5TS3A 4AUNA 2PR7A 3H19A 4BWFB 4ER3A 2WYOA 3TOCA 4X7FA 2YWRA 2PKXA 1GL3A 1UH5A 3COYA 1BS1A 2X2FA 3MOSA 1I3LA 3NEYA 3FWYA 4IHJA 2IT1A 1EFDN 1Z34A 4JNCA 4RSRA 5D7BA 5CRIA 4L5JA 2ILVA 1J1UA 2YV2A 1E1KA 3C4VA 3HCBA 4CIWA 5A4KA 4JGIA 1R7RA 2BCJQ 3K73O 3R7AA 3A04A 2DT5A 1V9LA 1L4HA 2HCTA 2VRCA 2ZT7A 3VVMA 4WNAA 4EEXA 5IVKA 1EA5A 4KDCA 1IEVA 4BASA 2TYSB 3N6VA 2ZBVA 2A59A 3EC2A 4KUHA 1SUDA 4MICA 4N3AA 5LWQA 4CLRA 3J80A 4PQRA 5LC1A 1Q1QA 5ES3A 4DCPA 1ZESA 2B1IA 3TXAA 5FULA 5FA6A 2BM8A 4O4JF 4E5PA 1ULTA 5ALUA 4U4AA 1UMBB 1PR3A 1KOFA 4N5MA 1NW9B 3AHJA 1DQZA 1TZKA 2CNOA 1KJJA 1A9ZA 5CYOA 4DWVA 2H00A 1DZ3A 5DIFA 2VWPA 3LQEA 3G0IA 1RE1A 3TNYA 2O8FB 4JDPA 1Q44A 3WE7A 2J09A 2PLAA 4IH4A 3SWWA 3UZUA 1L4KA 3W8NA 1KPHA 1DCMA 1QOPB 1DWPA 1K1EA 2QAGB 2WKRA 2ZWVA 4LGVA 5EXPA 2QW1A 3MWGA 2GFQA 2XJ9A 4O1IA 4C5AA 2YRWA 3FGPA 1KJYA 4Z2AA 2FEXA 1YDWA 2F00A 3CJQA 3FI0A 5BN5A 4KKXB 1TQ6A 4CV0A 3ZU6A 1JR3D 3E0XA 4UVEA 3ZWYA 2FZKA 5BNFA 2VBUA 1IJKA 1TZCA 2EATA 2H1HA 4QL3A 3D0QA 3BHNA 1I4EB 2Z4TA 5DN9A 1ZD8A 2Q9AA 1G60A 2H7XA 2F3SA 1M1YB 3VBEA 1Y5IA 4EA8A 4X84A 4XRRA 4DG5A 1VF7A 2IEBA 2R4UA 2X6TA 2IIQA 1PFGA 1SVOA 2XAUA 3AUJB 3BSWA 4X7RA 3TRIA 1RR6A 4BBZA 4CKXA 1WHTB 5CCXA 4NI5A 2X14A 3QSGA 4GMGA 2FKNA 2ZB8A 4D92A 4WHMA 5LNK1 1RHRA 2A9PA 3EA5A 2H4XA 5BV2P 3HXMA 5ECGC 1CX9B 4MB2A 4EA9A 2JHCA 1JXOA 4V3BA 4WNCA 3WWEA 1N3LA 3FMIA 4HIZA 2G63A 3IOCA 1XU7A 2QK4A 3IAAA 1EGQA 1HR0B 4DSUA 1OX4B 1T3HA 5CEFA 4BNWA 2IOHA 1N0IA 4EVIA 4FHEA 2QA5A 2OG2A 2P4SA 1W9XA 4P3OA 5A71A 4FE7A 2GUWA 2PQ2A 3N75A 4OQQA 1IHDA 4Y6SA 4KYIB 2YKGA 4G5SA 2CXPA 5LL6P 5LUAA 2R86A 2DT8A 3JQCA 1T5LA 1S72B 4BE4A 2DTDA 1RJDA 2C4HA 3BULA 4MZXA 3CCBA 2AD1A 4QTTB 2BCEA 2HHAA 1ZEJA 3PWSA 3ZDAA 2D5CA 4TXLA 1YB7A 1LWNA 1QTIA 2NUPB 4HXGA 2OMKA 3COPA 3MGKA 3MRSA 2JC3A 3GF4A 2GBGA 1WXDA 5KS2A 2XMCA 3GLTA 4ND7A 2H5LA 1ZIOA 4B7ZA 4IG4A 3AOGA 4HEJA 4K9NA 1KC1A 1U1EA 3GY0A 4H0NA 5DBGA 2BONA 3L7LA 2P67A 5DCUA 5C51B 3KLMX 2GYVA 1CDDA 3PNMA 4QTYA 3G5AA 3I6MA 4FZRA 2XWSA 3KALA 4L51A 4LRTB 5AKKA 4E94A 3VO9A 1C9JA 1N57A 3QBJA 2CXQA 2FEWB 2AMJA 1PSWA 1JLHA 1FS5A 1QCYA 1YRBA 2FLVA 2R2GA 2VP2A 2VXOA 2WU0A 3DULA 4NOMA 5BMVA 1DO2A 4N0PA 3RF7A 5LKRA 5TLSA 2C5LA 5HGJA 4F4CA 3SEZA 1WZUA 3CSDA 2WIFA 2AJBA 3NGMA 1ODTC 4LY6A 3S7ZA 3TWOA 3W77A 4FGWA 3HWRA 4JYZA 1MQ8B 2XNKA 4EEKA 4Z3OA 2JFFA 3OPNA 5DU2A 2G88A 2O48X 2C9MA 3BCHA 1IHYA 2ZJYA 4EPWA 2R0QC 1K88A 2OENG 4QPZA 4YAJA 5A7HA 4DSOA 2IYZA 4BZWA 5IZCC 2XHZA 3G82C 2I34A 3S28A 3ELYA 1KHTA 4ZGWA 2JJ2A 2XQKA 3GLHE 3LWBA 2OQVA 3RJ9A 4YRBA 5E9AA 2TS1A 2IBTA 1M1NB 2VS1A 3I53A 4JYBA 5ITVA 4BX8A 1CUIA 5M3BA 1NDUA 2AFIA 3T3NA 1GSIA 4DLSA 1N0UA 2N1MA 1W1WA 2V7QA 3DE1X 3N5KA 4MVWA 3GLHB 3H1GA 2ZUSA 2HF2A 3UJ8A 2RGWA 3WRVA 4WWVA 1RAGA 4GOMD 1XMIA 1L8OA 3CNBA 4Y6RA 3X1DA 3WC4A 4BNXA 3OCUA 3VJMA 4MWBA 4BNGA 3OKXA 2ZQ5A 4EGQA 2Y71A 3LTEA 3HVHA 3KPJA 2HMYB 5KTSA 1U2ZA 1AB5A 4N49A 2D1TA 1C30A 1JVBA 1P1CA 3UAYA 4D82A 5A6VA 4R41A 5IT5A 4UC0A 2W71A 1SHKA 3KFLA 4TKOB 3EZ9A 5LBTA 2BKAA 1X80A 3EFOB 3WNDA 1LI7A 3L01A 1ZDMA 4I5IA 3B6KA 4ZU3A 4IUCS 5B6PA 5BURA 4HS4A 1YBMA 1YU6A 3CLTD 3MXOA 1OASA 1Q3HA 1JJBA 4XQCA 4KPFC 1YHZA 4YYZA 4Z6KA 2AZMA 1M7BA 2QLTA 3WGHA 1RLIA 3C45A 1F8FA 1AGXA 1N5LA 2I4MA 5FPYA 5FI3A 2EKZA 3O8LA 1E5VA 2WD8A 4W1PA 4E5KA 2ZRMA 1FNDA 2E7ZA 2HEIA 2I78A 3L7YA 4UBMA 2JA2A 1Z2CA 3HNPA 2H85A 1H3NA 5F5NA 4I1VA 1HZZC 3A0UA 3P19A 3ZCTA 5KMGA 1ZIDA 1NIJA 4MUKA 1PAUA 2C07A 1M0TA 2H4YA 2WVHA 1YVDA 2RHTA 4KHPB 1Q0TA 1ODFA 3A27A 2HFJA 4DXDA 1XAGA 3AHEA 1EZZA 1JI0A 4KOAA 3K20A 1RMYA 4FGKA 2Z8ZA 5D3MB 3T8YA 3ZWPA 3GVCA 3MWLA 2DE0X 4Q9LA 5A03A 2W8BB 1LS1A 1U90A 2J5XA 4K9PA 4LZLA 1TRKA 1Y0BA 1E6LA 5KSOA 4GKJB 1W1IA 4GL4A 2GBCA 4MKZA 3OCCA 1JTFA 1K7YA 1Y8CA 3PC4A 2WINI 3C8DA 4HZIA 3KVVA 1ZMRA 4Q7LA 1B8OA 1BRMA 4ZOLF 5IJ0B 3AUYA 1J1ZA 4IOMA 3G8BA 3UMBA 1WQ4A 3GQBA 1Q7TA 2VJOA 4ZGGA 3IA2A 5E1MA 1E3TA 1WU7A 3JQ9C 1XVTA 5KYYA 3TB4A 1E8MA 1U11A 3U2QA 1BW9A 5TPZD 3MS4A 5A9SB 4TZ0A 1RADA 2LIVA 1GRVA 5KC8A 1J06A 5KX5F 4NVRA 1Z35A 5ENVA 5DO9A 3V7NA 1RP7A 1JPVA 5E0OA 3K1TA 2YCLA 5GZ1A 1S3IA 3O9VA 4LYAA 3T6KA 5KTPA 5EL0A 5KI6A 4UE3S 4WFQA 2C4KA 1TE2A 1OH7A 1G7TA 1LSSA 1RIFA 1UAGA 2I1VB 3K6KA 3R2JA 4P7JA 2HW8A 3D2LA 3EZ2A 1FVFA 2BCGY 4S1PA 3GLIB 4LYGA 3ZBPA 2MMGA 5GIOE 4TV8F 3S27A 4YMGA 1QH0A 5TY0A 1HPLA 1HDZA 2J9YB 4OHRA 4RJIA 4QDOA 3ZK8A 1I30A 5H0IA 1KOLA 1KC3A 1EAMA 1W6UA 2EAUA 2MSWA 2ZPTX 2PGJA 2G36A 3UUGA 3VU1A 4FBMA 2A2ZA 5JZ9A 2HMSA 2ZTNA 4IJUA 4J4TA 4FBLA 4WX2B 1YV9A 1C0EA 3DPSA 2VNJA 2Q50A 1WSBA 3FNFA 3HDHA 4UUNA 4LHYA 1GG2A 3JPYA 3O1IC 4ZVUA 4MGZR 2CD9A 2WSIA 4KGXA 4BKRA 3FG9A 2VDWA 1QU3A 1WMFA 3VO2A 2XZDA 1Y1LA 2YXEA 3NKVA 4FCTA 4PWZA 5A4JA 1R4AA 1G21A 4E15A 1SUAA 3M6AA 4PRYA 1JU3A 1F2UB 1T9GS 1U2SA 1GQRA 5L3ZA 3R9KA 4HY3A 1L4YA 2FVGA 2XDQB 4L7VA 3DKRA 5E4JA 5KEIA 4GL2A 1H0RA 3CUYA 1K2WA 4GMXA 4ECEA 2O5EA 1I8DA 4Q00A 3ES9A 4JXKA 4YDRA 2FN4A 4EX6A 1JNXX 5H8WA 3PDCA 1GZ6A 4MWTA 2FDXA 2GJ4A 5DYNA 1ZVVA 5AW1A 5JALA 1WPCA 1F1JA 4F4IA 1JR6A 1EJ2A 2CMGA 1K4MA 4LF5B 1UBGA 2QTVB 1HA3A 1X1AA 2UVPB 3NWOA 2ZT8A 3BA6A 1U4SA 4IV5A 3KVYA 2PUWA 4IO1A 1Z0JA 4M9CA 2GPAA 5B58C 4XRGA 4K9OA 2BEKA 2Q7XA 3VC2A 1ZD3A 3E22A 3PI6A 5HJ7A 5IS2A 1EYZA 1X92A 3ORSA 4TSFA 1XROA 2AVDA 2H9AA 3GFQA 5ESDA 3OMWA 3U9SA 3WB9A 4DC0A 1N2XA 1ISIA 1CUGA 1U7DA 3BH4A 3R6KA 1DXYA 2BTQA 4X8IA 2L19A 3CZ4A 4LN1A 4XX0A 3EH1A 5AYVA 1S2IA 5LZ8A 3VR5D 1W7AA 3ET5A 3QUAA 4JR0A 1MX5A 3EEOA 3BX1A 3GIRA 2VT2A 4L9WA 3RWMB 3LUCA 6ABPA 3PC7A 4KRYA 4EFKA 4RDKA 1A72A 1XMQB 3ZGYA 2AC2A 1E1DA 4X6LA 4TTTS 3MJHA 4Q1FA 3AHHA 3B36A 1CUAA 5ERXA 3TZHA 5KNBA 3AIIA 1IQ0A 3KQTA 3GLVA 5ADUS 2FCAA 3W6NA 1VXRA 1L1RA 4H9GA 1L4EA 1MAVA 4FMCF 1QNLA 4IGIA 4TVKA 4YCBA 3UJAA 4PQFA 4XVHA 4Z4QA 4DRXA 4M7WA 5KYWA 1SHTX 3JQ8B 1L7NA 4RHFA 4PXAA 5JDIC 3BY2A 3DH0A 2HJWA 3GVXA 4JQYA 1J56A 1PS9A 1ZVQA 2G08A 5DTQA 1JTEA 5JAPA 3OD1A 4PZEA 1KZ9A 2HD4A 1G3IA 2NX2A 5K3CA 1Y1PA 3ZXIA 3I09A 1QX3A 2WUWE 3LCUA 4FNMA 1MQAA 4KYTA 4Z7QB 2HT1A 5EIWA 3SBOA 3P9YA 3P4UA 2VVTA 3O9MA 4Y1GA 3U0BA 3V1KA 5CDHA 2F1LA 1A7JA 5FBQB 1QS0A 1XOIA 2GK3A 3EPJA 4DCGA 4F2GA 4LF7B 1UT5A 1G18A 5F9HA 3TLCA 4ZVSA 2AC4A 1JVSA 3OW7A 1XF9A 3L1UA 1TJPB 1K9MD 3ROPA 1PEYA 3RSSA 5L8VA 1IN6A 2ZB3A 4E70A 3S7TA 5AVJA 2YN4A 3GROA 3MYYA 4ZC1A 1U98A 1UZLA 4AROA 1XZJA 4L0DA 2B5VA 4FE3A 1J4AA 4MW6A 1DAKA 4MVXA 2DUNA 2MYUA 2UAGA 3ILXA 5LCXA 1RT9A 3UWMA 3USCS 5BPFA 4QKQA 3SQLA 4HG2A 4ARZA 3NEPX 3DBVO 4IZOA 4NNOA 3OECA 3UF0A 1E2MA 5B3LA 1KRWA 5HM6A 3E7FA 3VR5A 2J7PA 1MEJA 2ANCA 4TTSA 4R2IA 3HN6A 3FOBA 5GM2A 4AMZA 2WB2A 4DLUA 3SFVA 2ZU0C 5EQFA 1TU0A 5EMNA 2AMLA 3L0DA 1WP6A 3ZCSA 3EIFA 3O2QB 1Z0IA 3C4JA 1R0YA 1BS9A 1MRZA 3HO8A 1UINA 2ZBRA 3KUXA 1EFVA 4CMAA 1VCMA 4F6RB 5IHPA 3MJ4A 4P80A 4NXMB 3CEMA 4WZLA 3MGBA 2ZPAA 4DLAA 2BJVA 4WCDA 4MMXB 1N9GB 1XRPA 2DKNA 2V74B 5EUMA 1FEZA 4HB3A 4RVUA 3RKRA 3Q15C 4HNVA 1Q6ZA 1N78A 4Q5IA 2NACA 1T4DA 3CCJB 1V5VA 2G8LA 3BRWA 3WGYA 5GTDA 2CYBA 3V2IA 1Z25A 4L8VA 2G7MC 4NSNA 1L6RA 3H97A 5LBIA 2QPOA 3IPCA 4KXYA 4LXGA 4D8UA 2D1YA 4X7CA 2VHWA 2HK8A 2Q07A 1GITA 1Y8RA 2HADA 2JBAA 3BWBA 4HRXA 5F3RA 1PSZA 1IXKA 4UCXA 3O4VA 4ZT7A 1Q82D 2R1VB 3AVPA 1IZ9A 4RA9B 5HNKA 3T1OA 3JD1A 1BPLA 1BEZA 5B64A 3HDQA 1COZA 2EYUA 4P33A 5DBEX 4HDMA 5BYBA 1BJKA 4FM9A 1CVLA 3SLDA 1V37A 3JQ6A 2QN7A 2YVQA 3OPQA 1YGPA 4DR2B 2AFRA 3LRTA 3KDPA 5J5VA 1Z9BA 3B2EA 2QMYA 2VJQA 1VKRA 2HLDD 2W4IA 4ENQA 4YXWD 5AXDA 4MV0A 1QVFB 4IGKA 2C5FA 3R76A 4D9JA 5FTNA 2DUMA 4OK6A 1BCRB 2C2KA 4ZRNA 4LRSB 1WXGA 4O2BA 3DBRA 2E89A 1HFKA 1L3IA 3HA7A 2FJUA 2PA3A 4WXPA 3ZQUA 3H8WA 4R2MA 4US2R 2I91A 2QTAA 1YULA 3LWNA 2ONCA 2WP0A 3PENA 1GQSA 2RGYA 1CJUC 3AINA 3W05A 3UHAA 4LJRA 3HP7A 2GERA 1K6EA 4PIMA 1R16A 1FMLA 2JFNA 1TA0A 3K9GA 3NOQA 2CF4A 1RC8A 4B74A 4FLMA 3MM4A 4MW1A 1G8FA 5A5EA 4FMPA 2YQ4A 4EQZA 5EWMB 1NUTA 2GJRA 3QEBZ 2P9YA 1DJLA 2AF4C 2JEYA 3KJHA 4BEJA 4CT4B 2NVWA 4Y0VA 3QMMA 2IYFA 5IVHA 3ZKWB 1FOEB 3WHPA 1PTJC 1LBQA 3IMFA 3HCOA 3PYXA 4JCCA 5A02A 4OLHA 4UM9B 1AIPA 1J0XO 1C0IA 2X23A 3AVUA 4D3YA 1KO1A 3V8PA 4HNAA 2PT6A 3A25A 3A4IA 3JWIA 1EK6A 3GIDA 1P2SA 3GRVA 2AG8A 3DAPA 3PR2B 4E5UA 1KDRA 3HVIA 3T35A 4FR2A 2VSXA 2J08A 2FFRA 3GFFA 2V9PA 3M70A 4B6OA 1CP2A 1TJ3A 2EWWA 5E6SB 5JUWA 1ZPDA 4HLQB 5LXTB 4EJ2A 1N2OA 4MIKA 4BU1A 1X87A 3LCMA 3FMGA 5AOBA 4GI3A 2D2FA 2I87A 3HHPA 4P2NA 4GE3A 2WU4A 1T8UA 3R8XA 3L6EA 3STHA 5IVPA 3ZXSA 5CG2A 2Z9DA 4RXTA 3N3BC 4OUDB 1F4PA 1GOTA 3BGWA 1YI8A 4LXUA 2WG1A 3NBFA 2C95A 1YZNA 4BLSA 1EUCB 4Y9UA 1ZK0A 1D2MA 1YONA 3L79A 1L7DA 1Z6XA 2OP0A 1JBKA 1SZPA 2XDAA 1L4BA 1JHUA 2E4WA 1E1LA 2VT3A 4FOOA 1N1GA 3Q41A 4B3HA 5F4OA 4EHAA 3J81k 3L7DA 2O2ZA 2QROA 3GAFA 2VJIA 5F2KA 3WGLA 3JAWA 4JI8B 2XX3A 3RYCB 1JJ7A 2D4AA 2LV8A 2XUDA 3JQGA 3OAAD 1X15A 3PNPA 4FFSA 3BAZA 4G8DA 3DBOB 4P4LA 2ZJOA 2TMDA 3R6DA 4WLFA 3V4RA 3C70A 3CCLB 2BR3A 3LKVA 1M0SA 4NZPA 1K5PA 3BS4A 5TGZA 4YMLA 4GD3Q 4Q03A 2QZSA 2H1FA 3C5EA 2O8VA 3F90A 5J5AA 4EG3A 3SHFA 4ETIA 1PK9A 3PFWO 1EGMB 4BCDA 1TMKA 4XIYA 2D2VA 5DCYA 5LMUB 2HC9A 4XLTA 4DBVO 2OR3A 1NVDA 1WA5A 3GAZA 1MVOA 5FWXB 4FT4A 4I1IA 1WXFA 4M8SA 1X3SA 5CT8A 3UW3A 1Z5UA 1PJQA 2VWQA 3R3YA 3L4BC 3VSDA 3R20A 2WF9A 3M6LA 2G83A 4UULA 4D4GA 2ZUFA 3LT2A 1MORA 2ZIAA 3CW8X 5BT9A 9LDTA 4RBNA 3G3EA 3AI2A 1EWYA 1DOZA 1COWD 3Q2KA 2CSXA 1N0WA 2BBWA 2IL1A 3N1UA 3R5FA 4U9IS 3N8HA 5IAAA 4JLBA 1B23P 4FZVA 5JANA 3AI7A 1VHEA 3EIOA 2X0JA 3AERB 4G5HA 3RVKA 4B1FA 1T2UA 3ZVRA 1R6AA 4ANFA 1BN7A 1XLUA 3LX8A 4GPEA 5FB3A 3RC1A 1KQFA 4HOYA 5ICFA 2OCGA 3LBHA 1Z2DA 4CIXA 4EZBA 1GNVA 1YK0A 4DMHA 1GNQA 4TYYA 2WFLA 2CXUA 3SGLA 5EJIA 4BCBA 5L6MB 3G0DA 5T4EA 2FQQA 3OOWA 4ZVVA 4HFNA 2FUKA 1U99A 1USGA 2R7AA 2GCOB 4ZEMA 5GADl 4FLEA 5DLYA 3KEQA 1NZFA 4RL6A 2BGNA 1H22A 3MUNA 1HGXA 2JIRA 3HKEB 1ENPA 4QODA 4V02A 3NCTA 1KETA 1NI3A 4JIMA 3M49A 3LXRA 2CVQA 5CDFA 2JH8A 3THYB 5A5FA 1E94E 1QUFA 1B15A 1PT5A 4C22A 2XNJA 2C78A 4DV6B 1CUDA 1L5QA 3UPTA 1Z2PX 3F3SA 3NG1A 3O2JA 4IIGA 1BXKA 1Q74A 4XQ9A 4DAEA 4FR0A 1VLYA 1GKKA 2Z95A 5H70A 5AJVB 2OC9A 4Z9AA 5IC4A 4B76A 1H4QA 2DECA 4DJ5X 3WFJA 5AW8A 4IIBA 4C6HA 4I50B 1XHEA 1NXWA 1PD1A 5K3SA 4DV7B 1S2OA 1YZFA 2GYYA 2DEUA 1VRVA 2XCTB 3ADBA 1UKZA 1BN6A 3LT0A 3AHGA 4MPTA 1S9DA 2BGJA 3NC1C 3V4LA 5EC8A 5FHRA 4MWCA 3EGIA 2BD0A 5TS2A 5JASA 3H16A 1XXHB 1T1GA 3HFJA 4BNHA 5IYQA 4B82A 2YUTA 4C3VA 4BKOA 3IHWA 5CNIA 5LA6B 1A04A 3U16A 4LF8B 3I0NA 2O06A 3NKLA 3W9BA 3IALA 2HYIC 1YQWA 3FN4A 1NN0A 2AI3A 1CFJA 3D4LA 1UFKA 4V0MA 5H68A 3V1TC 4EFDA 4WBNA 4XYLA 3H3JA 1IZYA 3OX1A 2IDKA 2V6IA 2Y0PA 2Z58A 1E2JA 5BOVA 2PYDA 4PTZA 2PZAA 1X80B 1MJHA 4TWRA 4GXTA 1J5EB 4XLAA 3OUZA 3BN3A 1M6NA 3IXQA 4PO8A 2YS7A 1BHQ1 3UMGA 3KDAA 2PUJA 3CLSC 4MEAA 1OLUA 4ND2A 5HQJA 3ND9A 1E2IA 3ST7A 1XEWY 1U7OA 2C0QA 3U1VA 2A9JA 3WK9A 2CKDA 3CF6R 1RKVA 2SKEA 4EMBA 1UEIA 4IDCA 4RQBA 2IUUA 4RPLA 4O1MA 1IZZA 3DZIA 2R25B 1MO5A 2ZZNA 1PZGA 4F9FA 3A4LA 5KKNB 3KFVA 4BL5A 1A76A 4IIHA 3R74A 2X7HA 5REQB 1QV7A 1SUPA 4J0DA 4MUFA 3R8FA 1PQUA 4OP3A 1C8KA 3QKSB 4PLZA 4YAIA 5C4MA 2Z6BD 1MGOA 1BYIA 4EA7A 3ANXA 1HE5A 3MT8A 3OJOA 4CKZA 2QM3A 3PXGA 3V46A 3R0XA 1J0EA 1Z38A 4F5EA 4U02A 2WWWA 2DLDA 4Q4JB 3GGCA 2NZWA 4B3XA 3VYTB 3LC2O 4YT4A 2EYQA 3WVNA 1WSAA 3C85A 3EGXB 3ML1A 1AKQA 2Q0QA 1FJGB 1AUPA 1UM9B 4F21A 4HDAA 1MW8X 1QH9A 1SD1A 3LC0A 1CS0A 4H35A 1EM6A 4GEKA 4RMGA 3E84A 2XUJA 2FPLA 2QD3A 1WU8A 1MPXA 4E1BA 4HAVA 4P36A 1WTCA 2AK3A 3WG9A 5A6SB 1SN7A 5CCBA 4RHUA 3W8RA 4MLCA 1ZVMA 1RPAA 1AQUA 2H0RA 4HWKA 4C20A 4JJAA 4YY3B 1T9HA 4DDKA 1XU9A 2B94A 2A9OA 3BZWA 5JVDB 5JCJD 4Z99A 3E4DA 3QEOA 4ONEA 3WJ7A 1NQOA 3H42B 4I3HA 4C0BA 5FBRB 5I9LA 3T5AA 1DWUA 3R9IA 2VC2B 1QHEA 5GIPE 1P9RA 2BMEA 3AKYA 1ANKA 2QJFA 3PPWA 2FX3A 1VQLB 1VBFA 8AT1A 1RWKA 1X1EA 4WKNA 2DHEA 3N8IA 3PCTA 3Q7RA 3LQ4A 2IHYA 3F97A 3OJXA 3VU9B 2R8EA 2EZ4A 2HU5A 3DKVA 3IKLA 4GVPA 4M7OA 3L8CA 4HGNA 3FPFA 4FJ2A 4NHEA 1HEUA 1R10A 3GCDA 1EIWA 3FIJA 4LQ4A 4NQZA 1EVZA 4CG1A 2H3HA 1B43A 4MO2A 2W11A 3BH6A 4RE6A 1F9AA 1H4VB 1PJ6A 1AVTA 3FZGA 5A3QA 4L08A 1T36A 1T3TA 4IFBA 4W8OA 2W2PA 1KPGA 4HYYA 1CXZA 3RV4A 2OQIA 3K0CA 4EYSA 3KTAB 4HDQB 2NV4A 1UD3A 3LU1A 4QSHA 2DFKB 2NVUB 3F9CA 4NF2A 3RW9A 3V1UA 4IDOA 5SZJA 1I2MA 4QVAA 3REOA 2ZK7A 1XRMA 4J1TA 5JJLA 3GG9A 4JJIA 3QKRA 4X1YB 1HYQA 5CIYA 3DM5A 2IGBA 4KQGA 3H94A 2IXEA 4L16A 2JA1A 3COWA 1T5OA 2G17A 5CA0A 3PPIA 4KTTE 2BTOA 1AUOA 3QELA 2IYYA 1LSUA 1WDLA 4N7RA 5DLEA 5ILGA 3VA7A 3SP1A 2HHLA 2VJCA 3MSCA 5DHTA 2BEWB 2R5NA 3AVTA 2ZSKA 4JJ8A 3WIDA 2I80A 5L3SA 3K31A 5HCNA 3HI6A 1U1DA 4NRDA 1XQ1A 1P44A 4XDYA 5LMNB 2QP3A 2GXAA 4QJ4A 3IBYA 3TD2A 2G1UA 5KYYB 4KPYA 1ZNXA 3UXYA 2XE8A 4LDZA 1OZFA 4G89A 1HG1A 1XWWA 3JRWA 2IHNA 5EJAA 4MKGA 1XL0A 5JS6A 1NF2A 4S05A 1CZUA 3NIWA 3FDIA 3GJTA 1R9GA 3V4PB 3VSAA 2BZSA 2J5QA 1YX2A 4P4SB 2LZJA 3MCVA 1P73A 4ZEXA 4HUTA 4WRRA 1XTUA 3TNJA 2JAQA 1RHQA 2CBGA 4MI6A 3RIYA 1J8FA 2GEUA 2XA2A 3IQFA 2NSLA 2XUAA 3I61A 3ZD6A 1TUIA 1YUMA 2EJVA 1UMKA 1LLCA 3CH4B 3HO6A 1PEAA 4OYRA 3CE9A 3ZTTA 4L8JA 4R1MA 4BQFA 1PT8A 5LP6F 4DV4B 4FQ8A 3CIFA 3P26A 3P71T 4M9XA 4OH1A 4CF4A 2WTXA 2ZE7A 3GOQA 1RHJA 2J85A 1JLRA 4BB0A 1L5KA 1Z0AA 1GZ3A 4ENRA 2R96A 3HSKA 1QGDA 8MHTA 3DKKA 5EKXA 3MUEA 1MIOB 2VQ6A 4JIGA 3D8TA 3M4YA 1WHSA 3TJMA 5KNCA 2D1RA 3OJWA 1D4OA 4E1AA 4IIYA 2QX6A 2IW3A 2H0QA 3PEFA 4FOTA 1V4BA 2MSDB 1QWSA 1NVFA 3HFSA 1OZ0A 2O2YA 1Z6YA 3KTDA 4JLMA 5A0FA 3VNUA 4A16A 5FOWA 1MJGM 4JUBA 4M88A 5LIRA 2LR0A 3DAGA 2E5LB 2VBVA 2RGNA 4BGDA 5ELXA 1JV2B 1U63A 2WM2A 2WUGA 1JEDA 2COKA 3FMPB 3S1AA 3NORA 1ZW1A 4MITA 2Q7OE 3WYCA 3IDOA 3E1SA 1K3TA 3F98A 3LPAA 3NUZA 2HY7A 5F98A 3FRIA 5FNVB 1JH8A 5KHLB 3K1ZA 5ALHA 3V4ZA 4EB6B 5F73A 4X63A 2ERYA 2ODQA 1NKSA 2ARKA 2NW6A 3AFHA 3MERA 2BTQB 2YJNA 2GD2A 3H9GA 1ZJYA 1UUFA 2BBSA 1RQPA 1JR4A 1HQYE 3GZNA 4O2AB 3WICA 4G3XA 4NCKA 4INOA 4DV5B 1FP4A 4GGPA 4UASA 2TSYB 3ZDQA 3BMCB 4Z86A 3AM1A 4QSMA 1JHYA 3D7MA 5AM5A 3BSSA 2W6IA 3S1SA 1VSVA 4G07A 3M2PA 2V4MA 2YIVX 5IU6A 2V8OA 3KLBA 2NZUG 4B45A 2AEEA 3T1HB 3DZKA 3L4JA 4L3WA 5IX8A 4ZOBA 1I1NA 1J0DA 4Q9NA 2FEMA 2X4DA 2ZYTX 1TEVA 3A31A 1XA0A 3LZ6A 4QU5A 5GWXA 3E9RA 3WBFA 2B4QA 4A6PA 1MF7A 4AG6A 4DFDA 1TK3A 5FEMA 1R8XA 1CQJA 1DJNA 1NP7A 5EVJA 3VHXB 1QOZA 1NULA 1KPIA 5LPNA 1V39A 1J23A 1RTKA 4GSYA 4D4IA 3L8YA 2MR5A 3G9QA 2XB4A 4UHHA 3AI1A 1J8YF 2GZHA 3UUFA 3ZYZA 1BDMA 1YCDA 4X97A 2CFRA 4RLFA 3C6ZA 5IKMA 2C4UA 2G06A 3Q3JB 2B7CA 1F2DA 4RMJA 2QVBA 4CM6A 5FH9A 1LCIA 2WTUA 4IXDA 3S8YA 1KYVA 3N5CA 1Y3BE 1NVAA 4NBKA 5AMXA 3TM5A 2KPOA 3LY9A 1VE5A 3U7JA 3GEPA 4KH1A 4P4SA 4X94A 3LUGA 5A4AA 5KYUA 4LVOA 3GFSA 3ZV7A 3PA1A 1N6NA 3T53B 1L5SA 2FFBA 3RYFA 2X9NA 5JCOA 1VL2A 1RFGE 3EFHA 3SJZA 3PC6A 4TV8A 2PJUA 4G5YA 5C8YF 1N6HA 1M66A 2RGAA 2WSLA 4QUDA 3KBBA 1LPSA 4MGIR 4FXUA 2KBEA 2XUPA 4KQJA 2ZAYA 1NMEA 4WTOA 1E7MA 1WUHS 1SBQA 1BFUA 2V9ZA 2ZBFA 5I5EA 1EVQA 1KS2A 4HZUB 1P60A 3K0HA 4R69A 4XDZA 1BE8A 3RK0A 3S70A 2ZZEA 4ASUD 1A97A 3U40A 2O6LA 2VNIA 1XVIA 1IOVA 2GLXA 2MINA 2RAUA 2HSZA 1DCKA 1SR8A 1PFKA 3SQNA 1JB1A 1OD6A 3CN9A 5C53B 4DIOA 1KI9A 3NYIA 1QGED 2BBOA 3OPYB 3I6YA 3ZD9A 3OE4A 3TUJC 4W5QA 4OXIA 1I1OA 4DB2A 1VXOA 1QZTA 3R40A 5T8KA 1IHPA 1X1TA 1LI5A 3FYHA 2RB5A 4O25A 1IBCA 4RDLA 2I55A 3GJ3A 1OH6A 1KAHA 3WRYC 1TYDE 3BQJA 5IF9A 3C1UA 3M5DA 1HI9A 4XIIA 3WL8A 1ULSA 4IM7A 4BE7B 1USKA 1Z2AA 1A2KC 1VE6A 3LI2A 2HUNA 3WGNA 2Q4EA 4G5GA 2GBIA 3FWHA 3VKHA 4ZKDA 5AM4A 1W93A 1WCWA 1EXDA 1ZK1A 1LDGA 1H4TA 4C0XA 2IHTA 4MW0A 3Q98A 2RHBA 2CHVA 1B8VA 3SCZA 4J0KA 5FL7D 4ZGBA 3E1YE 4EY4A 4GRAA 5CDGA 1LF5A 3G8DA 1LLDA 4GM0A 1K0UA 5CFOA 1DRVA 5C3UA 3VV3A 2QA4B 1CJMA 2FU5C 4LYEA 4LSGA 4A2WA 3FYDA 3A70A 4OHFA 4UE6A 1RQ2A 2Z6UA 3EBLA 4B4WA 1KVTA 1NVVQ 3MRXA 4ZXFA 2Y9MB 3IUYA 4I55B 4RXUA 3EOAI 1YFLA 5AFSA 3AP3A 2ZJBA 4FMDF 5EJ8A 3KT3A 5AK6A 2CNDA 4MZDA 4QHSA 3VPDA 1P4SA 4EMSA 2KM1A 1GUYA 1OYYA 4ND3A 5HUQA 4JR2A 2N42A 1Y6ZA 1QIFA 3ZHQA 1NP3A 1K97A 1XTBA 3F3KA 4PICA 4DW8A 4B3SB 1TUEA 1TF2A 3MJRA 4XN0A 4JL8A 5JYDA 1X7WA 3CZRA 5IDVA 3RNLA 1PV2A 2XCSB 3GPLA 2Y2UA 1A5ZA 3BXFA 4DARA 1GCGA 5FNVF 3ISTA 4UJ3A 3KXDA 1NVUQ 2G72A 4JROA 2FJ0A 2QLLA 4EI8A 3LO5A 5DRYA 2GXQA 5TPWA 1G59A 4IL5A 3RHSA 1WZEA 2BMWA 3AHIA 3HBFA 4QPNA 5BPHA 5B3JC 4V1CA 5G02A 4KDEA 1IWPB 3VOTA 5IHXA 2DJ5A 3ZKWA 3BCFA 1ZD5A 4GGMX 4Z4WA 1WBJB 5ALZA 3I04M 3RCBA 4B87A 1ZD9A 4HBGA 1E9SA 3IODA 4YBZA 5HIAA 1SU4A 1W44A 1NOIA 2HNKA 4DZZA 5JAUA 5DNVA 3P2IA 3PXXA 1GLGA 4F1KA 1KVSA 2K2WA 2KWIA 2OYSA 1J24A 2HXYA 3K32A 3QXCA 1E9EA 4XR4A 3IV9A 3SZGA 1X7GA 3AFOA 4E46A 1DXHA 1SKBA 5H83A 4LDAA 1G9TA 1QP7A 2PBLA 1I4OA 5K3AA 2O3TA 1K8RA 2SHKA 4ZODA 5KNCH 2PS0A 2X3YA 3K72B 3OWOA 2Q4RA 3B6IA 3RS0A 4EG4A 4RK0A 3EN0A 1V0EA 1PG0A 1ZCBA 2LP4Y 3I1JA 3G2JA 5MFPA 2Y1CA 1W96A 4BLOA 2Q8QA 5FI1B 3UUWA 3R4VA 1MHPA 2GQFA 2YMLA 2QJRA 1AQIA 3IELA 2DB3A 1C3XA 2IEIA 3CU5A 4PM4A 4DLTA 1LNSA 1GL6A 1C1YA 2WHXA 2PMWB 5AKJA 4N6OA 5EKUA 5J2TA 1X38A 2AG5A 1SQ5A 5I7SA 4DK1A 3GVKA 4FT2A 5EJEA 3V1LA 4CEJB 4DDUA 3BGOS 1XMXA 3DE5X 3JQGB 4I14A 4Z4GA 1EZ1A 4GSLA 2D74A 3PFHA 3QW4B 5TJHA 3Q8MA 1VPEA 1E77A 1P4HA 1Y8QA 1RRFA 4OQYA 4Y2XA 4AZ0A 2DTXA 4M83A 2JD2A 5E9QA 1T1RA 4BMVA 4XYEA 4QDKA 4A2QA 4NPAA 3IB3A 5H4GA 3UWKA 4XVCA 4IJMA 1QG2A 5H3HA 1BH2A 4EENA 4EF4A 3QOYA 3T61A 1ZSVA 4Z9FA 4KACA 4R9RA 4KXFB 4UD6A 1X8JA 3CSSA 3C0KA 1OLSA 2GHTA 3EGCA 3KKOA 4K40A 2Z3ZA 3AWDA 4E6EA 4ROTA 4LF9B 3VDXA 4FE4A 4I99A 2JFYA 4NMLA 3UMSA 2DFPA 2IODA 2V0NA 3H3FA 3UKOA 1Y9JA 1F8UA 3O3OB 4UHEA 3S2IA 3HYRA 3UK0A 4PCVA 3PS9A 2WKWA 3M83A 1U80A 3U3KA 3VNRA 2WNIA 4RETA 1K9VF 4YAWA 3WIEA 3KZOA 1QP8A 4PIPA 1C8VB 1NBOA 3LNCA 2OHXA 3JARA 2NLOA 1GGHA 4R1PA 5EMMA 2QYOA 1P61B 2EKBA 3LVFO 4F11A 4L8LA 1Z4JA 1A0OA 1Q11A 1ZXLA 1N08A 1CETA 1U6JA 1VG1A 3CZPA 2DLNA 2I99A 1RFLA 5E3HA 2BKXA 4G4GA 4RC9A 3H2KA 2OPHA 2FY8A 2P7HA 5A8AA 1N25A 1NVVR 3UGKA 2F4VB 2IUFA 1K7CA 2Z43A 2VP9A 3V5NA 4H7DA 4I6JA 3ME5A 4CXMA 3G2MA 1PHRA 1I24A 1WY5A 2R6AA 2JVJA 2NU6A 2XOXA 1FYVA 3R5KA 4IV8A 2REBA 5E1DA 3C48A 1EQUA 3ZYCA 1VJ1A 2O0KA 3OA0A 2C84A 5T57A 1VC2A 2PYZA 3LLVA 1E2BA 2AE1A 2A5YB 3OTQA 3PLAE 1KZ7B 2EHDA 2JI9A 3UH0A 2VQDA 1IIBA 3IHTA 4U2FA 3SC3A 1K63A 2ZWIA 3PTAA 1K28D 3EEQA 2D3LA 1WRBA 4OF4A 2I65A 2OFFA 2C0CA 1K7EB 3OM8A 3I5YA 2ZRNA 1D6NA 2AXEA 1BHJA 1Z6AA 2CNWA 2B20A 1XVAA 2WZQA 3GJ7A 1P6UA 1EXVA 5HJ2A 3E23A 4JLVA 4QUHA 5AKZA 1T8SA 5F4BA 3P32A 2C4MA 1BMFA 2IOYA 1H42A 1RWWA 1VMAA 2BTEA 4YRTA 5DTMA 3FD8A 3AESA 4RQTA 2FDCA 3NT2A 1B6GA 2ID7A 4PU0A 1IJBA 1XRNA 4RH1A 1QH1B 4HYQA 4WOKA 2PX3A 2GRAA 3AY0A 1SY7A 4OP7A 2YDYA 4M8IA 2OZEA 3GLUA 5CX4A 2OBBA 1ID8A 1DFGA 1TT7A 4OXQA 1ZCZA 4BY9E 5HQ3B 3FJOA 1YRYE 4PFKA 1DBRA 1V3QE 3OOJA 3MOIA 1REQB 4PAOA 4Q1CA 1XZFA 4ZI7B 1BVRA 1CUJA 3IV6A 1V16A 1FXWA 4YCLA 1SXHA 1P3JA 2EJWA 3N7UA 3GLIE 2IZ6A 3N2IA 5ETJA 5IN4A 3BIXA 4IV0A 3CWCA 3I9LA 3VZBA 2WSSA 4MVJF 3VSBA 4ZVMA 2ORVA 4J49A 4DBZA 2I2CA 1JT2A 2A57A 5CH3A 2B9VA 3D9QX 3O92A 3D3WB 4OFXA 4ZVTA 4F5DA 2GNAA 1H2RS 5E8JA 3EZ6A 5G4LA 4O8ZA 3AMVA 2HF7A 1L3CA 3VRHA 1PDVA 1SCIA 2JIOA 2IVFA 4R31A 3BWYA 3L92A 1Y98A 3QNUA 1O95A 4B8YA 1II9A 3R0JA 5A3SA 4QM7A 5K0EA 1AZSC 4GLFA 4ITRC 4NBVA 1PGNA 2B35A 1IG0A 3BK1A 4RK7A 4GFDA 3EQ7A 3TTWA 1R4NB 3FZEA 4LWOA 4OY3A 4C3UA 4F4UA 10MHA 2HAEA 2NT4A 2H1VA 4GI7A 4QXPA 3NHLA 3I2GA 2VDOB 2HJHA 3CGGA 3HCNA 2BFEA 5J40A 5JS8A 5HZAA 5K8VA 3HRIA 4YRJA 1EEHA 3S2FA 5F1PA 2YIMA 2E87A 4WEOA 2VK8A 3F73A 3KPYA 5ICEA 3H2GA 1VSUA 1H66A 3DZFA 4KQ9A 2P0YA 1A9YA 4GHWA 4Z9XA 1CS0B 4MOWA 4NDAA 1DVRA 3BCDA 4OU4A 3K4PA 1F7UA 3ENNA 2BEWA 5LBUA 5CDYA 1KDVA 3KEGA 4ZVQA 3V2HA 2YQZA 3U7QB 2I62A 3JAKA 3WP1B 5C7YA 2XVXA 4RVSA 2SKDA 3PC2A 5ALNA 2OB1A 2OZVA 2VHJA 3F4BA 3EXFA 4A8PA 5DV9A 4BLRA 4B2IA 4TMTA 1SHLA 3OFSA 3PE6A 4IHAA 4C0QC 4EECA 3IR7A 5CFMA 3Q5DA 2LW7A 5DTRA 4KIWA 2AW3A 1XZGA 1QYDA 3QBVA 3W3AD 4A7PA 1VQ4B 3BH0A 1QO7A 1MEOA 1HLDA 3QQ5A 2VK1A 5T64A 2BM1A 1JDVA 1QR2A 5U1PA 1U0GA 3D0KA 1EAYA 5DCWA 3T9AA 3WL7A 2ICAA 4RTNA 4QEKA 4RIEA 4RXMA 3ZCQA 5IXJA 4GLJA 5EJGA 2JPDA 3ROGA 4YACA 3RU9A 2WYRA 1XQYA 3WLNA 4D9EA 5K0GA 1YT5A 3NM6B 3OQHA 4ARCA 1L5FA 2I66A 1XJQA 2JLBA 3DHYA 2WJ3A 4KVGA 1GPDG 4KMRA 1G42A 2HJVA 4DKJA 2JRCA 1JLMA 1GXSA 4CKBB 2VH2A 4CLOA 2O19A 4OOXA 2GTPA 4BUCA 3PHLA 1EMDA 3F6EX 3GLHA 3IVCA 3NHBA 1TQDA 1V5GA 3CCRB 5MFZA 1QU2A 3CBGA 1AKWA 1AHIA 2Y1WA 4RQAA 1DLJA 1KZ1A 4EYQA 3KQNA 1EGHA 1G8JA 2QENA 3O8OB 3DQPA 4IP0A 4MCAA 4QZVA 4DUYB 2QBYA 2JW5A 3TCKA 4WOPA 4H3SA 4DCMA 3IP3A 2GD1O 2GM4A 2WMNB 2ENWA 4B9EA 5B55A 2ZE6A 2YJ4A 1PQYA 1E3SA 2R97A 3E7XA 1K5GA 1T9CA 3UAZA 3MAGA 3DWGA 3LSYA 2Q8NA 3WP0A 2B1GA 4CIDA 1W9HA 1U2QA 2Q7DA 4C05A 4HT3B 5FLXA 3AF5A 2AI1A 1WOYA 5MDHA 1KO5A 4IRMA 2OHJA 2YY7A 3KQSA 3A6JA 3UJDA 3O0TA 4P9SA 1CY7A 2JI8A 1XDWA 3OBIA 4MRMA 4QXOA 2XCLA 1BGWA 1Z13A 3B7PA 3UUEA 3NIDB 1O9BA 4M3NA 1TLLA 2OAEA 4MRAA 2GF2A 5DBIA 4G0ZA 5LKAA 1CUHA 2OQ2A 2OWEA 3CVJA 4M0MA 2HLHA 3CX7A 4JEHA 4MLZA 4WDRA 5CM2Z 1JA1A 1V7PC 3OC6A 3OLXA 3IMEA 5D00A 3THXA 2F17A 3KE9A 1YMVA 1FCJA 2D8MA 1FW6A 3VHLB 3HCWA 3DE6X 4GUDA 5JFOA 2JAPA 4RTMA 1WETA 1DC3A 4P84A 4GQIA 4RJ2A 4D42A 5KB3A 5DYGA 2OGWA 4M22A 1RKXA 2SECE 5EYPA 1DDIA 5DTJA 5GZ6A 3W2TA 4YUAA 3GJ6A 3KK0A 3O3CA 4IQ0A 2P35A 3WMFA 3D43A 2V5AA 3LX6A 3ESBA 3T7JA 4AW9A 5FUWA 1LNZA 3EVBA 2A1UB 3I52A 4ESOA 5JSZA 1SBTA 3TNFA 3SIWA 3IHLA 5G2OA 4P3YA 1PJZA 2FWIA 3AW9A 4MGEA 4BQQA 2AOWA 4RACA 1KFBB 1OAOA 3KAJA 4ZJYA 3RAEC 2H8KA 3A8KA 3QUCA 4HS9A 1QOQB 5AD1A 4LRXA 2EC5A 2PL3A 1Y82A 3F3YA 3ADKA 1BJRE 3O8RA 1E79A 1U7PA 5FTKA 4OOVA 3L7OA 1CS4C 2ETVA 2BJWA 1G21E 1E89A 3E03A 3R3WA 4KYUA 5EJMA 3TQTA 4KO2S 2X1HA 5I7FA 3KYDB 1GPLA 4ZARA 4EB6A 3GRAA 4HTAA 4JVLA 4Q7JB 2AHRA 1J70A 1XTQA 2WHQA 3C7DB 1DRJA 2OB2A 4EBFA 5LQNA 1KY4A 1UKYA 1UBTS 5I8PA 2ECPA 3NVAA 3PQ3A 3NEJA 1JE0A 1OXSC 2VR1A 4RVDA 3AEYA 3H65A 1HEIA 1UJ6A 2Q6TA 4QVGA 5DLDA 1QZXA 2QGGA 3M1LA 4QPPA 5HGXA 1Q50A 3IVRA 4NCXA 5ITZA 4QJBA 1XELA 2JDID 3BMCA 4L0MA 4L9SA 1R00A 1PZEA 4JUAA 1UMBA 4EDHA 4EJSA 4WFKA 3H6GA 4BAZA 5LDDC 4DUZB 4KQHA 1FLDA 3D1LA 2F8TA 4BE9A 2Y77A 3A1EA 3DBHA 4MV4A 2IYAA 1VL6A 2O8FA 2PZBA 2ZIGA 4WVLA 1E0SA 5AK4A 1U04A 2C03A 2MHCA 1YFZA 1YJXA 2O1EA 2AMYA 3KT8A 3P45A 3I8OA 4EJSC 2X13A 3PF9A 5CDTA 2Q49A 5JPIA 4JYPA 3SF8B 4TLCA 5KU1A 3A9WA 1Z3CA 3M4JA 4OQLA 4C4YA 4Z54A 1O5IA 4GP9A 4YV7A 4RV4A 3NHWA 4OQZA 5DYTA 3FKSA 1Z4PX 1E99A 1YAJA 3B1XA 2R6HA 1Y4UA 3RVMA 1X1DA 4CODB 1XLVA 3TTTA 2PMKA 1E2FA 5JPCA 1IK6A 2HMUA 3EDCA 3TCXB 1C50A 2XYGA 3V3TA 5SV2A 5J23A 2AYYA 2PCLA 1QFSA 2QW0X 2Z56A 2B5OA 3CWQA 3I1YA 5H80A 5IARA 2QWXA 3HJHA 5E7IA 3OZTA 1X8LA 2B78A 1PNVA 2LZ0A 1TF7A 1SVUA 1JKXA 2GEVA 3N86A 3ZNNA 5FTJA 1ZJZA 2NU9A 2VRWA 3AV0B 4ZYVA 1B76A 1LJLA 2GZRA 3PV0A 3WB2A 2E3JA 2FZWA 4DYDA 3GK3A 2HFKA 2JGRA 3DP9A 4TLEA 1V2GA 1WOMA 5D2CA 1BXGA 3NXSA 3UIEA 2C5AA 3GC6A 5JHGB 2Z0MA 3D7KA 4KIGA 3IAXA 2X0EA 3VR5H 3FLEA 4CI9A 4N0DA 3C41J 3W9SA 4RK5A 4F71A 4AC9A 1GARA 1I3OA 3HHEA 1NR7A 4G5FA 4J2OA 4WOCA 4ZCSA 3RU3A 1K9SA 4UPDA 5EP2A 4C29A 1N5IA 2OC4A 5A1JA 4DE5A 1E1RD 1HF3A 4KEAA 2DFNA 4R0MA 2FZCA 3U39A 1S8FA 4DJAA 3Q3IA 2V0CA 3DM9B 3O1HB 1T9DA 1G0OA 1T24A 4CKWB 3E8MA 1QQBA 4AS2A 3OX4A 4TTVA 3K6SB 3FYTA 2Z1NA 3NLLA 1GL9B 5IUNC 4P38A 4WCFA 3AEXA 2F1MA 4FWTA 3AHCA 3ZWOA 2OEPA 4W9NA 3ASZA 5C5IA 4NAHA 2BH9A 4TTIA 1J25A 2NO1A 1ZJ6A 1A8UA 5HRAA 1QHHB 1CF2O 1KSJA 1NBEA 5E4YA 5IYZF 2CHEA 3HBNA 4QECA 3V55A 3D8SA 5KWIA 1M34E 3HL4A 3L8DA 3NDIA 3M82A 4IEIA 2IU0A 5FWYB 1L3BA 4OLFA 4J3NA 1XMPA 2UZ1B 3QX8A 1F20A 2DUWA 2H1LA 3EMDA 3RRMA 1AU9A 4KO1S 3RLFA 1SEPA 1O4WA 2GR9A 2ESRA 2NXNA 3RROA 3CVVA 2AQ8A 1HNZB 2YZ2A 3SXUA 2I6GA 3EXHA 3U0VA 3CUWA 3SMQA 3D6JA 2E4YA 5K0BA 2X1VA 4G01B 3DVAB 4UXJA 1JG7A 1RWXA 1U3WA 6NULA 4YONB 3W04A 3K0SA 3DT9A 4I46A 4QOIA 4CZ2A 1WUKS 3IBCA 1QQTA 1ZBQA 2PXAA 2Z98A 1ECLA 3Q5GA 3AOEC 3GCZA 1WB5A 1EFVB 2O4UX 4TQ9A 1C1XB 1CFZA 2R1UA 1ZLYA 1ZN9A 1DBIA 2AYZA 1Q7CA 2CSUA 2EKPA 1I3CA 2F3PA 2QX8A 4OQMA 1ORWA 1E6MA 1Z39A 2VNKA 1N9GA 4A8TA 1BSVA 3LK6A 2VH1A 3NRJA 2R8PA 2YASA 3FB4A 5DHSA 5KUTA 2XXAB 1Q0UA 1IOLA 1QVGB 1TEZA 4FZJA 3LFHA 2Q3EA 2BFCB 4YAUA 4DJEC 1N6PA 3D6NB 3NV7A 1C30B 1M6EX 2F9MA 2X7JA 3AR7A 1UFRA 1P9OA 5DX8A 2AQIA 4RIHA 1AV7A 4DMUB 2VQEB 3W5HA 1O6GA 4JT2A 1VLOA 1G19A 3FNRA 4CLHA 5KSYA 4XORA 3DUWA 3FA2A 3LH5A 1Z0DA 3P2YA 2YZMA 3CEAA 2XSZD 3FY4A 3NTUA 3AP2A 3QRWA 4BRUA 1TTHA 1KL7A 4RM0A 4CYMA 1LKZA 3EULA 1NKVA 3HM2A 1AKMA 2WJ4A 5HIIA 2R1TB 4FMDB 3HZZA 4H1UA 4MS3A 4HNSA 4UNQA 3VNBA 1RXCA 4DNOA 4A36A 4F2DA 2Z2XA 1Z29A 1H85A 3I2IA 4JLDA 4Q3OA 4JKOA 3DV0B 4YVFA 4F9TA 2CVPA 5DP2A 4FYPA 2Z08A 4XWTA 2FK8A 4KXVA 2VWGA 4BNNA 4XGIA 1KI3A 2W00A 3RAPR 3MTQA 2OM6A 4IFTA 4FI3F 4QYIA 1Y6QA 3MNFA 4RY0A 4IJVA 4OV6B 1DP4A 4Q82A 1WLSA 3GLFE 1D04A 3F5QA 2OM2A 3K1AA 4HWOA 1X1RA 1AN0A 4YIHA 1BMFD 3T34A 4AN1A 4YMWA 3MVEA 2ZTVA 1NNLA 5D85A 1ZGBA 4GZ3A 5IK2D 1AX9A 2Q3BA 4PHFA 1MAAA 3R7WB 2CJFA 3ZOZA 1KK2A 1PJ7A 4PLCA 3VU8A 4TZ6A 4PPGA 3RVNA 1RBZA 4KVFA 4UTVA 5K3BA 1US8A 2W8BA 2I3GA 2WLTA 4HQLA 4LQDA 4OHVA 3UN1A 4CRWB 4QDTA 3DDSA 1VQ8B 4TGLA 3FGZA 1DRUA 2IEDA 3U1TA 1OXKB 2B2XA 4RTKA 3LECA 3PEVA 4P6VF 3K0BA 4WCFB 4CTJA 5FUQA 2I5PO 1ZMTA 2IY8A 2ZIXA 2XTMA 4JI3B 1GFSA 5HVNA 2UZ4A 13PKA 1E3JA 4MUJA 3ZDBA 3GJ8A 2PUGA 1IOZA 3E15A 3ITEA 3IGFA 4QELA 4QHYA 2XAAA 3H4IA 3ZBQA 2GASA 3SSMA 3R7LA 1M73E 1CV2A 5IC5A 2XWQA 1PNRA 2PCJA 1PD0A 1U0FA 5BSMA 1Q9SA 2BGMA 1B2RA 3JQBA 1R5NA 4M87A 4PG7A 3KXPA 3ROXA 3ZU3A 1OLSB 1EQ2A 2GCNA 1WO8A 1W47A 2Z30A 4YQEA 4KMSA 4U00A 1VSBA 1U8FO 5D01A 2B69A 3PQ6A 4JJ7A 3FF1A 3WLFA 3B2QA 3GJZA 3ONVA 1O0SA 1DKPA 3FTPA 4EG5A 1Q57A 2C97A 3JR7A 4S12A 4PEVA 4RA6A 3OY2A 1Y9AA 3IXMA 1EP1B 3W8EA 4KN9S 2Y99A 4X65B 1TD1A 3DLTA 5JO0A 4WBXC 4WZAE 4C08A 2OOKA 3GH1A 1JAHA 821PA 4MIEA 2EG5A 1OOEA 1E7WA 4ZQEA 3GCXA 4N8DA 1HLGA 2QTNA 1ELOA 1KJIA 2WZBA 4NAVA 3I58A 1UJ4A 4UNIA 5HQ3A 2HOQA 4I5DA 1DXOA 3WQQA 4EY3A 2WG2A 4CE6A 1W6RA 3Q3CA 3UXMA 4ETWA 3KTFA 4KXMA 4D79A 4NNPA 2IFTA 2C7GA 2BFCA 4WWHA 1ZMBA 1I0LA 2WWGA 2DZDA 2JFXA 4X5OA 421PA 4WESB 3VNAA 3TW0A 4EK9A 3VKGA 4GPD1 3MMSA 3IEPA 3EC7A 5L3QB 3GMTA 1YR3A 3EFOA 2BZ0A 1Z6TA 3OQNA 1HE4A 2CBXA 4X7BA 4O63O 1QF9A 3HXLA 4I1UA 2GN8A 4KCGA 2BHTA 4M99A 1YBHA 3HJCA 3Q2OA 3QVGA 5DHRA 1NUUA 5EFOA 1ZGCA 1C2TA 4YP6A 1Z83A 4Z53A 3A1PA 1NSYA 2WF6A 1NUSA 3AKZA 5K8UA 4IQ8A 2O3SA 3BGIA 2NO0A 5JSQA 4LZWA 3WKBA 1XZCA 5HHTA 1NF9A 2MSEB 5DE3A 3ORRA 1JDSA 1WCIB 2V31A 2VEOA 4NMWA 4UHJA 3CX4A 3GBSA 3LQQA 4CMEC 1PJTA 5K7SA 5JCJA 1KARA 2HR1A 1WMSA 1ZIYA 1JILA 3HRKA 1O5TA 1KI6B 1BQ3A 3WADA 1NT4A 1R18A 1VPLA 2CLCX 3EZNA 2IXFA 2PZMA 2WE8A 4O3FA 2KX7A 4POOA 1T0JB 3QV2A 2XRYA 4JP2A 5G0SA 4C6RA 1MZVA 2J5BA 5EIXA 3D3KA 1Q1EA 4IDFA 4PPQA 3CO5A 1YQTA 4P1VA 2I6QA 3PNYA 4R8KA 5HP4A 2ZXFA 5AOAA 4MX8A 2XUGA 3ZWWA 3JAKB 3DO5A 4C07A 3C8UA 4LKRA 3KCQA 3F78A 2A4KA 2AMFA 4MKRA 4Y9TA 3OO0A 3CXUA 2IUEA 2IXDA 1MZPA 3KR2A 1AURA 3KQMA 3DZCA 3PXUA 4HWSA 3SBXA 1I6LA 2YYSA 1JVNA 3EUWA 3TPCA 1ODKA 3E70C 3QVLA 1P18A 2G07A 3PHJA 2PUEA 3NC4A 3B3GA 1UZNA 2NO4A 3UC5A 3UH1A 4BP9A 3I9MA 4QFBA 5FTMA 3G17A 3BMQB 1K4YA 3O90A 2BKUA 3COJA 1FU7A 1Z62A 2XOEA 4AP9A 1QS0B 1O89A 1P0PA 1PK8A 1X7HA 1G2PA 4WNAB 2W2TA 3JWHA 3VMFA 5T3YA 2PPVA 2ZJ5A 5AK5A 4KR6A 2PZJA 4LJ7A 1E7YA 5EQDA 5KW9A 1IB6A 1PYGA 3EIWA 4KAAA 3RIEA 4CM3A 3CURA 3UWDA 4FB4A 4XVQA 4DSNA 3E2MA<