1QGFA

Porcine pancreatic elastase complexed with (3r, 4s)n-para-toluenesulphonyl-3-ethyl-4-(carboxylic acid)pyrrolidin-2-one
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELASTASE
publication title Mechanistic insights into the inhibition of serine proteases by monocyclic lactams.
pubmed doi rcsb
molecule tags Hydrolase
total genus 58
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1999-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qgfA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qgfA01
3LH3A 3PO1B 5AFZH 2HNTF 1OWIA 2ZP0H 1ETSH 4SGAE 4CR5A 4IW4E 2FIRH 1O3LA 1CBWC 1FY5A 1S6HA 2XCNA 1OOKB 4ZKOU 1YCPK 3IG6B 1FJSA 1TRYA 3MO3A 1QIXB 4RN6A 1V2RT 1ZGVA 2VJ1A 1AGJA 1DPOA 2B0FA 2ZDNA 4TWYA 3ZZ3A 1BJVA 2ZDLA 3TK9A 3UQOA 2RG3A 2OBOA 3DUXH 1O2ZA 1A0LA 3SUGA 4BTIB 4IC5A 2EC9H 3VB3A 2PKSC 5E2OA 3SU5A 3VGCC 1TE0A 2R2WU 1DY8A 2TRMA 2KAIB 1GBFA 1NT1A 1ZHMA 2W3KA 1NC6A 1OP0A 2D26C 2FOGA 3SGAE 3FZDA 1KXBA 5L6NH 1QB6A 1OYQA 3RXUA 1FPCH 1ESAA 3ITIA 1F5KU 2D1JA 3U8TH 1THPB 5JBAS 7ESTE 2V3HH 2WPKS 2Y81A 1TONA 2W5EA 2H5CA 3I77A 1YPJH 1QY6A 1P04A 1W12U 4HFPB 3U69H 3SU6A 4MPUA 1GHBG 1EZQA 4MDSA 2XYAA 1D6RA 3M5NA 1CT0E 1SLXB 2WPJS 1LO6A 1TBQH 3GCTF 3BEFB 2ZHQH 1SGTA 1C2GA 3MU5A 4IMZA 4ABFA 3BTWE 1AWFH 1SGCA 3RXOA 1P06A 3GY4A 4HZHA 4J1YA 4B75A 1TGSZ 4GLYA 2Y7ZA 1HAYB 2A5IA 4FUFA 1PJPA 3Q77A 1UTNA 3B9FH 4VGCB 5GDSH 3TK6A 2BVRH 2PWXA 4FUHA 4K69A 1C1TA 2SGPE 3RMMH 4AX9H 2PTNA 2Y7XA 4X6PA 5LGOA 1C5ZB 2H2ZA 1GBLA 1GCTB 2FMJA 1DLKB 3E0NB 1QBVH 1W7XH 2ZCHP 1AVGH 2A45B 3M37A 1GMCF 1P2JA 4TWWA 1C9TA 4K60A 1QCPA 1ELGA 1GVZA 1ELDE 1TMUH 1E36B 2Z9KA 3ENSB 1O3IA 3ZZCA 5IDKA 5G4BA 1J9CH 3GCHC 2UUJB 2XXLA 4AGJA 5F6MA 5HM9A 4ABJA 2VVCA 4YT6H 4CBOA 1FUJA 3SORA 5A0AE 4AG2A 1QA0A 1H9HE 1QRZA 1GGDB 2ZU2A 3E90B 4AB8A 2Z7FE 3M61U 3SGQE 1LKAA 1XVOA 3ZYDA 3ZZ7A 2VWOA 1DX5M 3ZZ5A 1OWJA 3PO1C 1MTNC 4JK6A 1BRBE 2FI3E 5C67A 1LHFH 2P8OC 3ZV8A 4MNXA 2WYJA 4BANB 2BLQA 6CHAC 4CRGA 3MNXA 2CHAC 3LJOA 2OINA 1GL0E 2R0KA 3DA9B 2PR3A 1AVWA 5ESBA 1O5EH 1DANH 2G81E 2OC1A 1TX6A 3KQDA 4ABIA 2OC0A 1CHGA 1HAOH 2Z9IA 2BQ6B 4BNRA 2FYQA 4CRFA 1C5QA 4O9VA 5C1XA 2QF3A 1EZXC 3BG4B 3MNBA 2NU1E 3EGKH 4NA9H 1K9OE 2Z9GA 1NO9H 1KSNA 1KXDA 1MU8B 4Q2KA 1JMOH 3SJIA 4IC6A 2G4TA 3M5OA 1YCPM 2G5NA 2AERH 1C5MD 1P0SH 2FYRA 4AYYB 1MU6B 3SUDA 4OS2A 1QJ6B 1LVMA 1MAYA 3GY3A 3A84A 1C1OA 3KHVA 3DFJA 3P8FA 4FU8A 3I29A 1AMHA 4ZKRU 4ABBA 1F0RA 3ATWA 4UFDH 1TWXB 4JZDH 4I32A 5GPIB 1P2QA 1UTMA 2ZTYA 1T32A 2XWBI 4K1SA 1ID5H 1JBUH 3E6PH 3QWCH 1IQJA 1PPHE 3NUMA 1GVLA 1BTXA 1O2UA 3GYLB 1MUEB 5A0CA 2XC4A 1W0YH 1ZTKA 2ZU3A 3SHCH 1ANDA 1MQ6A 1SMFE 1T7CA 1AWHB 2A7HA 1C5VA 3PB1E 2W26A 5ESTE 1WV7H 1IQFA 4Y6DA 1C5OH 1Y59T 1J16A 1UVUH 3ZZ6A 1UTOA 1FN8A 2Y6TA 3GICB 3D62A 1SHHB 4VGCC 4K1TA 4NWLA 5L2ZH 2W3IA 1GCTC 2ZU5A 3OYPA 3Q3KA 2R3YA 4NSVA 2ZO3H 1EJNA 3V12A 6GCHG 1AU8A 5EXMA 2F9BH 3RXJA 1NTPA 1VGCB 4NCYA 4XBCA 2PUXB 3LPRA 1EZSC 1QL7A 1NU9A 2FESH 3BIVH 1D9IA 3EA7A 4INLA 1D6WA 3RMLH 1C4Y2 3UWJH 4ESTE 1C5SA 1G30B 2TGDA 2Z9JA 5JBTA 4IN2A 3FFGA 1NFUA 4X6MA 1Z6JH 1K22H 2FDAA 2PGBB 3V0XA 2O8MA 6LPRA 1OP8A 1L4DA 4ZKSU 3RU4D 2ZPRA 1BTWA 4OS7A 3SHAH 1D3PB 3S7HB 1PFXC 3TU7H 3BTDE 1FY8E 3P6ZB 3ZVDA 1C2IA 4E06H 1O2GH 1YF4A 3SW2B 2GDEH 2J2UA 2A4QA 4IBLH 1UK4A 4Y8YA 3LGYA 4GHQA 1GJCB 1UTPA 2SGDE 3MTYA 2P3TB 1V2MT 4X8SH 3CP7A 1E0FD 5TCCA 2DUCA 1OWDA 2NU2E 1WTHD 1P02A 1IHTH 1QBNA 1RRKA 4FUCA 2FX6A 1RTLA 4WH8A 1A4WH 2O8UA 1GHWH 4AZ2B 3BG8A 4WWYA 1F5RA 5J4SA 4LXBH 1NS3A 4MVNA 4A1VA 1OYTH 1T8LA 1DT2A 3DHKH 5BRRE 2A4OA 2TBSA 1S5SA 1YPLH 1P2NA 1HAVB 3BG4C 3ZVEA 1LVBA 3A80A 2O9QA 3RM2H 1AD8H 2TPIZ 2ZEBA 1PYTD 1DUAA 1JXPA 2BDIA 3VFEA 3O8DA 3KGPA 1LCYA 2H1UA 1GMHF 3UREA 1O2NA 1A2CH 4R0IA 5A09A 4BXWA 2GTBA 1FXYA 2KAIA 1ZHPA 1P2KA 4DG4A 1P9UA 1W13U 1P8VC 1W10U 2H5DA 3LOXA 4LK4A 2BLVA 3SUFA 3A8DA 1O2KA 1K1JA 1GI4A 3LH1A 2ZCKP 3UY9A 1GHAF 3A8AA 4E7RG 2GV7A 2NU3E 1LHGH 1FZZA 1V2QT 2ZHEH 2GKVE 1Y3XA 2GV6A 4YOGA 5LH8A 5EGMA 2ZFSA 1B0EA 1ABIH 1Z7KA 1TNIA 1P3CA 3LU9B 2HPQH 4XBBA 3RC4A 1F92A 2F9PA 1KLTA 3RXCA 5DP4A 3QTVH 4MPWA 4X2YA 2B7DH 2C90B 1ZSLA 3UR9A 3ZYEA 3AW1A 4YM9A 5E0GA 1ESTA 1ZJKA 4Y8ZA 3BEIB 1HYLA 1ZPBA 3SU0A 3OY5U 1C1PA 1BHXF 5C5OA 4X6OA 2C8ZB 3BTKE 5A0BA 2V6NA 1Z6EA 2YNBA 4NSYA 7KMEH 2XBWA 2R9PA 2ANWA 4K8YA 1L1NA 1EX3A 2VH0A 3BTTE 2BX4A 1C1MA 1O2WA 1CGIE 1YGCH 2BVSH 2AGGX 3GCTG 3K6YA 3NZIA 1F7ZA 1EB2A 2CMYA 2WINI 1K28D 1LHEH 3QUMP 3GY2A 4B74A 1KDQB 1O2LA 1CU1A 4DY7B 1SFIA 4Y79A 1GI2A 1P2IA 2QN5T 4I8JA 5F8XA 2AIPA 2EI8A 4CRBA 1Y3UA 1O5FH 5HGGA 3HGNA 3E0PB 1FV9A 1DVAH 1NN6A 1EPTC 1E35B 1ARCA 1UO6A 2Y5GA 2BMGB 4NIWA 1SGRE 2ZGHA 2Z3CA 3FVFB 3LGUA 1BZXE 3STJA 4DGJA 1SLVB 3F6UH 1D3TB 2P3FH 3RXQA 2ILNA 3L33A 1UK3A 3QGNB 4OS4A 4D9RA 1SG8B 1GMCG 4FXGH 3K9XB 1ELFA 3TJUA 1JRSA 2UWPA 3RXKA 2A7CA 4ZUHA 3A82A 1G2LA 1W8BH 1C1VH 3BTHE 1ZMJA 5FPSA 2IJOB 3S7KB 2FOHA 3RP2A 1G37A 5DP7A 2XBXA 4I8HA 1N1LA 2BLOA 1SGIB 2BY7X 1DWBH 3MWIU 1H4WA 3E8LA 3GCNA 3BSQA 2QA9E 2J38A 3LGTA 7GCHF 1HIAA 3K65B 4UONA 3K2UA 1RS0A 1SGPE 1TB6H 2I6SA 3DT0H 3NCLA 5DKMA 1QQ4A 1O2YA 1CGJE 4JZIA 5EQQA 1JIRA 2LPRA 1MZDA 2ANYA 3D23A 1MKXK 5EQRA 1ELVA 1PPEE 4JZEH 1VCWA 1T8OA 1GI1A 2VWLA 3PMJA 1YPHC 4YTAA 1DXPA 3EYDA 1M9UA 3ZZ4A 1W3CA 3A7XA 9LPRA 1GHXH 4A92A 1QFKH 2Z94A 1HAPH 4NZQA 2SNVA 3A87A 1GBEA 2BDCA 1P12E 4FU9A 4ISIH 1HXFH 1O38A 5K7RA 2HVXA 4B2CA 2XBVA 3UQVA 3BF6H 4R8TB 1TFXA 3K6ZA 1T8MA 5C5NA 2GMTB 4HI3A 1YKTA 2AIQA 3MH6A 4Y10E 3NWUA 1IQNA 4JYTA 3RC6A 3FP8E 1G9IE 5JDUB 4D9QA 3QTOH 8KME2 5JBCS 1SGEE 2BDAA 5I46H 1TQ0B 2VVUA 4YT7H 3SU1A 3TH3H 3M7QA 3AAVA 1A1RA 1BRUP 4MG3A 1P10A 1A3BH 2OC7A 1O33A 1P57B 4OGYA 1Y5AT 3BTFE 1XUFA 1IQGA 3JZ2B 1QRXA 1GBCA 2YOLA 5DG6A 1SVPA 1O2XA 3RU4E 2ZHWH 1GVKB 2BOHB 2FS8A 2OBQA 1W7GH 1SGFA 3EE0B 4GVUA 2EA3A 1O5DH 1IAUA 1UCYE 2ODQA 1XM1A 3E1XB 1NESE 1QB1A 2GCTB 1OWKA 2GCHF 2FS9A 5HYOA 1BHXB 1DWEH 1QA7A 4A1TA 1ABJH 3S9CA 1GL1A 3RC5A 3UTUH 1NRSH 2ZTXA 2FEQH 3Q76A 5FPTA 4NFEA 3LONA 3OX7U 1BTYA 1ELTA 2TIOA 5FXLA 3M35A 1HXEH 2C93B 3RXFA 3VB6A 1WU1A 4MNYA 4OGXA 2PKAB 1O2SA 2QIQA 2UUYA 5H4IB 1EPTA 1AUJA 4UD9H 1HAXB 4BAKB 2CF8H 3QDZB 1SOTA 3VB7A 1O3GA 1XUKA 5DO4H 2ZFQH 1FIWA 2Q6DA 1N6XA 3T26A 4K8BA 1SC8U 3M7TA 2F83A 1OX1A 1DOJA 1XKBC 1LHDH 4NIYA 3GISB 1JOUB 1RXPA 1INCA 1NFYA 1GBDA 1BMNH 5GXPA 3Q00A 1O32A 1ANEA 3A88A 4Y71A 1V2JT 1ZTJA 3O8BA 4YZUA 3A7VA 1DWCH 1G32B 2W7UA 1J8AA 1CHOF 1EAUA 5DPAA 1TPOA 3PM3A 2QYIA 1YLCA 1HAVA 2EI6A 1MTSA 2QAAA 4NG9H 1OKXA 2SGAA 3BTME 3IWMA 1CA0C 1TGTA 2P95A 1QTFA 4OS1A 1IQKA 2QXJA 4X6NA 1E38B 1T4UH 1O3NA 2Q1JA 2SNWA 3F68H 2WUCA 3TNTA 1OXGA 1XUIA 1Y3VA 3P8NA 1AN1E 3RXHA 1CE5A 2GMTC 4UFFH 2ZIQH 5EW2H 1YPKH 1NU7B 1EP5A 1FONA 1HAGE 1C5TA 1SLUB 3VB4A 5DP8A 2A2XH 3RXGA 5AVDA 1YBWA 1MBMA 1GMHG 1CT2E 2B5TB 5T6FA 5LPFA 5FPYA 2ZG0H 1ZTLA 4OS6A 3RUOA 1TRNA 2FOAA 1XUGA 1GI5A 1UTLM 1ZMLA 4BAOB 2XWAA 1EP6A 3GY7A 3SV2H 1HFDA 1GI6A 1GG6B 1ZPCA 4YLUA 3ATKA 4A7IB 1O2HA 2QGRA 2VWNA 3T5FH 2WYGA 1DICA 3OSYA 3SO3A 3ATLA 5FX6A 4FUIA 2BB4A 1EXFA 1GHAG 4AFUA 1RTKA 4B71A 4WMFA 1UCYK 4MPVA 2EI7A 2GT7A 1LQEA 1BDAA 3LGVA 1SLWB 3V13A 1QQUA 5GCHF 2WV4A 3VEQB 1QJ1B 3QN7A 3SNCA 4GPGA 3P17H 3TGJE 4XSKU 1SGDE 2JETB 4H42U 1ZZZA 1V2WT 1V3XA 1UTJA 2FP7B 1UTKA 3BTGE 1J14A 1IQHA 3BTEE 3FANA 4H4FA 1MQ5A 4MTBA 2AGEX 2BD2A 4RKOB 5CE1A 2OC8A 2VIPA 1KDQA 1WAYB 1O3JA 2ZHDA 2OLGA 4NA8A 3LJJA 1TOMH 1LTOA 4WF8A 1HNEE 3M3TA 2QC2A 3LGIA 4XE4A 2W7SA 4X2VA 2M5TA 4K2YA 4U30A 1YCPH 1ANCA 1EAIA 1AE5A 1AUTC 4X8TH 2VGCB 2ZFRH 1T8NA 1ELBA 1RFNA 1X7AC 1FI8A 2PUQH 1WTGH 5IYTA 1TA6A 1AFEH 4FVBA 1GBAA 1V6DA 3QGJA 3SNAA 1GMDF 1DUEA 2FO9A 5F8TA 2B8OH 5FCKA 1MKWK 4NIVA 2A5AA 1MMJN 4B2AA 3QK1A 3ZVCA 1THSH 1HJAB 2FTLE 1V2UT 1P09A 4AORA 1S0RA 1V2TT 1GDNA 3R3GB 3H7OA 4UFEH 1K2I1 1YPHE 4UE7H 2V0BA 1LDTT 1HPGA 3OTJE 1UHBB 1WYKA 2ANKH 3N7OA 1LPZB 4GHTA 3SJ9A 3KNXA 1Z1JA 3A89A 2ALVA 1DITH 4BTTB 2FLBH 3PMHB 1IQIA 3KN2A 1HBTH 1KLJH 3RXEA 2HGTH 5E0JA 2BM2A 2GP9B 3U1JB 3A81A 1K1MA 3D49H 3VB5A 3EDXB 2A5KA 7GCHG 1P01A 4NIXA 3PWCA 2ZA5A 1TBZH 2PV9B 1EUFA 1ZRKA 1HB0B 4ZAEA 1FAXA 5SGAE 2DE8A 1QGFA 1TGBA 5L2YH 5FCRA 3KL6A 3CENA 1ETRH 1TNHA 3ATMA 1VCQA 4BAHB 4ZMAH 4AG1A 5HXFA 1BRCE 4M7GA 5C3NA 1O5GH 1IOEA 4KTCA 4JMYA 2ZECA 1GG6C 2H9EH 3DD2H 4AFSA 1TPAE 1O3MA 1UK2A 1RD3B 2P59A 1PPFE 2G52A 1TNKA 1QR3E 3RXIA 3I78A 1O39A 1GBJA 2ZU1A 3NK8A 2J95A 1GGDC 1GJ8B 2BD9A 1F0TA 2G5VA 1K1LA 4KGAA 3H5CB 1D3QB 2A7JA 1L1JA 2BD7A 2TGAA 1CVWH 2HLCA 3SV8A 2JETC 4IN1A 1DY9A 2HALA 5C1YA 2PFEA 4ISHH 1XX9A 5EG4A 3MFJA 1SGQE 1KLIH 1O3OA 2G55A 1TOCB 3SV6A 1HAHH 2XRCA 5EODA 3A7WA 2VIOA 1GBHA 2PSXA 1Q2WA 2DE9A 1UCYH 3PLBA 1IQMA 3RXDA 1NROH 3TJOA 2HNTC 5J4QA 3F9HA 1AO5A 4IMQA 3S9AA 1GBTA 1LVOA 2VU8E 3A7ZA 5CMXH 1UJ1A 3ZV9A 1C5NH 2BQ7B 3PYHA 1SGNE 2ODYB 1C2FA 3F9FA 1GJBB 1Q3XA 1J17T 1SFQB 2VGCC 2GCHG 1A3EH 4ABEA 1EQ9A 2VIWA 3A8BA 2NU0E 3AAUA 1ZR0A 3M36A 4Z0KA 1WBGB 2FM2A 1TGNA 8GCHF 3T25A 2BZ6H 4AYVB 1Q31A 1DSTA 4F49A 1SQTA 3U1IB 5EXLA 1LMWB 4MLFB 2XBYA 3SV9A 2QY0B 2ZF0H 3T2NA 3W94A 4YO9A 1SPJA 1Z8RA 4GCHF 4BAQB 1TPPA 1A5GH 1HV7A 2OQ5A 4ABGA 3MHWU 6ESTA 1HLTH 3HGPA 2UUKB 1H9IE 3DFLA 3SBKA 1TX8A 2RDLA 1GJDB 2EEKA 5DP6A 3SV7A 1MH0A 3LKWA 1AHTH 1GDUA 1SBWA 5EQSA 1VJ9U 3KQBA 5JPMH 4K1EA 4B2BA 1MTWA 4XOJA 1YM0A 1NM6A 1O3FA 1P9SA 3MMGA 2H6MA 3SZNA 1BBRK 1KY9A 1A0JA 4ZHMU 3UOUA 2VVVA 2V35A 1F5LA 3UNQA 2ZQ2A 1CHOG 1O2OA 1VGCC 1MZAA 2CV3A 5GWZA 1ZOMA 1KTSB 2G8TA 3P92A 3TH4H 3URDA 2OD3B 4GUXA 4FUDA 1KTTB 3T29A 2Y80A 3CS0A 1S84A 1CA8B 1OP2A 1TALA 1MD7A 1UVOA 1AKSB 2P3UB 3ZZ9A 3RMOH 1FAKH 2O8TA 5GJ4B 1PPCE 3PLPA 1O2PA 1DXWA 4KTUA 1FLEE 1A46H 4Y7BA 4ZHAA 2PSYA 3L6PA 4NFFA 3A7TA 4O3TA 4X1NU 2Y5FA 1CT4E 1SI5H 3SGBE 3VXFH 2CGAA 5JB9S 3T62A 1T4VH 4NGAH 1GJAB 1DE7H 2ZC9H 2XW9A 3HK6B 4ISLA 2IN2A 2XTTB 3HKJB 1YPEH 2ZFPH 1ZLRA 3C1KA 5DJ7A 3AASA 1VCPA 1BTHH 1TX7A 4D76A 5PTPA 2AMDA 2ESTE 2THFB 2BY6X 1AE8H 4BOHA 4O97A 1BUIA 2C4FH 3F1SB 3FZZA 1ORFA 1ARBA 2ZFFH 1RJXB 2ANMH 2BDBA 3D65E 4WXIA 1LVYA 3SU3A 3A85A 1P2MA 5EXNA 1O3EA 3S69A 4ABDA 4FUJA 1Z1IA 1PQ7A 3MH5A 1HAZB 5AHGH 2JH5D 4Y76A 1C2MA 2GD4B 1S82A 1D4PB 3BEUA 3UFAA 1O2RA 5GCHG 4ZXYH 1DWDH 2BD8A 1F2SE 3TVJB 4DW2U 2R2MB 4DVAU 1OPHB 1QL8A 3KCGH 4DURA 4WMEA 5BPEA 3ZZAA 1NRPH 4LZ1H 4CREA 1AZ8A 2JH0D 3RXPA 2FZZA 1K1PA 1ELEE 1O5AB 3A7YA 2SGFE 2BY5X 1ESBA 1RIWB 1F0SA 1XXFA 1BMAA 8LPRA 1DS2E 2QV1A 4DIIH 2VB0A 2JH6D 5A8YA 1O0DH 1V2OT 3KEEA 1BOQA 1ETTH 4Y8XA 5FAHA 3RXLA 1Z8IB 2GT8A 3MO9A 5C2ZA 3LGWA 1MCTA 1O3PB 1P05A 2WPIS 2BXUH 5TCAA 1N6YA 2UWOA 1GHZA 2AYWA 2CN0H 3Q3YA 2RCEA 3SN8A 1G2MA 1VITH 5I25A 3UNSA 3UNRA 4DIHH 5DP5A 1GDQA 3TIUA 4IS5A 1O34A 3SJOA 2I6QA 1O5CB 3SI3H 3S0NA 2A32A 1TMTH 5AF9H 4FUGA 1HDTH 5B6OA 2Y5HA 3HATH 4X2WA 1SHYA 1V2PT 4YLQH 9ESTA 4D8NA 3FP7E 5DGJA 3HKIB 3SQHE 4A6LA 3WY8A 3CS7A 1W11U 3GCHB 1VR1H 2OUAA 1FDPA 1H1BA 2H9HA 2OCVB 1BMLA 3V3MA 4THNH 2ZFTA 1GJ9B 4O3UA 2XCFA 1DDJA 4Q7XA 1BMMH 4Y7AA 1TYNA 1P2OA 3GDVA 1EOLA 2GZ8A 3KIDU 3MYWA 4JYUH 1MTNB 1FPHH 3M7UA 3MNCA 2P8OB 1EZUC 3EA8A 3NXPA 3Q3XA 4O03A 4UDWH 1XKAC 3B23B 1GI7B 1O3BA 6CHAB 1XUJA 2FOCA 2CHAB 2HNTE 1NRQH 1BIOA 2FPZA 1SR5C 2C3SA 1P03A 4GSOA 1L2EA 1A5HA 2VWMA 5EOKA 1ZSKA 3F9GA 1QL9A 2SGEE 3KQCA 3SQEE 3PTNA 2Z9LA 3GOVB 3MI4A 3GY5A 5T6GA 3OY6U 2J94A 2STBE 4H6TA 3TK5A 2ZZUH 3B8JA 2SGQE 1TIOA 1BT7A 1Z71A 1DSUA 1FY4A 4WMDA 2O8WA 2GX4A 4Q7YA 7LPRA 2OXSA 1Y3YA 1PQ5A 4ZKNU 1G3CA 5LPEA 5FHTA 3GDSA 4JCNA 1UVSH 2G4UA 3UIRA 1Y8TA 3SI4H 1O2QA 2FI4E 3W95A 2BY9X 5EU8A 2BYAX 4B73A 2BTCE 1TLDA 4K5ZA 1XXDA 3R0FA 4WY3A 1YC0A 4Z6AH 5LPRA 1RIWC 2FI5E 1RGQA 1DM4B 1O2JA 5C1UA 1H8IH 3EQ0H 3PV4A 3QLPH 2BQWB 1AI8H 3LDXH 1HJ8A 3P95A 1S83A 2AMQA 3F9EA 1YLDA 1GI0A 3PMAB 2LNCA 4HTCH 2PHBA 2RA0A 1MKXH 1KYNA 1TA2A 3SJ8A 1IQLA 1KXCA 4MNWA 1GBBA 3RXVA 1SQOA 1A0HB 2XC5A 3C27B 3A86A 3GY8A 3LT3A 1B5GH 1C5WB 1E34B 1BA8B 1FN6A 3GDUA 3RXRA 1LQDB 2Q6GA 1SGYE 1C1RA 1V2NT 2QXGA 8GCHG 3T27A 4E05H 5AFYH 2YNAA 3LIWA 1S85A 1V2LT 2FOMB 2R0LA 5FBEA 5HM2A 1AB9B 3MNSA 1EJAA 2Q6FA 4Y0YE 2ZU4A 2OQUA 4GCHG 5A8ZA 2FOBA 1G3DA 3PROA 4X1QU 3TITA 3M3SA 2B9LA 2J4IA 4CRCA 1OS8A 2WPLS 4CHAB 1BJUA 1BITA 4D7FA 1QRWA 2WV5A 4X1PU 1GJ6A 1HJ9A 2GCTC 3PWBA 3QZQA 3H7TA 2Y82A 4H6SB 1K21H 4AGKA 4ZXXH 4KTSA 2K1QA 1PQ8A 2F9NA 4INHA 3FAOA 3A83A 1CQQA 1K1NA 1PPGE 1OWEA 1C5RA 1DFPA 5F8ZA 2F3CE 1NRRH 1MD8A 4ABHA 1QHRB 3L3TA 1BTUA 2QCYA 1Y3WA 1AKSA 4IGDA 5A8XA 4AFQA 2WPHS 1C5YB 1Z8JB 3ODFA 3MU4A 1TGCA 1C5PA 3SU2A 3RXMA 3U9AH 4CR9A 3KQEA 2ZGJA 2GGVB 1LHCH 1KXFA 3M5MA 1HCGA 1HIAB 1MTVA 1O36A 2RA3A 3EAJA 4RKJB 2XNIA 1UTQA 1GJ7B 2O8LA 2R3UA 1S0QA 3SJKA 1KIGH 1FNIA 3ZVFA 1C5UA 1C2LA 4ABAA 4ZHLU 4X0WU 1VITF 1G3EA 2A4RA 3ZVBA 1C5LH 3MU8A 3AW0A 1JWTA 2BZAA 2FXRA 1YPGH 4ZROA 2WUBA 2J34A 1LKBA 4E7NA 3RXAA 3RU4T 1O2MA 3LC5A 2BD4A 4BAMB 4FVDA 2VINA 1OSSA 2TGPZ 1B0FA 1F0UA 4LOYH 1TQ7B 1ZJDA 1O31A 4CBNA 1ZRBA 4XBDA 3VPKA 4I8GA 1HUTH 1O3CA 5F03A 1WQSA 1IHSH 3SNBA 1C2EA 2AGIX 2TGTA 1VJAU 1DLEA 1QBOA 1GHVH 2P93A 2GVFA 4NA7A 3MH7A 4WXVA 4WVPE 2H9TH 3GYMA 2OP9A 3E3TA 4B76A 1EASA 1OWHA 4U2WA 1N8OB 2PTCE 2ULLA 4DCDA 1O3AA 1WQVH 1O2TA 3JZ1B 1NFWA 3P70B 2P16A 4NZLA 4I7YH 2ZDMA 1BBRE 4U01A 1GWAA 2A31A 5E2PA 1AFQB 3AVZA 4X1SU 3V7TA 1C5XB 3UUZA 1EOJA 3SNDA 2A1DB 2PGQB 2D2DA 5T6DA 1GCDA 1J15A 1VZQH 4AB9A 1C2KA 5T3HA 4ZH8A 3SUEA 4JYVH 2FLRH 2F9OA 1ANBA 1BQYA 5E0HA 1PPBH 2QXHA 5GIBA 4UEHH 2BDYA 2BY8X 1TNLA 2ZTZA 4Y0ZE 3TPIZ 1AB9C 1O3KA 4YESB 1Z8GA 4X2XA 1O3HA 5FX5A 3A8CA 2GDDA 1NZQH 1HRTH 4CH8B 5TJXA 4MQAA 1EAWA 1O2VA 3STIA 3MOCA 2BVXH 1C1WH 4CHAC 3ATIA 2BOKA 5JYIA 3M5LA 3RXSA 2C8WB 2BD3A 3BIUH 1ZGIA 2QF0A 1EPTB 1TAWA 1YPMH 1A7SA 1PQAA 1AQ7A 4NWKA 1JRTA 2ZKSA 4SGBE 1L1GA 1GHBF 1TNGA 1GJ5H 1S6FA 1EKBB 2WPMS 1O3DA 4WJG2 1YP9A 2BX3A 2AFQB 2HPPH 4TY7A 1ZSJA 2F9UA 4B1TA 1EB1H 2ASUB 2XC0A 4A1XA 2ZHFH 1GHYH 4I8LA 2PKAA 4I31A 2ZDAH 5EW1H 3MH4A 1MBQA 2ZGXH 3NPSA 5DK1A 1AZZA 3ZVGA 3MU0A 2JKHA 2VIDA 1ZHRA 2IOTA 2V3OH 3QO6A 4K3JA 1PYTC 5DP3A 2UWLA 3IITA 5ABWA 1K1OA 4PROA 1C1UH 4ASHA 4Y11E 1C1NA 1BB0B 3TJNA 4J2YB 1HJAC 1UVTH 3HPTB 1GJ4H 2FWWA 3RLYH 1NPMA 2BD5A 3P8OA 4LZ4B 3ELAH 1SB1H 5K0HA 5JBBS 3TH2H 1QJ7B 1ZMNA 1HGTH 3QX5H 1ZPZA 2VH6A 1Y5BT 3TGKE 2BLWA 2PLXA 1FY1A 3PMBB 2VNTA 3NKKA 2G00A 2UUFB 1GI8B 1MKWH 1SQAA 3TLOA 1UMAH 3S9BA 3MU1A 4Q80A 4AN7A 3GY6A 1RTFB 2ZWLH 1QB9A 1MTUA 5A2MH 1TABE 1N8OC 2NWNA 2ZCLP 1C4V2 2HWLB 3ODDA 4BTUB 2BDHA 4WH6A 4I33A 1AFQC 4QT8C 1GBIA 1BRAA 4D7GA 3RLWH 2ZGBH 1O30A 3TJVA 1WUNH 2J9NA 3M3VA 3GCOA 3ZZBA 1CSOE 4DT7B 2C8XB 4KKDA 1NRNH 1EATA 5HMAA 1LPGB 2QXIA 3TNSA 3UWIA 2ZPSA 2AEIH 5L30H 4TPYA 4DJZB 3ZZ8A 1C9PA 2AH4X 4KELA 3SU4A 1BTPA 1C2JA 4X1RU 3RDZA 2OTVA 1SGFG 1GBKA 1XMNB 1WCZA 4FUEA 3ZZDA 4YOJA 4CRAA 1GI3A 3LC3A 5CHAB 1H8DH 2CXVA 1TRMA 1QURH 2PW8H 3FP6E 2Z3EA 1BTZA 1CBWB 2FTMA 4GAWA 2STAE 1V2VT 2ZPQA 4YOIA 3U8OH 3OU0A 3UR6A 4U32A 1JIMA 1ACBE 4INKA 2BXTH 1FMGA 1B7XB 1G36A 1XVMA 2C8YB 3BTQE 1GPZA 1EAXA 2AS9A 4TYDA 2D8WA 1Y5UT 2PKSB 1EJMA 1ZYOA 1UVPA 3VGCB 2ZQ1A 4MNVA 2ALPA 1W0ZU 4A5TS 2GZ9A 5JB8S 1TPSA 1O2IA 4AOQA 4MPXA 2GZ7A 4F4OC 1HAIH 2F9VA 2AMPA 4JZ1A 4UFGH 3RXBA 1XUHA 4Q7ZA 4KP0A 3EA9A 1CGHA 1CO7E 5C20A 5FBIA 1TMBH 2ZDKA 1MAXA 3UOPA 5ETXA 1WSSH 4X8UH 3P8GA 3T28A 3O8CA 1TBRH 1KXEA 3SOSA 6GCHF 1H9LB 2NU4E 2P94A 2FX4A 1BCUH 2SFAA 1SSXA 2ZNKH 1AIXH 4TPIZ 1NY22 3ZVAA 1C1SA 4XDEA 4CRDA 1NFXA 3MO6A 2HRVA 3E16B 4AFZA 1D3DB 1ELCA 1G3BA 1U6QA 1GBMA 1FIZA 1K1IA 2J92A 1CA0B 2VIQA 2ZI2H 3HK3B 2CF9H 4OS5A 4CH2B 1T31A 1LPKB 1C2DA 2Z6BD 1ELAA 2ODPA 1P11E 1W14U 2VIVA 1IQEA 2FODA 1PPZA 4BXSA 1UHBA 1FY3A 1GMDG 1S81A 1A61H 1SOZA 1VITG 2ZGCA 5DP9A 4XFQA 5EPYA 4X8VH 1L0ZA 3URCA 1A5IA 2A0QB 3PTBA 3UPEA 1P3EA 4TY6A 1THRH 3O8RA 1AY6H 1KXAA 1V2KT 5E8EH 2ZDVH 1O35A 3KF2A 2BHGA 3U98H 3E91A 8ESTE 1QNJA 4JK5A 2FOFA 2CJIA 1AVXA 1GI9B 3ESTA 3TGIE 1O37A 2A4GA 2A2QH 2G51A 1SL3A 3PLKA 1C1QA 3RMNH 4HGCA 2BDGA 1V2ST 4ISNA 4RSPA 1E37B 3RM0H 3U8RH 3QZRA 1BBRH 3RXTA 4JZFH 1MCVA 1C4U2 5EPNA 4FU7A 3VXEH 2Z3DA 4FUBA 2HOBA 2FOEA 3SNEA 2F91A 1FQ3A 1W2KH 3BV9B 4ISOA 4DOQA 3BN9A 3G01A 4I8KA 1O5BB 2IPHA 1C2HA 1YYY1 5CHAC 1L4ZA 1TNJA 1WOFA
chains in the Genus database with same CATH superfamily
3LH3A 3PO1B 5AFZH 2HNTF 1OWIA 2ZP0H 1ETSH 4SGAE 4CR5A 2KZ4A 4IW4E 2FIRH 1O3LA 3OEHD 1CBWC 1FY5A 1S6HA 2XCNA 1OOKB 4ZKOU 1YCPK 3IG6B 1FJSA 1TRYA 3MO3A 1QIXB 4RN6A 1V2RT 1ZGVA 2VJ1A 1AGJA 1DPOA 2B0FA 2ZDNA 4TWYA 3ZZ3A 1BJVA 2ZDLA 3TK9A 3UQOA 2RG3A 2OBOA 3DUXH 1O2ZA 1A0LA 3SUGA 2GJGA 4BTIB 4IC5A 2EC9H 3VB3A 2PKSC 5E2OA 3SU5A 3VGCC 1TE0A 2R2WU 1DY8A 2TRMA 2J98B 2KAIB 1GBFA 1NT1A 1ZHMA 2W3KA 1NC6A 1OP0A 2D26C 2FOGA 3SGAE 2HLDD 3FZDA 1KXBA 5L6NH 1QB6A 1OYQA 3RXUA 1FPCH 1ESAA 3EE7A 3ITIA 1F5KU 2D1JA 3U8TH 2L74A 1THPB 5JBAS 7ESTE 2V3HH 2WPKS 2RDEA 2Y81A 1TONA 1NBMD 2W5EA 2H5CA 3I77A 1YPJH 1QY6A 1P04A 1W12U 4HFPB 3U69H 3SU6A 4MPUA 1GHBG 1EZQA 1UW7A 4MDSA 5CDFE 2XYAA 1D6RA 3M5NA 1CT0E 1SLXB 2WPJS 1LO6A 1TBQH 5FL7D 3GCTF 3BEFB 2ZHQH 1SGTA 1C2GA 3MU5A 4IMZA 4ABFA 2WZQA 3BTWE 1AWFH 1SGCA 4FOUC 3RXOA 1P06A 3GY4A 5C94A 4HZHA 4J1YA 4B75A 1TGSZ 4GLYA 2Y7ZA 1HAYB 2A5IA 4FUFA 1PJPA 3Q77A 1UTNA 3B9FH 4VGCB 5GDSH 3TK6A 2BVRH 2PWXA 4FUHA 4K69A 1C1TA 2SGPE 3RMMH 4AX9H 2PTNA 2Y7XA 4X6PA 5LGOA 1C5ZB 2H2ZA 1GBLA 1GCTB 2FMJA 1DLKB 3E0NB 1QBVH 1W7XH 2ZCHP 1AVGH 3FOAA 2A45B 3M37A 1GMCF 1P2JA 4TWWA 1C9TA 4K60A 1QCPA 1ELGA 1GVZA 2M2AA 1ELDE 1TMUH 1E36B 2Z9KA 3ENSB 1O3IA 3ZZCA 5IDKA 5G4BA 1J9CH 3GCHC 2UUJB 2XXLA 4AGJA 5F6MA 5HM9A 4ABJA 2VVCA 4YT6H 4CBOA 1FUJA 1S6LA 1YY3A 3SORA 4ACAA 5A0AE 4AG2A 1QA0A 1H9HE 1QRZA 1GGDB 2ZU2A 3E90B 4AB8A 2Z7FE 3M61U 3SGQE 1LKAA 1XVOA 3ZYDA 3ZZ7A 2VWOA 1DX5M 3SZEA 3ZZ5A 1OWJA 3PO1C 3WWFA 1MTNC 4JK6A 1BRBE 2FI3E 5C67A 1LHFH 2P8OC 3ZIAD 3ZV8A 4MNXA 2WYJA 4BANB 2BLQA 2KCYA 6CHAC 4CRGA 3MNXA 2CHAC 3LJOA 2OINA 1GL0E 2R0KA 3DA9B 2PR3A 1AVWA 5ESBA 1SQRA 1O5EH 1DANH 2G81E 2OC1A 1KMHB 1TX6A 3KQDA 4ABIA 2OC0A 1CHGA 5KEDA 1HAOH 2Z9IA 2BQ6B 4BNRA 2FYQA 4CRFA 1C5QA 4O9VA 5C1XA 2QF3A 1EZXC 3BG4B 3MNBA 2NU1E 3EGKH 4NA9H 1K9OE 2Z9GA 1NO9H 1KSNA 1KXDA 1MU8B 4Q2KA 1JMOH 3SJIA 4IC6A 2G4TA 2IJD1 3M5OA 1YCPM 4P02A 2G5NA 2AERH 1C5MD 1P0SH 2FYRA 4AYYB 1MU6B 3SUDA 4OS2A 1QJ6B 1LVMA 1MAYA 3GY3A 3A84A 1C1OA 3KHVA 3DFJA 3P8FA 4FU8A 3I29A 1AMHA 4ZKRU 4ABBA 1F0RA 3ATWA 4UFDH 1TWXB 4JZDH 4I32A 5GPIB 1P2QA 1UTMA 2ZTYA 1T32A 2XWBI 4K1SA 1ID5H 1JBUH 3E6PH 3QWCH 1IQJA 1PPHE 3NUMA 2V3MA 1GVLA 1BTXA 1O2UA 3GYLB 1MUEB 3PV5A 5A0CA 2XC4A 1W0YH 1ZTKA 2ZU3A 3SHCH 1ANDA 1MQ6A 1SMFE 1T7CA 1AWHB 4F55A 2A7HA 1C5VA 3PB1E 2W26A 5ESTE 1WV7H 1IQFA 4Y6DA 1C5OH 1Y59T 1J16A 1UVUH 2WV9A 3ZZ6A 1UTOA 1FN8A 2Y6TA 3GICB 3D62A 1SHHB 4VGCC 2YMSB 4K1TA 4B6EA 4NWLA 5L2ZH 2W3IA 1GCTC 2ZU5A 3OYPA 3Q3KA 2R3YA 4NSVA 2ZO3H 1EJNA 3V12A 6GCHG 1AU8A 5EXMA 2F9BH 3RXJA 1NTPA 1VGCB 4NCYA 4XBCA 2PUXB 3LPRA 1EZSC 1QL7A 1NU9A 2FESH 3BIVH 1D9IA 3EA7A 4INLA 1D6WA 3RMLH 1C4Y2 3UWJH 4ESTE 1C5SA 1G30B 2TGDA 2Z9JA 5JBTA 4IN2A 3FFGA 1NFUA 4X6MA 1Z6JH 1K22H 2FDAA 2PGBB 3V0XA 2O8MA 6LPRA 1OP8A 1L4DA 4ZKSU 3RU4D 2ZPRA 1BTWA 4OS7A 3SHAH 1D3PB 3S7HB 1PFXC 3TU7H 3BTDE 1FY8E 3P6ZB 3ZVDA 1C2IA 4E06H 1O2GH 1YF4A 3SW2B 2GDEH 2J5UA 2J2UA 2A4QA 4IBLH 1UK4A 4Y8YA 3LGYA 4GHQA 1GJCB 1UTPA 2SGDE 3MTYA 2P3TB 1V2MT 4X8SH 3CP7A 1E0FD 5TCCA 2DUCA 1OWDA 2NU2E 1WTHD 1P02A 1IHTH 1QBNA 1RRKA 4FUCA 2FX6A 1RTLA 4WH8A 1A4WH 3KYFA 2O8UA 3W1EA 1GHWH 2XNDD 4AZ2B 3BG8A 4WWYA 1F5RA 5J4SA 4LXBH 1YWUA 1NS3A 4MVNA 4A1VA 2KX4A 1OYTH 1T8LA 1DT2A 3DHKH 5BRRE 2A4OA 2TBSA 1S5SA 1YPLH 1P2NA 1HAVB 3BG4C 3ZVEA 1LVBA 2KR7A 2O9QA 3A80A 1AD8H 3RM2H 2TPIZ 2ZEBA 1PYTD 1DUAA 1JXPA 2BDIA 3VFEA 1NBME 3O8DA 3KGPA 1LCYA 2H1UA 1GMHF 3UREA 1O2NA 1A2CH 4R0IA 5A09A 4BXWA 2GTBA 1FXYA 2KAIA 1ZHPA 1P2KA 3F0OA 4DG4A 1P9UA 1W13U 1P8VC 1W10U 2H5DA 3LOXA 4LK4A 2BLVA 3SUFA 3A8DA 1O2KA 1K1JA 1GI4A 3LH1A 2JIZD 2ZCKP 3UY9A 1GHAF 3A8AA 4E7RG 1QZ8A 2GV7A 2NU3E 1LHGH 1FZZA 1V2QT 2ZHEH 2GKVE 2RFKC 1Y3XA 2GV6A 4YOGA 5LH8A 5EGMA 2ZFSA 1B0EA 1ABIH 1Z7KA 1TNIA 1P3CA 3LU9B 2HPQH 4XBBA 3RC4A 1F92A 2F9PA 1KLTA 3RXCA 5DP4A 3QTVH 4MPWA 4X2YA 2B7DH 2C90B 1ZSLA 3UR9A 3ZYEA 3AW1A 4YM9A 5E0GA 3FN8A 1ESTA 1ZJKA 4Y8ZA 2YMSC 3BEIB 5KGOA 1HYLA 1ZPBA 3SU0A 3OY5U 1C1PA 1BHXF 5C5OA 4X6OA 2C8ZB 3BTKE 5A0BA 2V6NA 1Z6EA 2YNBA 4NSYA 7KMEH 2XBWA 4B6FA 2R9PA 2ANWA 4K8YA 1L1NA 1EX3A 5EIYA 2VH0A 3BTTE 2BX4A 1C1MA 1O2WA 1CGIE 1YGCH 2BVSH 2AGGX 3GCTG 3K6YA 3NZIA 1F7ZA 1EB2A 2CMYA 2WINI 1K28D 1LHEH 3QUMP 3GY2A 4B74A 1KDQB 1O2LA 1CU1A 4DY7B 1SFIA 4Y79A 1GI2A 1P2IA 2QN5T 4I8JA 5F8XA 2AIPA 2EI8A 4CRBA 1Y3UA 1O5FH 5HGGA 3HGNA 3E0PB 1FV9A 1DVAH 1NN6A 1EPTC 1E35B 1ARCA 1UO6A 2Y5GA 2BMGB 4NIWA 1SGRE 2ZGHA 2Z3CA 3FVFB 3LGUA 1BZXE 3STJA 4DGJA 1SLVB 3F6UH 1D3TB 1OHHD 2P3FH 3RXQA 2ILNA 3L33A 1UK3A 3QGNB 4OS4A 4D9RA 1SG8B 1GMCG 4FXGH 3OAAD 3K9XB 4AC9A 1ELFA 3TJUA 1JRSA 2UWPA 3RXKA 2A7CA 4ZUHA 3A82A 1G2LA 1W8BH 1C1VH 3BTHE 1ZMJA 5FPSA 2IJOB 3S7KB 2FOHA 3RP2A 1G37A 5DP7A 2XBXA 4I8HA 1N1LA 2BLOA 1SGIB 2BY7X 4OM9A 1DWBH 3MWIU 1H4WA 3E8LA 3GCNA 3BSQA 2QA9E 2J38A 3LGTA 7GCHF 1HIAA 3K65B 4UONA 3K2UA 1RS0A 1SGPE 1TB6H 2I6SA 3DT0H 3NCLA 5DKMA 1QQ4A 1O2YA 1CGJE 4JZIA 5EQQA 1JIRA 2LPRA 1MZDA 2ANYA 3D23A 1MKXK 5EQRA 1ELVA 1PPEE 4JZEH 1VCWA 1T8OA 1GI1A 2VWLA 3PMJA 1YPHC 4YTAA 1DXPA 3EYDA 1M9UA 3ZZ4A 1W3CA 3A7XA 9LPRA 1GHXH 4A92A 1QFKH 2Z94A 1HAPH 4NZQA 2SNVA 3A87A 1GBEA 2BDCA 1P12E 4FU9A 4ISIH 1HXFH 1O38A 5K7RA 2HVXA 4B2CA 2XBVA 3UQVA 3BF6H 4R8TB 1TFXA 3K6ZA 1T8MA 5C5NA 2GMTB 4HI3A 4P00A 1YKTA 2AIQA 3MH6A 1FX0B 2EY4C 4Y10E 3NWUA 1IQNA 4JYTA 3RC6A 3FP8E 3PRDA 1G9IE 5JDUB 4D9QA 5C0TA 3QTOH 8KME2 5JBCS 1SGEE 2BDAA 5I46H 1TQ0B 2VVUA 4YT7H 3F0PA 3SU1A 3TH3H 3M7QA 3AAVA 1A1RA 1BRUP 4MG3A 1P10A 4ACBA 3H09A 1A3BH 2OC7A 1O33A 1P57B 4RI0A 4OGYA 1Y5AT 3BTFE 1XUFA 1IQGA 3JZ2B 1QRXA 1GBCA 2YOLA 5DG6A 1SVPA 1O2XA 3RU4E 2ZHWH 1GVKB 2BOHB 2FS8A 2OBQA 1W7GH 1SGFA 3EE0B 4GVUA 2EA3A 1O5DH 1IAUA 1UCYE 2ODQA 1XM1A 3E1XB 1NESE 1QB1A 2GCTB 2LP6A 1OWKA 2GCHF 2FS9A 5HYOA 1BHXB 1DWEH 1QA7A 4A1TA 1ABJH 3S9CA 1GL1A 3RC5A 3UTUH 1NRSH 2ZTXA 2FEQH 3Q76A 5FPTA 4NFEA 3LONA 3OX7U 1BTYA 1ELTA 1YLNA 2TIOA 5FXLA 3M35A 1HXEH 2C93B 3RXFA 3VB6A 1WU1A 4MNYA 4OGXA 2PKAB 1O2SA 2QIQA 2UUYA 5H4IB 1EPTA 1AUJA 4UD9H 1HAXB 4BAKB 2KCAA 3NRLA 2CF8H 3QDZB 1SOTA 3VB7A 5C0UA 1O3GA 1XUKA 5DO4H 2ZFQH 1FIWA 2Q6DA 1N6XA 3T26A 4K8BA 1SC8U 3M7TA 2F83A 1OX1A 1DOJA 1XKBC 1LHDH 4NIYA 3GISB 1JOUB 1RXPA 1INCA 1NFYA 1GBDA 1BMNH 5GXPA 3Q00A 1O32A 1ANEA 3A88A 4Y71A 1V2JT 1ZTJA 3O8BA 4YZUA 3A7VA 1DWCH 1G32B 2W7UA 1J8AA 1CHOF 1EAUA 5DPAA 1TPOA 3PM3A 2QYIA 1YLCA 1HAVA 2EI6A 1MTSA 2QAAA 4NG9H 1OKXA 2WPDD 2SGAA 3BTME 3IWMA 1CA0C 1TGTA 2P95A 1QTFA 4OS1A 1IQKA 2QXJA 4X6NA 1E38B 1T4UH 3DSPA 1O3NA 2Q1JA 2SNWA 3F68H 2WUCA 3TNTA 1OXGA 1XUIA 1Y3VA 3P8NA 1AN1E 3RXHA 1CE5A 2GMTC 4UFFH 2ZIQH 5EW2H 1YPKH 1NU7B 1EP5A 1FONA 3OTPA 1HAGE 1C5TA 1SLUB 3VB4A 5DP8A 2A2XH 3RXGA 2PP6A 5AVDA 4Q4LA 1YBWA 3DCLA 1MBMA 1GMHG 1CT2E 2B5TB 5T6FA 5LPFA 5FPYA 2ZG0H 1ZTLA 4OS6A 3RUOA 4DT4A 1TRNA 2FOAA 1XUGA 1GI5A 1UTLM 1ZMLA 4BAOB 2XWAA 1EP6A 3GY7A 3SV2H 1HFDA 1GI6A 1GG6B 1ZPCA 4YLUA 3ATKA 4A7IB 1O2HA 2QGRA 2VWNA 3T5FH 2WYGA 1DICA 3OSYA 3SO3A 3ATLA 5FX6A 4FUIA 2BB4A 1EXFA 1GHAG 4AFUA 1RTKA 4B71A 4WMFA 1UCYK 4MPVA 2EI7A 2GT7A 1LQEA 1BDAA 3LGVA 1SLWB 3V13A 1QQUA 5GCHF 2WV4A 3VEQB 1QJ1B 3QN7A 3SNCA 4GPGA 3P17H 3TGJE 1W0KD 4XSKU 2KFWA 1SGDE 2JETB 4H42U 1ZZZA 1V2WT 1V3XA 1UTJA 2FP7B 1UTKA 3BTGE 1J14A 1IQHA 3WW7A 3BTEE 3FANA 2XOKD 1SKYE 4H4FA 1MQ5A 4MTBA 2CK3D 2AGEX 2BD2A 4RKOB 5CE1A 2OC8A 2VIPA 1KDQA 1WAYB 1O3JA 2ZHDA 3VG8A 2OLGA 4NA8A 3LJJA 1TOMH 1LTOA 4WF8A 1HNEE 3M3TA 2WHXA 1VKYA 2QC2A 3LGIA 4XE4A 2W7SA 4X2VA 2M5TA 5HIZA 4K2YA 4U30A 3U28C 2W6JD 1YCPH 1ANCA 1EAIA 3KQ5A 1AE5A 1AUTC 4X8TH 2VGCB 2ZFRH 1T8NA 1ELBA 1RFNA 1X7AC 1FI8A 2PUQH 1WTGH 5IYTA 1TA6A 1AFEH 4FVBA 1GBAA 1V6DA 3QGJA 3SNAA 1GMDF 1DUEA 2FO9A 5F8TA 2B8OH 5FCKA 1MKWK 4NIVA 2A5AA 1MMJN 4B2AA 3QK1A 3ZVCA 1THSH 1HJAB 2J97A 2JJ2D 2FTLE 1V2UT 1P09A 4AORA 1S0RA 1V2TT 1GDNA 4HG6A 3R3GB 5KECA 3H7OA 4UFEH 1K2I1 1YPHE 4UE7H 2V0BA 1LDTT 1HPGA 3OTJE 1UHBB 1WYKA 2ANKH 3N7OA 1LPZB 4GHTA 3SJ9A 3KNXA 1Z1JA 3A89A 2ALVA 1DITH 4BTTB 2FLBH 3PMHB 1IQIA 3KN2A 1HBTH 1KLJH 3RXEA 2HGTH 5E0JA 2BM2A 2GP9B 3U1JB 3A81A 1K1MA 3D49H 3VB5A 3EDXB 2IPQX 2A5KA 7GCHG 1P01A 4NIXA 3PWCA 2JDID 2ZA5A 1TBZH 2PV9B 1EUFA 1ZRKA 1HB0B 4ZAEA 1FAXA 5SGAE 2DE8A 1QGFA 1TGBA 5L2YH 5FCRA 3KL6A 3CENA 1ETRH 1TNHA 3ATMA 1VCQA 4BAHB 4ZMAH 4AG1A 5HXFA 1BRCE 1E1RD 4M7GA 5C3NA 1O5GH 1IOEA 4KTCA 4JMYA 2ZECA 1GG6C 2H9EH 3DD2H 4AFSA 1TPAE 1O3MA 1UK2A 1RD3B 2P59A 1PPFE 2G52A 1TNKA 1QR3E 3RXIA 3I78A 2VBCA 1O39A 1GBJA 2ZU1A 3NK8A 2J95A 1GGDC 1GJ8B 2BD9A 1F0TA 2G5VA 1K1LA 4KGAA 3H5CB 3OFND 1D3QB 2A7JA 1L1JA 2BD7A 2TGAA 2AHME 1CVWH 2HLCA 3SV8A 2JETC 4IN1A 1DY9A 2HALA 5C1YA 2PFEA 4ISHH 1XX9A 5EG4A 3MFJA 1SGQE 1KLIH 1O3OA 2G55A 1TOCB 3SV6A 1HAHH 2XRCA 5EODA 3A7WA 2VIOA 1GBHA 2PSXA 1Q2WA 2DE9A 1UCYH 4TT3D 3PLBA 1IQMA 3RXDA 1NROH 3TJOA 2HNTC 5J4QA 1H8HD 3F9HA 1AO5A 4IMQA 3S9AA 1GBTA 1LVOA 2VU8E 3A7ZA 5CMXH 1UJ1A 3ZV9A 1C5NH 2BQ7B 3PYHA 1SGNE 2ODYB 1C2FA 3F9FA 1GJBB 1Q3XA 1J17T 1SFQB 2VGCC 2GCHG 1A3EH 4ABEA 5B6LA 4RT0A 1EQ9A 2VIWA 3A8BA 2NU0E 3AAUA 1ZR0A 2J98A 3M36A 4Z0KA 1WBGB 2FM2A 1TGNA 8GCHF 3T25A 2BZ6H 4AYVB 1Q31A 1DSTA 4F49A 1SQTA 3U1IB 5EXLA 1LMWB 4MLFB 2XBYA 3SV9A 2QY0B 2ZF0H 3T2NA 3W94A 4YO9A 1SPJA 1Z8RA 4GCHF 4BAQB 1TPPA 5EJZA 1A5GH 1HV7A 2OQ5A 4ABGA 3MHWU 6ESTA 1HLTH 3HGPA 2UUKB 1H9IE 3DFLA 3SBKA 1TX8A 2RDLA 1GJDB 2EEKA 5DP6A 3SV7A 1MH0A 3LKWA 1AHTH 1GDUA 1SBWA 5EQSA 1VJ9U 3KQBA 5JPMH 4K1EA 4B2BA 1MTWA 4XOJA 1YM0A 1NM6A 1O3FA 1P9SA 3MMGA 2H6MA 3SZNA 1BBRK 1KY9A 1A0JA 4ZHMU 3UOUA 2VVVA 2YMSD 2V35A 1F5LA 3UNQA 2ZQ2A 1CHOG 1O2OA 1VGCC 1MZAA 2CV3A 5GWZA 5IK2D 1ZOMA 1KTSB 2G8TA 3P92A 3TH4H 3URDA 2OD3B 4GUXA 4FUDA 1KTTB 3T29A 2Y80A 3CS0A 1S84A 1CA8B 1OP2A 1TALA 3OEED 1MD7A 1UVOA 1AKSB 2P3UB 3ZZ9A 3RMOH 1FAKH 2O8TA 5GJ4B 1PPCE 3PLPA 1O2PA 1DXWA 4KTUA 1FLEE 1A46H 4Y7BA 3FKSD 4ZHAA 2PSYA 3L6PA 4NFFA 3A7TA 4O3TA 4X1NU 2Y5FA 1CT4E 1SI5H 3SGBE 3VXFH 2CGAA 5JB9S 3T62A 1T4VH 4NGAH 2KCPA 5DN6D 1GJAB 1DE7H 2ZC9H 2XW9A 3HK6B 4ISLA 2IN2A 2XTTB 3HKJB 1YPEH 2ZFPH 1ZLRA 3C1KA 5DJ7A 3AASA 1VCPA 1BTHH 1TX7A 4D76A 5PTPA 2AMDA 2ESTE 2THFB 2BY6X 1AE8H 4BOHA 4O97A 1BUIA 2C4FH 5GNDA 3F1SB 5T1VA 5HKKD 3FZZA 1ORFA 4Q63A 1ARBA 2ZFFH 3F2GA 1RJXB 2ANMH 2BDBA 3D65E 4WXIA 1LVYA 3SU3A 3A85A 1P2MA 5EXNA 1O3EA 3S69A 4ABDA 4FUJA 1Z1IA 1PQ7A 3MH5A 1HAZB 5AHGH 2JH5D 4Y76A 1C2MA 2GD4B 1S82A 1D4PB 3BEUA 3UFAA 1O2RA 5GCHG 4ZXYH 1DWDH 2BD8A 1MABB 1F2SE 3TVJB 4DW2U 2R2MB 4DVAU 1OPHB 1QL8A 3F2HA 3KCGH 4DURA 4WMEA 5BPEA 3ZZAA 1NRPH 4LZ1H 1H8ED 4CREA 1AZ8A 2JH0D 3RXPA 2FZZA 1K1PA 1ELEE 1O5AB 3A7YA 2SGFE 2BY5X 2KCOA 1ESBA 1RIWB 1F0SA 1XXFA 1BMAA 8LPRA 1DS2E 2QV1A 4DIIH 2VB0A 2JH6D 2K0QA 5A8YA 1O0DH 1V2OT 2WSSD 3KEEA 1BOQA 1ETTH 4Y8XA 5FAHA 3RXLA 1Z8IB 2GT8A 3MO9A 5C2ZA 2F43B 3LGWA 1MCTA 1O3PB 1P05A 2WPIS 2BXUH 5TCAA 1N6YA 2UWOA 1GHZA 2AYWA 2CN0H 3Q3YA 2RCEA 3SN8A 3PRBA 1G2MA 1VITH 5I25A 1K0HA 3UNSA 3UNRA 4DIHH 5DP5A 1GDQA 3TIUA 4IS5A 1O34A 3SJOA 2I6QA 1O5CB 4XD7D 3SI3H 3S0NA 2A32A 4ASUD 1TMTH 5AF9H 4FUGA 1HDTH 5B6OA 2Y5HA 3HATH 4X2WA 4M9FA 1SHYA 1V2PT 4YLQH 9ESTA 4D8NA 3FP7E 5DGJA 3HKIB 3SQHE 4A6LA 3WY8A 3CS7A 1W11U 3GCHB 1VR1H 2OUAA 1FDPA 1H1BA 2H9HA 2OCVB 1BMLA 3V3MA 4THNH 2ZFTA 1GJ9B 4O3UA 2XCFA 1DDJA 4Q7XA 1BMMH 4Y7AA 1TYNA 1P2OA 3GDVA 1EOLA 2GZ8A 1COWD 3KIDU 3MYWA 4JYUH 1MTNB 1FPHH 3M7UA 3MNCA 2P8OB 1EZUC 2HVYB 3EA8A 3NXPA 3Q3XA 4O03A 4UDWH 1XKAC 3B23B 1GI7B 1O3BA 6CHAB 1XUJA 2FOCA 2CHAB 2HNTE 1NRQH 1BIOA 2FPZA 1SR5C 2C3SA 1P03A 4GSOA 1L2EA 1A5HA 2VWMA 5EOKA 1ZSKA 3F9GA 1QL9A 2SGEE 3KQCA 3SQEE 3PTNA 2Z9LA 3GOVB 3MI4A 3GY5A 5T6GA 3OY6U 2J94A 2STBE 4H6TA 3TK5A 2ZZUH 3B8JA 2SGQE 1TIOA 1BT7A 1Z71A 1DSUA 1FY4A 4WMDA 2O8WA 2GX4A 4Q7YA 7LPRA 2OXSA 1Y3YA 1PQ5A 4ZKNU 1G3CA 5LPEA 5FHTA 3GDSA 4JCNA 1UVSH 2G4UA 3UIRA 1Y8TA 3SI4H 1O2QA 2FI4E 3W95A 2BY9X 5EU8A 2BYAX 4B73A 2BTCE 4I86A 1TLDA 4K5ZA 1XXDA 3R0FA 4WY3A 1YC0A 4Z6AH 5LPRA 1RIWC 2FI5E 1RGQA 1DM4B 1O2JA 5C1UA 1H8IH 3EQ0H 3PV4A 3QLPH 2BQWB 1AI8H 3LDXH 1HJ8A 3P95A 1S83A 2AMQA 3F9EA 1YLDA 1GI0A 3PMAB 2LNCA 4HTCH 2PHBA 2RA0A 1MKXH 1KYNA 1TA2A 3SJ8A 1IQLA 1KXCA 4MNWA 1GBBA 3RXVA 1SQOA 1A0HB 2XC5A 3C27B 3A86A 3GY8A 3LT3A 1B5GH 1C5WB 1E34B 1BA8B 1FN6A 3GDUA 4RT1A 2OK5A 3N7EA 3RXRA 1LQDB 2Q6GA 1SGYE 1C1RA 1V2NT 2QXGA 8GCHG 4Z1MD 3T27A 4E05H 5AFYH 2YNAA 3LIWA 1S85A 1V2LT 2FOMB 2R0LA 5FBEA 5HM2A 1AB9B 3MNSA 1EJAA 2Q6FA 4Y0YE 2ZU4A 2OQUA 4GCHG 5A8ZA 2FOBA 1G3DA 3PROA 4X1QU 3TITA 2K8IA 3M3SA 2B9LA 2J4IA 4CRCA 1OS8A 2WPLS 4CHAB 1BJUA 1BITA 4D7FA 1QRWA 2WV5A 4X1PU 1GJ6A 1HJ9A 2GCTC 3PWBA 3QZQA 3H7TA 2Y82A 4H6SB 1K21H 1BMFD 4AGKA 4ZXXH 4KTSA 2K1QA 1PQ8A 2F9NA 4INHA 3FAOA 3A83A 1E79D 1CQQA 1K1NA 1PPGE 1OWEA 1C5RA 1DFPA 5F8ZA 2F3CE 1NRRH 1MD8A 4ABHA 1QHRB 3L3TA 1BTUA 2QCYA 1Y3WA 1AKSA 4IGDA 5A8XA 4AFQA 2WPHS 1C5YB 1Z8JB 3ODFA 3MU4A 1TGCA 1C5PA 3SU2A 3RXMA 3U9AH 4CR9A 3KQEA 2ZGJA 2GGVB 1LHCH 1KXFA 3M5MA 1HCGA 1HIAB 1MTVA 1O36A 2RA3A 3EAJA 4RKJB 2XNIA 1UTQA 1GJ7B 2O8LA 2R3UA 1S0QA 3SJKA 3AK5A 1KIGH 1FNIA 3ZVFA 1C5UA 1C2LA 4ABAA 4ZHLU 4X0WU 1VITF 1G3EA 2A4RA 5F53A 3ZVBA 1C5LH 3MU8A 3AW0A 1JWTA 2BZAA 2FXRA 1YPGH 4ZROA 2WUBA 2J34A 1LKBA 4E7NA 3RXAA 3RU4T 1O2MA 3LC5A 2BD4A 4BAMB 4FVDA 4TSFD 2VINA 1OSSA 2TGPZ 1B0FA 3UB0A 1F0UA 4LOYH 1TQ7B 1ZJDA 1O31A 4CBNA 1ZRBA 2L6OA 4XBDA 3VPKA 4I8GA 3CNRA 1HUTH 1O3CA 5F03A 1WQSA 1IHSH 3SNBA 1C2EA 2AGIX 2TGTA 1VJAU 2F4LA 1DLEA 1QBOA 1GHVH 2P93A 2GVFA 4NA7A 3MH7A 4WXVA 4WVPE 2H9TH 3GYMA 2OP9A 3E3TA 4B76A 1EASA 1OWHA 2JJ1D 4U2WA 1N8OB 2PTCE 2ULLA 4DCDA 1O3AA 1WQVH 1O2TA 3JZ1B 1NFWA 3P70B 2P16A 2QF5A 4NZLA 4I7YH 2ZDMA 1BBRE 4U01A 1GWAA 2A31A 5E2PA 1AFQB 3AVZA 4X1SU 3V7TA 1C5XB 3UUZA 1EOJA 3SNDA 2A1DB 2PGQB 2D2DA 3DSGA 5T6DA 1GCDA 1J15A 1VZQH 4AB9A 1C2KA 3KYGA 5T3HA 4ZH8A 3SUEA 4JYVH 2FLRH 2F9OA 1EFRD 1ANBA 2KM0A 1BQYA 5E0HA 1PPBH 2QXHA 5GIBA 4UEHH 2BDYA 2BY8X 1TNLA 2ZTZA 4Y0ZE 3TPIZ 1AB9C 1O3KA 4YESB 1Z8GA 4X2XA 1O3HA 5FX5A 3A8CA 2GDDA 1NZQH 1HRTH 4CH8B 3FO8D 5TJXA 4MQAA 1EAWA 1O2VA 4F48B 3STIA 3MOCA 2BVXH 1C1WH 4CHAC 3ATIA 2BOKA 5JYIA 3M5LA 3RXSA 2C8WB 2BD3A 3BIUH 1ZGIA 4XRNA 2QF0A 3WWBA 1EPTB 3GS9A 1TAWA 1YPMH 1A7SA 1PQAA 1AQ7A 4NWKA 1JRTA 5HIYA 2ZKSA 4SGBE 1L1GA 1GHBF 1TNGA 4FETA 1GJ5H 3N7DA 1S6FA 1EKBB 5EJ1A 2WPMS 1O3DA 4WJG2 1YP9A 2BX3A 2AFQB 2HPPH 1WXRA 4TY7A 1ZSJA 2F9UA 4B1TA 1EB1H 2ASUB 2XC0A 4A1XA 1WDIA 2ZHFH 1GHYH 4I8LA 2PKAA 2QF4A 4I31A 2ZDAH 5EW1H 3MH4A 1MBQA 2ZGXH 3NPSA 5DK1A 1AZZA 3ZVGA 3MU0A 2JKHA 2VIDA 2IOTA 1ZHRA 2V3OH 3QO6A 4K3JA 1PYTC 5DP3A 2UWLA 3IITA 5ABWA 1K1OA 4PROA 1C1UH 4ASHA 4Y11E 1C1NA 1BB0B 3TJNA 4J2YB 1HJAC 1UVTH 3HPTB 1GJ4H 2FWWA 3RLYH 1NPMA 2BD5A 3P8OA 4LZ4B 5CHBA 3ELAH 1SB1H 5K0HA 2V7QD 5JBBS 3TH2H 1QJ7B 1ZMNA 1HGTH 3QX5H 1ZPZA 2VH6A 1Y5BT 3TGKE 2BLWA 2PLXA 1FY1A 3PMBB 2VNTA 3NKKA 2G00A 2UUFB 1GI8B 1MKWH 1SQAA 3TLOA 1UMAH 1W0JD 3S9BA 3MU1A 4Q80A 4AN7A 2QE7D 3GY6A 1RTFB 2ZWLH 3N99A 1QB9A 1MTUA 5A2MH 1TABE 1N8OC 2NWNA 2ZCLP 1C4V2 2HWLB 3ODDA 3UAIC 4BTUB 4ZCNA 2BDHA 4WH6A 4I33A 5C17A 1AFQC 4QT8C 1GBIA 1BRAA 4D7GA 3SYJA 3PV2A 3RLWH 2ZGBH 1O30A 3TJVA 1WUNH 2J9NA 3M3VA 3GCOA 3ZZBA 1CSOE 4DT7B 2C8XB 4KKDA 1NRNH 1EATA 5HMAA 1LPGB 2QXIA 3TNSA 3UWIA 2ZPSA 2AEIH 5L30H 4TPYA 4DJZB 4YXWD 3ZZ8A 1C9PA 2AH4X 4KELA 3SU4A 1BTPA 1C2JA 4X1RU 3RDZA 2OTVA 1SGFG 1GBKA 1XMNB 1WCZA 4FUEA 3DSOA 3ZZDA 4YOJA 4CRAA 1GI3A 3LC3A 5CHAB 5EJLA 1H8DH 2CXVA 1TRMA 1QURH 2PW8H 3F3BA 3FP6E 2Z3EA 1BTZA 1CBWB 2FTMA 4GAWA 2STAE 1V2VT 2ZPQA 3OE7D 4YOIA 3U8OH 3OU0A 3UR6A 4U32A 1JIMA 1ACBE 4INKA 2BXTH 1FMGA 1B7XB 1G36A 1XVMA 2C8YB 3BTQE 1GPZA 1EAXA 2AS9A 4TYDA 2D8WA 1Y5UT 2PKSB 1EJMA 1ZYOA 1UVPA 3VGCB 2ZQ1A 4MNVA 3F2FA 2ALPA 2EQNA 1W0ZU 4A5TS 2GZ9A 5JB8S 1TPSA 1O2IA 4AOQA 4MPXA 2GZ7A 4F4OC 1HAIH 2F9VA 2AMPA 4JZ1A 4UFGH 3RXBA 1XUHA 4Q7ZA 4KP0A 3EA9A 1CGHA 1CO7E 5C20A 5FBIA 1TMBH 2ZDKA 1MAXA 3UOPA 5ETXA 1WSSH 4X8UH 3P8GA 3T28A 1E1QD 3O8CA 1TBRH 1KXEA 3SOSA 6GCHF 1H9LB 2NU4E 2P94A 2FX4A 1BCUH 2SFAA 1SSXA 2ZNKH 1AIXH 4TPIZ 1NY22 3ZVAA 1C1SA 4XDEA 4CRDA 1NFXA 3MO6A 2HRVA 3E16B 4AFZA 1D3DB 1ELCA 1G3BA 1U6QA 1GBMA 1FIZA 1K1IA 2J92A 1CA0B 2VIQA 2ZI2H 3HK3B 2CF9H 4OS5A 4CH2B 1T31A 1LPKB 1C2DA 2Z6BD 1ELAA 2ODPA 1P11E 1W14U 2VIVA 1IQEA 2FODA 1PPZA 4BXSA 1UHBA 1FY3A 1GMDG 1S81A 1A61H 1SOZA 1VITG 2ZGCA 5DP9A 4XFQA 5EPYA 4X8VH 1L0ZA 3URCA 1A5IA 2A0QB 3PTBA 3UPEA 1P3EA 4TY6A 1THRH 3O8RA 1AY6H 1KXAA 1V2KT 2W6ID 5E8EH 2ZDVH 1O35A 3KF2A 2BHGA 3U98H 3E91A 5DSFA 8ESTE 1QNJA 4JK5A 2FOFA 2CJIA 1AVXA 1GI9B 3ESTA 3TGIE 1O37A 2A4GA 2A2QH 2G51A 1SL3A 3PLKA 1C1QA 3RMNH 3MQKC 4HGCA 2BDGA 1V2ST 4ISNA 4RSPA 1E37B 3RM0H 3U8RH 3QZRA 1BBRH 3RXTA 4JZFH 1MCVA 1C4U2 5EPNA 4FU7A 3VXEH 2Z3DA 4FUBA 2HOBA 2FOEA 3SNEA 2F91A 1FQ3A 1W2KH 3BV9B 4ISOA 4DOQA 3BN9A 3G01A 4I8KA 1O5BB 2IPHA 1C2HA 1YYY1 2LELA 1L4ZA 1TNJA 5CHAC 1WOFA
chains in the Genus database with same CATH topology
3LH3A 3PO1B 5AFZH 2HNTF 1OWIA 2ZP0H 1ETSH 4SGAE 4CR5A 4IW4E 2FIRH 1O3LA 1CBWC 1FY5A 1S6HA 2XCNA 1OOKB 4ZKOU 1YCPK 3IG6B 1FJSA 1TRYA 3MO3A 1QIXB 4RN6A 1V2RT 1ZGVA 2VJ1A 1AGJA 1DPOA 2B0FA 2ZDNA 4TWYA 3ZZ3A 1BJVA 2ZDLA 3TK9A 3UQOA 2RG3A 2OBOA 3DUXH 1O2ZA 1A0LA 3SUGA 4BTIB 4IC5A 2EC9H 3VB3A 2PKSC 5E2OA 3SU5A 3VGCC 1TE0A 2R2WU 1DY8A 2TRMA 2KAIB 1GBFA 1NT1A 1ZHMA 2W3KA 1NC6A 1OP0A 2D26C 2FOGA 3SGAE 3FZDA 1KXBA 5L6NH 1QB6A 1OYQA 3RXUA 1FPCH 1ESAA 3ITIA 1F5KU 2D1JA 3U8TH 1THPB 5JBAS 7ESTE 2V3HH 2WPKS 2Y81A 1TONA 2W5EA 2H5CA 3I77A 1YPJH 1QY6A 1P04A 1W12U 4HFPB 3U69H 3SU6A 4MPUA 1GHBG 1EZQA 4MDSA 2XYAA 1D6RA 3M5NA 1CT0E 1SLXB 2WPJS 1LO6A 1TBQH 3GCTF 3BEFB 2ZHQH 1SGTA 1C2GA 3MU5A 4IMZA 4ABFA 3BTWE 1AWFH 1SGCA 3RXOA 1P06A 3GY4A 4HZHA 4J1YA 4B75A 1TGSZ 4GLYA 2Y7ZA 1HAYB 2A5IA 4FUFA 1PJPA 3Q77A 1UTNA 3B9FH 4VGCB 5GDSH 3TK6A 2BVRH 2PWXA 4FUHA 4K69A 1C1TA 2SGPE 3RMMH 4AX9H 2PTNA 2Y7XA 4X6PA 5LGOA 1C5ZB 2H2ZA 1GBLA 1GCTB 2FMJA 1DLKB 3E0NB 1QBVH 1W7XH 2ZCHP 1AVGH 2A45B 3M37A 1GMCF 1P2JA 4TWWA 1C9TA 4K60A 1QCPA 1ELGA 1GVZA 1ELDE 1TMUH 1E36B 2Z9KA 3ENSB 1O3IA 3ZZCA 5IDKA 5G4BA 1J9CH 3GCHC 2UUJB 2XXLA 4AGJA 5F6MA 5HM9A 4ABJA 2VVCA 4YT6H 4CBOA 1FUJA 3SORA 5A0AE 4AG2A 1QA0A 1H9HE 1QRZA 1GGDB 2ZU2A 3E90B 4AB8A 2Z7FE 3M61U 3SGQE 1LKAA 1XVOA 3ZYDA 3ZZ7A 2VWOA 1DX5M 3ZZ5A 1OWJA 3PO1C 1MTNC 4JK6A 1BRBE 2FI3E 5C67A 1LHFH 2P8OC 3ZV8A 4MNXA 2WYJA 4BANB 2BLQA 6CHAC 4CRGA 3MNXA 2CHAC 3LJOA 2OINA 1GL0E 2R0KA 3DA9B 2PR3A 1AVWA 5ESBA 1O5EH 1DANH 2G81E 2OC1A 1TX6A 3KQDA 4ABIA 2OC0A 1CHGA 1HAOH 2Z9IA 2BQ6B 4BNRA 2FYQA 4CRFA 1C5QA 4O9VA 5C1XA 2QF3A 1EZXC 3BG4B 3MNBA 2NU1E 3EGKH 4NA9H 1K9OE 2Z9GA 1NO9H 1KSNA 1KXDA 1MU8B 4Q2KA 1JMOH 3SJIA 4IC6A 2G4TA 3M5OA 1YCPM 2G5NA 2AERH 1C5MD 1P0SH 2FYRA 4AYYB 1MU6B 3SUDA 4OS2A 1QJ6B 1LVMA 1MAYA 3GY3A 3A84A 1C1OA 3KHVA 3DFJA 3P8FA 4FU8A 3I29A 1AMHA 4ZKRU 4ABBA 1F0RA 3ATWA 4UFDH 1TWXB 4JZDH 4I32A 5GPIB 1P2QA 1UTMA 2ZTYA 1T32A 2XWBI 4K1SA 1ID5H 1JBUH 3E6PH 3QWCH 1IQJA 1PPHE 3NUMA 1GVLA 1BTXA 1O2UA 3GYLB 1MUEB 5A0CA 2XC4A 1W0YH 1ZTKA 2ZU3A 3SHCH 1ANDA 1MQ6A 1SMFE 1T7CA 1AWHB 2A7HA 1C5VA 3PB1E 2W26A 5ESTE 1WV7H 1IQFA 4Y6DA 1C5OH 1Y59T 1J16A 1UVUH 3ZZ6A 1UTOA 1FN8A 2Y6TA 3GICB 3D62A 1SHHB 4VGCC 4K1TA 4NWLA 5L2ZH 2W3IA 1GCTC 2ZU5A 3OYPA 3Q3KA 2R3YA 4NSVA 2ZO3H 1EJNA 3V12A 6GCHG 1AU8A 5EXMA 2F9BH 3RXJA 1NTPA 1VGCB 4NCYA 4XBCA 2PUXB 3LPRA 1EZSC 1QL7A 1NU9A 2FESH 3BIVH 1D9IA 3EA7A 4INLA 1D6WA 3RMLH 1C4Y2 3UWJH 4ESTE 1C5SA 1G30B 2TGDA 2Z9JA 5JBTA 4IN2A 3FFGA 1NFUA 4X6MA 1Z6JH 1K22H 2FDAA 2PGBB 3V0XA 2O8MA 6LPRA 1OP8A 1L4DA 4ZKSU 3RU4D 2ZPRA 1BTWA 4OS7A 3SHAH 1D3PB 3S7HB 1PFXC 3TU7H 3BTDE 1FY8E 3P6ZB 3ZVDA 1C2IA 4E06H 1O2GH 1YF4A 3SW2B 2GDEH 2J2UA 2A4QA 4IBLH 1UK4A 4Y8YA 3LGYA 4GHQA 1GJCB 1UTPA 2SGDE 3MTYA 2P3TB 1V2MT 4X8SH 3CP7A 1E0FD 5TCCA 2DUCA 1OWDA 2NU2E 1WTHD 1P02A 1IHTH 1QBNA 1RRKA 4FUCA 2FX6A 1RTLA 4WH8A 1A4WH 2O8UA 1GHWH 4AZ2B 3BG8A 4WWYA 1F5RA 5J4SA 4LXBH 1NS3A 4MVNA 4A1VA 1OYTH 1T8LA 1DT2A 3DHKH 5BRRE 2A4OA 2TBSA 1S5SA 1YPLH 1P2NA 1HAVB 3BG4C 3ZVEA 1LVBA 3A80A 2O9QA 3RM2H 1AD8H 2TPIZ 2ZEBA 1PYTD 1DUAA 1JXPA 2BDIA 3VFEA 3O8DA 3KGPA 1LCYA 2H1UA 1GMHF 3UREA 1O2NA 1A2CH 4R0IA 5A09A 4BXWA 2GTBA 1FXYA 2KAIA 1ZHPA 1P2KA 4DG4A 1P9UA 1W13U 1P8VC 1W10U 2H5DA 3LOXA 4LK4A 2BLVA 3SUFA 3A8DA 1O2KA 1K1JA 1GI4A 3LH1A 2ZCKP 3UY9A 1GHAF 3A8AA 4E7RG 2GV7A 2NU3E 1LHGH 1FZZA 1V2QT 2ZHEH 2GKVE 1Y3XA 2GV6A 4YOGA 5LH8A 5EGMA 2ZFSA 1B0EA 1ABIH 1Z7KA 1TNIA 1P3CA 3LU9B 2HPQH 4XBBA 3RC4A 1F92A 2F9PA 1KLTA 3RXCA 5DP4A 3QTVH 4MPWA 4X2YA 2B7DH 2C90B 1ZSLA 3UR9A 3ZYEA 3AW1A 4YM9A 5E0GA 1ESTA 1ZJKA 4Y8ZA 3BEIB 1HYLA 1ZPBA 3SU0A 3OY5U 1C1PA 1BHXF 5C5OA 4X6OA 2C8ZB 3BTKE 5A0BA 2V6NA 1Z6EA 2YNBA 4NSYA 7KMEH 2XBWA 2R9PA 2ANWA 4K8YA 1L1NA 1EX3A 2VH0A 3BTTE 2BX4A 1C1MA 1O2WA 1CGIE 1YGCH 2BVSH 2AGGX 3GCTG 3K6YA 3NZIA 1F7ZA 1EB2A 2CMYA 2WINI 1K28D 1LHEH 3QUMP 3GY2A 4B74A 1KDQB 1O2LA 1CU1A 4DY7B 1SFIA 4Y79A 1GI2A 1P2IA 2QN5T 4I8JA 5F8XA 2AIPA 2EI8A 4CRBA 1Y3UA 1O5FH 5HGGA 3HGNA 3E0PB 1FV9A 1DVAH 1NN6A 1EPTC 1E35B 1ARCA 1UO6A 2Y5GA 2BMGB 4NIWA 1SGRE 2ZGHA 2Z3CA 3FVFB 3LGUA 1BZXE 3STJA 4DGJA 1SLVB 3F6UH 1D3TB 2P3FH 3RXQA 2ILNA 3L33A 1UK3A 3QGNB 4OS4A 4D9RA 1SG8B 1GMCG 4FXGH 3K9XB 1ELFA 3TJUA 1JRSA 2UWPA 3RXKA 2A7CA 4ZUHA 3A82A 1G2LA 1W8BH 1C1VH 3BTHE 1ZMJA 5FPSA 2IJOB 3S7KB 2FOHA 3RP2A 1G37A 5DP7A 2XBXA 4I8HA 1N1LA 2BLOA 1SGIB 2BY7X 1DWBH 3MWIU 1H4WA 3E8LA 3GCNA 3BSQA 2QA9E 2J38A 3LGTA 7GCHF 1HIAA 3K65B 4UONA 3K2UA 1RS0A 1SGPE 1TB6H 2I6SA 3DT0H 3NCLA 5DKMA 1QQ4A 1O2YA 1CGJE 4JZIA 5EQQA 1JIRA 2LPRA 1MZDA 2ANYA 3D23A 1MKXK 5EQRA 1ELVA 1PPEE 4JZEH 1VCWA 1T8OA 1GI1A 2VWLA 3PMJA 1YPHC 4YTAA 1DXPA 3EYDA 1M9UA 3ZZ4A 1W3CA 3A7XA 9LPRA 1GHXH 4A92A 1QFKH 2Z94A 1HAPH 4NZQA 2SNVA 3A87A 1GBEA 2BDCA 1P12E 4FU9A 4ISIH 1HXFH 1O38A 5K7RA 2HVXA 4B2CA 2XBVA 3UQVA 3BF6H 4R8TB 1TFXA 3K6ZA 1T8MA 5C5NA 2GMTB 4HI3A 1YKTA 2AIQA 3MH6A 4Y10E 3NWUA 1IQNA 4JYTA 3RC6A 3FP8E 1G9IE 5JDUB 4D9QA 3QTOH 8KME2 5JBCS 1SGEE 2BDAA 5I46H 1TQ0B 2VVUA 4YT7H 3SU1A 3TH3H 3M7QA 3AAVA 1A1RA 1BRUP 4MG3A 1P10A 1A3BH 2OC7A 1O33A 1P57B 4OGYA 1Y5AT 3BTFE 1XUFA 1IQGA 3JZ2B 1QRXA 1GBCA 2YOLA 5DG6A 1SVPA 1O2XA 3RU4E 2ZHWH 1GVKB 2BOHB 2FS8A 2OBQA 1W7GH 1SGFA 3EE0B 4GVUA 2EA3A 1O5DH 1IAUA 1UCYE 2ODQA 1XM1A 3E1XB 1NESE 1QB1A 2GCTB 1OWKA 2GCHF 2FS9A 5HYOA 1BHXB 1DWEH 1QA7A 4A1TA 1ABJH 3S9CA 1GL1A 3RC5A 3UTUH 1NRSH 2ZTXA 2FEQH 3Q76A 5FPTA 4NFEA 3LONA 3OX7U 1BTYA 1ELTA 2TIOA 5FXLA 3M35A 1HXEH 2C93B 3RXFA 3VB6A 1WU1A 4MNYA 4OGXA 2PKAB 1O2SA 2QIQA 2UUYA 5H4IB 1EPTA 1AUJA 4UD9H 1HAXB 4BAKB 2CF8H 3QDZB 1SOTA 3VB7A 1O3GA 1XUKA 5DO4H 2ZFQH 1FIWA 2Q6DA 1N6XA 3T26A 4K8BA 1SC8U 3M7TA 2F83A 1OX1A 1DOJA 1XKBC 1LHDH 4NIYA 3GISB 1JOUB 1RXPA 1INCA 1NFYA 1GBDA 1BMNH 5GXPA 3Q00A 1O32A 1ANEA 3A88A 4Y71A 1V2JT 1ZTJA 3O8BA 4YZUA 3A7VA 1DWCH 1G32B 2W7UA 1J8AA 1CHOF 1EAUA 5DPAA 1TPOA 3PM3A 2QYIA 1YLCA 1HAVA 2EI6A 1MTSA 2QAAA 4NG9H 1OKXA 2SGAA 3BTME 3IWMA 1CA0C 1TGTA 2P95A 1QTFA 4OS1A 1IQKA 2QXJA 4X6NA 1E38B 1T4UH 1O3NA 2Q1JA 2SNWA 3F68H 2WUCA 3TNTA 1OXGA 1XUIA 1Y3VA 3P8NA 1AN1E 3RXHA 1CE5A 2GMTC 4UFFH 2ZIQH 5EW2H 1YPKH 1NU7B 1EP5A 1FONA 1HAGE 1C5TA 1SLUB 3VB4A 5DP8A 2A2XH 3RXGA 5AVDA 1YBWA 1MBMA 1GMHG 1CT2E 2B5TB 5T6FA 5LPFA 5FPYA 2ZG0H 1ZTLA 4OS6A 3RUOA 1TRNA 2FOAA 1XUGA 1GI5A 1UTLM 1ZMLA 4BAOB 2XWAA 1EP6A 3GY7A 3SV2H 1HFDA 1GI6A 1GG6B 1ZPCA 4YLUA 3ATKA 4A7IB 1O2HA 2QGRA 2VWNA 3T5FH 2WYGA 1DICA 3OSYA 3SO3A 3ATLA 5FX6A 4FUIA 2BB4A 1EXFA 1GHAG 4AFUA 1RTKA 4B71A 4WMFA 1UCYK 4MPVA 2EI7A 2GT7A 1LQEA 1BDAA 3LGVA 1SLWB 3V13A 1QQUA 5GCHF 2WV4A 3VEQB 1QJ1B 3QN7A 3SNCA 4GPGA 3P17H 3TGJE 4XSKU 1SGDE 2JETB 4H42U 1ZZZA 1V2WT 1V3XA 1UTJA 2FP7B 1UTKA 3BTGE 1J14A 1IQHA 3BTEE 3FANA 4H4FA 1MQ5A 4MTBA 2AGEX 2BD2A 4RKOB 5CE1A 2OC8A 2VIPA 1KDQA 1WAYB 1O3JA 2ZHDA 2OLGA 4NA8A 3LJJA 1TOMH 1LTOA 4WF8A 1HNEE 3M3TA 2QC2A 3LGIA 4XE4A 2W7SA 4X2VA 2M5TA 4K2YA 4U30A 1YCPH 1ANCA 1EAIA 1AE5A 1AUTC 4X8TH 2VGCB 2ZFRH 1T8NA 1ELBA 1RFNA 1X7AC 1FI8A 2PUQH 1WTGH 5IYTA 1TA6A 1AFEH 4FVBA 1GBAA 1V6DA 3QGJA 3SNAA 1GMDF 1DUEA 2FO9A 5F8TA 2B8OH 5FCKA 1MKWK 4NIVA 2A5AA 1MMJN 4B2AA 3QK1A 3ZVCA 1THSH 1HJAB 2FTLE 1V2UT 1P09A 4AORA 1S0RA 1V2TT 1GDNA 3R3GB 3H7OA 4UFEH 1K2I1 1YPHE 4UE7H 2V0BA 1LDTT 1HPGA 3OTJE 1UHBB 1WYKA 2ANKH 3N7OA 1LPZB 4GHTA 3SJ9A 3KNXA 1Z1JA 3A89A 2ALVA 1DITH 4BTTB 2FLBH 3PMHB 1IQIA 3KN2A 1HBTH 1KLJH 3RXEA 2HGTH 5E0JA 2BM2A 2GP9B 3U1JB 3A81A 1K1MA 3D49H 3VB5A 3EDXB 2A5KA 7GCHG 1P01A 4NIXA 3PWCA 2ZA5A 1TBZH 2PV9B 1EUFA 1ZRKA 1HB0B 4ZAEA 1FAXA 5SGAE 2DE8A 1QGFA 1TGBA 5L2YH 5FCRA 3KL6A 3CENA 1ETRH 1TNHA 3ATMA 1VCQA 4BAHB 4ZMAH 4AG1A 5HXFA 1BRCE 4M7GA 5C3NA 1O5GH 1IOEA 4KTCA 4JMYA 2ZECA 1GG6C 2H9EH 3DD2H 4AFSA 1TPAE 1O3MA 1UK2A 1RD3B 2P59A 1PPFE 2G52A 1TNKA 1QR3E 3RXIA 3I78A 1O39A 1GBJA 2ZU1A 3NK8A 2J95A 1GGDC 1GJ8B 2BD9A 1F0TA 2G5VA 1K1LA 4KGAA 3H5CB 1D3QB 2A7JA 1L1JA 2BD7A 2TGAA 1CVWH 2HLCA 3SV8A 2JETC 4IN1A 1DY9A 2HALA