1QGFA

Porcine pancreatic elastase complexed with (3r, 4s)n-para-toluenesulphonyl-3-ethyl-4-(carboxylic acid)pyrrolidin-2-one
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
240
structure length
240
Chain Sequence
b'VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELASTASE
publication title Mechanistic insights into the inhibition of serine proteases by monocyclic lactams.
pubmed doi rcsb
molecule tags Hydrolase
total genus 58
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1999-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qgfA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qgfA01
3ZZ9A 1NFXA 1QA7A 1TGNA 2PKSC 1P8VC 1NESE 1KXDA 1SGQE 1QJ7B 2J95A 1PPFE 2A2XH 3TK5A 3BTFE 3A8CA 5HGGA 2ZI2H 2Z3DA 1ZMNA 2GVFA 4AX9H 1SSXA 3SGBE 1BTPA 1IQKA 1P2MA 2BXUH 3ZZ7A 4WH8A 1TA2A 3U9AH 4YT7H 4ZKSU 6CHAC 1SGFG 8LPRA 2QXIA 1G37A 1LHFH 1TPOA 3TITA 1TA6A 4AFUA 5JBBS 1O3GA 1F92A 1ANEA 1W8BH 3OY6U 1DT2A 3ZVAA 1L4ZA 3E16B 2BMGB 1XKBC 2VB0A 1CBWC 1O3JA 1W13U 4Q80A 1D9IA 2XC0A 4FUCA 3LGWA 4GLYA 1EPTA 4X1RU 5ESTE 2FXRA 4ZHMU 1AKSA 2VIPA 1GJCB 1CA0B 3ZYEA 1FZZA 3RMLH 1NPMA 1ZMJA 2AS9A 3KNXA 1KLTA 4UE7H 1BUIA 1YPHE 3SU0A 1PYTD 1O3EA 1NRNH 2ZF0H 2FOHA 2AMPA 4OGYA 1GBIA 3A8AA 3LU9B 2ZGBH 4FUEA 1DS2E 1CA8B 1O2OA 1AQ7A 1QBNA 1A3EH 2BY5X 1YF4A 3ZZDA 1T8MA 1J8AA 4B75A 2FYRA 3O8BA 3BG4C 1A7SA 1PPGE 4ABHA 3EYDA 1IQNA 2NWNA 3RUOA 4ASHA 3PB1E 3O8RA 3SUEA 1SGIB 1SC8U 4MNXA 3D49H 1FPHH 2SGQE 2GZ9A 2FTLE 2BQWB 3SJ9A 1GBLA 1V2VT 3KL6A 1QIXB 1BDAA 1FMGA 1S0RA 2FX6A 2GV6A 1FN6A 1K1MA 4WY3A 1UTLM 1EAWA 3SU6A 3GY4A 5AFYH 1BMMH 1K28D 4IS5A 1P05A 3QLPH 4OS5A 4DW2U 3V12A 5FBIA 2RDLA 5FPTA 3TVJB 1JOUB 1GVKB 1KXFA 1KDQA 1S5SA 1IQEA 1EOLA 2QXJA 3OU0A 4Q7ZA 2GCTB 1FIWA 1A0HB 2FYQA 2ZU2A 4GUXA 1P57B 4A1VA 3OX7U 1UHBA 2GV7A 1C5VA 3LGTA 1L1GA 1P2IA 2XYAA 4MVNA 1OP8A 1EP6A 2NU0E 3M5OA 1BTWA 5HM2A 2GMTB 5HMAA 2FWWA 3TNSA 3RXBA 1CT4E 2FOMB 1SQTA 2BY8X 1Y3WA 1RIWB 3C27B 1YGCH 1K9OE 1RGQA 2UUJB 1Y3XA 1TNJA 1C5TA 1O3MA 1WYKA 2BD4A 4JZDH 1GMDG 2EC9H 3T5FH 3WY8A 1BBRK 1C2MA 3U8TH 5F8XA 4O3TA 2ZHDA 1OWDA 3ATMA 1MUEB 1JRSA 1FNIA 3OY5U 2ZGJA 3TK6A 2ODPA 5CMXH 3ZVBA 3U1JB 3L3TA 1GDUA 4NA9H 5AFZH 4TPIZ 1C5WB 1C5PA 3ZZBA 4AB8A 1HIAB 4ISLA 1C1OA 4O9VA 1IQIA 6ESTA 1FONA 1V2KT 3P95A 1ARBA 4JMYA 4I8HA 1V2TT 3UUZA 1TX6A 1O2WA 1V2UT 3VB7A 2PKAA 1LVOA 2W7UA 5HM9A 1RJXB 2WPIS 2ZPRA 5FPSA 1HUTH 3UPEA 1GJ7B 4MDSA 1QL8A 1ORFA 1BCUH 4UONA 1HYLA 2I6QA 4X2XA 1F2SE 4FUHA 3FFGA 3SJOA 4AGJA 3RLWH 1O2KA 8KME2 4DIIH 2A5IA 1HJ9A 2AGEX 1EAXA 1O2MA 3PTNA 3TU7H 4NSVA 1AB9B 1GHBF 3SI3H 2BOHB 3K6YA 3SN8A 2O8TA 3B8JA 1RS0A 2AIQA 4SGBE 4D7FA 2Y82A 1GHVH 3GY2A 1V2NT 2RCEA 3MO6A 2O8UA 4R8TB 1D6WA 5HYOA 2XBYA 1QTFA 3SNDA 1E37B 3ZZAA 5J4QA 3S9AA 5GCHF 3MU0A 1TX8A 3BSQA 2ZU3A 2FP7B 4IC6A 4UFGH 1XUHA 1HNEE 1UTMA 3VPKA 1HDTH 2AMDA 2V6NA 3F6UH 1BRUP 4MNWA 1HB0B 3GCHC 2ZPQA 2Z94A 1C4U2 1TGSZ 1O5FH 2TGAA 1AU8A 3A8BA 2BX4A 4FVBA 3CS7A 1ZPCA 1W10U 1INCA 4U2WA 1TRYA 1VGCB 1F0UA 1VITF 1D6RA 3IG6B 1YC0A 2GGVB 1O5GH 4DJZB 2JH0D 2F9UA 1WTHD 1C5RA 5T6GA 4NFEA 4GPGA 4F4OC 1QFKH 1C4V2 1UCYH 4YM9A 1AUJA 3ZVEA 5IYTA 1GVZA 4CHAC 2P16A 1TBZH 3P70B 3M3TA 2CN0H 1DITH 2JH5D 3EQ0H 4E06H 3STJA 1O2JA 4ABBA 2ZFQH 2QY0B 4CRGA 3LGIA 1Y3UA 9LPRA 4NA8A 1XX9A 3UQVA 1EAIA 4FU9A 1EZSC 3GDSA 4X8VH 3ZZ5A 4A5TS 2BM2A 1THSH 1XVMA 1GHYH 1HGTH 1ZZZA 2A5KA 4ISNA 2XBWA 3U8RH 1K22H 4FUFA 1K21H 4IGDA 5ABWA 4I8JA 2W3IA 1VR1H 3C1KA 4O03A 4Y0ZE 4Y8XA 2ZPSA 2PTCE 1GJ4H 1XMNB 3EAJA 4MPWA 1TNGA 2ZFSA 3K6ZA 5GPIB 1HFDA 4B2AA 1ELDE 3DA9B 5DO4H 4I7YH 1SOTA 4AZ2B 1GI3A 1DY8A 4Y11E 1GJDB 1AGJA 2AGGX 2QYIA 4UD9H 1GDQA 3GY8A 1DPOA 2VJ1A 3S9CA 3MU5A 2SNVA 1SLXB 5DJ7A 4JYTA 2H9HA 2FI3E 2PHBA 1OX1A 5E2OA 1B5GH 1GG6B 4DGJA 4Q7YA 3QGJA 3R0FA 5DP3A 1O38A 3SNBA 1W14U 3O8CA 3HKIB 1Z6JH 1QRWA 1ZGVA 2XCFA 1KIGH 2Y81A 3JZ1B 2C3SA 4IC5A 2WPJS 1S82A 2QCYA 2QF3A 1PYTC 1GMHF 4NIVA 5FX5A 1ANCA 3MI4A 4K1TA 4AFQA 1UCYE 3UTUH 5E0HA 1WQSA 1GBTA 1WBGB 1ESTA 1EUFA 2M5TA 3P17H 3ZV8A 1AMHA 2QN5T 4X6NA 1GBBA 3DD2H 1XUIA 4ZH8A 1O5AB 1GI0A 1TWXB 2ZDKA 4UEHH 1F0SA 3MH6A 2WYJA 3MWIU 2XBXA 5EU8A 4A7IB 1C1SA 2YNBA 1C2IA 2SGAA 1GBEA 5DP4A 1KY9A 2A0QB 3BTTE 1SR5C 4NIYA 4O97A 1TB6H 4TYDA 1IQLA 4Y8ZA 1EXFA 3GYMA 4E7RG 4BTIB 4YLUA 3A84A 1DVAH 3F9FA 4RN6A 3L6PA 1BMLA 3U8OH 1YPKH 1QHRB 3M7UA 4ISIH 1MKWK 2HNTE 3AVZA 1W11U 1L4DA 1ZHMA 2VIQA 2FLRH 4YESB 4ZAEA 1SVPA 5A0AE 1ETTH 3MNBA 1V2RT 5PTPA 2FEQH 5JBCS 1LHCH 2A31A 4Y7AA 3QK1A 3MH5A 4BAKB 1DWBH 3GCNA 2A7JA 1EPTC 3LC5A 1SLWB 1H1BA 3HK3B 2ZCLP 4CRBA 2Q6DA 3PYHA 3SV6A 1BITA 1NRSH 1GI2A 3MFJA 3P8FA 2DE8A 4ABJA 1GMHG 2AEIH 3VEQB 1GI1A 2ZKSA 3RXIA 1O5CB 1G9IE 4HI3A 5DGJA 3NUMA 2EEKA 1T8LA 2H9EH 1BJVA 1CHGA 1NC6A 1AZZA 1HAXB 4Z6AH 1T4UH 3RMMH 4X6MA 2CF9H 1O3LA 3EA8A 5GWZA 1TFXA 3P92A 1C5YB 1O3HA 5C1UA 1W12U 2BQ7B 2ZU4A 4IN1A 5B6OA 2RA3A 4ZKRU 1MBQA 3UNSA 1QJ1B 4DT7B 5SGAE 1ELCA 3CS0A 3AW1A 3E3TA 1QA0A 3BF6H 3BTQE 3IITA 2HALA 1YBWA 5CE1A 3RM0H 2B7DH 1LMWB 2Z7FE 3TJVA 2VIVA 2H9TH 1C2EA 1BTUA 1MQ6A 1AD8H 4XBCA 4UFDH 3KIDU 1SGDE 3PMJA 2FOEA 2ZC9H 3P8NA 4FUBA 3M3SA 3F9HA 2FPZA 2A7CA 4YOGA 1O5BB 2BLWA 3FP6E 1CSOE 1FAXA 4GHQA 4WXIA 1P2KA 1SLUB 3ZV9A 3QDZB 2FS9A 4BANB 1BTHH 5JYIA 3P6ZB 1F5LA 1HAVA 2BD3A 2PUQH 1AVWA 1UVUH 1ZRBA 1QJ6B 1AFEH 5A8ZA 1N6XA 1Q3XA 2NU3E 1GJ5H 1C1WH 2ZQ2A 5LPFA 3LGYA 4A92A 2V35A 2Y6TA 4ABGA 3BTDE 1BIOA 2FESH 2V0BA 2ZCKP 3LKWA 1DE7H 3AW0A 3TK9A 1K1NA 3VGCC 4MPXA 1EATA 1YPJH 3T29A 1L1NA 3PO1B 1MAXA 1PQ8A 1BT7A 5CHAC 3MYWA 3IWMA 4LK4A 3SZNA 1AO5A 1BRAA 1SHHB 5J4SA 1OWEA 1DOJA 4I31A 3KQBA 2Z9LA 2QXHA 1JIRA 1SGEE 1HJ8A 1NZQH 2D26C 4B73A 1T4VH 1RFNA 1MBMA 1EOJA 2ULLA 4OS6A 2DUCA 1NFUA 2XW9A 1GBJA 2FDAA 2G00A 3RXTA 3FZDA 1LVBA 4ZXYH 1SGYE 2QXGA 4OS4A 1A0JA 3A82A 1ZSJA 2C8XB 1F5KU 1RTKA 1N8OB 1GBDA 1Q2WA 1VCWA 3UR6A 1LHEH 1HAHH 5AVDA 4NSYA 1QURH 2WPHS 2TIOA 4IN2A 2ZHQH 1K2I1 4X1SU 2ZGHA 1O3CA 2BD7A 1GL1A 3MO9A 1C4Y2 1ETSH 1QBVH 3A7WA 1A5HA 1ELVA 4CR5A 2Z3EA 4PROA 3UWIA 1YCPK 5FCKA 3RXGA 2PSXA 3VB3A 1E0FD 2CXVA 2ESTE 3ZYDA 2ALPA 4AB9A 1ZPZA 2ZZUH 3QUMP 1K1LA 2CHAC 4HZHA 3K65B 1DLKB 2D8WA 4KP0A 2UUYA 2QIQA 3M37A 5EODA 1O2GH 4A6LA 1C2KA 3FP7E 2O8MA 3SUDA 2ZDLA 1G3DA 3FVFB 2J92A 5DP7A 3Q00A 3S9BA 3E1XB 3E90B 3A85A 3MHWU 4AG2A 3F1SB 2IN2A 1O2LA 2VWLA 3NWUA 1B0FA 1YM0A 4JZEH 1DSTA 1MTNB 4VGCB 4YT6H 5DG6A 1O2ZA 1S84A 2OQUA 4X6PA 1TAWA 1DWDH 2ZA5A 4GHTA 1BQYA 2BZAA 1G32B 1SB1H 5EXMA 3RXQA 5FAHA 1G3CA 2ANKH 3VB4A 3SHAH 1AHTH 1L1JA 2B0FA 4AYVB 1P3CA 1SBWA 1QB9A 3MNSA 3ELAH 4Q7XA 3LONA 4FVDA 2D2DA 2XBVA 2ZECA 5EXLA 7KMEH 1GMDF 2VWOA 1E34B 1DANH 1O2TA 2VNTA 2PWXA 1BRBE 1DY9A 1HAIH 4WMDA 3LH1A 1CA0C 3D65E 1BMNH 1RTLA 3RM2H 2VGCB 1AFQB 2OQ5A 3NK8A 3EA7A 2FTMA 1OXGA 3M36A 1GDNA 4ABIA 3GY7A 2BYAX 3SOSA 1C1QA 1GI7B 4UFEH 1Y5BT 1C5LH 2WPKS 4XE4A 1FAKH 3TNTA 4B76A 4A1TA 3T2NA 3RU4E 3PMHB 3ZZ6A 1UJ1A 1S81A 3A83A 1T8NA 5H4IB 3LDXH 1GCDA 4NWLA 2A1DB 1O3OA 3HKJB 1WQVH 4NIWA 5GDSH 4ESTE 4UDWH 4KTUA 1FV9A 1VCPA 3RC4A 5I25A 3DHKH 1AY6H 1O2XA 5E0JA 1ZYOA 1QCPA 1PQAA 1GI5A 3NKKA 1NS3A 1YPGH 1IOEA 1O2VA 1XUKA 1YCPH 5TCAA 4XOJA 2CJIA 5LPEA 3RU4T 1CT0E 1UCYK 2RA0A 1O30A 1TBRH 2HWLB 3KQDA 5JPMH 1A1RA 5LPRA 1LKBA 2F9NA 2TBSA 3U69H 3D23A 1AVXA 5L6NH 5FCRA 2BLVA 1EAUA 1K1IA 4AYYB 1T32A 1OYTH 2UWLA 2GCTC 1MCVA 4CRAA 2JH6D 4KGAA 1C5MD 2BDIA 1CU1A 3ATIA 2G81E 1GHAF 1PPCE 3EE0B 3M5MA 2BDCA 4Y76A 4MQAA 1UK2A 4FU7A 1F5RA 2GMTC 3TJOA 2BTCE 1CO7E 2C93B 2FX4A 2ZP0H 2UWOA 4FUDA 3S7HB 1SL3A 1KYNA 2VVUA 4TY6A 1GVLA 2BDYA 3W95A 2FODA 1RIWC 1H9LB 5AHGH 1VJ9U 1ZTKA 4AORA 3KEEA 2FMJA 1EZQA 1HRTH 2YOLA 4FXGH 2CGAA 2PLXA 1DWCH 3E6PH 2FIRH 2ODYB 2XCNA 4AG1A 1AI8H 3HATH 2BD5A 2ANWA 2R3UA 1H9IE 2BLQA 1DICA 1QQ4A 3Q76A 2ZDAH 4MG3A 2FZZA 1AWFH 1DM4B 4THNH 1FIZA 1GBAA 1UVPA 5TJXA 1G30B 4GCHF 4AN7A 1TE0A 3SORA 1ACBE 5E0GA 3RMOH 2C4FH 1IQHA 2H5DA 1GCTB 3TGKE 1YLDA 3TJUA 5T3HA 4I32A 1FXYA 1ZPBA 2WUBA 3QTOH 2UUKB 1ELFA 4KTCA 2GZ8A 3R3GB 3SO3A 4X6OA 2OCVB 2H6MA 1TABE 5C3NA 3RXCA 1T8OA 5F8TA 1LKAA 1BRCE 1HV7A 1EB2A 3QGNB 1VZQH 1FN8A 2BY9X 3OSYA 5BPEA 6GCHG 3A7ZA 2A4GA 4LZ4B 7LPRA 2ZQ1A 1TMBH 1Y3VA 5EPYA 4ABAA 1A46H 4HGCA 1GGDB 1GHAG 4X2YA 4CH2B 1WU1A 2FOCA 1D4PB 1W7GH 2BLOA 1Z8GA 3T25A 2XC4A 1GHZA 2FOGA 4OGXA 1KTSB 1TBQH 1YCPM 1A5IA 4D8NA 1HAOH 4Z0KA 7ESTE 4Q2KA 1DXWA 2A7HA 4WXVA 3S69A 3SUGA 2G5NA 4B1TA 1Z8IB 3A86A 1BMAA 1HAVB 1FY4A 2Y5HA 3FAOA 4CREA 2ZNKH 3BV9B 3KCGH 2A2QH 2SFAA 1TONA 3SU1A 4K5ZA 1DUAA 1UTOA 1Z8RA 1VCQA 4I33A 4X1NU 1W3CA 1C2FA 2UWPA 3VXEH 2J38A 1OSSA 1P0SH 5C1XA 2ZWLH 4GCHG 1O3FA 2XWAA 3MNCA 5BRRE 5F6MA 1DX5M 1TX7A 1N1LA 3DT0H 2ZFRH 1AWHB 1AN1E 1MZAA 2IJOB 1VGCC 3AAVA 3DFLA 1BZXE 1HAZB 1YKTA 1OWJA 3SUFA 1GI9B 3A81A 2K1QA 2QAAA 2Y7ZA 2P93A 3FANA 5EQQA 2SGEE 4JZIA 1JBUH 1L0ZA 1MZDA 2IOTA 2Z9JA 3AASA 1O3KA 5JB9S 4DG4A 1TGBA 4XFQA 2WINI 4DURA 1E38B 3L33A 3H7TA 1K1JA 4BAMB 1ETRH 3BTEE 1V2QT 2FO9A 1GJ6A 1W2KH 1A2CH 5GXPA 1FY5A 1ZGIA 1ANDA 2W26A 4TWWA 3QTVH 2NU4E 2ODQA 3P8OA 3SU2A 3PLKA 3T27A 4U01A 5DK1A 3GCTG 1GBMA 7GCHG 1SGPE 1GHXH 2Y5GA 1O3BA 1LVYA 1P03A 1MAYA 1P3EA 4YO9A 1DFPA 1TNLA 2C8ZB 3ZZ4A 3AAUA 3A88A 2WPLS 2PGQB 1D3DB 4O3UA 3RXRA 4D9QA 3DUXH 1NO9H 1TRNA 1OS8A 2SNWA 3SQEE 1QL9A 2ZFTA 1MTSA 5I46H 1KLIH 2XWBI 1JXPA 2ZIQH 1FDPA 2OC7A 1PQ5A 2TGDA 3NXPA 3UY9A 1QGFA 1TOCB 2BQ6B 1GG6C 2QGRA 3M61U 3Q3KA 4YLQH 2ANMH 3F9GA 2Z9IA 2JKHA 2CF8H 1L2EA 1PJPA 2ILNA 2OLGA 4H4FA 3RXSA 4ZKOU 3RC5A 2CV3A 1V2LT 2TRMA 3M7TA 4I8KA 4TY7A 3SJKA 2XNIA 2VINA 2R3YA 4ZKNU 1A4WH 3A87A 3GDVA 1ZRKA 4H6TA 1QR3E 1O2PA 1SG8B 4ZUHA 2VU8E 1V2JT 3MU4A 1GJBB 4OS2A 1ARCA 1IQMA 3RXJA 3SW2B 1KXAA 4DVAU 2AYWA 4U32A 1YPEH 1TLDA 3RP2A 3BG8A 3U98H 1KLJH 1IHTH 2BOKA 4BNRA 4GSOA 1ESBA 1O2YA 2GTBA 3UWJH 2ZG0H 1LDTT 4XBBA 1VITH 1HXEH 3GY3A 1GL0E 1O2HA 1P2JA 5G4BA 1V2ST 3BEUA 4CBNA 3GY5A 2P3UB 1KXCA 1O2UA 2BDBA 1NFYA 1SGCA 4K60A 4BAQB 2VWNA 1NN6A 5L2YH 3I77A 1ZJKA 4MNYA 3SHCH 1PPBH 2ZHFH 5DP6A 4Y79A 3PLBA 2P8OB 2F3CE 1C1RA 1C9TA 4H42U 2AH4X 2O8WA 4TWYA 4X0WU 2JETB 3SNAA 3SU3A 1XUGA 3O8DA 3SI4H 1T31A 5JDUB 3NZIA 2BVRH 1C9PA 5EGMA 5T6DA 4JK5A 1SOZA 4U30A 5A09A 1TYNA 1HJAB 1DDJA 1G36A 1O2RA 1ELAA 3PMBB 2O9QA 2ZU1A 3LJJA 1ZHRA 2G52A 2PR3A 4J1YA 3TPIZ 2WYGA 1NRRH 3ZVFA 5A8YA 2Q6FA 1HLTH 2Y7XA 3F68H 4NWKA 1PPZA 1KXEA 4A1XA 3MNXA 1YPHC 2FOBA 2IPHA 1HAPH 1NRPH 5A8XA 2VVVA 1JWTA 1QY6A 4INHA 4AGKA 1P2QA 2EI8A 2ZEBA 4X1PU 1V2WT 3ZZ3A 4CRCA 1CGHA 1YYY1 2BVXH 1ZJDA 4NA7A 5EQSA 3CP7A 1CHOF 5EW1H 1YP9A 5GIBA 1NT1A 2G51A 2HRVA 2BY6X 3FZZA 4WMFA 3ATLA 1V2PT 1MU8B 1A5GH 2R0KA 3ITIA 1FI8A 4UFFH 4Y6DA 5EG4A 1P9UA 1ID5H 3PV4A 2XRCA 3SGQE 1P06A 3I78A 1FUJA 1DUEA 1D3QB 5DP8A 4KTSA 1DWEH 2PKSB 1TQ0B 3KN2A 1EB1H 4DCDA 1ZMLA 1Q31A 2P3TB 5FPYA 2QV1A 3TLOA 3MO3A 1NU7B 1WV7H 3M3VA 1O3AA 2ANYA 4WH6A 2ZO3H 4CRDA 3D62A 3RXVA 2OTVA 1MTVA 3ZZ8A 5LH8A 5JBTA 2PUXB 1C2HA 2VIWA 8ESTE 1LQEA 2GKVE 6CHAB 3GY6A 1TOMH 5ESBA 4AOQA 1LPGB 2B8OH 2GD4B 1C1MA 1CT2E 5JBAS 1AZ8A 3RXAA 4SGAE 2HPPH 1OP2A 1S83A 1TPPA 2A4RA 2Y80A 5F03A 3PO1C 1IQFA 1P09A 1C1TA 4ISHH 3BTKE 1ELGA 1EJNA 1CBWB 3NCLA 1O31A 2A4OA 4NZLA 1C1NA 4D7GA 4I8GA 4JZFH 2J4IA 1OWKA 3ODFA 4BAOB 1Y3YA 1ESAA 3BTHE 1CHOG 2EA3A 1FY3A 5DP9A 3URCA 3RXHA 1BHXB 1ELTA 2WPMS 2HVXA 3UREA 1V2MT 4LOYH 2GT7A 2R2WU 3TH4H 4R0IA 1GJ8B 1MU6B 1ELEE 1TNKA 2ZDVH 3GICB 2TGTA 4XSKU 3W94A 4KELA 2XC5A 4K8BA 1Z1IA 2VH0A 3V0XA 1IQGA 1N8OC 2GP9B 1CE5A 5A2MH 4JCNA 4MPVA 3BG4B 3ZVCA 3T28A 1Y8TA 2ZTYA 2PSYA 1CGIE 1P04A 1UTPA 2C8YB 4YZUA 1GJAB 2F83A 3SNCA 2VIDA 5EQRA 2AIPA 3SQHE 1MCTA 1TGTA 2H5CA 4ZHAA 1RRKA 4CBOA 3RXDA 3SV8A 2W3KA 1JMOH 1UK4A 2P95A 3ATWA 4E7NA 3QWCH 1IHSH 4DY7B 2G4TA 1XVOA 1ZSLA 1D3PB 1TPSA 1QBOA 1X7AC 3BTGE 4LZ1H 3VB5A 1QL7A 2BDHA 1WSSH 3MOCA 3MH7A 3E91A 1TALA 4CH8B 1ZTLA 2P94A 2LPRA 5C5NA 5L2ZH 2AMQA 2J34A 3UOPA 4WMEA 2QC2A 3G01A 3PTBA 1TQ7B 2BY7X 5JB8S 1GHWH 1MTNC 4VGCC 3QZRA 1U6QA 2WV4A 4Y71A 1J14A 1SGRE 3S7KB 4HTCH 2THFB 3V3MA 4H6SB 1C5NH 4F49A 3TIUA 1F0RA 1G2LA 4BTUB 2PGBB 1Y59T 4CR9A 4FUJA 2Q1JA 3UIRA 3RDZA 3RC6A 1LTOA 1V2OT 2GX4A 3QN7A 1NU9A 4NIXA 1ZOMA 3GISB 1VJAU 1NY22 1Y5AT 4K1SA 1O2IA 1TRMA 1M9UA 1C1VH 2NU2E 1C2DA 5C67A 2VGCC 4BOHA 1J15A 2STAE 2CMYA 2W5EA 1AFQC 4OS7A 4HFPB 2I6SA 3PMAB 5FX6A 2BDAA 1N6YA 3SJIA 2C8WB 3KHVA 1PPHE 2SGPE 2ALVA 1O2SA 2Q6GA 3UFAA 2BD8A 4ABEA 2FI4E 3V13A 1UMAH 1THPB 2ZDMA 1SHYA 2GDDA 1H8DH 4ABFA 5DKMA 1J9CH 1GI6A 1K1OA 1T7CA 4WF8A 1QB6A 1BB0B 1H9HE 2BB4A 2J9NA 3JZ2B 1CVWH 6GCHF 2R0LA 5DP5A 2F9PA 1K1PA 2AERH 1BOQA 2ASUB 3PM3A 2HNTF 1CQQA 1OWHA 5EOKA 2OC8A 5A0BA 4K69A 1OYQA 1MQ5A 3MMGA 1C2LA 2ZHWH 1SPJA 3SV7A 4KKDA 4WWYA 2BDGA 4X8SH 4IMQA 1EASA 1XUJA 4GVUA 2DE9A 3ENSB 1TMUH 2Z9KA 1Z7KA 3VXFH 1SMFE 3M35A 2P3FH 2OBOA 5K7RA 3LH3A 4JZ1A 2WUCA 1EX3A 3QX5H 1BJUA 2SGDE 1BA8B 4AFSA 3KGPA 3URDA 1NRQH 1O36A 4I8LA 3ESTA 1O5DH 3UNQA 1HBTH 2J2UA 1UTQA 1MKXK 1FJSA 1EQ9A 1DLEA 1TGCA 4B74A 1W0ZU 2F9VA 2C90B 2GT8A 5IDKA 4IBLH 1LHDH 1WCZA 2P59A 2F9BH 1UK3A 5C5OA 3UNRA 1Z8JB 2FI5E 1SLVB 5C1YA 1O5EH 3HPTB 4YOIA 1HCGA 4B2BA 3TH3H 6LPRA 3GCHB 2RG3A 2ZTXA 1HPGA 1UVSH 2V3OH 4RKOB 4B71A 3LPRA 1TPAE 1MD8A 1EP5A 1THRH 3H7OA 3ZVGA 1F0TA 2Z3CA 2KAIB 1FQ3A 1UTNA 3V7TA 8GCHF 1JIMA 2VH6A 2B9LA 3RXUA 1AE8H 1AVGH 1PQ7A 1S6HA 4YOJA 4CHAB 4RSPA 2BD2A 1AB9C 3PROA 3EA9A 1FPCH 5FXLA 2F91A 1GBKA 3MU8A 2OINA 3RXOA 2A5AA 1SGFA 1C5QA 2FLBH 2QA9E 1P02A 3SJ8A 2G55A 3STIA 3RU4D 3GCTF 1C5ZB 1GCTC 3ODDA 1H4WA 7GCHF 1XM1A 1SQOA 1Z6EA 1BTYA 5A0CA 1O35A 1BTZA 1KXBA 4MLFB 4MPUA 2LNCA 2VIOA 1JRTA 9ESTA 1QNJA 2OXSA 3N7OA 1H8IH 4JYVH 1DXPA 1G3EA 3F9EA 3GOVB 3VB6A 2OD3B 2BVSH 1C5XB 2HNTC 2R2MB 5C20A 4JK6A 4NCYA 5LGOA 1O3DA 1C1UH 5FHTA 3Q77A 4MNVA 2V3HH 3TH2H 1EKBB 2BX3A 1GGDC 1GI4A 1LO6A 1B0EA 4OS1A 2J94A 1BBRH 1LVMA 3BIUH 2OP9A 2Z9GA 1O3IA 2TPIZ 3A8DA 1HXFH 1WAYB 5EW2H 2UUFB 5EXNA 1SGNE 2HPQH 1GHBG 2OUAA 3Q3XA 1NROH 3SV9A 1SI5H 1EJMA 1QQUA 3LJOA 1A61H 8GCHG 1E35B 1MKXH 1LHGH 1P01A 1Z1JA 3SNEA 1RTFB 1O33A 3M7QA 1KTTB 4FUIA 5F8ZA 3RXEA 1O34A 1J17T 2XTTB 3UR9A 3A89A 3RXPA 1RD3B 5GCHG 2FM2A 2STBE 1MTWA 2GCHF 1PPEE 4BXSA 1UTKA 3A7XA 5E2PA 5GJ4B 1UVTH 4INLA 1OWIA 3P8GA 4ISOA 1GMCF 1ZSKA 2Y5FA 1XKAC 4X8UH 1TNIA 1Z71A 1P11E 1GI8B 3GCOA 1ABJH 4ABDA 4K2YA 2FS8A 5EPNA 1OOKB 4E05H 2R9PA 4X2VA 3RXMA 1VITG 4NGAH 1SGTA 1P2OA 2VVCA 3GDUA 4J2YB 2TGPZ 3KF2A 2ZGXH 2A45B 2BD9A 3I29A 2W7SA 2H2ZA 1LQDB 4YTAA 1NM6A 3UQOA 3OTJE 4IW4E 1WUNH 2ZGCA 3KQCA 4B2CA 4AFZA 5HXFA 3MTYA 1AUTC 1QRZA 3PWBA 4TPYA 2FOFA 2ZFFH 1EJAA 1A0LA 1BBRE 3LOXA 3QO6A 3TGIE 2Z6BD 2BZ6H 4D76A 1J16A 2A32A 1WOFA 2ZHEH 1O3PB 3A7YA 2BXTH 3RXLA 2ZFPH 3ZZCA 1EPTB 4BTTB 4JYUH 1AKSB 1E36B 4XBDA 1C5SA 3KQEA 4WVPE 5K0HA 4BAHB 3BTWE 1LCYA 1O2NA 1MMJN 1O37A 2HOBA 3SU4A 1NTPA 5AF9H 3BTME 1HAYB 1YPLH 1UVOA 1GBCA 2HGTH 2ZCHP 3LGVA 2GCHG 3GYLB 1HIAA 1LPKB 2B5TB 1D3TB 4NFFA 2QF0A 3UOUA 1GMCG 3MU1A 1KSNA 4DOQA 1O39A 3SBKA 1EZUC 4Y8YA 1OPHB 1P12E 1DSUA 2A4QA 2G5VA 2NU1E 3EGKH 3RMNH 1Y5UT 4Y7BA 4INKA 1TMTH 1EZXC 2GZ7A 1C2GA 1C5UA 4FU8A 2D1JA 4ZROA 4LXBH 1G3BA 4ZXXH 1XXFA 1QRXA 3S0NA 4Y10E 2H1UA 4K8YA 4K1EA 5T6FA 3A7TA 4M7GA 3LT3A 1HAGE 1CGJE 2OBQA 1MH0A 4XDEA 5FBEA 3E8LA 2EI6A 1ZTJA 1ELBA 2G4UA 4FUGA 4X1QU 1TIOA 2KAIA 1C5OH 2YNAA 1XXDA 2SGFE 3PWCA 3HK6B 4K3JA 2HLCA 3EDXB 3FP8E 1FLEE 4MTBA 3TJNA 4X8TH 1F7ZA 3HGNA 1SQAA 1MTUA 1MD7A 3E0PB 3OYPA 1UO6A 1KDQB 2FOAA 3BEFB 4Y0YE 5L30H 1W7XH 1IAUA 1NFWA 2BHGA 1XUFA 5ETXA 1ZR0A 1SFQB 1ANBA 2PV9B 2OC1A 4RKJB 1UHBB 3BIVH 1QB1A 2OC0A 2XXLA 1O3NA 1C2JA 5DPAA 5E8EH 1P9SA 3Q3YA 1O0DH 2AGIX 1OP0A 1C1PA 1S85A 2PTNA 1GBFA 3ZVDA 2P8OC 4QT8C 3VGCB 3SU5A 3HGPA 2ZU5A 3H5CB 3LIWA 2VWMA 1TNHA 4CRFA 5TCCA 2JETC 4WJG2 4ZHLU 3PLPA 2G8TA 3DFJA 5CHAB 1BHXF 2ZTZA 4ZMAH 4D9RA 1W0YH 3VFEA 2WV5A 1HJAC 2AFQB 3M5LA 1V3XA 3ATKA 1ZLRA 2EI7A 1LPZB 3K9XB 4NZQA 1PFXC 2O8LA 3K2UA 1GWAA 3RXFA 4DIHH 1O32A 4BXWA 1BTXA 3LGUA 4GAWA 1IQJA 1P10A 1V6DA 3CENA 1FY8E 3M5NA 1MKWH 2PW8H 2PKAB 4IMZA 2GDEH 3SV2H 3NPSA 1AE5A 1YPMH 3A80A 3T26A 3SGAE 1B7XB 3T62A 3MH4A 3BN9A 1S0QA 1AIXH 3RXKA 3TGJE 1G2MA 1GJ9B 1S6FA 1ZHPA 1GBHA 3QZQA 1ABIH 1WTGH 2ZDNA 1SFIA 3LC3A 1O2QA 1UTJA 4X2WA 4NG9H 3RLYH 1GPZA 3B23B 1OKXA 1YLCA 2PFEA 3E0NB 3BEIB 3U1IB 1FY1A 5C2ZA 1P2NA 1RXPA 1A3BH 3A7VA 2F9OA 3B9FH 2CHAB
chains in the Genus database with same CATH superfamily
3ZZ9A 1NFXA 1QA7A 1TGNA 2PKSC 1P8VC 2J98A 1NESE 1KXDA 1SGQE 1QJ7B 2J95A 1PPFE 2A2XH 3TK5A 3BTFE 3A8CA 5HGGA 2ZI2H 2Z3DA 3F2GA 1ZMNA 2GVFA 4AX9H 1SSXA 3SGBE 1BTPA 1IQKA 1P2MA 2BXUH 3ZZ7A 5EIYA 4WH8A 1TA2A 3U9AH 4YT7H 4ZKSU 6CHAC 1SGFG 8LPRA 2QXIA 1G37A 1LHFH 1TPOA 3TITA 1TA6A 4AFUA 5JBBS 1O3GA 1F92A 1ANEA 1W8BH 3OY6U 1DT2A 3ZVAA 1L4ZA 3E16B 2BMGB 1XKBC 2VB0A 1CBWC 1O3JA 1W13U 4Q80A 1D9IA 2XC0A 4FUCA 3NRLA 3LGWA 4GLYA 1EPTA 4X1RU 5ESTE 4M9FA 1SQRA 2FXRA 4ZHMU 1AKSA 2VIPA 3OFND 1GJCB 1CA0B 3ZYEA 1FZZA 3RMLH 1NPMA 1ZMJA 2AS9A 3KNXA 1KLTA 4UE7H 1BUIA 1YPHE 3SU0A 1PYTD 1O3EA 1NRNH 2ZF0H 2FOHA 2AMPA 4OGYA 1GBIA 3A8AA 3LU9B 4RT0A 2ZGBH 4FUEA 1DS2E 1CA8B 1O2OA 1AQ7A 1QBNA 1A3EH 2BY5X 1YF4A 3ZZDA 1T8MA 1J8AA 4B75A 2FYRA 3O8BA 3BG4C 1A7SA 1PPGE 4ABHA 5B6LA 3EYDA 1IQNA 2NWNA 3RUOA 4ASHA 3PB1E 3O8RA 3SUEA 1SGIB 1SC8U 4MNXA 3D49H 1FPHH 2SGQE 2GZ9A 2FTLE 2BQWB 3SJ9A 1GBLA 3FN8A 1V2VT 3KL6A 1QIXB 1BDAA 1FMGA 1S0RA 2FX6A 2GV6A 1FN6A 2LELA 2KCYA 1K1MA 4WY3A 1UTLM 1EAWA 3SU6A 3OE7D 3GY4A 5AFYH 1BMMH 1K28D 5CDFE 4IS5A 1P05A 1H8HD 4OS5A 3QLPH 1BMFD 4DW2U 3V12A 5FBIA 2RDLA 5FPTA 3TVJB 1JOUB 1GVKB 1KXFA 1KDQA 1S5SA 1IQEA 1EOLA 2QXJA 3OU0A 4Q7ZA 2GCTB 1FIWA 2F4LA 1A0HB 2FYQA 2ZU2A 4GUXA 1P57B 4A1VA 2K0QA 3OX7U 1UHBA 2GV7A 1C5VA 3LGTA 1L1GA 1P2IA 2XYAA 4MVNA 1OP8A 1EP6A 2NU0E 3M5OA 1BTWA 5HM2A 2GMTB 5HMAA 2FWWA 3TNSA 3RXBA 1CT4E 2FOMB 3W1EA 1SQTA 2BY8X 1Y3WA 1RIWB 3C27B 1YGCH 1K9OE 1RGQA 2UUJB 1Y3XA 1TNJA 1C5TA 1O3MA 1WYKA 2BD4A 4JZDH 1GMDG 2EC9H 3T5FH 3WY8A 1BBRK 1C2MA 3U8TH 5F8XA 4O3TA 2ZHDA 1OWDA 3ATMA 1MUEB 1JRSA 1FNIA 3OY5U 2ZGJA 3TK6A 2ODPA 5CMXH 3ZVBA 3U1JB 3L3TA 1GDUA 4NA9H 5AFZH 4TPIZ 1C5WB 1C5PA 3ZZBA 4AB8A 1HIAB 4ISLA 1C1OA 4O9VA 1IQIA 6ESTA 1FONA 1V2KT 3P95A 1ARBA 4JMYA 4I8HA 1V2TT 3UUZA 1TX6A 1O2WA 1V2UT 3VB7A 2M2AA 2PKAA 1LVOA 2W7UA 5HM9A 1RJXB 2WPIS 2ZPRA 5FPSA 1HUTH 3UPEA 1GJ7B 4MDSA 1QL8A 1ORFA 4HG6A 4F48B 1BCUH 4UONA 1HYLA 2I6QA 4X2XA 1F2SE 4FUHA 3FFGA 3FOAA 3SJOA 4AGJA 3RLWH 1O2KA 8KME2 4DIIH 2A5IA 1HJ9A 2AGEX 1EAXA 1O2MA 3PTNA 3TU7H 4NSVA 1AB9B 1GHBF 3SI3H 2BOHB 3K6YA 2L6OA 3SN8A 2O8TA 3B8JA 1RS0A 2AIQA 5F53A 4SGBE 4D7FA 2Y82A 1GHVH 3GY2A 1V2NT 2RCEA 3MO6A 2RFKC 2O8UA 4R8TB 1D6WA 5HYOA 2XBYA 1QTFA 3SNDA 1E37B 3ZZAA 1VKYA 5J4QA 3S9AA 5GCHF 3MU0A 1TX8A 3BSQA 2ZU3A 2FP7B 1OHHD 4IC6A 4UFGH 1XUHA 1HNEE 1UTMA 3VPKA 1HDTH 2AMDA 2V6NA 3F6UH 1BRUP 4MNWA 1HB0B 3GCHC 2ZPQA 2YMSD 2Z94A 1C4U2 3F0PA 1TGSZ 1O5FH 2TGAA 1AU8A 3A8BA 4Q63A 2BX4A 4FVBA 3CS7A 1ZPCA 1W10U 1INCA 4U2WA 1TRYA 1VGCB 1F0UA 1VITF 1D6RA 3IG6B 1YC0A 2GGVB 1O5GH 4DJZB 2JH0D 2F9UA 1WTHD 4DT4A 1C5RA 5T6GA 4NFEA 4GPGA 4F4OC 1QFKH 1C4V2 1UCYH 4YM9A 1AUJA 3ZVEA 5IYTA 1GVZA 4CHAC 2P16A 1TBZH 3P70B 3M3TA 2CN0H 1DITH 2JH5D 3EQ0H 4E06H 3STJA 1O2JA 4ABBA 2ZFQH 2QY0B 4CRGA 3LGIA 1Y3UA 3VG8A 9LPRA 4NA8A 1XX9A 3UQVA 1EAIA 4FU9A 1EZSC 3GDSA 4X8VH 3ZZ5A 4A5TS 2BM2A 1THSH 1XVMA 1GHYH 1HGTH 1ZZZA 2A5KA 4FOUC 4ISNA 2XBWA 3U8RH 1K22H 4FUFA 1K21H 4IGDA 5ABWA 4I8JA 2W3IA 1VR1H 3C1KA 4O03A 4Y0ZE 4Y8XA 2ZPSA 2PTCE 1GJ4H 1XMNB 3EAJA 4MPWA 1TNGA 2ZFSA 3K6ZA 5GPIB 1HFDA 4B2AA 1ELDE 3DA9B 5DO4H 4I7YH 1SOTA 4AZ2B 1GI3A 1DY8A 4Y11E 1GJDB 1AGJA 2AGGX 2QYIA 4UD9H 1GDQA 3GY8A 1DPOA 2VJ1A 3S9CA 3MU5A 2SNVA 3F0OA 1SLXB 5DJ7A 4JYTA 2H9HA 2FI3E 2PHBA 1OX1A 5E2OA 2QE7D 1B5GH 1GG6B 4DGJA 2WPDD 4Q7YA 3QGJA 3R0FA 5DP3A 1O38A 3SNBA 1W14U 3O8CA 3HKIB 1Z6JH 1QRWA 1ZGVA 2XCFA 1KIGH 2Y81A 3JZ1B 2C3SA 4IC5A 2WSSD 2WPJS 1S82A 1MABB 2QCYA 2JDID 1PYTC 1GMHF 2QF3A 4NIVA 5FX5A 1ANCA 3MI4A 4K1TA 4AFQA 1UCYE 3UTUH 5E0HA 1WQSA 1GBTA 1WBGB 1ESTA 1EUFA 2M5TA 3P17H 3ZV8A 1AMHA 2QN5T 4X6NA 1GBBA 3DD2H 1XUIA 4ZH8A 1O5AB 3KYGA 1GI0A 1TWXB 2ZDKA 4UEHH 1F0SA 3MH6A 2WYJA 3MWIU 2XBXA 5EU8A 4A7IB 1C1SA 4B6EA 2YNBA 1C2IA 2SGAA 1GBEA 5DP4A 1KY9A 2A0QB 3BTTE 1SR5C 4NIYA 4O97A 1TB6H 4TYDA 1IQLA 4Y8ZA 1EXFA 3GYMA 4E7RG 4BTIB 4YLUA 3A84A 1DVAH 3F9FA 2XOKD 4RN6A 3L6PA 1BMLA 3U8OH 1YPKH 2KCOA 1QHRB 3M7UA 4ISIH 1MKWK 2HNTE 3AVZA 1W11U 1L4DA 1ZHMA 2VIQA 2FLRH 4YESB 4ZAEA 1SVPA 5A0AE 1ETTH 3MNBA 1V2RT 5PTPA 2FEQH 5JBCS 1LHCH 2A31A 4Y7AA 3QK1A 3MH5A 4BAKB 1DWBH 3GCNA 2A7JA 1EPTC 3LC5A 1SLWB 1H1BA 2EQNA 3HK3B 2ZCLP 4CRBA 2KCPA 2Q6DA 3PYHA 3AK5A 3SV6A 1BITA 1NRSH 1GI2A 3MFJA 3P8FA 2DE8A 4ABJA 1GMHG 2AEIH 3VEQB 1GI1A 2ZKSA 1WXRA 3RXIA 1O5CB 1G9IE 4HI3A 5DGJA 3NUMA 2EEKA 1T8LA 2H9EH 1BJVA 1CHGA 1NC6A 1AZZA 1HAXB 4Z6AH 1T4UH 3RMMH 4X6MA 2PP6A 2WV9A 2CF9H 1O3LA 3EA8A 5GWZA 1TFXA 3P92A 1C5YB 5FL7D 1O3HA 5C1UA 1W12U 2BQ7B 2ZU4A 4IN1A 5B6OA 2RA3A 4ZKRU 1MBQA 3UNSA 1QJ1B 4DT7B 5SGAE 1ELCA 3CS0A 3AW1A 3E3TA 1QA0A 3BF6H 3BTQE 3IITA 2HALA 1YBWA 2KZ4A 3N7DA 4AC9A 5CE1A 3RM0H 2B7DH 1LMWB 2Z7FE 3TJVA 2VIVA 2H9TH 1C2EA 1BTUA 1MQ6A 1AD8H 4XBCA 4UFDH 3KIDU 1SGDE 3PMJA 2FOEA 2ZC9H 3P8NA 4FUBA 3M3SA 3F9HA 2FPZA 2A7CA 4YOGA 1O5BB 2BLWA 3FP6E 1CSOE 1FAXA 2V3MA 4GHQA 4WXIA 1P2KA 1SLUB 3ZV9A 3QDZB 2FS9A 4BANB 1BTHH 3MQKC 5JYIA 3P6ZB 1F5LA 2YMSB 1HAVA 2BD3A 2PUQH 1AVWA 1UVUH 1ZRBA 1QJ6B 1AFEH 5A8ZA 2WHXA 3PRDA 5EJLA 1N6XA 1Q3XA 4ACBA 2NU3E 1GJ5H 1C1WH 2ZQ2A 5LPFA 3LGYA 4A92A 1COWD 2V35A 2Y6TA 4ABGA 5EJZA 3BTDE 1BIOA 2FESH 2V0BA 2ZCKP 3LKWA 1DE7H 3AW0A 3TK9A 1K1NA 3VGCC 1W0KD 4MPXA 1EATA 1YPJH 3T29A 5HKKD 1L1NA 3PO1B 1MAXA 1PQ8A 4RT1A 1BT7A 5CHAC 3MYWA 3IWMA 4LK4A 3SZNA 1AO5A 1BRAA 2VBCA 1SHHB 5J4SA 1OWEA 1DOJA 4I31A 3KQBA 2Z9LA 2QXHA 1JIRA 3SZEA 3U28C 1SGEE 1HJ8A 1NZQH 2D26C 4B73A 1T4VH 1RFNA 1MBMA 1EOJA 2ULLA 4OS6A 2DUCA 1NFUA 2XW9A 1GBJA 2FDAA 2G00A 3RXTA 3FZDA 1LVBA 4ZXYH 1SGYE 2QXGA 4OS4A 1A0JA 3A82A 1ZSJA 2C8XB 1F5KU 1RTKA 2WZQA 1N8OB 1GBDA 1Q2WA 1VCWA 3UR6A 3DSPA 1LHEH 1HAHH 5AVDA 4NSYA 1QURH 2WPHS 3WW7A 2TIOA 4IN2A 2ZHQH 1K2I1 4X1SU 2ZGHA 1O3CA 2BD7A 1GL1A 3MO9A 1C4Y2 1ETSH 1QBVH 3A7WA 1A5HA 1ELVA 4CR5A 2Z3EA 4PROA 3UWIA 1YCPK 5FCKA 3RXGA 2PSXA 3VB3A 1E0FD 2CXVA 2ESTE 3ZYDA 2ALPA 4AB9A 1ZPZA 2ZZUH 3QUMP 1K1LA 2CHAC 4HZHA 3K65B 1DLKB 2D8WA 4KP0A 2UUYA 2W6JD 2QIQA 3M37A 5EODA 1O2GH 4A6LA 1C2KA 3PV2A 3FP7E 2O8MA 3SUDA 2ZDLA 1G3DA 3FVFB 2J92A 5DP7A 3Q00A 3S9BA 3E1XB 3E90B 3A85A 3MHWU 4F55A 4AG2A 3F1SB 2IN2A 3FKSD 1O2LA 2VWLA 3NWUA 1B0FA 1YM0A 4JZEH 1DSTA 1MTNB 4VGCB 4YT6H 5DG6A 1O2ZA 1S84A 2OQUA 4X6PA 1TAWA 1DWDH 1SKYE 2ZA5A 4GHTA 1BQYA 2BZAA 1G32B 1SB1H 5EXMA 3RXQA 5FAHA 1G3CA 2ANKH 3VB4A 3SHAH 1AHTH 1L1JA 2B0FA 4AYVB 1P3CA 1SBWA 1QB9A 3MNSA 2HVYB 3ELAH 4Q7XA 3LONA 4FVDA 2D2DA 2XBVA 2ZECA 5EXLA 7KMEH 1GMDF 2VWOA 1E34B 1DANH 1O2TA 2VNTA 2PWXA 1BRBE 1DY9A 1HAIH 4WMDA 3LH1A 1CA0C 3D65E 1BMNH 1RTLA 3RM2H 2VGCB 1AFQB 2OQ5A 3NK8A 3EA7A 2L74A 2FTMA 1OXGA 3M36A 1GDNA 4ABIA 3GY7A 2BYAX 3SOSA 1C1QA 1GI7B 4UFEH 1Y5BT 1C5LH 2WPKS 4XE4A 1FAKH 3TNTA 2HLDD 4B76A 4A1TA 3T2NA 3RU4E 3PMHB 3ZZ6A 1NBME 1UJ1A 1S81A 4XD7D 3KYFA 3A83A 1T8NA 5H4IB 3LDXH 1GCDA 4NWLA 2A1DB 1O3OA 3FO8D 3HKJB 1WQVH 4NIWA 5GDSH 4ESTE 4UDWH 4KTUA 1FV9A 1VCPA 3RC4A 5I25A 3DHKH 1AY6H 1O2XA 5E0JA 1ZYOA 1QCPA 1PQAA 1GI5A 3NKKA 1NS3A 1YPGH 1IOEA 1O2VA 1XUKA 1YCPH 5TCAA 4XOJA 2CJIA 5LPEA 3RU4T 1CT0E 1UCYK 2RA0A 1O30A 1TBRH 2HWLB 3KQDA 5JPMH 1A1RA 5LPRA 1LKBA 2F9NA 2KM0A 2TBSA 3U69H 2F43B 3D23A 1AVXA 5L6NH 5FCRA 2BLVA 1EAUA 1K1IA 4AYYB 1T32A 1OYTH 2UWLA 2GCTC 1MCVA 4CRAA 2JH6D 4KGAA 1C5MD 2BDIA 1CU1A 3ATIA 2G81E 1GHAF 1PPCE 4ACAA 3EE0B 3M5MA 1H8ED 2BDCA 4Y76A 5DSFA 4MQAA 1UK2A 4FU7A 1F5RA 2GMTC 3TJOA 2BTCE 1CO7E 2C93B 2FX4A 2ZP0H 2UWOA 4FUDA 3S7HB 1SL3A 1KYNA 2VVUA 4TY6A 1GVLA 2BDYA 3W95A 2FODA 1RIWC 1H9LB 5AHGH 1VJ9U 1ZTKA 4AORA 3KEEA 2FMJA 1EZQA 1HRTH 2YOLA 4FXGH 2OK5A 2CGAA 2PLXA 1DWCH 3E6PH 2FIRH 2IPQX 2ODYB 2XCNA 4AG1A 1AI8H 3CNRA 3HATH 2BD5A 2ANWA 2R3UA 1H9IE 2BLQA 1DICA 1QQ4A 3Q76A 2ZDAH 4MG3A 2FZZA 1AWFH 1DM4B 4THNH 1FIZA 1GBAA 1UVPA 1YLNA 5TJXA 1G30B 4GCHF 4AN7A 1TE0A 3SORA 1ACBE 5E0GA 3RMOH 2C4FH 1IQHA 2H5DA 1GCTB 3TGKE 1YLDA 3TJUA 5T3HA 4I32A 4XRNA 1FXYA 1ZPBA 2WUBA 3QTOH 2UUKB 1ELFA 4KTCA 2GZ8A 3R3GB 1KMHB 3SO3A 4X6OA 2OCVB 2H6MA 1TABE 5C3NA 3RXCA 1T8OA 5F8TA 1LKAA 1BRCE 1HV7A 3OAAD 1EB2A 3QGNB 1VZQH 1FN8A 2BY9X 3OSYA 5BPEA 6GCHG 3A7ZA 2A4GA 4LZ4B 7LPRA 2ZQ1A 1TMBH 1Y3VA 5EPYA 4ABAA 4P00A 1A46H 4HGCA 1GGDB 1GHAG 4X2YA 4CH2B 1WU1A 2FOCA 3WWFA 1D4PB 1W7GH 2BLOA 1Z8GA 4Q4LA 3T25A 2XC4A 2EY4C 2KX4A 1GHZA 2FOGA 3F3BA 4OGXA 1KTSB 1TBQH 1YCPM 1A5IA 4D8NA 1HAOH 1S6LA 4Z0KA 7ESTE 4Q2KA 1DXWA 2A7HA 4WXVA 3S69A 3SUGA 2G5NA 4B1TA 1Z8IB 3A86A 1BMAA 1HAVB 1YWUA 1FY4A 2Y5HA 3FAOA 4CREA 2ZNKH 3BV9B 3KCGH 2A2QH 2SFAA 1TONA 3SU1A 4K5ZA 1DUAA 1UTOA 1Z8RA 1VCQA 4I33A 4X1NU 1W3CA 1C2FA 2UWPA 3VXEH 2J38A 1OSSA 1P0SH 3DCLA 5C1XA 2ZWLH 4GCHG 1O3FA 2XWAA 3MNCA 5BRRE 5F6MA 1DX5M 1TX7A 1N1LA 3DT0H 2ZFRH 1AWHB 1AN1E 1MZAA 2IJOB 1VGCC 3AAVA 3DFLA 1BZXE 1HAZB 1YKTA 1OWJA 3SUFA 1GI9B 3A81A 2K1QA 2QAAA 2Y7ZA 2P93A 3FANA 5EQQA 2SGEE 4JZIA 1JBUH 1L0ZA 1MZDA 2IOTA 2Z9JA 3AASA 1O3KA 5JB9S 3PRBA 4DG4A 1TGBA 4XFQA 2WINI 4DURA 1E38B 3L33A 3H7TA 1K1JA 4BAMB 1ETRH 3BTEE 1V2QT 2FO9A 4YXWD 1GJ6A 1W2KH 1A2CH 5GXPA 1FY5A 1ZGIA 1ANDA 2W26A 4TWWA 3QTVH 2NU4E 2ODQA 3P8OA 3SU2A 3PLKA 3T27A 4U01A 5DK1A 3GCTG 1GBMA 7GCHG 1SGPE 1GHXH 2Y5GA 1O3BA 1LVYA 1P03A 1MAYA 1P3EA 4YO9A 1DFPA 2RDEA 1TNLA 2C8ZB 3ZZ4A 3AAUA 3A88A 2WPLS 2PGQB 1D3DB 4O3UA 3RXRA 4D9QA 3DUXH 1NO9H 1TRNA 1OS8A 2SNWA 3SQEE 1QL9A 2ZFTA 1FX0B 1MTSA 2W6ID 5I46H 1KLIH 2XWBI 2KR7A 3N99A 1JXPA 2ZIQH 1FDPA 2OC7A 1PQ5A 2TGDA 3NXPA 3UY9A 1QGFA 1TOCB 2BQ6B 1GG6C 2QGRA 3M61U 3Q3KA 3KQ5A 4YLQH 3OTPA 4RI0A 2ANMH 3F9GA 2Z9IA 2JKHA 2CF8H 1L2EA 1PJPA 2ILNA 2OLGA 4H4FA 3RXSA 4ZKOU 3RC5A 2CV3A 1V2LT 2TRMA 3M7TA 5GNDA 4I8KA 4TY7A 3SJKA 2XNIA 2VINA 2R3YA 4ZKNU 1A4WH 3A87A 3GDVA 5T1VA 3UB0A 1K0HA 1ZRKA 4H6TA 1QR3E 1O2PA 1SG8B 4ZUHA 2VU8E 1V2JT 3DSGA 3MU4A 1GJBB 4OS2A 1ARCA 1IQMA 3RXJA 3SW2B 1KXAA 5EJ1A 4DVAU 2AYWA 4U32A 1YPEH 1TLDA 3RP2A 3BG8A 3U98H 1KLJH 1IHTH 2BOKA 4BNRA 4GSOA 1ESBA 1O2YA 2GTBA 3UWJH 2ZG0H 1LDTT 4XBBA 1VITH 1HXEH 3GY3A 1GL0E 1O2HA 1P2JA 5G4BA 1V2ST 3BEUA 4TT3D 4CBNA 3GY5A 2P3UB 1KXCA 1O2UA 2BDBA 1NFYA 1SGCA 4K60A 4TSFD 4BAQB 2VWNA 1NN6A 5L2YH 3I77A 1ZJKA 4MNYA 3SHCH 1PPBH 1EFRD 2ZHFH 5DP6A 4Y79A 5C0UA 3PLBA 2P8OB 2F3CE 2KFWA 1C1RA 1C9TA 4H42U 2AH4X 2O8WA 4TWYA 4X0WU 2JETB 3SNAA 4FETA 1XUGA 3O8DA 3SI4H 3SU3A 1T31A 5DN6D 3SYJA 5JDUB 3NZIA 2BVRH 1C9PA 4ZCNA 5EGMA 5T6DA 4JK5A 2J97A 1SOZA 4U30A 5A09A 1TYNA 1HJAB 1DDJA 1G36A 1O2RA 1ELAA 3PMBB 2O9QA 2ZU1A 3LJJA 1ZHRA 2G52A 2PR3A 4J1YA 3TPIZ 2WYGA 1NRRH 3ZVFA 5A8YA 2Q6FA 1HLTH 2Y7XA 3F68H 4NWKA 1PPZA 1KXEA 3DSOA 4A1XA 3MNXA 1YPHC 2FOBA 2IPHA 1HAPH 1NRPH 5A8XA 2VVVA 1JWTA 1QY6A 4INHA 4AGKA 1P2QA 2EI8A 2ZEBA 4X1PU 1V2WT 3ZZ3A 4CRCA 1CGHA 1YYY1 2BVXH 1ZJDA 3EE7A 4NA7A 5EQSA 3CP7A 1CHOF 5EW1H 1YP9A 5GIBA 1NT1A 2G51A 2HRVA 2BY6X 3FZZA 4WMFA 3ATLA 1V2PT 1MU8B 1A5GH 2R0KA 3ITIA 1FI8A 4UFFH 4Y6DA 5EG4A 1P9UA 1ID5H 3PV4A 2XRCA 3SGQE 1P06A 3I78A 1FUJA 1E79D 1DUEA 1D3QB 5DP8A 4KTSA 1DWEH 2PKSB 1TQ0B 3KN2A 1EB1H 4DCDA 1ZMLA 1Q31A 2P3TB 5FPYA 5KGOA 2QV1A 3TLOA 3MO3A 1NU7B 1WV7H 2YMSC 3M3VA 1O3AA 2ANYA 4WH6A 2ZO3H 4CRDA 3D62A 3RXVA 2OTVA 1MTVA 3ZZ8A 5LH8A 5JBTA 2PUXB 3WWBA 1C2HA 2VIWA 8ESTE 1LQEA 2GKVE 6CHAB 3OEED 3GY6A 1TOMH 5ESBA 4AOQA 1LPGB 2B8OH 2GD4B 1C1MA 3OEHD 1CT2E 5JBAS 1AZ8A 3RXAA 4SGAE 2HPPH 1OP2A 1S83A 1TPPA 2A4RA 2Y80A 5F03A 2AHME 3PO1C 1IQFA 1P09A 1C1TA 4ISHH 3BTKE 1ELGA 1EJNA 1CBWB 3NCLA 1O31A 2A4OA 4NZLA 1C1NA 4D7GA 4I8GA 4JZFH 2J4IA 1OWKA 3ODFA 4BAOB 4P02A 1Y3YA 1ESAA 3BTHE 1CHOG 2EA3A 1FY3A 4Z1MD 5DP9A 3URCA 3RXHA 1BHXB 1ELTA 2WPMS 2HVXA 3UREA 1V2MT 4LOYH 2GT7A 2R2WU 3TH4H 4R0IA 1GJ8B 1MU6B 1ELEE 1TNKA 2ZDVH 3GICB 2TGTA 4XSKU 3W94A 4KELA 2XC5A 4K8BA 1Z1IA 2VH0A 3V0XA 1IQGA 1N8OC 2GP9B 1CE5A 5A2MH 4JCNA 4MPVA 3BG4B 3ZVCA 3T28A 1Y8TA 2ZTYA 2PSYA 1CGIE 1P04A 1UTPA 2C8YB 4YZUA 1GJAB 2F83A 3SNCA 2VIDA 5EQRA 2AIPA 3SQHE 1MCTA 1TGTA 2H5CA 4ZHAA 1RRKA 4CBOA 3RXDA 3SV8A 2W3KA 1JMOH 4ASUD 1UK4A 2P95A 3ATWA 4E7NA 3QWCH 1IHSH 4DY7B 2G4TA 1XVOA 1ZSLA 5C17A 1D3PB 1TPSA 1QBOA 1X7AC 3BTGE 4LZ1H 3VB5A 3PV5A 1QL7A 2BDHA 1WSSH 3MOCA 3MH7A 3E91A 1TALA 4CH8B 1ZTLA 2P94A 2LPRA 5C5NA 5L2ZH 2AMQA 2J34A 3UOPA 4WMEA 2QC2A 3G01A 3PTBA 1TQ7B 2BY7X 5JB8S 1GHWH 1MTNC 4VGCC 3QZRA 1U6QA 2WV4A 4Y71A 1J14A 2GJGA 1SGRE 3S7KB 4HTCH 2THFB 3V3MA 4H6SB 1C5NH 4F49A 3TIUA 1F0RA 1G2LA 4BTUB 2PGBB 1Y59T 3H09A 4FUJA 4CR9A 2Q1JA 4OM9A 3UIRA 3RDZA 3RC6A 1E1QD 1LTOA 1V2OT 2GX4A 3QN7A 1NU9A 4NIXA 1ZOMA 2QF4A 3GISB 1VJAU 1NY22 1Y5AT 4K1SA 1O2IA 1TRMA 1M9UA 1C1VH 2NU2E 1C2DA 5C67A 2VGCC 4BOHA 1J15A 2STAE 2CMYA 2W5EA 1AFQC 4OS7A 4HFPB 2I6SA 3PMAB 5FX6A 2BDAA 1N6YA 3SJIA 2C8WB 3KHVA 1PPHE 2SGPE 2ALVA 1O2SA 2Q6GA 3UFAA 2BD8A 4ABEA 2FI4E 3V13A 1UMAH 1THPB 2ZDMA 1SHYA 2GDDA 1H8DH 4ABFA 5DKMA 1J9CH 1GI6A 1K1OA 1T7CA 4WF8A 1QB6A 1BB0B 1H9HE 2BB4A 2J9NA 3JZ2B 1CVWH 6GCHF 2R0LA 5DP5A 2F9PA 1K1PA 2AERH 1BOQA 2ASUB 3PM3A 2HNTF 1CQQA 1OWHA 5EOKA 2OC8A 5IK2D 5A0BA 4K69A 1OYQA 1WDIA 1MQ5A 3MMGA 1C2LA 2ZHWH 1SPJA 3SV7A 4KKDA 4WWYA 2BDGA 4X8SH 4IMQA 1EASA 1XUJA 4GVUA 2DE9A 3ENSB 1TMUH 2Z9KA 1Z7KA 3VXFH 1SMFE 3M35A 2P3FH 3F2HA 2OBOA 5K7RA 3GS9A 3LH3A 4JZ1A 2WUCA 1EX3A 3QX5H 1BJUA 2SGDE 1BA8B 4AFSA 3KGPA 3URDA 1NRQH 1O36A 4I8LA 3ESTA 1O5DH 3UNQA 1HBTH 2J5UA 2J2UA 1UTQA 1MKXK 1FJSA 1EQ9A 1DLEA 1TGCA 4B74A 1W0ZU 2F9VA 2C90B 2GT8A 5IDKA 4IBLH 1LHDH 1WCZA 2P59A 2F9BH 1UK3A 5C5OA 3UNRA 1Z8JB 2FI5E 1SLVB 5C1YA 1O5EH 2LP6A 3HPTB 4YOIA 1HCGA 2KCAA 4B2BA 3TH3H 6LPRA 3GCHB 2RG3A 2ZTXA 1HPGA 1UVSH 2V3OH 4RKOB 4B71A 3LPRA 1TPAE 1MD8A 1EP5A 1THRH 3H7OA 3ZVGA 1F0TA 2Z3CA 2KAIB 1FQ3A 1UTNA 3V7TA 8GCHF 1JIMA 2VH6A 2B9LA 3RXUA 1AE8H 1AVGH 1PQ7A 1S6HA 4YOJA 4CHAB 4RSPA 2BD2A 1AB9C 3PROA 3EA9A 1FPCH 5FXLA 2F91A 1GBKA 3MU8A 2OINA 3RXOA 2A5AA 4I86A 1SGFA 1C5QA 2FLBH 2QA9E 1P02A 3SJ8A 2G55A 3STIA 3RU4D 3GCTF 1C5ZB 1GCTC 3ODDA 1H4WA 7GCHF 1NBMD 1XM1A 1SQOA 1Z6EA 1BTYA 5A0CA 1O35A 1BTZA 1KXBA 4MLFB 4MPUA 2LNCA 2VIOA 1JRTA 9ESTA 1QNJA 2OXSA 3N7OA 1H8IH 4JYVH 1DXPA 1G3EA 3F9EA 3GOVB 2JIZD 3VB6A 2OD3B 2BVSH 1C5XB 3ZIAD 2HNTC 2R2MB 5C20A 2QF5A 4JK6A 4NCYA 5LGOA 1O3DA 1C1UH 5KECA 5FHTA 3Q77A 1E1RD 4MNVA 2V3HH 3TH2H 1EKBB 2BX3A 1GGDC 1GI4A 1LO6A 1B0EA 2CK3D 4OS1A 2J94A 1BBRH 1LVMA 3BIUH 2OP9A 2Z9GA 1O3IA 2TPIZ 3A8DA 1HXFH 1WAYB 5EW2H 2UUFB 5EXNA 1SGNE 3UAIC 2HPQH 1GHBG 2OUAA 3Q3XA 1NROH 3SV9A 1SI5H 1EJMA 1QQUA 3LJOA 2XNDD 1A61H 8GCHG 1E35B 1MKXH 1LHGH 1P01A 1Z1JA 3SNEA 5HIZA 1RTFB 1O33A 3M7QA 1KTTB 4FUIA 5F8ZA 5KEDA 3RXEA 1O34A 1J17T 2XTTB 3UR9A 3A89A 3RXPA 1RD3B 5GCHG 2FM2A 2STBE 1MTWA 2IJD1 2GCHF 1PPEE 4BXSA 1UTKA 3A7XA 5E2PA 5GJ4B 1UVTH 4INLA 1OWIA 3P8GA 4ISOA 1GMCF 1ZSKA 2Y5FA 1XKAC 4X8UH 1TNIA 1Z71A 1P11E 2J98B 1GI8B 3N7EA 3GCOA 1ABJH 4ABDA 4K2YA 4B6FA 2FS8A 5EPNA 2K8IA 1OOKB 4E05H 2R9PA 4X2VA 1W0JD 3RXMA 1VITG 4NGAH 1SGTA 1P2OA 2VVCA 3GDUA 4J2YB 2TGPZ 3KF2A 2ZGXH 2A45B 2BD9A 3I29A 2W7SA 2H2ZA 1LQDB 4YTAA 1NM6A 3UQOA 3OTJE 4IW4E 1WUNH 2ZGCA 3KQCA 4B2CA 4AFZA 5HXFA 3MTYA 1AUTC 1QRZA 3PWBA 4TPYA 2FOFA 2ZFFH 1EJAA 1A0LA 1BBRE 3LOXA 3QO6A 5HIYA 3TGIE 2Z6BD 2BZ6H 4D76A 1J16A 2A32A 1WOFA 2ZHEH 1O3PB 5C94A 3A7YA 2BXTH 3RXLA 2ZFPH 3ZZCA 1EPTB 4BTTB 4JYUH 1AKSB 1E36B 4XBDA 1C5SA 3KQEA 3F2FA 4WVPE 5K0HA 4BAHB 3BTWE 1LCYA 1O2NA 1MMJN 1UW7A 1O37A 2HOBA 3SU4A 1NTPA 5AF9H 3BTME 1HAYB 1YPLH 1UVOA 1GBCA 2HGTH 2ZCHP 3LGVA 2GCHG 3GYLB 1HIAA 1LPKB 2B5TB 1D3TB 4NFFA 2QF0A 3UOUA 1GMCG 3MU1A 1KSNA 4DOQA 1O39A 3SBKA 1EZUC 4Y8YA 1OPHB 1P12E 1DSUA 2A4QA 2G5VA 2NU1E 3EGKH 3RMNH 2JJ2D 1Y5UT 4Y7BA 4INKA 1TMTH 1EZXC 2GZ7A 1C2GA 1C5UA 4FU8A 2D1JA 4ZROA 4LXBH 1G3BA 4ZXXH 1XXFA 1QRXA 3S0NA 4Y10E 2H1UA 4K8YA 4K1EA 5T6FA 3A7TA 4M7GA 3LT3A 1HAGE 1CGJE 2OBQA 1MH0A 4XDEA 5FBEA 3E8LA 2EI6A 5C0TA 1ZTJA 1ELBA 2G4UA 4FUGA 4X1QU 1TIOA 2KAIA 1C5OH 2YNAA 1XXDA 2SGFE 3PWCA 3HK6B 4K3JA 2HLCA 3EDXB 3FP8E 1FLEE 4MTBA 3TJNA 4X8TH 1F7ZA 3HGNA 1SQAA 1MTUA 1MD7A 3E0PB 3OYPA 1UO6A 1KDQB 2FOAA 3BEFB 4Y0YE 5L30H 1W7XH 1IAUA 1NFWA 2BHGA 1XUFA 5ETXA 1ZR0A 1SFQB 1ANBA 2PV9B 2OC1A 4RKJB 1UHBB 3BIVH 1QB1A 2OC0A 2XXLA 1O3NA 1C2JA 5DPAA 5E8EH 1P9SA 3Q3YA 1O0DH 2AGIX 2V7QD 1OP0A 2JJ1D 1C1PA 1S85A 2PTNA 1GBFA 3ZVDA 2P8OC 4QT8C 3VGCB 3SU5A 3HGPA 2ZU5A 3H5CB 3LIWA 2VWMA 1TNHA 4CRFA 5TCCA 2JETC 4WJG2 4ZHLU 3PLPA 2G8TA 3DFJA 5CHAB 1BHXF 2ZTZA 4ZMAH 4D9RA 1W0YH 3VFEA 2WV5A 1QZ8A 1HJAC 2AFQB 3M5LA 1V3XA 3ATKA 1ZLRA 2EI7A 1LPZB 3K9XB 4NZQA 1PFXC 2O8LA 3K2UA 1GWAA 5CHBA 3RXFA 4DIHH 1O32A 4BXWA 1BTXA 3LGUA 4GAWA 1IQJA 1P10A 1V6DA 3CENA 1FY8E 3M5NA 1MKWH 2PW8H 2PKAB 4IMZA 2GDEH 3SV2H 3NPSA 1AE5A 1YPMH 3A80A 3T26A 3SGAE 1B7XB 3T62A 3MH4A 3BN9A 1S0QA 1AIXH 3RXKA 3TGJE 1G2MA 1GJ9B 1S6FA 1ZHPA 1GBHA 3QZQA 1ABIH 1WTGH 2ZDNA 1SFIA 3LC3A 1O2QA 1UTJA 4X2WA 4NG9H 3RLYH 1GPZA 3B23B 1OKXA 1YLCA 2PFEA 3E0NB 3BEIB 3U1IB 1FY1A 1YY3A 5C2ZA 1P2NA 1RXPA 1A3BH 3A7VA 2F9OA 3B9FH 2CHAB
chains in the Genus database with same CATH topology
3ZZ9A 1NFXA 1QA7A 1TGNA 2PKSC 1P8VC 1NESE 1KXDA 1SGQE 1QJ7B 2J95A 1PPFE 2A2XH 3TK5A 3BTFE 3A8CA 5HGGA 2ZI2H 2Z3DA 1ZMNA 2GVFA 4AX9H 1SSXA 3SGBE 1BTPA 1IQKA 1P2MA 2BXUH 3ZZ7A 4WH8A 1TA2A 3U9AH 4YT7H 4ZKSU 6CHAC 1SGFG 8LPRA 2QXIA 1G37A 1LHFH 1TPOA 3TITA 1TA6A 4AFUA 5JBBS 1O3GA 1F92A 1ANEA 1W8BH 3OY6U 1DT2A 3ZVAA 1L4ZA 3E16B 2BMGB 1XKBC 2VB0A 1CBWC 1O3JA 1W13U 4Q80A 1D9IA 2XC0A 4FUCA 3LGWA 4GLYA 1EPTA 4X1RU 5ESTE 2FXRA 4ZHMU 1AKSA 2VIPA 1GJCB 1CA0B 3ZYEA 1FZZA 3RMLH 1NPMA 1ZMJA 2AS9A 3KNXA 1KLTA 4UE7H 1BUIA 1YPHE 3SU0A 1PYTD 1O3EA 1NRNH 2ZF0H 2FOHA 2AMPA 4OGYA 1GBIA 3A8AA 3LU9B 2ZGBH 4FUEA 1DS2E 1CA8B 1O2OA 1AQ7A 1QBNA 1A3EH 2BY5X 1YF4A 3ZZDA 1T8MA 1J8AA 4B75A 2FYRA 3O8BA 3BG4C 1A7SA 1PPGE 4ABHA 3EYDA 1IQNA 2NWNA 3RUOA 4ASHA 3PB1E 3O8RA 3SUEA 1SGIB 1SC8U 4MNXA 3D49H 1FPHH 2SGQE 2GZ9A 2FTLE 2BQWB 3SJ9A 1GBLA 1V2VT 3KL6A 1QIXB 1BDAA 1FMGA 1S0RA 2FX6A 2GV6A 1FN6A 1K1MA 4WY3A 1UTLM 1EAWA 3SU6A 3GY4A 5AFYH 1BMMH 1K28D 4IS5A 1P05A 3QLPH 4OS5A 4DW2U 3V12A 5FBIA 2RDLA 5FPTA 3TVJB 1JOUB 1GVKB 1KXFA 1KDQA 1S5SA 1IQEA 1EOLA 2QXJA 3OU0A 4Q7ZA 2GCTB 1FIWA 1A0HB 2FYQA 2ZU2A 4GUXA 1P57B 4A1VA 3OX7U 1UHBA 2GV7A 1C5VA 3LGTA 1L1GA 1P2IA 2XYAA 4MVNA 1OP8A 1EP6A 2NU0E 3M5OA 1BTWA 5HM2A 2GMTB 5HMAA 2FWWA 3TNSA 3RXBA 1CT4E 2FOMB 1SQTA 2BY8X 1Y3WA 1RIWB 3C27B 1YGCH 1K9OE 1RGQA 2UUJB 1Y3XA 1TNJA 1C5TA 1O3MA 1WYKA 2BD4A 4JZDH 1GMDG 2EC9H 3T5FH 3WY8A 1BBRK 1C2MA 3U8TH 5F8XA 4O3TA 2ZHDA 1OWDA 3ATMA 1MUEB 1JRSA 1FNIA 3OY5U 2ZGJA 3TK6A 2ODPA 5CMXH 3ZVBA 3U1JB 3L3TA 1GDUA 4NA9H 5AFZH 4TPIZ 1C5WB 1C5PA 3ZZBA 4AB8A 1HIAB 4ISLA 1C1OA 4O9VA 1IQIA 6ESTA 1FONA 1V2KT 3P95A 1ARBA 4JMYA 4I8HA 1V2TT 3UUZA 1TX6A 1O2WA 1V2UT 3VB7A 2PKAA 1LVOA 2W7UA 5HM9A 1RJXB 2WPIS 2ZPRA 5FPSA 1HUTH 3UPEA 1GJ7B 4MDSA 1QL8A 1ORFA 1BCUH 4UONA 1HYLA 2I6QA 4X2XA 1F2SE 4FUHA 3FFGA 3SJOA 4AGJA 3RLWH 1O2KA 8KME2 4DIIH 2A5IA 1HJ9A 2AGEX 1EAXA 1O2MA 3PTNA 3TU7H 4NSVA 1AB9B 1GHBF 3SI3H 2BOHB 3K6YA 3SN8A 2O8TA 3B8JA 1RS0A 2AIQA 4SGBE 4D7FA 2Y82A 1GHVH 3GY2A 1V2NT 2RCEA 3MO6A 2O8UA 4R8TB 1D6WA 5HYOA 2XBYA 1QTFA 3SNDA 1E37B 3ZZAA 5J4QA 3S9AA 5GCHF 3MU0A 1TX8A 3BSQA 2ZU3A 2FP7B 4IC6A 4UFGH 1XUHA 1HNEE 1UTMA 3VPKA 1HDTH 2AMDA 2V6NA 3F6UH 1BRUP 4MNWA 1HB0B 3GCHC 2ZPQA 2Z94A 1C4U2 1TGSZ 1O5FH 2TGAA 1AU8A 3A8BA 2BX4A 4FVBA 3CS7A 1ZPCA 1W10U 1INCA 4U2WA 1TRYA 1VGCB 1F0UA 1VITF 1D6RA 3IG6B 1YC0A 2GGVB 1O5GH 4DJZB 2JH0D 2F9UA 1WTHD 1C5RA 5T6GA 4NFEA 4GPGA 4F4OC 1QFKH 1C4V2 1UCYH 4YM9A 1AUJA 3ZVEA 5IYTA 1GVZA 4CHAC 2P16A 1TBZH 3P70B 3M3TA 2CN0H 1DITH 2JH5D 3EQ0H 4E06H 3STJA 1O2JA 4ABBA 2ZFQH 2QY0B 4CRGA 3LGIA 1Y3UA 9LPRA 4NA8A 1XX9A 3UQVA 1EAIA 4FU9A 1EZSC 3GDSA 4X8VH 3ZZ5A 4A5TS 2BM2A 1THSH 1XVMA 1GHYH 1HGTH 1ZZZA 2A5KA 4ISNA 2XBWA 3U8RH 1K22H 4FUFA 1K21H 4IGDA 5ABWA 4I8JA 2W3IA 1VR1H 3C1KA 4O03A 4Y0ZE 4Y8XA 2ZPSA 2PTCE 1GJ4H 1XMNB 3EAJA 4MPWA 1TNGA 2ZFSA 3K6ZA 5GPIB 1HFDA 4B2AA 1ELDE 3DA9B 5DO4H 4I7YH 1SOTA 4AZ2B 1GI3A 1DY8A 4Y11E 1GJDB 1AGJA 2AGGX 2QYIA 4UD9H 1GDQA 3GY8A 1DPOA 2VJ1A 3S9CA 3MU5A 2SNVA 1SLXB 5DJ7A 4JYTA 2H9HA 2FI3E 2PHBA 1OX1A 5E2OA 1B5GH 1GG6B 4DGJA 4Q7YA 3QGJA 3R0FA 5DP3A 1O38A 3SNBA 1W14U 3O8CA 3HKIB 1Z6JH 1QRWA 1ZGVA 2XCFA 1KIGH 2Y81A 3JZ1B 2C3SA 4IC5A 2WPJS 1S82A 2QCYA 2QF3A 1PYTC 1GMHF 4NIVA 5FX5A 1ANCA 3MI4A 4K1TA 4AFQA 1UCYE 3UTUH 5E0HA 1WQSA 1GBTA 1WBGB 1ESTA 1EUFA 2M5TA 3P17H 3ZV8A 1AMHA 2QN5T 4X6NA 1GBBA 3DD2H 1XUIA 4ZH8A 1O5AB 1GI0A 1TWXB 2ZDKA 4UEHH 1F0SA 3MH6A 2WYJA 3MWIU 2XBXA 5EU8A 4A7IB 1C1SA 2YNBA 1C2IA 2SGAA 1GBEA 5DP4A 1KY9A 2A0QB 3BTTE 1SR5C 4NIYA 4O97A 1TB6H 4TYDA 1IQLA 4Y8ZA 1EXFA 3GYMA 4E7RG 4BTIB 4YLUA 3A84A 1DVAH 3F9FA 4RN6A 3L6PA 1BMLA 3U8OH 1YPKH 1QHRB 3M7UA 4ISIH 1MKWK 2HNTE 3AVZA 1W11U 1L4DA 1ZHMA 2VIQA 2FLRH 4YESB 4ZAEA 1SVPA 5A0AE 1ETTH 3MNBA 1V2RT 5PTPA 2FEQH 5JBCS 1LHCH 2A31A 4Y7AA 3QK1A 3MH5A 4BAKB 1DWBH 3GCNA 2A7JA 1EPTC 3LC5A 1SLWB 1H1BA 3HK3B 2ZCLP 4CRBA 2Q6DA 3PYHA 3SV6A 1BITA 1NRSH 1GI2A 3MFJA 3P8FA 2DE8A 4ABJA 1GMHG 2AEIH 3VEQB 1GI1A 2ZKSA 3RXIA 1O5CB 1G9IE 4HI3A 5DGJA 3NUMA 2EEKA 1T8LA 2H9EH 1BJVA 1CHGA 1NC6A 1AZZA 1HAXB 4Z6AH 1T4UH 3RMMH 4X6MA 2CF9H 1O3LA 3EA8A 5GWZA 1TFXA 3P92A 1C5YB 1O3HA 5C1UA 1W12U 2BQ7B 2ZU4A 4IN1A 5B6OA 2RA3A 4ZKRU 1MBQA 3UNSA 1QJ1B 4DT7B 5SGAE 1ELCA 3CS0A 3AW1A 3E3TA 1QA0A 3BF6H 3BTQE 3IITA 2HALA 1YBWA 5CE1A 3RM0H 2B7DH 1LMWB 2Z7FE 3TJVA 2VIVA 2H9TH 1C2EA 1BTUA 1MQ6A 1AD8H 4XBCA 4UFDH 3KIDU 1SGDE 3PMJA 2FOEA 2ZC9H 3P8NA 4FUBA 3M3SA 3F9HA 2FPZA 2A7CA 4YOGA 1O5BB 2BLWA 3FP6E 1CSOE 1FAXA 4GHQA 4WXIA 1P2KA 1SLUB 3ZV9A 3QDZB 2FS9A 4BANB 1BTHH 5JYIA 3P6ZB 1F5LA 1HAVA 2BD3A 2PUQH 1AVWA 1UVUH 1ZRBA 1QJ6B 1AFEH 5A8ZA 1N6XA 1Q3XA 2NU3E 1GJ5H 1C1WH 2ZQ2A 5LPFA 3LGYA 4A92A 2V35A 2Y6TA 4ABGA 3BTDE 1BIOA 2FESH 2V0BA 2ZCKP 3LKWA 1DE7H 3AW0A 3TK9A 1K1NA 3VGCC 4MPXA 1EATA 1YPJH 3T29A 1L1NA 3PO1B 1MAXA 1PQ8A 1BT7A 5CHAC 3MYWA 3IWMA 4LK4A 3SZNA 1AO5A 1BRAA 1SHHB 5J4SA 1OWEA 1DOJA 4I31A 3KQBA 2Z9LA 2QXHA 1JIRA 1SGEE 1HJ8A 1NZQH 2D26C 4B73A 1T4VH 1RFNA 1MBMA 1EOJA 2ULLA 4OS6A 2DUCA 1NFUA 2XW9A 1GBJA 2FDAA 2G00A 3RXTA 3FZDA 1LVBA 4ZXYH 1SGYE 2QXGA 4OS4A 1A0JA 3A82A 1ZSJA 2C8XB 1F5KU 1RTKA 1N8OB 1GBDA 1Q2WA 1VCWA 3UR6A 1LHEH 1HAHH 5AVDA 4NSYA 1QURH 2WPHS 2TIOA 4IN2A 2ZHQH 1K2I1 4X1SU 2ZGHA 1O3CA 2BD7A 1GL1A 3MO9A 1C4Y2 1ETSH 1QBVH 3A7WA 1A5HA 1ELVA 4CR5A 2Z3EA 4PROA 3UWIA 1YCPK 5FCKA 3RXGA 2PSXA 3VB3A 1E0FD 2CXVA 2ESTE 3ZYDA 2ALPA 4AB9A 1ZPZA 2ZZUH 3QUMP 1K1LA 2CHAC 4HZHA 3K65B 1DLKB 2D8WA 4KP0A 2UUYA 2QIQA 3M37A 5EODA 1O2GH 4A6LA 1C2KA 3FP7E 2O8MA 3SUDA 2ZDLA 1G3DA 3FVFB 2J92A 5DP7A 3Q00A 3S9BA 3E1XB 3E90B 3A85A 3MHWU 4AG2A 3F1SB 2IN2A 1O2LA 2VWLA 3NWUA 1B0FA 1YM0A 4JZEH 1DSTA 1MTNB 4VGCB 4YT6H 5DG6A 1O2ZA 1S84A 2OQUA 4X6PA 1TAWA 1DWDH 2ZA5A 4GHTA 1BQYA 2BZAA 1G32B 1SB1H 5EXMA 3RXQA 5FAHA 1G3CA 2ANKH 3VB4A 3SHAH 1AHTH 1L1JA 2B0FA 4AYVB 1P3CA 1SBWA 1QB9A 3MNSA 3ELAH 4Q7XA 3LONA 4FVDA 2D2DA 2XBVA 2ZECA 5EXLA 7KMEH 1GMDF 2VWOA 1E34B 1DANH 1O2TA 2VNTA 2PWXA 1BRBE 1DY9A 1HAIH 4WMDA 3LH1A 1CA0C 3D65E 1BMNH 1RTLA 3RM2H 2VGCB 1AFQB 2OQ5A 3NK8A 3EA7A 2FTMA 1OXGA 3M36A 1GDNA 4ABIA 3GY7A 2BYAX 3SOSA 1C1QA 1GI7B 4UFEH 1Y5BT 1C5LH 2WPKS 4XE4A 1FAKH 3TNTA 4B76A 4A1TA 3T2NA 3RU4E 3PMHB 3ZZ6A 1UJ1A 1S81A 3A83A 1T8NA 5H4IB 3LDXH 1GCDA 4NWLA 2A1DB 1O3OA 3HKJB 1WQVH 4NIWA 5GDSH 4ESTE 4UDWH 4KTUA 1FV9A 1VCPA 3RC4A 5I25A 3DHKH 1AY6H 1O2XA 5E0JA 1ZYOA 1QCPA 1PQAA 1GI5A 3NKKA 1NS3A 1YPGH 1IOEA 1O2VA 1XUKA 1YCPH 5TCAA 4XOJA 2CJIA 5LPEA 3RU4T 1CT0E 1UCYK 2RA0A 1O30A 1TBRH 2HWLB 3KQDA 5JPMH 1A1RA 5LPRA 1LKBA 2F9NA 2TBSA 3U69H 3D23A 1AVXA 5L6NH 5FCRA 2BLVA 1EAUA 1K1IA 4AYYB 1T32A 1OYTH 2UWLA 2GCTC 1MCVA 4CRAA 2JH6D 4KGAA 1C5MD 2BDIA 1CU1A 3ATIA 2G81E 1GHAF 1PPCE 3EE0B 3M5MA 2BDCA 4Y76A 4MQAA 1UK2A 4FU7A 1F5RA 2GMTC 3TJOA 2BTCE 1CO7E 2C93B 2FX4A 2ZP0H 2UWOA 4FUDA 3S7HB 1SL3A 1KYNA 2VVUA 4TY6A 1GVLA 2BDYA 3W95A 2FODA 1RIWC 1H9LB 5AHGH 1VJ9U 1ZTKA 4AORA 3KEEA 2FMJA 1EZQA 1HRTH 2YOLA 4FXGH 2CGAA 2PLXA 1DWCH 3E6PH 2FIRH 2ODYB 2XCNA 4AG1A 1AI8H 3HATH 2BD5A 2ANWA 2R3UA 1H9IE 2BLQA 1DICA 1QQ4A 3Q76A 2ZDAH 4MG3A 2FZZA 1AWFH 1DM4B 4THNH 1FIZA 1GBAA 1UVPA 5TJXA 1G30B 4GCHF 4AN7A 1TE0A 3SORA 1ACBE 5E0GA 3RMOH 2C4FH 1IQHA 2H5DA 1GCTB 3TGKE 1YLDA 3TJUA 5T3HA 4I32A 1FXYA 1ZPBA 2WUBA 3QTOH 2UUKB 1ELFA 4KTCA 2GZ8A 3R3GB 3SO3A 4X6OA 2OCVB 2H6MA 1TABE 5C3NA 3RXCA 1T8OA 5F8TA 1LKAA 1BRCE 1HV7A 1EB2A 3QGNB 1VZQH 1FN8A 2BY9X 3OSYA 5BPEA 6GCHG 3A7ZA 2A4GA 4LZ4B 7LPRA 2ZQ1A 1TMBH 1Y3VA 5EPYA 4ABAA 1A46H 4HGCA 1GGDB 1GHAG 4X2YA 4CH2B 1WU1A 2FOCA 1D4PB 1W7GH 2BLOA 1Z8GA 3T25A 2XC4A 1GHZA 2FOGA 4OGXA 1KTSB 1TBQH 1YCPM 1A5IA 4D8NA 1HAOH 4Z0KA 7ESTE 4Q2KA 1DXWA 2A7HA 4WXVA 3S69A 3SUGA 2G5NA 4B1TA 1Z8IB 3A86A 1BMAA 1HAVB 1FY4A 2Y5HA 3FAOA 4CREA 2ZNKH 3BV9B 3KCGH 2A2QH 2SFAA 1TONA 3SU1A 4K5ZA 1DUAA 1UTOA 1Z8RA 1VCQA 4I33A 4X1NU 1W3CA 1C2FA 2UWPA 3VXEH 2J38A 1OSSA 1P0SH 5C1XA 2ZWLH 4GCHG 1O3FA 2XWAA 3MNCA 5BRRE 5F6MA 1DX5M 1TX7A 1N1LA 3DT0H