1QGFA

Porcine pancreatic elastase complexed with (3r, 4s)n-para-toluenesulphonyl-3-ethyl-4-(carboxylic acid)pyrrolidin-2-one
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ELASTASE
publication title Mechanistic insights into the inhibition of serine proteases by monocyclic lactams.
pubmed doi rcsb
total genus 58
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1999-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qgfA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qgfA01
2BOKA 1ZYOA 8ESTE 1SGYE 3QDZB 1SGRE 5IYTA 1T8LA 4F4OC 4YT7H 3ZZCA 2R2MB 1SR5C 4X2VA 1OYQA 2VH0A 2BY9X 1EAWA 2NU3E 4MPWA 2AEIH 2VGCB 1J8AA 5DP5A 3SJIA 1OWEA 4FVDA 2HRVA 4B76A 1TFXA 5FX6A 2PTCE 1QFKH 4B1TA 3A7WA 2ZPSA 2A0QB 4Y8XA 1TAWA 1O35A 3STIA 5EW2H 2BLVA 2AFQB 3EDXB 3GCNA 3V13A 3Q3YA 4GVUA 3LC3A 1C5WB 1C2LA 1DWBH 2C93B 3QK1A 2D2DA 1AKSA 1QBNA 2BDAA 2OTVA 1SVPA 2ODPA 4MNWA 2AGGX 3A84A 1JWTA 1TLDA 4YOJA 2C4FH 1SGIB 3Q77A 2A5IA 2A2XH 2QXIA 3A89A 1VCPA 3D49H 2HGTH 2I6QA 1IQKA 4Y7BA 2Q6DA 4CH8B 3QGNB 1YF4A 4E7RG 5EXMA 1AZ8A 1ZHRA 2PKSC 1CT0E 3OX7U 3GY7A 4ZKNU 1EKBB 1AN1E 1QB9A 1OS8A 1SQAA 2RA0A 2AERH 4VGCB 2P93A 3SZNA 1KTSB 3A8AA 5T6GA 2C8XB 2BDHA 1K9OE 5GPIB 4OS5A 4ABIA 1IQGA 1AWHB 4U30A 3T5FH 3A81A 1E34B 1VGCC 2AMPA 3OU0A 3M3VA 3ODDA 4AZ2B 5LPEA 2OCVB 1SGNE 3GDSA 3M37A 2XCNA 1JIRA 1QRWA 1XVMA 1OKXA 2QV1A 2P16A 1GHBG 4MVNA 3A83A 3A7ZA 1YGCH 3D62A 3SV8A 3M3TA 1MBMA 4NFEA 4WF8A 1VZQH 1MTVA 1MZDA 3SORA 1BRUP 4Q80A 3FAOA 3M5LA 3SUEA 3ESTA 1WSSH 3SQHE 5A0AE 4DCDA 1GI0A 3HGNA 3HGPA 3GCHC 4ABGA 1LKBA 2IOTA 2ZHDA 3CS0A 1EOJA 2ZHQH 4NSYA 1O3AA 1AUTC 2GDDA 2Z3CA 1DLEA 2F83A 3MO6A 2QA9E 2GTBA 1W0ZU 3LDXH 3ZZ8A 3Q76A 2QIQA 1O30A 1DXPA 3CS7A 1W0YH 2RG3A 2FLBH 3BIVH 3VXEH 1O2IA 4GPGA 3AW0A 1ZSKA 1AE8H 2A7JA 1NC6A 1N6YA 2ZGCA 2QGRA 1UCYH 1OXGA 3TJOA 5GWZA 2ZQ1A 2JETC 1C1NA 1EB2A 1C2MA 2BY7X 4H6TA 3UREA 3UWJH 8GCHG 3RUOA 2BD9A 3MU5A 2HNTC 3TH3H 1IQJA 4XBBA 5SGAE 1NU7B 2XW9A 5F03A 1BTXA 1K1OA 5C1YA 4YLUA 1ESAA 1NO9H 1PQ7A 1GG6C 1LHEH 2Y81A 5CHAB 4D9RA 1PPBH 1SHHB 1TA6A 3UY9A 5LPFA 4IMQA 4I8JA 2XXLA 1Y3VA 1CGJE 4GLYA 2AYWA 2ZF0H 1V2VT 2BX3A 1K1IA 1M9UA 4HGCA 4NZLA 2H1UA 1GVZA 5HYOA 3AASA 1BQYA 4IN1A 5JBCS 3BTQE 1C1RA 1NRQH 1P11E 1AY6H 1O32A 2YNAA 4X1QU 1MKXH 2WV5A 1BTHH 1KTTB 2ZU2A 2NU1E 3SNAA 1CT2E 2DE9A 1Y3XA 1UTQA 4XDEA 1Z6JH 3EGKH 3QTVH 1GMHG 5I46H 1BOQA 2CGAA 4F49A 2QXGA 2R2WU 2J95A 1UCYK 3RU4E 3SU0A 3M7UA 1YPGH 2A45B 2P95A 1C5TA 1FY8E 5FX5A 5BPEA 1FPCH 3ZZ3A 3GOVB 5A8ZA 1HAZB 1LQEA 4BAOB 4K60A 4FU9A 1GI9B 1FY4A 3T27A 1O2KA 1G3EA 3RXAA 2ZECA 5A0BA 2PFEA 2A5KA 5DJ7A 4DG4A 1O38A 4BAMB 5JBBS 1Z1IA 1IHSH 1OSSA 1VITG 4UFGH 3UOUA 4BXSA 1SGDE 1HAPH 1OWDA 1A3BH 2GCHG 3ZVGA 1EP5A 3TK6A 4LK4A 5G4BA 2ZHEH 1DUAA 2GKVE 4ISLA 1KLTA 3TH2H 5ETXA 1TX7A 1FAKH 5DGJA 3M7QA 1O3FA 4U32A 3SNCA 2GP9B 1QB1A 1V2UT 1C1PA 1S0QA 1L4DA 1D9IA 4CRAA 2PW8H 1DANH 1F0SA 1QL8A 1SQOA 2FOAA 1GHWH 1YM0A 3KGPA 3NUMA 5EQQA 4ABJA 2BMGB 3DHKH 1GMHF 1ZLRA 1P10A 1Z8GA 2VB0A 1PPCE 2HLCA 3PMAB 8KME2 5EOKA 3VB7A 1HIAA 1W10U 3A86A 5FCRA 1ABJH 1UTMA 1T4VH 1SPJA 1CA8B 3NKKA 1F2SE 1YC0A 3K65B 5T3HA 3T62A 4X0WU 2FODA 2PLXA 5B6OA 1K1MA 3TGIE 1C5SA 1ZHMA 4ZHLU 2FO9A 4AN7A 3RXDA 1AD8H 4XSKU 1MAYA 1GBIA 1O5EH 3V0XA 1AB9C 8LPRA 1TNJA 2TGAA 2BY6X 1DICA 1MTNC 3K2UA 1QGFA 4Y0ZE 3LT3A 3P95A 1SB1H 3O8CA 2R0KA 4X2WA 1HLTH 2Z9GA 4IBLH 3PO1B 1P2IA 3GY4A 1P3CA 3UWIA 1Z7KA 4IN2A 2THFB 1T31A 2FS9A 3BG4C 5FPTA 2QXHA 3ZYDA 1TQ7B 1C5RA 1EX3A 2ZGHA 1DOJA 2CJIA 2IPHA 3UQOA 4OS2A 1DT2A 2WV4A 3M36A 3F9HA 1G3CA 3MU8A 1O3JA 5EGMA 4O3TA 3PB1E 1ZSLA 3M5MA 2BB4A 4UONA 1LPGB 1O5CB 4RSPA 3DD2H 3OYPA 2OP9A 4ZROA 3LGTA 3MTYA 1V2JT 4A7IB 2BHGA 7LPRA 1P8VC 1D3PB 1GCTC 1O3PB 4NSVA 3LJJA 2C3SA 2EA3A 3VB6A 3ZVDA 1O36A 4MPVA 4JK6A 1DSTA 3MO3A 1HGTH 2QAAA 1T8MA 2FM2A 3ITIA 4KGAA 1MTWA 3BEFB 4DVAU 1QBOA 2ZFPH 4AFZA 1BDAA 1ELBA 2FTMA 2VIQA 3SNDA 2FOGA 1WQSA 3L6PA 4WVPE 1OP8A 2SGQE 2ANWA 4A92A 1LQDB 2I6SA 5F6MA 3B9FH 1W7XH 1CGIE 5C5NA 1GMCG 1RJXB 3RXFA 2OUAA 1E38B 1A61H 3NXPA 1T8NA 1C2GA 2STAE 4TY6A 1NRPH 1LVBA 3U1JB 3ZVAA 1HDTH 1LDTT 2ZZUH 3SGQE 1SLUB 1EATA 5F8TA 2BLQA 4I8KA 4JYUH 1JOUB 1XUHA 4GCHF 3HKJB 1FJSA 1EZQA 2DE8A 1ZTLA 2A4GA 1SGPE 1KSNA 2HPQH 2WPLS 3SHCH 3K6ZA 1FNIA 3GCTG 4YZUA 2G4TA 3Q3XA 2XBWA 1DY9A 2Z6BD 3E91A 2H2ZA 5A0CA 1Q31A 1ARCA 4X1PU 4AGKA 1WCZA 5TJXA 1UTLM 1MZAA 1EPTB 1BRAA 1MBQA 2D8WA 3OY6U 3RXQA 1BRCE 1DDJA 4WMDA 1SBWA 4KELA 1IQIA 1O3KA 1TRMA 4JMYA 1FY5A 1KDQB 4JZEH 1HNEE 1SGCA 2ALPA 3Q00A 3LC5A 1ANEA 2UUFB 1QNJA 1Z1JA 1O2UA 2ZTZA 4ZHAA 1TALA 3UUZA 1ELCA 1G32B 2XTTB 5FCKA 4CRGA 1L1GA 2FPZA 3JZ2B 1MKWH 2HNTF 2R3YA 3BEIB 1LVOA 1LVMA 4X6MA 3UTUH 2VGCC 5EXLA 1KY9A 1O5DH 4QT8C 2GZ7A 1Z8JB 2R3UA 5C3NA 1TMUH 1GHZA 2ZFRH 2Y5GA 4X2XA 1EZSC 1LHDH 4INLA 1C4U2 1C5LH 4NA7A 1X7AC 4Q7ZA 3GCTF 1QA0A 2TIOA 3MH4A 4AORA 6GCHG 4D7FA 5HGGA 3EA7A 3MU0A 3LOXA 4A6LA 1F92A 3RP2A 1A46H 2Y5FA 3KQBA 3PTNA 2GT7A 4CHAB 1DY8A 3A8DA 2PSXA 1GDNA 1O2JA 3VXFH 3BTWE 5ESBA 3A80A 1Y5AT 4NIYA 4BTIB 4NIXA 3RXSA 3AAUA 4FUEA 1WU1A 4Y8ZA 5IDKA 1TPAE 1QBVH 4DOQA 3MH6A 4ZKOU 9LPRA 2BLWA 2FYQA 2BY5X 2FWWA 4VGCC 4UE7H 1O3HA 1V2MT 1XXFA 2QF0A 2AGEX 4WMFA 3RC4A 5FPSA 1D6RA 1YPHE 1H9LB 2A4OA 1EB1H 1TGCA 3A88A 3F9EA 1TGSZ 1ID5H 2VJ1A 4FVBA 1C5QA 3RXJA 1UHBB 1W3CA 1O37A 2B0FA 3TJNA 1TGTA 2NU0E 3QLPH 4HFPB 2Z94A 4WH6A 5PTPA 1HAVB 1B0FA 2W3KA 4ZH8A 2LPRA 2Z9LA 1TOMH 4Z0KA 1RTLA 1DSUA 1ZHPA 2Z3DA 4XOJA 3MWIU 2PUQH 2GGVB 3ATKA 5DP3A 4M7GA 5AHGH 1D3QB 1WOFA 1ZGIA 1ZZZA 7GCHF 2QF3A 5E2PA 1DFPA 2FX4A 2ZA5A 1CVWH 3FVFB 3M3SA 5FHTA 3GISB 1D3DB 1HB0B 1S0RA 1P12E 3RXTA 4MDSA 1AQ7A 3MNCA 2VINA 2XYAA 1TYNA 1XUJA 2BDCA 2ANYA 5A8YA 1QQUA 2F9PA 3OSYA 1UVOA 1ANDA 1A0HB 1PPHE 1DWCH 4MPXA 5C67A 1LPZB 1SGQE 1K22H 1TMBH 2WPMS 2C90B 1ZPCA 1W13U 1AFEH 3SBKA 3LKWA 2AMQA 1INCA 2VH6A 2W5EA 1EJMA 2ZHFH 1GJBB 1TONA 4OGYA 4TY7A 4ZUHA 2AS9A 3ELAH 4AYVB 4D76A 2TGPZ 4AOQA 1V6DA 1H9HE 2NU4E 2IJOB 1P2MA 1LTOA 5CHAC 3S9BA 3SI4H 5L2ZH 1KXFA 1NN6A 2KAIA 3U9AH 1J14A 4I31A 5E0JA 4INHA 3RXLA 4K1SA 1A5HA 1ZR0A 2ZGJA 3LGWA 4A1VA 3CP7A 2Q6GA 1GVLA 3A7YA 1O0DH 1D6WA 1QIXB 3UOPA 2ASUB 2SNVA 1GBLA 5JDUB 3SN8A 1YCPH 3TVJB 3RXVA 2PKAB 3H7OA 4NWLA 2PSYA 4XE4A 2V6NA 1RGQA 4NWKA 1WV7H 1XKAC 1Y3UA 1GVKB 3RU4T 4PROA 4WY3A 1F0RA 2BQ6B 1O5AB 2PGBB 2ZFQH 5EPYA 3WY8A 3M5NA 5L2YH 4A1XA 3S9CA 3RXHA 4MNVA 2J9NA 1OWJA 3CENA 1BHXB 1IHTH 2XWAA 2F9BH 3S7HB 1O2MA 1GBKA 2F9VA 5EXNA 1S84A 2UWPA 1O5GH 4OS6A 2F9NA 2WUCA 1B7XB 2G5NA 1UVSH 3LPRA 1HYLA 1H1BA 1H8IH 1FIWA 2ZFTA 3I77A 3MH7A 2F9OA 1P2QA 3SI3H 2A1DB 4INKA 3KHVA 2FP7B 1P9SA 1V2KT 4NIWA 1VJ9U 3GY8A 1IQLA 1DLKB 1NT1A 4I8LA 2A5AA 1GI7B 2VVVA 1LMWB 3KL6A 2WPKS 1QJ7B 2M5TA 1P2OA 1O3LA 1WYKA 1YPKH 4CR9A 4TPIZ 1ETRH 1TPPA 2STBE 4XBDA 4BAQB 2GX4A 1YYY1 1DX5M 1O3DA 3SU1A 2F3CE 4GHTA 1UK3A 1P02A 2LNCA 1MMJN 3PV4A 1QJ6B 1P09A 1U6QA 1EZUC 1XXDA 1ELFA 1HBTH 3GY6A 4THNH 1PQ5A 1Y3YA 1HAYB 1LPKB 1DWEH 2GV7A 2OQ5A 3PTBA 1BUIA 2BQ7B 4Y71A 2PUXB 3QUMP 4ZXXH 1OP0A 4WXVA 3BTME 2AMDA 2HALA 3SUFA 5DP9A 6CHAB 2Q6FA 1TNLA 3OY5U 3KEEA 1J16A 1TBQH 4MG3A 1T8OA 1PPEE 2UUKB 3VGCB 5E2OA 3PMBB 1SFIA 3L33A 1ZJKA 3LONA 1P2NA 1UVPA 2QXJA 3GICB 7ESTE 1YPMH 4X8TH 1UVUH 1MCTA 2ALVA 5EPNA 5FPYA 1GHYH 1Y3WA 2PTNA 5EODA 3RXUA 3RXBA 5DO4H 3DFLA 5E0GA 5FXLA 2AGIX 1CHGA 4X8SH 4Q7XA 3P17H 2RCEA 1SQTA 1W8BH 3PO1C 2H6MA 3MNBA 1H4WA 3F9FA 4JCNA 1SLXB 4YLQH 1O3GA 1SLWB 2K1QA 2AIPA 1RIWB 4GSOA 1AU8A 4H4FA 3VB3A 3RMMH 5JBAS 3SJOA 1C1TA 1HAGE 2UWOA 1GMDF 1TB6H 2ZCLP 1MQ5A 3N7OA 1UTJA 3E1XB 5GDSH 1FMGA 1HCGA 2TGDA 4JYTA 4DT7B 1P03A 7KMEH 1K1LA 2Y82A 1C5XB 4O3UA 4ISHH 1SOZA 1BTYA 3LJOA 1SGFA 1AMHA 1C9PA 1BMMH 1GL1A 1MQ6A 2PHBA 2BD4A 5JPMH 4A1TA 3TJUA 2JH6D 2ZGBH 3S69A 2RA3A 2BTCE 3SW2B 2OLGA 2FOCA 1EXFA 1Q3XA 3SJ8A 2TGTA 1OWIA 1WTHD 1J15A 1FONA 2P3FH 2UUJB 3M35A 1VJAU 1DUEA 5T6FA 1UTNA 3SV2H 2SFAA 4B2CA 2FOFA 1BHXF 2VWMA 4CRCA 1THSH 1DVAH 1O2XA 3T28A 3E8LA 1L2EA 3ATWA 3SJ9A 1HXEH 1CA0B 1NFUA 3RLWH 1O2GH 1GHXH 2WPHS 4Y76A 4AG1A 1ELAA 3QZRA 1MKXK 1C9TA 3EYDA 4AGJA 2ODQA 1ESTA 4K1TA 2ZDKA 3TJVA 3KF2A 3S0NA 2VIPA 2ZCKP 2F9UA 5GJ4B 2PWXA 1QL9A 5DP8A 2B5TB 1V2ST 1RXPA 3RM2H 3UR6A 4Y10E 3I78A 1AZZA 1V2TT 5ABWA 1MTUA 2F91A 3QWCH 1BMNH 4LOYH 2R9PA 1HAHH 2XNIA 1GJCB 2TPIZ 3OTJE 2XC5A 1RS0A 1EPTC 2H9EH 1N8OB 1GBBA 1PFXC 1TABE 2BYAX 1IQNA 1K1JA 1C2FA 2OC0A 1YPLH 3RXMA 4AX9H 1ELVA 4HZHA 2QYIA 4O97A 1O3MA 2J92A 2YOLA 1F5KU 3SNBA 2ZDVH 1THRH 2ODYB 1GI6A 1JRTA 2FOEA 1HXFH 1FY3A 2OC8A 1KYNA 2BDGA 1AO5A 3LGYA 3H5CB 4Y7AA 2G52A 3NK8A 1C1WH 4DURA 1C5VA 1GI8B 1GBAA 1GJ5H 2VIWA 2G5VA 3BF6H 2A7CA 2WPJS 5K0HA 1MD7A 4IMZA 1PQ8A 2Y7ZA 3IITA 5AFZH 2ZU4A 1NTPA 2G00A 3STJA 1MU8B 4GCHG 1PYTD 3KCGH 4Q2KA 4ABFA 2ZP0H 4SGBE 1O31A 4IW4E 4WXIA 1NM6A 1YKTA 2QC2A 3TH4H 1O3OA 4AG2A 1BCUH 1K28D 1YPHC 1MD8A 3C27B 1SGFG 2BD3A 1PQAA 1L1JA 4WH8A 2J2UA 2P3TB 3P8OA 1V2LT 3ATMA 1O34A 3BTDE 1XKBC 3BTHE 3VEQB 1GGDB 4CHAC 3LH1A 4DIIH 1XM1A 1V2PT 3MOCA 3RMLH 4R8TB 3ZV8A 3E0PB 1GBDA 4JZIA 4GHQA 3SGAE 1S5SA 1QL7A 5EQSA 3U98H 3ZV9A 2VU8E 3AVZA 1TBZH 1FN6A 1O3IA 4YO9A 1Z8RA 2OBQA 2H9HA 4WMEA 3RXEA 2G8TA 3F68H 1A1RA 4KP0A 1XVOA 3ATIA 4UFEH 4ZHMU 1AFQB 3B23B 1TIOA 1GBHA 1FPHH 1BA8B 3FP6E 2ZDMA 4NGAH 2UUYA 3O8DA 2QCYA 1C5MD 3SV9A 4FXGH 3EQ0H 1D3TB 3R3GB 4XBCA 2JH0D 3TGJE 1GBEA 2SGPE 4Y11E 1TA2A 4E06H 3VFEA 1NFXA 3ATLA 1EUFA 1FUJA 1PJPA 3SU3A 3DUXH 2FIRH 1GJ9B 1XUFA 1A4WH 1IQFA 1F5RA 1V2WT 3UPEA 2O8TA 3LGVA 4ZMAH 3JZ1B 3E0NB 1A5IA 2G51A 2PV9B 3P92A 1P01A 3BN9A 1KXBA 3FZZA 4JZDH 1ACBE 3ZZDA 3P70B 3F9GA 1KIGH 1GJ6A 3BTGE 1S6FA 1HAOH 4I33A 3A7VA 5GIBA 1O2ZA 1NS3A 2GVFA 3E6PH 4JZFH 1ELDE 4I8GA 1PPFE 2BQWB 1ZTJA 4X6PA 1E35B 1O2HA 2BZ6H 1OX1A 2J34A 2FS8A 4FUFA 1MU6B 1C1SA 1MAXA 3ZZ7A 1Y59T 1BBRE 1UTOA 2GZ9A 1QHRB 2BDYA 3PWBA 4BNRA 1OYTH 1TNHA 1ZMLA 1GJ4H 2ZEBA 1F0UA 5L6NH 1HJAB 3E3TA 4OS7A 1NZQH 5GCHF 1V3XA 3V7TA 1OWKA 3GYMA 2XRCA 3PM3A 3M61U 1WBGB 1G36A 1GWAA 4FU7A 3GDUA 3MFJA 2FI5E 1QRXA 2BM2A 4X8VH 2FOHA 1O33A 1NFWA 3S9AA 1TNKA 1J17T 3ZVFA 2VWNA 2ZO3H 1BMAA 1MH0A 1SHYA 2CF8H 2ZNKH 3SUDA 1L4ZA 2BVSH 3U8RH 1P0SH 4ASHA 2HWLB 4CR5A 7GCHG 5J4SA 1SI5H 3EAJA 2SGAA 1YP9A 4UFDH 3UQVA 1DWDH 3U1IB 2BVRH 1JIMA 2Y5HA 1LHCH 1TGNA 1NU9A 4JYVH 1HAVA 4HTCH 4E7NA 2JH5D 2OD3B 3VPKA 1MKWK 2BZAA 1QRZA 3SU4A 1J9CH 4BAKB 1GJ8B 4DGJA 1GBMA 2G4UA 2GD4B 1CBWB 3RXRA 4TYDA 2ZG0H 3TNTA 1LHFH 2ZFFH 4D9QA 2ZKSA 1GL0E 1HV7A 4WJG2 3TK5A 3ZZ4A 2FXRA 2VIVA 3PLPA 4ISIH 5LGOA 1P3EA 3RXCA 4B2AA 1BTPA 3MNSA 1O3EA 2CN0H 2BVXH 2SGFE 3B8JA 5J4QA 4X1RU 4B75A 5CMXH 1AUJA 2GMTB 3W94A 4X1NU 5DP4A 1CSOE 2B7DH 2O8UA 3FFGA 1FI8A 1WQVH 2UWLA 2VWOA 1A3EH 1L1NA 2BY8X 2JKHA 4OS4A 3VB4A 2W26A 1MUEB 1GHVH 2ZTYA 3SJKA 4LZ4B 1BT7A 2NWNA 3UNSA 4K3JA 1BTUA 2J94A 5EQRA 3IG6B 1UVTH 3PROA 1TPSA 1RTFB 2ANKH 2FI3E 1W12U 4Q7YA 2XC4A 3PMHB 6CHAC 1FV9A 1ESBA 1GHAF 2ANMH 3DT0H 3V12A 4H42U 1BTWA 1GCDA 4IGDA 4CRFA 5HM2A 4AFUA 3DA9B 2WYGA 1ETSH 1TBRH 3VGCC 1A0JA 4MLFB 4TWYA 3GYLB 4ISOA 5C1XA 2ZHWH 3MYWA 1C5PA 4FUJA 1VCWA 4ISNA 1BJUA 5E0HA 2FMJA 1K21H 1JBUH 3DFJA 1JMOH 2IN2A 5K7RA 1W7GH 1NRNH 1QB6A 4FUBA 4U01A 1SOTA 1BMLA 1AI8H 3C1KA 1GPZA 1CHOG 4DY7B 4NA9H 2D26C 1VITH 2GDEH 1G2LA 4B73A 3RM0H 4B2BA 3URCA 3ZYEA 1XX9A 1C4Y2 5C1UA 1LCYA 1NY22 1RIWC 3PWCA 3SU6A 3TU7H 1A5GH 2A2QH 1OWHA 1W14U 4ZXYH 3P8NA 2VVCA 1AVWA 1S6HA 2BDIA 3E16B 1C1MA 4MTBA 1O2PA 4NFFA 1Z6EA 1EOLA 1EQ9A 3A7XA 1DXWA 1GBCA 4MNYA 5DPAA 3KIDU 2ZCHP 3I29A 1LO6A 1TRNA 3SOSA 4NZQA 3FANA 1O2TA 1GI4A 2Y6TA 3ZZAA 3BIUH 1AVXA 2ULLA 3W95A 1FIZA 4X1SU 3MU4A 1AKSB 1GJDB 2Y80A 1SLVB 1V2NT 2D1JA 1ZSJA 2KAIB 3MHWU 3QZQA 1TWXB 4KTCA 5EG4A 4ABHA 5H4IB 2W3IA 1GJ7B 4FUIA 3S7KB 1TX8A 1PPZA 1GDUA 3T2NA 4BTTB 5JBTA 1UTPA 4KKDA 2CHAB 1CHOF 5T6DA 4BXWA 3TK9A 3A85A 1CA0C 3HKIB 4ABAA 2SGEE 4ESTE 1MTSA 5DG6A 2TRMA 4Y0YE 2P94A 1AWFH 1HAXB 1YCPK 4CH2B 2R0LA 1O5FH 1EASA 4R0IA 3UNQA 1C1UH 1SC8U 1G37A 1GBTA 1GMDG 4DIHH 5I25A 3AW1A 4Y8YA 2P8OB 2ZDLA 4TWWA 3FP8E 1ZGVA 1ZPZA 1ELEE 3T29A 4YOGA 1QJ1B 1O3BA 5TCCA 1N6XA 1K2I1 1SMFE 1ZMNA 3O8BA 2Y7XA 2OQUA 4U2WA 1WTGH 1F0TA 1ZTKA 5A8XA 1HRTH 1IQEA 2ZU5A 1ANBA 3LIWA 3PMJA 1N8OC 4BAHB 4CRBA 4AB9A 1MCVA 5AVDA 1HUTH 1T32A 2PR3A 2BD8A 1JXPA 2V3HH 3Q3KA 3H7TA 4J2YB 1UTKA 2ILNA 2CXVA 1HAIH 4Y79A 2GCTC 1G9IE 1GI5A 3GY5A 3PYHA 4DJZB 1DS2E 3NPSA 4CRDA 1KXCA 1O3CA 1FLEE 2Z3EA 6ESTA 3RC6A 3LGIA 1QA7A 1C2EA 1GHBF 1OOKB 2A7HA 3PLKA 2FX6A 1C5OH 3TIUA 3G01A 2Q1JA 5A09A 5AFYH 3U69H 4FUGA 1YPJH 2XBXA 3ZZ5A 1O2LA 3GCOA 3KQCA 3M5OA 1C2IA 2H5CA 2PGQB 1AIXH 1ZRBA 1E36B 1K1PA 2BD2A 2XBYA 4O03A 1OPHB 3TGKE 4A5TS 3FZDA 1V2OT 2WYJA 2OC1A 1QCPA 2PKSB 1O2NA 1WUNH 1QQ4A 4LZ1H 4UD9H 3QX5H 1YPEH 1GGDC 5DK1A 1IAUA 1Q2WA 1SSXA 2ZWLH 2VVUA 1CO7E 1CGHA 4ZKRU 1C2KA 5DKMA 2C8WB 1BB0B 1BIOA 2BD5A 2FYRA 4IC5A 1CT4E 1VGCB 1NRSH 5GXPA 2VIDA 2SNWA 4K8BA 3NWUA 8GCHF 3HK6B 1BRBE 1YLDA 1SGTA 3SO3A 5LH8A 3TITA 5L30H 1AFQC 4I32A 3GY2A 4JK5A 1RRKA 3MNXA 1GBFA 1KLIH 1HJ8A 1GI1A 3K6YA 1LVYA 4FUDA 5DP7A 1XUKA 2SGDE 2ZU1A 1EAXA 1A7SA 1TOCB 1Y5BT 2TBSA 5JB8S 2ZIQH 2OXSA 3MH5A 3E90B 4FUCA 1G3DA 3A8BA 3GCHB 5C5OA 2BOHB 1Y8TA 2EI6A 3UNRA 3A8CA 2A32A 1BTZA 2FDAA 4H6SB 1H8DH 1ARBA 3TLOA 1NPMA 3NCLA 3SHAH 2FOMB 3EE0B 1HJ9A 2AH4X 2FTLE 1O2OA 1UK4A 4XFQA 2ZU3A 4K69A 1CQQA 2W7SA 3ZVBA 3QN7A 2A4RA 1BBRH 3ZZ6A 3PLBA 1SFQB 9ESTA 1H9IE 1TX6A 3ZVEA 2JETB 2ZDNA 1KLJH 1NFYA 4YTAA 4AFSA 2GCTB 3EA8A 1THPB 1C1QA 2AIQA 1S83A 2ZI2H 1O2QA 1RTKA 2C8ZB 3A87A 4YT6H 4RN6A 3SU2A 2C8YB 3TPIZ 3BV9B 2ZGXH 2CV3A 2BX4A 5EU8A 3T26A 1PPGE 2VWLA 3QTOH 3RMNH 2J4IA 1Z8IB 3BG8A 3F6UH 3D65E 1UCYE 4X2YA 1GG6B 4YESB 1VITF 5F8XA 5CE1A 1ORFA 3RXPA 2GV6A 4NCYA 2BXUH 1HJAC 2GCHF 1ZMJA 1JRSA 3MU1A 2RDLA 1XMNB 1ZRKA 3GY3A 1O2WA 3GDVA 4UEHH 1ETTH 3SUGA 1HIAB 1UJ1A 1BZXE 1WAYB 1T4UH 1TNIA 2GZ8A 1XUGA 4OGXA 3UIRA 4AFQA 2GT8A 2V35A 1ZJDA 4Z6AH 3P8GA 5A2MH 1DITH 4ABEA 1BBRK 2HNTE 2FOBA 1UK2A 5AF9H 3A7TA 1A2CH 2FEQH 1E37B 3L3TA 1C2DA 1P06A 4RKOB 1FAXA 4IC6A 3RU4D 1EAIA 1O2VA 4JZ1A 4E05H 4AB8A 4MPUA 1LKAA 1DPOA 3D23A 2HOBA 2O8LA 2H5DA 2W7UA 1KXDA 4D8NA 1EAUA 4K5ZA 4D7GA 4BTUB 1EPTA 1P57B 1RD3B 1G30B 3BTEE 1TE0A 3SQEE 1QR3E 4RKJB 2BLOA 1P9UA 4J1YA 1O2SA 1NRRH 2QY0B 1CBWC 1P04A 1KDQA 2V3OH 3IWMA 4UDWH 4ZKSU 4ABBA 4B74A 3M7TA 4ABDA 1NESE 3SV6A 5GCHG 5HM9A 1TMTH 1CU1A 4UFFH 2FZZA 1FQ3A 3RXKA 2XWBI 5FAHA 4GUXA 2XCFA 1AE5A 1SG8B 1EZXC 2P59A 3SGBE 3BTTE 1EJNA 1FDPA 3KN2A 2O8WA 1O3NA 2EC9H 2FI4E 1O2RA 2ZFSA 2VNTA 5JB9S 1L0ZA 2GMTC 3QO6A 2H9TH 3P6ZB 5LPRA 2YNBA 1V2RT 1YBWA 4CREA 4OS1A 4SGAE 2OBOA 4K2YA 4IS5A 1OP2A 1XUIA 2BDBA 4K8YA 1BITA 3UR9A 1VCQA 2J38A 1K1NA 1QURH 1F5LA 1ANCA 5FBEA 3RXIA 3AAVA 4DW2U 1GJAB 1EJAA 5BRRE 2V0BA 4O9VA 1TPOA 1N1LA 4ZAEA 1A0LA 2XBVA 4FUHA 1IOEA 3BSQA 3LU9B 1F7ZA 1GI2A 1TRYA 1ZPBA 5F8ZA 4CBNA 1DM4B 1TQ0B 1ELGA 1E0FD 1S82A 1W2KH 4GAWA 1AB9B 3BTKE 5FBIA 3MMGA 2A31A 3SU5A 1UO6A 1UMAH 5TCAA 3A82A 1MTNB 4MNXA 3NZIA 2P3UB 4YOIA 4Y6DA 2EI7A 2DUCA 3KQEA 1Y5UT 1IQHA 3HPTB 1RFNA 1AHTH 5HMAA 2BD7A 1GMCF 4MQAA 2O8MA 2WINI 3BG4B 2QN5T 1C1VH 3LGUA 3ODFA 2XC0A 1C4V2 3RLYH 5EW1H 4TPYA 5E8EH 2PKAA 1GDQA 2ZTXA 4HI3A 3SV7A 2O9QA 3EA9A 1B0EA 1C1OA 1VR1H 4B71A 2Z7FE 5C2ZA 4FU8A 2EI8A 3U8OH 2VIOA 3VB5A 3RXOA 2FESH 1SL3A 1C5YB 4X6OA 3ZZ9A 1UHBA 2G81E 3URDA 4X8UH 2WUBA 3RDZA 1FY1A 2ZC9H 2B9LA 1T7CA 1FXYA 1C5NH 2A4QA 1GCTB 2ZPQA 1FN8A 3UFAA 1S81A 4I7YH 1C5ZB 1O39A 1ELTA 1P2JA 4AYYB 6LPRA 3MO9A 2FLRH 3F1SB 1GHAG 1YCPM 4X6NA 1D4PB 3HK3B 4BOHA 2OINA 2NU2E 1TNGA 2BXTH 2Z9KA 2WPIS 1DE7H 1BJVA 4KTUA 4WWYA 1G3BA 2OC7A 4K1EA 3P8FA 3HATH 3BEUA 1AVGH 3BTFE 3TNSA 1QTFA 3ENSB 1NROH 3KNXA 1HPGA 1O2YA 3ZZBA 1FZZA 3RXGA 1KXAA 1ZOMA 4NG9H 1B5GH 3RC5A 2ESTE 2Z9JA 1HFDA 1GBJA 1ABIH 5JYIA 3FP7E 1V2QT 2ZPRA 4YM9A 3LH3A 2CHAC 2HVXA 4BANB 1GI3A 5DP6A 5ESTE 3MI4A 1C2JA 1TGBA 3U8TH 4LXBH 4CBOA 1G2MA 1AGJA 1CE5A 4NA8A 1KXEA 1S85A 3RMOH 6GCHF 2G55A 1P05A 3QGJA 1C5UA 2CMYA 5HXFA 2P8OC 3ZVCA 1EP6A 1LHGH 2Z9IA 2B8OH 2ZQ2A 1O5BB 3KQDA 3V3MA 5C20A 4I8HA 3O8RA 2ZDAH 2EEKA 2CF9H 2HPPH 1SGEE 3R0FA 4NIVA 1C2HA 3T25A 1IQMA 1P2KA 3SNEA 4KTSA 1YLCA 1W11U 3K9XB 1PYTC 1Z71A 1QY6A
chains in the Genus database with same CATH superfamily
2BOKA 1ZYOA 8ESTE 1SGYE 3QDZB 1SGRE 5IYTA 1T8LA 4F4OC 4YT7H 3ZZCA 2R2MB 1SR5C 4X2VA 1OYQA 2VH0A 2BY9X 1EAWA 2NU3E 4MPWA 2AEIH 2VGCB 2WZQA 1J8AA 5DP5A 3SJIA 1OWEA 4FVDA 3SZEA 2HRVA 4B76A 1TFXA 4RT1A 5FX6A 2PTCE 1QFKH 4B1TA 3A7WA 2ZPSA 2A0QB 4Q4LA 4Y8XA 1TAWA 1O35A 3STIA 5EW2H 2BLVA 2AFQB 3EDXB 3GCNA 3V13A 3Q3YA 5EJ1A 4GVUA 3LC3A 1C5WB 1C2LA 1DWBH 2C93B 3QK1A 2D2DA 1AKSA 1QBNA 2BDAA 2OTVA 1SVPA 2ODPA 4MNWA 2AGGX 3A84A 1JWTA 1TLDA 4YOJA 2C4FH 1SGIB 3Q77A 2A5IA 2A2XH 2QXIA 3A89A 1VCPA 2L6OA 3D49H 2HGTH 2I6QA 1IQKA 2LP6A 4Y7BA 2Q6DA 4CH8B 3QGNB 1YF4A 4E7RG 5EXMA 1AZ8A 1ZHRA 2PKSC 1CT0E 3OX7U 3GY7A 4ZKNU 1EKBB 2OK5A 1AN1E 1QB9A 1OS8A 1SQAA 2RA0A 3FN8A 2AERH 4VGCB 2P93A 3SZNA 1KTSB 5C0UA 2W6ID 3A8AA 5T6GA 2C8XB 2BDHA 1K9OE 5GPIB 4OS5A 4ABIA 1IQGA 2KCAA 1AWHB 4U30A 3T5FH 3A81A 1E34B 1VGCC 2AMPA 3OU0A 3M3VA 3ODDA 2PP6A 4AZ2B 5LPEA 2OCVB 1SGNE 3GDSA 3M37A 2XCNA 1JIRA 1QRWA 1XVMA 1OKXA 2QV1A 2P16A 1GHBG 4MVNA 3A83A 3A7ZA 1YGCH 3D62A 3SV8A 3M3TA 1MBMA 4NFEA 4WF8A 3SYJA 1VZQH 1MTVA 1MZDA 3SORA 1BRUP 4Q80A 3FAOA 3M5LA 3SUEA 3ESTA 1WSSH 5C17A 3SQHE 5A0AE 5KGOA 4DCDA 1GI0A 3HGNA 2YMSD 3HGPA 3GCHC 4ABGA 1LKBA 2IOTA 2ZHDA 3CS0A 1EOJA 2ZHQH 4NSYA 1O3AA 1AUTC 2GDDA 2Z3CA 1DLEA 2F83A 3MO6A 2QA9E 2GTBA 1W0ZU 3LDXH 3ZZ8A 3Q76A 2QIQA 1O30A 1DXPA 2JIZD 1W0YH 2RG3A 2FLBH 3BIVH 3CS7A 3VXEH 1O2IA 4GPGA 3AW0A 1ZSKA 1AE8H 2A7JA 1NC6A 1N6YA 2ZGCA 2QGRA 1UCYH 1OXGA 3TJOA 5GWZA 2KX4A 2ZQ1A 2JETC 1C1NA 1EB2A 1C2MA 2BY7X 4H6TA 3UREA 3UWJH 8GCHG 3RUOA 2BD9A 3MU5A 2HNTC 3TH3H 1IQJA 4XBBA 5SGAE 1NU7B 2XW9A 5F03A 1BTXA 1K1OA 4XRNA 5C1YA 4YLUA 1ESAA 1NO9H 1PQ7A 1GG6C 1LHEH 2Y81A 5CHAB 4D9RA 1PPBH 1SHHB 1TA6A 3UY9A 5LPFA 3N7DA 4IMQA 4I8JA 2XXLA 1Y3VA 1CGJE 4GLYA 2AYWA 2ZF0H 1V2VT 2BX3A 1K1IA 1M9UA 4HGCA 4NZLA 2H1UA 1GVZA 5HYOA 3AASA 1BQYA 4IN1A 5JBCS 3BTQE 1C1RA 1NRQH 2JDID 1P11E 1AY6H 1O32A 2YNAA 4X1QU 3UAIC 1MKXH 2WV5A 1BTHH 1KTTB 2ZU2A 2NU1E 3SNAA 1CT2E 2DE9A 1Y3XA 1UTQA 4XDEA 1Z6JH 3EGKH 3QTVH 1GMHG 5I46H 1BOQA 2CGAA 4F49A 2QXGA 2R2WU 2J95A 1UCYK 3RU4E 3SU0A 3M7UA 1YPGH 2A45B 2P95A 1C5TA 1FY8E 5FX5A 5BPEA 1FPCH 3ZZ3A 3GOVB 5A8ZA 1HAZB 1LQEA 4BAOB 4K60A 4FU9A 1GI9B 1FY4A 3T27A 1O2KA 1G3EA 3RXAA 2ZECA 2WPDD 5A0BA 2PFEA 2A5KA 5DJ7A 4DG4A 1O38A 4BAMB 5JBBS 1Z1IA 1IHSH 1OSSA 1VITG 1SQRA 2QE7D 4UFGH 3UOUA 4BXSA 2KZ4A 1SGDE 1HAPH 1OWDA 1A3BH 2GCHG 3ZVGA 1EP5A 3TK6A 4LK4A 5G4BA 2ZHEH 1DUAA 2GKVE 4ISLA 1KLTA 3TH2H 5ETXA 1TX7A 1FAKH 5DGJA 3M7QA 1O3FA 4U32A 3SNCA 2GP9B 1QB1A 1V2UT 1C1PA 1S0QA 1L4DA 1D9IA 4CRAA 2PW8H 1DANH 1F0SA 1QL8A 1SQOA 2FOAA 1GHWH 1W0JD 1YM0A 3KGPA 1WXRA 3NUMA 5EQQA 4ABJA 2BMGB 3DHKH 1GMHF 1ZLRA 1P10A 1Z8GA 5C0TA 2VB0A 1PPCE 2HLCA 3PMAB 8KME2 5EOKA 3VB7A 1HIAA 1W10U 2XOKD 3A86A 3N7EA 5FCRA 1ABJH 1UTMA 1T4VH 1SPJA 4RT0A 1CA8B 2GJGA 4ACBA 3NKKA 1F2SE 1YC0A 3K65B 5T3HA 3T62A 4X0WU 2FODA 2PLXA 5B6OA 1K1MA 3TGIE 1C5SA 1ZHMA 4ZHLU 2FO9A 4AN7A 3RXDA 1AD8H 4XSKU 1MAYA 1GBIA 1O5EH 3V0XA 1AB9C 8LPRA 1TNJA 2TGAA 2BY6X 1DICA 1MTNC 5DSFA 3K2UA 1QGFA 4Y0ZE 3LT3A 3P95A 1SB1H 3O8CA 2R0KA 4X2WA 1HLTH 2Z9GA 4IBLH 3PO1B 1P2IA 3GY4A 1P3CA 3UWIA 1Z7KA 4IN2A 2THFB 1T31A 2FS9A 2HLDD 3BG4C 2QXHA 5FPTA 3ZYDA 1TQ7B 1C5RA 1EX3A 2ZGHA 1DOJA 2CJIA 2IPHA 3UQOA 2KM0A 4OS2A 1DT2A 2WV4A 3M36A 2KCYA 3F9HA 3KQ5A 1G3CA 3MU8A 1O3JA 5EGMA 4O3TA 3PB1E 1ZSLA 3UB0A 3M5MA 2BB4A 4UONA 1LPGB 1O5CB 4RSPA 3DD2H 3OYPA 2OP9A 4ZROA 3LGTA 3MTYA 1V2JT 4A7IB 2BHGA 7LPRA 1P8VC 1D3PB 2J98A 1GCTC 1O3PB 4NSVA 3LJJA 2C3SA 3OFND 2EA3A 3VB6A 3ZVDA 1O36A 4MPVA 4JK6A 1DSTA 3MO3A 1HGTH 2QAAA 1T8MA 2FM2A 3ITIA 4KGAA 1MTWA 3BEFB 4DVAU 1QBOA 2ZFPH 4AFZA 1BDAA 1ELBA 2FTMA 2VIQA 3SNDA 2FOGA 1WQSA 3L6PA 4WVPE 1OP8A 2SGQE 2ANWA 4A92A 1LQDB 2I6SA 5F6MA 1COWD 3B9FH 3KYFA 1W7XH 1CGIE 5C5NA 1GMCG 1RJXB 3RXFA 2OUAA 1E38B 2QF4A 1A61H 3NXPA 1T8NA 1C2GA 2STAE 4TY6A 1NRPH 1LVBA 3U1JB 3ZVAA 1HDTH 1LDTT 2ZZUH 3F0OA 3SGQE 1SLUB 1EATA 5F8TA 2BLQA 4I8KA 4JYUH 1JOUB 1XUHA 2K8IA 3HKJB 1FJSA 4GCHF 1EZQA 2DE8A 1ZTLA 2A4GA 3WWBA 1SGPE 1KSNA 2HPQH 2WPLS 3SHCH 3K6ZA 1FNIA 3GCTG 4YZUA 2G4TA 3Q3XA 2XBWA 1DY9A 2Z6BD 3E91A 2H2ZA 5A0CA 1Q31A 1ARCA 4X1PU 4AGKA 1WCZA 5TJXA 1UTLM 1MZAA 3PV5A 1EPTB 1BRAA 1MBQA 2D8WA 3OY6U 3RXQA 5IK2D 1BRCE 1DDJA 4WMDA 1SBWA 4KELA 1IQIA 1O3KA 1TRMA 4JMYA 1FY5A 1KDQB 4JZEH 1HNEE 1SGCA 2ALPA 3Q00A 3LC5A 1ANEA 2UUFB 1QNJA 1Z1JA 1O2UA 2ZTZA 4ZHAA 1TALA 3UUZA 1ELCA 2KCOA 1G32B 2XTTB 5FCKA 4CRGA 1L1GA 2FPZA 3JZ2B 1MKWH 2HNTF 2R3YA 3BEIB 2RDEA 1LVOA 1LVMA 4X6MA 3UTUH 2VGCC 5EXLA 1KY9A 1O5DH 4QT8C 2GZ7A 1Z8JB 2R3UA 5C3NA 1TMUH 1MABB 5EJLA 1GHZA 2ZFRH 2Y5GA 4X2XA 1EZSC 1LHDH 4INLA 1C4U2 1C5LH 4NA7A 1X7AC 4Q7ZA 3GCTF 1QA0A 2TIOA 3MH4A 4AORA 6GCHG 4D7FA 5HGGA 3EA7A 2AHME 3MU0A 3LOXA 4A6LA 1F92A 3RP2A 1A46H 2Y5FA 3KQBA 3PTNA 2GT7A 3N99A 4CHAB 1DY8A 2F4LA 3A8DA 2PSXA 1GDNA 1O2JA 3VXFH 3BTWE 5ESBA 1YLNA 2J97A 3A80A 1Y5AT 4NIYA 4BTIB 4NIXA 3RXSA 3AAUA 3WWFA 4FUEA 1WU1A 4Y8ZA 5IDKA 2KR7A 1TPAE 1QBVH 4DOQA 3MH6A 1H8ED 4B6EA 3DSGA 4ZKOU 9LPRA 2BLWA 2FYQA 2BY5X 2FWWA 4VGCC 4UE7H 1O3HA 1V2MT 1XXFA 2QF0A 2AGEX 4WMFA 3RC4A 5FPSA 1D6RA 1YPHE 1H9LB 2A4OA 1EB1H 1TGCA 3A88A 3F9EA 1TGSZ 2WV9A 1ID5H 2VJ1A 4FVBA 1C5QA 3RXJA 1UHBB 1W3CA 1O37A 2B0FA 4Q63A 3TJNA 1TGTA 2NU0E 3QLPH 4HFPB 2Z94A 4WH6A 5PTPA 1HAVB 1B0FA 2CK3D 2W3KA 4ZH8A 2LPRA 2Z9LA 1TOMH 4Z0KA 1RTLA 1DSUA 1ZHPA 2Z3DA 4XOJA 3MWIU 2PUQH 2GGVB 3ATKA 5DP3A 4M7GA 5AHGH 1D3QB 1WOFA 1ZGIA 1ZZZA 7GCHF 2QF3A 5E2PA 1DFPA 2FX4A 2ZA5A 1CVWH 3FOAA 3FVFB 3M3SA 5FHTA 3GISB 1D3DB 1HB0B 1S0RA 1P12E 3RXTA 4MDSA 1AQ7A 3MNCA 2VINA 2XYAA 1TYNA 1XUJA 2BDCA 2ANYA 5A8YA 1QQUA 2F9PA 5EIYA 3OSYA 1UVOA 1ANDA 1A0HB 1PPHE 1DWCH 4MPXA 5C67A 1LPZB 1SGQE 1K22H 1TMBH 2WPMS 2C90B 1ZPCA 1W13U 1AFEH 3SBKA 3LKWA 2AMQA 1INCA 2VH6A 2W5EA 1EJMA 3OEHD 2ZHFH 1GJBB 2IJD1 1TONA 4OGYA 4TY7A 4ZUHA 2AS9A 3ELAH 4AYVB 4D76A 2TGPZ 4AOQA 1V6DA 1H9HE 2NU4E 2IJOB 1P2MA 1LTOA 5CHAC 3S9BA 3SI4H 5L2ZH 1KXFA 1NN6A 2KAIA 3U9AH 1J14A 3CNRA 4I31A 5E0JA 4INHA 4ZCNA 3RXLA 4K1SA 1A5HA 1ZR0A 2ZGJA 1UW7A 3LGWA 4A1VA 3CP7A 2Q6GA 1GVLA 3A7YA 1O0DH 1D6WA 1QIXB 3UOPA 2ASUB 2SNVA 1GBLA 5JDUB 3SN8A 1YCPH 3TVJB 3RXVA 2PKAB 3H7OA 1S6LA 2PSYA 4NWLA 4XE4A 2V6NA 3WW7A 1RGQA 2WSSD 4NWKA 1WV7H 1XKAC 1Y3UA 1GVKB 3RU4T 2HVYB 4PROA 4WY3A 1F0RA 2BQ6B 1O5AB 2PGBB 2ZFQH 5EPYA 3WY8A 3M5NA 5L2YH 4A1XA 3S9CA 3RXHA 4MNVA 2J9NA 1OWJA 3CENA 3PRBA 1BHXB 1IHTH 2XWAA 1VKYA 2F9BH 3S7HB 1O2MA 3VG8A 1GBKA 2F9VA 5EXNA 1S84A 2UWPA 1O5GH 4OS6A 2F9NA 2WUCA 1B7XB 2G5NA 1UVSH 3LPRA 1HYLA 1H1BA 1H8IH 1FIWA 2ZFTA 3I77A 3MH7A 2F9OA 1P2QA 3SI3H 2A1DB 4INKA 3KHVA 2FP7B 1P9SA 1V2KT 4NIWA 1VJ9U 3GY8A 1IQLA 1DLKB 1NT1A 4I8LA 2LELA 2A5AA 1GI7B 2VVVA 1LMWB 3KL6A 2WPKS 1QJ7B 1P2OA 2M5TA 1O3LA 1WYKA 1YPKH 4CR9A 4TPIZ 2RFKC 1ETRH 1TPPA 2STBE 4XBDA 4BAQB 2GX4A 1YYY1 1DX5M 1O3DA 3SU1A 2F3CE 4GHTA 1UK3A 1P02A 2LNCA 4ACAA 1MMJN 3PV4A 1QJ6B 1P09A 1U6QA 1EZUC 1XXDA 1ELFA 1HBTH 3GS9A 3GY6A 4THNH 1PQ5A 1Y3YA 1HAYB 1LPKB 1DWEH 2GV7A 2OQ5A 3PTBA 1BUIA 2BQ7B 4Y71A 2PUXB 3QUMP 4ZXXH 1OP0A 4WXVA 3BTME 2AMDA 2HALA 3SUFA 5DP9A 6CHAB 2Q6FA 1TNLA 3OY5U 3KEEA 1J16A 1TBQH 4MG3A 1T8OA 1PPEE 1H8HD 2UUKB 3F0PA 3VGCB 5E2OA 3PMBB 1SFIA 3L33A 1ZJKA 3H09A 3LONA 1P2NA 1UVPA 2QXJA 3GICB 7ESTE 1YPMH 3EE7A 4X8TH 1UVUH 1MCTA 2ALVA 5EPNA 5FPYA 1GHYH 1Y3WA 2PTNA 5EODA 3RXUA 3RXBA 5DO4H 3DFLA 5E0GA 5FXLA 2AGIX 1CHGA 4X8SH 4Q7XA 3P17H 2RCEA 1SQTA 1W8BH 3PO1C 2H6MA 1WDIA 3MNBA 1H4WA 3F9FA 4JCNA 1SLXB 4YLQH 1O3GA 1SLWB 2K1QA 2AIPA 1RIWB 4GSOA 1AU8A 4H4FA 3VB3A 1NBMD 3RMMH 5JBAS 3SJOA 1C1TA 1HAGE 2UWOA 1GMDF 1TB6H 2ZCLP 1MQ5A 3N7OA 1UTJA 3E1XB 5GDSH 1FMGA 1HCGA 2TGDA 4JYTA 4DT7B 1P03A 7KMEH 1K1LA 2Y82A 4TSFD 1C5XB 3OTPA 4O3UA 4ISHH 1SOZA 1BTYA 3LJOA 1SGFA 1AMHA 1C9PA 1BMMH 1GL1A 1MQ6A 2PHBA 2BD4A 5JPMH 4A1TA 3TJUA 2JH6D 2ZGBH 4I86A 2RA3A 3S69A 1E1QD 2BTCE 3SW2B 2OLGA 2FOCA 1EXFA 1Q3XA 3SJ8A 2TGTA 1OWIA 1WTHD 1J15A 1FONA 2P3FH 2UUJB 3M35A 1VJAU 1DUEA 5T6FA 1UTNA 3SV2H 2SFAA 4B2CA 2FOFA 1BHXF 2VWMA 4CRCA 1THSH 2EQNA 1DVAH 1O2XA 3T28A 3E8LA 1L2EA 3ATWA 3SJ9A 1HXEH 1CA0B 1NFUA 3RLWH 1O2GH 1GHXH 2WPHS 4Y76A 4AG1A 1ELAA 3QZRA 1MKXK 1C9TA 3EYDA 4AGJA 2ODQA 1ESTA 4K1TA 2ZDKA 3TJVA 3KF2A 3S0NA 2VIPA 2ZCKP 2F9UA 5GJ4B 2PWXA 1QL9A 5DP8A 2B5TB 1V2ST 1RXPA 3RM2H 3UR6A 4Y10E 3I78A 1AZZA 1V2TT 5ABWA 1MTUA 2F91A 3QWCH 1BMNH 4LOYH 2R9PA 1HAHH 2XNIA 1GJCB 2TPIZ 3OTJE 2XC5A 1RS0A 1EPTC 2H9EH 1N8OB 1GBBA 1PFXC 1TABE 2BYAX 1IQNA 1K1JA 1C2FA 2OC0A 1YPLH 3RXMA 4AX9H 1ELVA 5CHBA 4HZHA 2QYIA 4O97A 1O3MA 2J92A 2YOLA 1F5KU 3SNBA 2ZDVH 1THRH 2ODYB 1GI6A 1JRTA 2FOEA 1HXFH 5EJZA 1FY3A 2OC8A 1KYNA 2BDGA 1AO5A 3LGYA 3H5CB 4Y7AA 2G52A 3NK8A 1C1WH 4DURA 1C5VA 1GI8B 1GBAA 1GJ5H 2VIWA 2G5VA 3BF6H 4FETA 2A7CA 2WPJS 5K0HA 1MD7A 4IMZA 1KMHB 1PQ8A 2Y7ZA 3IITA 5AFZH 5T1VA 2ZU4A 1NTPA 2G00A 3STJA 1MU8B 4GCHG 1PYTD 3KCGH 4FOUC 4Q2KA 4ABFA 2ZP0H 4SGBE 1O31A 4IW4E 4WXIA 1NM6A 1YKTA 2QC2A 3TH4H 1O3OA 4AG2A 1BCUH 1K28D 1YPHC 1MD8A 3C27B 1SGFG 2BD3A 1PQAA 1L1JA 4WH8A 2J2UA 2P3TB 3P8OA 1V2LT 4M9FA 3ATMA 1O34A 3BTDE 1XKBC 3BTHE 3VEQB 1GGDB 4CHAC 3LH1A 4DIIH 1XM1A 1V2PT 3MOCA 3RMLH 4R8TB 3ZV8A 3E0PB 1GBDA 4JZIA 4GHQA 3SGAE 1S5SA 1QL7A 5EQSA 3U98H 3ZV9A 2VU8E 3AVZA 1TBZH 1FN6A 1O3IA 4YO9A 1Z8RA 2OBQA 2H9HA 4WMEA 3RXEA 2G8TA 2YMSC 3F68H 1A1RA 4KP0A 1XVOA 3ATIA 4UFEH 4ZHMU 1AFQB 3B23B 1TIOA 1GBHA 1FPHH 1BA8B 3FP6E 2ZDMA 4NGAH 2UUYA 3O8DA 2QCYA 1C5MD 3SV9A 4FXGH 3EQ0H 1D3TB 3R3GB 4XBCA 2JH0D 3TGJE 1GBEA 2SGPE 4Y11E 1TA2A 4E06H 3VFEA 1NFXA 3ATLA 1EUFA 1FUJA 1PJPA 3SU3A 3OE7D 3DUXH 2FIRH 1GJ9B 1XUFA 1A4WH 4YXWD 1IQFA 1F5RA 1V2WT 3UPEA 2O8TA 3F2GA 3LGVA 4ZMAH 3JZ1B 3E0NB 1A5IA 2G51A 2PV9B 3P92A 1P01A 3BN9A 3W1EA 1KXBA 3FZZA 4JZDH 1ACBE 3ZZDA 3P70B 3F9GA 1KIGH 1GJ6A 3BTGE 1S6FA 1HAOH 4I33A 3A7VA 5GIBA 1O2ZA 1NS3A 4TT3D 2GVFA 3E6PH 4JZFH 1ELDE 4I8GA 1PPFE 4RI0A 2BQWB 1ZTJA 4X6PA 1E35B 1O2HA 2BZ6H 1OX1A 2J34A 2FS8A 4FUFA 1MU6B 1C1SA 1MAXA 3ZZ7A 1Y59T 1BBRE 1UTOA 2GZ9A 1QHRB 2BDYA 3PWBA 4BNRA 1OYTH 1TNHA 1ZMLA 1GJ4H 2ZEBA 1F0UA 5L6NH 1HJAB 3E3TA 4OS7A 1NZQH 5GCHF 1V3XA 3V7TA 1OWKA 3GYMA 2XRCA 3PM3A 3M61U 1WBGB 1G36A 1GWAA 4FU7A 3GDUA 3MFJA 2FI5E 1QRXA 2BM2A 4X8VH 2FOHA 1O33A 1NFWA 3S9AA 1TNKA 1J17T 3ZVFA 2VWNA 2ZO3H 1BMAA 1MH0A 1SHYA 2CF8H 2ZNKH 3SUDA 1L4ZA 2BVSH 3U8RH 3AK5A 1P0SH 4ASHA 2HWLB 4CR5A 7GCHG 5J4SA 1SI5H 3EAJA 2SGAA 1YP9A 4UFDH 3UQVA 1DWDH 3U1IB 2BVRH 1JIMA 2Y5HA 1LHCH 1TGNA 1NU9A 4JYVH 1HAVA 4HTCH 4E7NA 2JH5D 2OD3B 3FKSD 3VPKA 1MKWK 1SKYE 2BZAA 2YMSB 1QRZA 3SU4A 1J9CH 4BAKB 1GJ8B 4DGJA 1GBMA 2G4UA 2GD4B 1CBWB 3RXRA 4TYDA 2ZG0H 3TNTA 1LHFH 2ZFFH 4D9QA 2ZKSA 1GL0E 1HV7A 4WJG2 3TK5A 3ZZ4A 1BMFD 2FXRA 2VIVA 2WHXA 3PLPA 4ISIH 5LGOA 1P3EA 3RXCA 4B2AA 1BTPA 3MNSA 1O3EA 2CN0H 2BVXH 3U28C 5C94A 2SGFE 3B8JA 5J4QA 4X1RU 4B75A 5CMXH 1AUJA 2GMTB 3W94A 4X1NU 5DP4A 1CSOE 2B7DH 2O8UA 3FFGA 1K0HA 1FI8A 1WQVH 3OAAD 2UWLA 2VWOA 1A3EH 1L1NA 2BY8X 2JKHA 4OS4A 3VB4A 2W26A 1MUEB 1GHVH 2ZTYA 3FO8D 3SJKA 4LZ4B 1BT7A 2NWNA 3UNSA 4K3JA 1E1RD 1BTUA 2J94A 5EQRA 3IG6B 1UVTH 3PROA 1TPSA 1RTFB 2ANKH 2FI3E 1W12U 4Q7YA 2XC4A 3PMHB 6CHAC 1FV9A 1ESBA 1GHAF 2ANMH 3DT0H 5KECA 3V12A 4H42U 1BTWA 1GCDA 2V7QD 4IGDA 2QF5A 4CRFA 5HM2A 4AFUA 3DA9B 4ASUD 2WYGA 1ETSH 1TBRH 3VGCC 1A0JA 4MLFB 4TWYA 3GYLB 4ISOA 5C1XA 2L74A 2ZHWH 3MYWA 1C5PA 4FUJA 1VCWA 4ISNA 1BJUA 5E0HA 2FMJA 1K21H 1JBUH 3DFJA 1JMOH 2IN2A 5K7RA 1W7GH 1NRNH 1QB6A 4FUBA 4U01A 1SOTA 1BMLA 1AI8H 3C1KA 1GPZA 1YY3A 1CHOG 4DY7B 4NA9H 2D26C 1VITH 2GDEH 1G2LA 4HG6A 2K0QA 4B73A 3RM0H 4B2BA 3URCA 3ZYEA 1EFRD 1XX9A 1C4Y2 5C1UA 1LCYA 1NBME 1NY22 1RIWC 3PWCA 3SU6A 3TU7H 1A5GH 2A2QH 1OWHA 1W14U 4ZXYH 3P8NA 2IPQX 2VVCA 1AVWA 1S6HA 2BDIA 3E16B 1C1MA 4MTBA 1O2PA 4NFFA 1Z6EA 1EOLA 1EQ9A 3A7XA 1DXWA 1GBCA 4MNYA 5DPAA 3KIDU 2ZCHP 3I29A 1LO6A 1TRNA 2JJ1D 3SOSA 4NZQA 3FANA 1O2TA 1GI4A 2Y6TA 3ZZAA 3BIUH 1AVXA 2ULLA 3W95A 1FIZA 4X1SU 3MU4A 1AKSB 1GJDB 2Y80A 1SLVB 1V2NT 2D1JA 2KFWA 1ZSJA 2KAIB 3MHWU 3QZQA 1TWXB 4KTCA 5EG4A 4ABHA 5H4IB 2W3IA 1GJ7B 4FUIA 3S7KB 1TX8A 1PPZA 1GDUA 3T2NA 4BTTB 5JBTA 1UTPA 4KKDA 2CHAB 1CHOF 5T6DA 4BXWA 3TK9A 3A85A 1CA0C 3HKIB 4ABAA 2SGEE 4ESTE 1MTSA 5DG6A 2TRMA 4Y0YE 2P94A 1AWFH 1HAXB 1YCPK 4CH2B 2R0LA 1O5FH 1EASA 4R0IA 4B6FA 3UNQA 1C1UH 1SC8U 1G37A 1GBTA 1GMDG 4Z1MD 4DIHH 5I25A 3AW1A 4Y8YA 2P8OB 2ZDLA 4TWWA 3FP8E 1ZGVA 1ZPZA 1ELEE 3T29A 4YOGA 1QJ1B 1O3BA 5TCCA 1N6XA 1K2I1 1SMFE 1ZMNA 3O8BA 2Y7XA 2OQUA 4U2WA 1WTGH 1F0TA 1ZTKA 5A8XA 1HRTH 1IQEA 2ZU5A 1ANBA 3LIWA 3PMJA 1N8OC 4BAHB 4CRBA 4AB9A 1MCVA 3F2FA 5AVDA 1HUTH 1T32A 2PR3A 2BD8A 1JXPA 2V3HH 3Q3KA 5B6LA 3H7TA 4J2YB 1UTKA 2ILNA 2CXVA 1HAIH 4Y79A 2GCTC 1G9IE 1GI5A 3GY5A 3PYHA 3PRDA 4DJZB 4DT4A 1DS2E 3NPSA 4CRDA 3PV2A 1KXCA 1O3CA 1FLEE 2Z3EA 6ESTA 3RC6A 3LGIA 1QA7A 1C2EA 1GHBF 1OOKB 2A7HA 3DSPA 3PLKA 2FX6A 1C5OH 3TIUA 3G01A 2Q1JA 5A09A 5AFYH 3U69H 4FUGA 1YPJH 2XBXA 3ZZ5A 1O2LA 5HKKD 3GCOA 3KQCA 3M5OA 1C2IA 2H5CA 2PGQB 1AIXH 1ZRBA 1E36B 1K1PA 2BD2A 2XBYA 4O03A 1OPHB 3TGKE 3ZIAD 4A5TS 3FZDA 1V2OT 2WYJA 2OC1A 1QCPA 2PKSB 1O2NA 1WUNH 1QQ4A 4LZ1H 4UD9H 3QX5H 2XNDD 1YPEH 1GGDC 5DK1A 1IAUA 1Q2WA 1SSXA 2ZWLH 2VVUA 1CO7E 1CGHA 4ZKRU 1C2KA 5DKMA 2C8WB 1BB0B 1BIOA 2BD5A 2FYRA 4IC5A 1CT4E 1VGCB 1NRSH 5GXPA 5DN6D 2VIDA 2SNWA 4K8BA 3NWUA 8GCHF 3HK6B 1BRBE 1YLDA 1SGTA 3SO3A 1QZ8A 3TITA 5L30H 5LH8A 1AFQC 4OM9A 4I32A 3GY2A 4JK5A 1RRKA 3MNXA 1GBFA 1KLIH 3MQKC 1HJ8A 1GI1A 3K6YA 1LVYA 4FUDA 5DP7A 1XUKA 2SGDE 2ZU1A 1EAXA 1A7SA 1TOCB 1Y5BT 1YWUA 2J5UA 2TBSA 5JB8S 2ZIQH 2OXSA 3MH5A 3E90B 4FUCA 1G3DA 3A8BA 3GCHB 5C5OA 2BOHB 1Y8TA 2EI6A 3UNRA 3A8CA 2A32A 1BTZA 2FDAA 4H6SB 4F55A 1H8DH 1ARBA 3TLOA 1NPMA 3NCLA 3SHAH 2FOMB 3EE0B 1HJ9A 2AH4X 2FTLE 1O2OA 1UK4A 4XFQA 2ZU3A 4K69A 1CQQA 2W7SA 3ZVBA 3QN7A 2A4RA 1BBRH 3ZZ6A 3PLBA 1SFQB 9ESTA 1H9IE 4AC9A 1TX6A 3ZVEA 2JETB 3KYGA 2ZDNA 1KLJH 1NFYA 4YTAA 4AFSA 2GCTB 3EA8A 1THPB 1C1QA 2AIQA 1S83A 2ZI2H 1O2QA 1RTKA 2C8ZB 3A87A 4YT6H 4RN6A 3SU2A 2M2AA 2C8YB 3TPIZ 3BV9B 2ZGXH 2CV3A 2BX4A 5EU8A 3T26A 4XD7D 1PPGE 2VWLA 3QTOH 3RMNH 2J4IA 1Z8IB 3BG8A 3F6UH 3D65E 1UCYE 4X2YA 1GG6B 4YESB 1VITF 5F8XA 5CE1A 1ORFA 3RXPA 2GV6A 4NCYA 2BXUH 1HJAC 2GCHF 3F2HA 1ZMJA 1JRSA 3MU1A 2RDLA 1XMNB 1ZRKA 3GY3A 1O2WA 3GDVA 4UEHH 1ETTH 3SUGA 1HIAB 1UJ1A 1BZXE 1WAYB 1T4UH 1TNIA 2KCPA 2GZ8A 1XUGA 4OGXA 3UIRA 4AFQA 2GT8A 2V35A 1ZJDA 4Z6AH 3P8GA 5A2MH 1DITH 4ABEA 1BBRK 2HNTE 2FOBA 1UK2A 5AF9H 3A7TA 1A2CH 2FEQH 1E37B 3L3TA 1C2DA 1P06A 4RKOB 1FAXA 4IC6A 3RU4D 1EAIA 1O2VA 4JZ1A 4P00A 4E05H 4AB8A 4MPUA 1LKAA 1DPOA 3D23A 2HOBA 2O8LA 2H5DA 2W7UA 1KXDA 4D8NA 1EAUA 4K5ZA 4D7GA 4BTUB 1EPTA 1P57B 1RD3B 1G30B 3BTEE 1TE0A 3SQEE 1QR3E 4RKJB 2BLOA 1P9UA 4J1YA 1O2SA 1OHHD 1NRRH 2QY0B 1CBWC 1P04A 1KDQA 2V3OH 3IWMA 4UDWH 4ZKSU 4ABBA 4B74A 3M7TA 4ABDA 1NESE 3SV6A 5GCHG 5HM9A 1TMTH 1CU1A 4UFFH 2FZZA 1FQ3A 3RXKA 2XWBI 5FAHA 4GUXA 2XCFA 1AE5A 1SG8B 1EZXC 2P59A 5GNDA 3SGBE 3BTTE 1EJNA 1FDPA 3KN2A 2J98B 1O3NA 2EC9H 2FI4E 2O8WA 1O2RA 2ZFSA 2VNTA 5JB9S 1L0ZA 2GMTC 3QO6A 2H9TH 2JJ2D 3P6ZB 5LPRA 2YNBA 1V2RT 1YBWA 4CREA 4OS1A 4SGAE 2OBOA 3DCLA 4K2YA 4IS5A 1OP2A 2W6JD 1XUIA 5CDFE 2BDBA 3OEED 4K8YA 1BITA 3UR9A 1VCQA 2J38A 1K1NA 1QURH 1F5LA 1ANCA 5FBEA 3RXIA 3AAVA 4DW2U 5KEDA 1GJAB 1EJAA 5BRRE 2V0BA 4O9VA 1TPOA 1N1LA 4ZAEA 1A0LA 2XBVA 4FUHA 1IOEA 3BSQA 2EY4C 3LU9B 1F7ZA 1GI2A 1TRYA 1ZPBA 5F8ZA 4CBNA 1DM4B 1TQ0B 1ELGA 1E0FD 1S82A 1W2KH 4GAWA 2V3MA 1AB9B 3BTKE 5FBIA 3MMGA 2A31A 3SU5A 1UO6A 1UMAH 5TCAA 3A82A 1MTNB 4MNXA 3NZIA 2P3UB 4YOIA 4Y6DA 2EI7A 2DUCA 4P02A 3KQEA 1Y5UT 1IQHA 3HPTB 1RFNA 1AHTH 5HMAA 2BD7A 1GMCF 4MQAA 2O8MA 2WINI 3BG4B 2QN5T 1C1VH 3LGUA 3ODFA 2XC0A 1C4V2 5HIZA 4F48B 3RLYH 5EW1H 4TPYA 5E8EH 2PKAA 1GDQA 2ZTXA 4HI3A 3SV7A 2O9QA 3EA9A 1B0EA 1C1OA 1VR1H 4B71A 2Z7FE 5C2ZA 4FU8A 2EI8A 5FL7D 3U8OH 2VIOA 3VB5A 3RXOA 2FESH 1SL3A 1C5YB 4X6OA 3ZZ9A 1UHBA 2G81E 3URDA 4X8UH 2WUBA 3RDZA 1FY1A 2ZC9H 2B9LA 1T7CA 1FXYA 1C5NH 2A4QA 1GCTB 2ZPQA 1FN8A 3UFAA 1S81A 4I7YH 1C5ZB 1O39A 3F3BA 1ELTA 1P2JA 4AYYB 6LPRA 3MO9A 2FLRH 3F1SB 1GHAG 1YCPM 4X6NA 1D4PB 3HK3B 1E79D 4BOHA 2OINA 2NU2E 1TNGA 2BXTH 2Z9KA 2WPIS 1DE7H 1W0KD 1BJVA 4KTUA 4WWYA 1G3BA 2OC7A 4K1EA 3P8FA 3HATH 3BEUA 1AVGH 3BTFE 3TNSA 1QTFA 3ENSB 3NRLA 3DSOA 1NROH 3KNXA 1HPGA 1O2YA 3ZZBA 1FZZA 3RXGA 1KXAA 1ZOMA 4NG9H 5HIYA 1B5GH 3RC5A 2ESTE 2Z9JA 1HFDA 1GBJA 1ABIH 5JYIA 3FP7E 1V2QT 2ZPRA 4YM9A 3LH3A 2CHAC 2HVXA 4BANB 1GI3A 5DP6A 5ESTE 3MI4A 1C2JA 1TGBA 3U8TH 4LXBH 4CBOA 1G2MA 1AGJA 1CE5A 4NA8A 1KXEA 1S85A 3RMOH 6GCHF 2G55A 2F43B 1P05A 3QGJA 5F53A 1C5UA 2CMYA 5HXFA 2P8OC 3ZVCA 1EP6A 1LHGH 2Z9IA 2B8OH 1FX0B 2ZQ2A 1O5BB 3KQDA 3V3MA 2VBCA 5C20A 4I8HA 3O8RA 2ZDAH 2EEKA 2CF9H 2HPPH 1SGEE 3R0FA 4NIVA 1C2HA 3T25A 1IQMA 1P2KA 3SNEA 4KTSA 1YLCA 1W11U 3K9XB 1PYTC 1Z71A 1QY6A
chains in the Genus database with same CATH topology
2BOKA 1ZYOA 8ESTE 1SGYE 3QDZB 1SGRE 5IYTA 1T8LA 4F4OC 4YT7H 3ZZCA 2R2MB 1SR5C 4X2VA 1OYQA 2VH0A 2BY9X 1EAWA 2NU3E 4MPWA 2AEIH 2VGCB 1J8AA 5DP5A 3SJIA 1OWEA 4FVDA 2HRVA 4B76A 1TFXA 5FX6A 2PTCE 1QFKH 4B1TA 3A7WA 2ZPSA 2A0QB 4Y8XA 1TAWA 1O35A 3STIA 5EW2H 2BLVA 2AFQB 3EDXB 3GCNA 3V13A 3Q3YA 4GVUA 3LC3A 1C5WB 1C2LA 1DWBH 2C93B 3QK1A 2D2DA 1AKSA 1QBNA 2BDAA 2OTVA 1SVPA 2ODPA 4MNWA 2AGGX 3A84A 1JWTA 1TLDA 4YOJA 2C4FH 1SGIB 3Q77A 2A5IA 2A2XH 2QXIA 3A89A 1VCPA 3D49H 2HGTH 2I6QA 1IQKA 4Y7BA 2Q6DA 4CH8B 3QGNB 1YF4A 4E7RG 5EXMA 1AZ8A 1ZHRA 2PKSC 1CT0E 3OX7U 3GY7A 4ZKNU 1EKBB 1AN1E 1QB9A 1OS8A 1SQAA 2RA0A 2AERH 4VGCB 2P93A 3SZNA 1KTSB 3A8AA 5T6GA 2C8XB 2BDHA 1K9OE 5GPIB 4OS5A 4ABIA 1IQGA 1AWHB 4U30A 3T5FH 3A81A 1E34B 1VGCC 2AMPA 3OU0A 3M3VA 3ODDA 4AZ2B 5LPEA 2OCVB 1SGNE 3GDSA 3M37A 2XCNA 1JIRA 1QRWA 1XVMA 1OKXA 2QV1A 2P16A 1GHBG 4MVNA 3A83A 3A7ZA 1YGCH 3D62A 3SV8A 3M3TA 1MBMA 4NFEA 4WF8A 1VZQH 1MTVA 1MZDA 3SORA 1BRUP 4Q80A 3FAOA 3M5LA 3SUEA 3ESTA 1WSSH 3SQHE 5A0AE 4DCDA 1GI0A 3HGNA 3HGPA 3GCHC 4ABGA 1LKBA 2IOTA 2ZHDA 3CS0A 1EOJA 2ZHQH 4NSYA 1O3AA 1AUTC 2GDDA 2Z3CA 1DLEA 2F83A 3MO6A 2QA9E 2GTBA 1W0ZU 3LDXH 3ZZ8A 3Q76A 2QIQA 1O30A 1DXPA 3CS7A 1W0YH 2RG3A 2FLBH 3BIVH 3VXEH 1O2IA 4GPGA 3AW0A 1ZSKA 1AE8H 2A7JA 1NC6A 1N6YA 2ZGCA 2QGRA 1UCYH 1OXGA 3TJOA 5GWZA 2ZQ1A 2JETC 1C1NA 1EB2A 1C2MA 2BY7X 4H6TA 3UREA 3UWJH 8GCHG 3RUOA 2BD9A 3MU5A 2HNTC 3TH3H 1IQJA 4XBBA 5SGAE 1NU7B 2XW9A 5F03A 1BTXA 1K1OA 5C1YA 4YLUA 1ESAA 1NO9H 1PQ7A 1GG6C 1LHEH 2Y81A 5CHAB 4D9RA 1PPBH 1SHHB 1TA6A 3UY9A 5LPFA 4IMQA 4I8JA 2XXLA 1Y3VA 1CGJE 4GLYA 2AYWA 2ZF0H 1V2VT 2BX3A 1K1IA 1M9UA 4HGCA 4NZLA 2H1UA 1GVZA 5HYOA 3AASA 1BQYA 4IN1A 5JBCS 3BTQE 1C1RA 1NRQH 1P11E 1AY6H 1O32A 2YNAA 4X1QU 1MKXH 2WV5A 1BTHH 1KTTB 2ZU2A 2NU1E 3SNAA 1CT2E 2DE9A 1Y3XA 1UTQA 4XDEA 1Z6JH 3EGKH 3QTVH 1GMHG 5I46H 1BOQA 2CGAA 4F49A 2QXGA 2R2WU 2J95A 1UCYK 3RU4E 3SU0A 3M7UA 1YPGH 2A45B 2P95A 1C5TA 1FY8E 5FX5A 5BPEA 1FPCH 3ZZ3A 3GOVB 5A8ZA 1HAZB 1LQEA 4BAOB 4K60A 4FU9A 1GI9B 1FY4A 3T27A 1O2KA 1G3EA 3RXAA 2ZECA 5A0BA 2PFEA 2A5KA 5DJ7A 4DG4A 1O38A 4BAMB 5JBBS 1Z1IA 1IHSH 1OSSA 1VITG 4UFGH 3UOUA 4BXSA 1SGDE 1HAPH 1OWDA 1A3BH 2GCHG 3ZVGA 1EP5A 3TK6A 4LK4A 5G4BA 2ZHEH 1DUAA 2GKVE 4ISLA 1KLTA 3TH2H 5ETXA 1TX7A 1FAKH 5DGJA 3M7QA 1O3FA 4U32A 3SNCA 2GP9B 1QB1A 1V2UT 1C1PA 1S0QA 1L4DA 1D9IA 4CRAA 2PW8H 1DANH 1F0SA 1QL8A 1SQOA 2FOAA 1GHWH 1YM0A 3KGPA 3NUMA 5EQQA 4ABJA 2BMGB 3DHKH 1GMHF 1ZLRA 1P10A 1Z8GA 2VB0A 1PPCE 2HLCA 3PMAB 8KME2 5EOKA 3VB7A 1HIAA 1W10U 3A86A 5FCRA 1ABJH 1UTMA 1T4VH 1SPJA 1CA8B 3NKKA 1F2SE 1YC0A 3K65B 5T3HA 3T62A 4X0WU 2FODA 2PLXA 5B6OA 1K1MA 3TGIE 1C5SA 1ZHMA 4ZHLU 2FO9A 4AN7A 3RXDA 1AD8H 4XSKU 1MAYA 1GBIA 1O5EH 3V0XA 1AB9C 8LPRA 1TNJA 2TGAA 2BY6X 1DICA 1MTNC 3K2UA 1QGFA 4Y0ZE 3LT3A 3P95A 1SB1H 3O8CA 2R0KA 4X2WA 1HLTH 2Z9GA 4IBLH 3PO1B 1P2IA 3GY4A 1P3CA 3UWIA 1Z7KA 4IN2A 2THFB 1T31A 2FS9A 3BG4C 5FPTA 2QXHA 3ZYDA 1TQ7B 1C5RA 1EX3A 2ZGHA 1DOJA 2CJIA 2IPHA 3UQOA 4OS2A 1DT2A 2WV4A 3M36A 3F9HA 1G3CA 3MU8A 1O3JA 5EGMA 4O3TA 3PB1E 1ZSLA 3M5MA 2BB4A 4UONA 1LPGB 1O5CB 4RSPA 3DD2H 3OYPA 2OP9A 4ZROA 3LGTA 3MTYA 1V2JT 4A7IB 2BHGA 7LPRA 1P8VC 1D3PB 1GCTC 1O3PB 4NSVA 3LJJA 2C3SA 2EA3A 3VB6A 3ZVDA 1O36A 4MPVA 4JK6A 1DSTA 3MO3A 1HGTH 2QAAA 1T8MA 2FM2A 3ITIA 4KGAA 1MTWA 3BEFB 4DVAU 1QBOA 2ZFPH 4AFZA 1BDAA 1ELBA 2FTMA 2VIQA 3SNDA 2FOGA 1WQSA 3L6PA 4WVPE 1OP8A 2SGQE 2ANWA 4A92A 1LQDB 2I6SA 5F6MA 3B9FH 1W7XH 1CGIE 5C5NA 1GMCG 1RJXB 3RXFA 2OUAA 1E38B 1A61H 3NXPA 1T8NA 1C2GA 2STAE 4TY6A 1NRPH 1LVBA 3U1JB 3ZVAA 1HDTH 1LDTT 2ZZUH 3SGQE 1SLUB 1EATA 5F8TA 2BLQA 4I8KA 4JYUH 1JOUB 1XUHA 4GCHF 3HKJB 1FJSA 1EZQA 2DE8A 1ZTLA 2A4GA 1SGPE 1KSNA 2HPQH 2WPLS 3SHCH 3K6ZA 1FNIA 3GCTG 4YZUA 2G4TA 3Q3XA 2XBWA 1DY9A 2Z6BD 3E91A 2H2ZA 5A0CA 1Q31A 1ARCA 4X1PU 4AGKA 1WCZA 5TJXA 1UTLM 1MZAA 1EPTB 1BRAA 1MBQA 2D8WA 3OY6U 3RXQA 1BRCE 1DDJA 4WMDA 1SBWA 4KELA 1IQIA 1O3KA 1TRMA 4JMYA 1FY5A 1KDQB 4JZEH 1HNEE 1SGCA 2ALPA 3Q00A 3LC5A 1ANEA 2UUFB 1QNJA 1Z1JA 1O2UA 2ZTZA 4ZHAA 1TALA 3UUZA 1ELCA 1G32B 2XTTB 5FCKA 4CRGA 1L1GA 2FPZA 3JZ2B 1MKWH 2HNTF 2R3YA 3BEIB 1LVOA 1LVMA 4X6MA 3UTUH 2VGCC 5EXLA 1KY9A 1O5DH 4QT8C 2GZ7A 1Z8JB 2R3UA 5C3NA 1TMUH 1GHZA 2ZFRH 2Y5GA 4X2XA 1EZSC 1LHDH 4INLA 1C4U2 1C5LH 4NA7A 1X7AC 4Q7ZA 3GCTF 1QA0A 2TIOA 3MH4A 4AORA 6GCHG 4D7FA 5HGGA 3EA7A 3MU0A 3LOXA 4A6LA 1F92A 3RP2A 1A46H 2Y5FA 3KQBA 3PTNA 2GT7A 4CHAB 1DY8A 3A8DA 2PSXA 1GDNA 1O2JA 3VXFH 3BTWE 5ESBA 3A80A 1Y5AT 4NIYA 4BTIB 4NIXA 3RXSA 3AAUA 4FUEA 1WU1A 4Y8ZA 5IDKA 1TPAE 1QBVH 4DOQA 3MH6A 4ZKOU 9LPRA 2BLWA 2FYQA 2BY5X 2FWWA 4VGCC 4UE7H 1O3HA 1V2MT 1XXFA 2QF0A 2AGEX 4WMFA 3RC4A 5FPSA 1D6RA 1YPHE 1H9LB 2A4OA 1EB1H 1TGCA 3A88A 3F9EA 1TGSZ 1ID5H 2VJ1A 4FVBA 1C5QA 3RXJA 1UHBB 1W3CA 1O37A 2B0FA 3TJNA 1TGTA 2NU0E 3QLPH 4HFPB 2Z94A 4WH6A 5PTPA 1HAVB 1B0FA 2W3KA 4ZH8A 2LPRA 2Z9LA 1TOMH 4Z0KA 1RTLA 1DSUA 1ZHPA 2Z3DA 4XOJA 3MWIU 2PUQH 2GGVB 3ATKA 5DP3A 4M7GA 5AHGH 1D3QB 1WOFA 1ZGIA 1ZZZA 7GCHF 2QF3A 5E2PA 1DFPA 2FX4A 2ZA5A 1CVWH 3FVFB 3M3SA 5FHTA 3GISB 1D3DB 1HB0B 1S0RA 1P12E 3RXTA 4MDSA 1AQ7A 3MNCA 2VINA 2XYAA 1TYNA 1XUJA 2BDCA 2ANYA 5A8YA 1QQUA 2F9PA 3OSYA 1UVOA 1ANDA 1A0HB 1PPHE 1DWCH 4MPXA 5C67A 1LPZB 1SGQE 1K22H 1TMBH 2WPMS 2C90B 1ZPCA 1W13U 1AFEH 3SBKA 3LKWA 2AMQA 1INCA 2VH6A 2W5EA 1EJMA 2ZHFH 1GJBB 1TONA 4OGYA 4TY7A 4ZUHA 2AS9A 3ELAH 4AYVB 4D76A 2TGPZ 4AOQA 1V6DA 1H9HE 2NU4E 2IJOB 1P2MA 1LTOA 5CHAC 3S9BA 3SI4H 5L2ZH 1KXFA 1NN6A 2KAIA 3U9AH 1J14A 4I31A 5E0JA 4INHA 3RXLA 4K1SA 1A5HA 1ZR0A 2ZGJA 3LGWA 4A1VA 3CP7A 2Q6GA 1GVLA 3A7YA 1O0DH 1D6WA 1QIXB 3UOPA 2ASUB 2SNVA 1GBLA 5JDUB 3SN8A 1YCPH 3TVJB 3RXVA 2PKAB 3H7OA 4NWLA 2PSYA 4XE4A 2V6NA 1RGQA 4NWKA 1WV7H 1XKAC 1Y3UA 1GVKB 3RU4T 4PROA 4WY3A 1F0RA 2BQ6B 1O5AB 2PGBB 2ZFQH 5EPYA 3WY8A 3M5NA 5L2YH 4A1XA 3S9CA 3RXHA 4MNVA 2J9NA 1OWJA 3CENA 1BHXB 1IHTH 2XWAA 2F9BH 3S7HB 1O2MA 1GBKA 2F9VA 5EXNA 1S84A 2UWPA 1O5GH 4OS6A 2F9NA 2WUCA 1B7XB 2G5NA 1UVSH 3LPRA 1HYLA 1H1BA 1H8IH 1FIWA 2ZFTA 3I77A 3MH7A 2F9OA 1P2QA 3SI3H 2A1DB 4INKA 3KHVA 2FP7B 1P9SA 1V2KT 4NIWA 1VJ9U 3GY8A 1IQLA 1DLKB 1NT1A 4I8LA 2A5AA 1GI7B 2VVVA 1LMWB 3KL6A 2WPKS 1QJ7B 2M5TA 1P2OA 1O3LA 1WYKA 1YPKH 4CR9A 4TPIZ 1ETRH 1TPPA 2STBE 4XBDA 4BAQB 2GX4A 1YYY1 1DX5M 1O3DA 3SU1A 2F3CE 4GHTA 1UK3A 1P02A 2LNCA 1MMJN 3PV4A 1QJ6B 1P09A 1U6QA 1EZUC 1XXDA 1ELFA 1HBTH 3GY6A 4THNH 1PQ5A 1Y3YA 1HAYB 1LPKB 1DWEH 2GV7A 2OQ5A 3PTBA 1BUIA 2BQ7B 4Y71A 2PUXB 3QUMP 4ZXXH 1OP0A 4WXVA 3BTME 2AMDA 2HALA 3SUFA 5DP9A 6CHAB 2Q6FA 1TNLA 3OY5U 3KEEA 1J16A 1TBQH 4MG3A 1T8OA 1PPEE 2UUKB 3VGCB 5E2OA 3PMBB 1SFIA 3L33A 1ZJKA 3LONA 1P2NA 1UVPA 2QXJA 3GICB 7ESTE 1YPMH 4X8TH 1UVUH 1MCTA 2ALVA 5EPNA 5FPYA 1GHYH 1Y3WA 2PTNA 5EODA 3RXUA 3RXBA 5DO4H 3DFLA 5E0GA 5FXLA 2AGIX 1CHGA 4X8SH 4Q7XA 3P17H 2RCEA 1SQTA 1W8BH 3PO1C 2H6MA 3MNBA 1H4WA 3F9FA 4JCNA 1SLXB 4YLQH 1O3GA 1SLWB 2K1QA 2AIPA 1RIWB 4GSOA 1AU8A 4H4FA 3VB3A 3RMMH 5JBAS 3SJOA 1C1TA 1HAGE 2UWOA 1GMDF 1TB6H 2ZCLP 1MQ5A 3N7OA 1UTJA 3E1XB 5GDSH 1FMGA 1HCGA 2TGDA 4JYTA 4DT7B 1P03A 7KMEH 1K1LA 2Y82A 1C5XB 4O3UA 4ISHH 1SOZA 1BTYA 3LJOA 1SGFA 1AMHA 1C9PA 1BMMH 1GL1A 1MQ6A 2PHBA 2BD4A 5JPMH 4A1TA 3TJUA 2JH6D 2ZGBH 3S69A 2RA3A 2BTCE 3SW2B 2OLGA 2FOCA 1EXFA 1Q3XA 3SJ8A 2TGTA 1OWIA 1WTHD 1J15A 1FONA 2P3FH 2UUJB 3M35A 1VJAU 1DUEA 5T6FA 1UTNA 3SV2H 2SFAA 4B2CA 2FOFA 1BHXF 2VWMA 4CRCA 1THSH 1DVAH 1O2XA 3T28A 3E8LA 1L2EA 3ATWA 3SJ9A 1HXEH 1CA0B 1NFUA 3RLWH 1O2GH 1GHXH 2WPHS 4Y76A 4AG1A 1ELAA 3QZRA 1MKXK 1C9TA 3EYDA 4AGJA 2ODQA 1ESTA 4K1TA 2ZDKA 3TJVA 3KF2A 3S0NA 2VIPA 2ZCKP 2F9UA 5GJ4B 2PWXA 1QL9A 5DP8A 2B5TB 1V2ST 1RXPA 3RM2H 3UR6A 4Y10E 3I78A 1AZZA 1V2TT 5ABWA 1MTUA 2F91A 3QWCH 1BMNH 4LOYH 2R9PA 1HAHH 2XNIA 1GJCB 2TPIZ 3OTJE 2XC5A 1RS0A 1EPTC 2H9EH 1N8OB 1GBBA 1PFXC 1TABE 2BYAX 1IQNA 1K1JA 1C2FA 2OC0A 1YPLH 3RXMA 4AX9H 1ELVA 4HZHA 2QYIA 4O97A 1O3MA 2J92A 2YOLA 1F5KU 3SNBA 2ZDVH 1THRH 2ODYB 1GI6A 1JRTA 2FOEA 1HXFH 1FY3A