1QGPA

Nmr structure of the z-alpha domain of adar1, 15 structures
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
76
structure length
76
Chain Sequence
LSSHFQELSIYQDQEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIAVSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The solution structure of the Zalpha domain of the human RNA editing enzyme ADAR1 reveals a prepositioned binding surface for Z-DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords PROTEIN (DOUBLE STRANDED RNA ADENOSINE DEAMINASE)
total genus 18
structure length 76
sequence length 76
ec nomenclature ec 3.5.4.37: Double-stranded RNA adenine deaminase.
pdb deposition date 1999-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02295 z-alpha Adenosine deaminase z-alpha domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1qgpA00
3QPHA 1LQ1A 2V1XA 5FO5A 1R00A 2Z99A 1K78A 3HTSB 2X0LA 1W7PA 1DPUA 1ZRFA 4HF2A 5CVRA 1OMIA 3MWMA 3QRFF 3IRRA 1TQIA 4EM1A 1DUXC 2VBZA 3J80K 2M8EA 3LA2A 3IWFA 1RUOA 5ICCA 5ILSA 4GYGA 5TRDA 2P8TA 1BJAA 3WGHA 2ZMEB 4ON0A 4HDUA 1D5VA 1U5TB 1ZG1A 4G9YA 5JVTA 2UZKA 1TNTA 2VT2A 3C18A 2EFWA 5FLXK 3EYIA 2PMUA 1S7AA 1B4AA 1S3JA 1PP8F 2MC3A 4A0YA 3BJAA 3KP5A 3ZMSA 3I53A 1C0WA 2EK5A 2KIMA 1KU2A 3RKYA 1U5TC 1FX7A 4EV0A 3TOAA 4HQEA 3P9CA 3WTVC 2OBPA 3M8FA 1BBYA 1OR7A 2EV5A 4IHSA 5JHUA 5FFXA 1F9NA 1D3YA 5JI6A 1KGSA 2ZFWA 1ZARA 4EGZA 2RVCA 3FHZA 4WF2A 1BC7C 2RKHA 3CTAA 5E1ZB 5HDNA 3JTGA 2DPUA 4RGRA 4OIRF 2COMA 2VONA 3SHFA 3LA7A 4ZYEA 3O2PE 5FGMA 3I59B 3F23A 3FMQA 4UHTA 3N97A 3E5UA 1KU7A 1EH6A 3SQNA 4A12A 4ZH4F 4G7HF 5ICEA 1XCBA 2NNYA 3F8MA 1IXRC 3F8FA 1TQPA 1KQ9A 4BHPA 1CF7A 4M74A 3EETA 5A2QK 3GVAA 4R8HA 3J80Z 4KN4X 3WGGA 1K78B 1ZYRF 1K7AA 3E6CC 2PG4A 1W7PB 1XMKA 5F6FA 4EM2A 1TQMA 3E6BA 2A69F 1I6XA 1J0RA 3TKYA 1FYKA 1BI1A 3DXJF 4ZZLA 4Q47A 2QQBA 2DBBA 3GO5A 2AXLA 2MLKA 2EFNA 3W6KB 4GGGA 2HKOA 1B59A 2FOKA 2YR2A 4BHBA 2PN6A 4L9JA 2PEXA 2ACJA 2EV6A 1ZLKA 1S8NA 1XCVA 3AAFA 1ZH5A 2MD5A 2ZNZA 1R58A 3Q9VA 1YS6A 4XLNF 2F5FA 3CO7C 2W85A 1IUYA 4UV8A 2IA2A 1KU3A 2VE8A 3RKWA 4OOIA 3WTWC 4MTEA 4WXCA 1R36A 2O0YA 3WG9A 3GEZA 4ESJA 3H3UA 1ZG5A 3TGNA 4RS8A 3ZMDA 4OIQF 3GUDA 3M8EA 1SD7A 2F2EA 3I59A 1IXCA 4HLXA 1H9GA 2CQKA 3HRMA 3I58A 2M1BA 4EM0B 2WWYA 1LNWA 3ZMVA 4HOBA 3JAMZ 4Q5SF 4EJVA 2Q0OA 2ESNA 1ON2A 2P6TA 2M5WA 3QAHA 5LGUA 3J7AO 4IXAA 1P4XA 2K4JA 3KZZA 4YFXF 1OYIA 1ZN2A 4JK1X 1IXSB 1R5GA 4OMZA 3VODA 2F5DA 2EFPA 3HSEA 4HF0A 5LRSA 3KCCA 4IJAA 5J8FA 1I1GA 1XB4A 3GFMA 3HSFA 3I64A 3H92A 1SAXA 4FHTA 3EUHA 3FF5A 1U3EM 2Q8KA 1R23A 4BNCA 4LD5A 2HYGD 4LK1F 1MJAA 1U78A 1FSHA 5CVUA 5FLXZ 4EQQA 3C7JA 3ZN0A 2B0LA 5L3DA 3DFGA 1FYLA 1IN4A 5DCFA 3SFZA 3R0AA 2Z9OA 1BC8C 4G7ZF 2EA2A 2K4BA 2R3SA 3T8TA 4ENMA 4L0YB 1HXDA 2IA1A 5F1RA 1IW7F 1F4KA 1QO0D 4OINF 1YO5C 2DK8A 2HQNA 2FMYA 2QZ8A 1XN7A 4HV5A 1YFHA 3DKWA 1XGSA 2MA3A 2P4WA 2DU9A 3HOSA 3TDUC 4ZYGA 1V4RA 5LRRA 2D1VA 2IVMA 4ETSA 5HS7A 1HSTA 1SD5A 1U5TA 4A5NA 4UVCA 2HFHA 5D5UB 4LGWA 1O57A 1B9NA 2AS5F 2PJPA 4MNUA 2QBYA 3LQQA 5L3GA 5LHGA 3BY6A 3L09A 2KIUA 4P9UA 3GF2A 3CLOA 1Z7UA 4I01A 4GO1A 5DCMB 3F22A 2K27A 1SMTA 5E20A 3BWGA 1HSJA 2JTVA 2GWRA 2CFXA 5HOOA 3E6DA 1J7KA 3HHGA 1J59A 1IN6A 4P9FA 5HLGA 2HEOA 5K5OA 4MGRA 4U88A 3ABUA 2V1DA 1WSUA 4MQVA 4QLCU 4U0WA 2ISZA 4OMYA 2FEZA 4HV6A 4RAZA 3ZP5A 4CICA 2XAGA 2A6EF 3DV8A 3ISPA 1RNLA 1R1TA 1KA8A 2GZWA 3LWFA 1UCRA 2F5CA 3F8BA 1J2XA 2HOEA 1JXSA 4LFUA 4Y15A 2ISYA 3N4MA 1XSDA 3P9IA 1G3SA 2LF8A 3L9FA 2D1HA 1YQAA 3TO9A 4H0EA 1J9IA 3KZYA 5DD4A 6PAXA 3W6JB 2XHKA 2FU4A 1FNNA 2MH2A 4CO8A 2R7DA 2JT1A 3M7GA 3WTUC 3C3WA 4DNCA 1USSA 3KP4A 1YIOA 1W5SA 1TW3A 4HX8A 5DD8A 3BDDA 3LA3A 3DF8A 2BBYA 3RPUA 5D6FA 3KLNA 3QOPA 3FZVA 5LEJA 2LNBA 4HF1A 2O3FA 1GVJA 3LAPA 1OPCA 4OU0A 3WE3A 3KP6A 2FMLA 3FXRA 1STZA 1LEAA 4EJOA 2D45A 5A2QZ 1ZRDA 4AIJA 4LB6B 2A6HF 1R5HA 2OA4A 2XV4S 3J81Z 4I09A 3F6VA 4NB5A 1OYWA 4ESBA 2HS5A 3FMSA 3KLOA 2FQ3A 3ELKA 2O6GE 4LLGF 2H09A 4GCVA 2YX4A 2M87A 2KIFA 1YTYA 3CO6C 1FPQA 3BOQA 5IT9Z 3JTHA 2P5KA 3BROA 3M9AA 1FOKA 3F8NA 2RNJA 2CG4A 1BOAA 2P5VA 1Y0UA 5DCMA 1ZGAA 4I02A 2QQAA 3WU1B 3G3ZA 2ESHA 2ADUA 3WTZA 4CZZA 2VC0A 4CHUA 3LAJA 1F5TA 3MCZA 3ERED 2HKXA 2DTRA 2QWWA 5BS6A 2HTJA 3WTSC 3DP7A 4KUMA 3GWZA 3FX3A 4AWXB 2Y75A 4EJTA 5LGNA 1FC3A 3U2RA 5E8IA 5D5XB 1HW1A 1XDSA 3L00A 1TBXA 2LSOA 1Z9CA 1ON1A 1FWZA 1OYYA 5LLQA 3GXOA 1SD6A 3MZHA 2XROA 2PBIA 4GXOA 4I0BA 4YFNF 2IA0A 4TV7A 3QP5A 4MQ9F 1FZPB 2VOOA 4KIFA 3R61A 1OKRA 5HLHA 4D0PA 2E7WA 3HUGA 3R4KA 4KNYA 3EYYA 2WV0A 3PQJA 5HVQC 4M9SA 4UV9A 2DAOA 1CGPA 1L0OC 1FBUA 2FNAA 1PP7U 1TNSA 1XMAA 2ZKZA 5H20A 3V8KA 1AWCA 4LJZF 4ZYDA 4PGGA 2VN2A 3PFIA 1RIOH 4LLNA 2FSWA 5IT3A 4WXDA 3JSPA 2G7UA 3QP6A 1Q1HA 2GXBA 4LK0F 2O8XA 5J8CA 3CUOA 2XAJA 3JSOA 4EMSA 3ULQB 1TLHB 2V6CA 1G3TA 4YFKF 3BJ6A 4B8XA 1H0MA 1LDDA 2QVOA 3MAJA 2P5LC 2H6BA 1EH7A 1BIBA 1P6RA 3LFKA 4L5IA 2Y0MA 1LVAA 3H3ZA 1I1SA 1O3SA 2PFBA 4A5MA 3HIFA 2XVCA 3ZQ7A 3KFWX 1P4AA 1DP7P 2PQ8A 1BI0A 1WWXA 4WCGA 5DEQA 2NYXA 4U7DA 4ENKA 1XD7A 2ETHA 4MEXF 2VODA 5E17F 2DPDA 2UXXA 2W25A 2OD5A 3EQLF 4HX7A 4PGHA 4AIKA 5DYMA 3T8RA 1USTA 4YIIA 4UVAA 1LEBA 2DFIA 4HQMA 3OOPA 3ZPLA 3G73A 4I2OA 5ICFA 3L7WA 4IRIA 3U9GA 3HRTA 1Z91A 3KEQA 4L5JA 4PZJA 1ZAOA 2CGPA 3QU3A 3IWZA 1G4DA 3F6OA 1BN5A 5FD6A 3CUQB 4RGSA 4G6DA 1T0FA 4I98B 2FBKA 4IPAA 3COAC 3DQVC 1ZHFA 3RKXA 1KQ0A 2J5PA 4UNOA 3IRQA 2A61A 3DPLC 1XGOA 1B1BA 1K6OA 2XASA 4RGXA 2FBIA 3K1MA 1Z6TA 2ZXJA 4MTDA 2L01A 4NHJA 2W57A 2NS0A 4F7ZA 4MEYF 1E17A 3T0YA 2PI0A 3V7RA 1A04A 2FBHA 2LDUA 2IRFG 4YG2F 1MKMA 2FNPA 3ML6A 2KJCA 3BJOA 2E1NA 3VEPA 1R7JA 3GFLA 4IRGA 5DUIA 1YYVA 5IT9K 4LMYA 1P4WA 3GW2A 3B02A 3K1NA 4CXFA 3TO6A 3ZMUA 3R6SA 3RYPA 1HKTA 4QWQA 3WE2A 5BQTA 5AIQA 4RGUA 2FXAA 5HDKA 2GIVA 3HSRA 4DQ2A 3WTYC 4WK8F 5F64A 5CVJA 1S29A 3B73A 2W84A 3E97A 1B6AA 2V9VA 4BQAA 1MD0A 2KRFA 2GXGA 3BP8A 3I5UA 2BEOA 3FWEA 4G6QA 4HW0A 1O3TA 3MQ0A 3J81K 3JAMK 5ILVA 3K2ZA 4P96A 2VC1A 5JR3A 4LG0B 4N9IA 5ERIA 1FP1D 4O5VA 3RI4A 4M6YA 2EFOA 2DO7A 4WXHA 3GFIA 4M9XA 4KN7X 1HW5A 5HLIA 3ECOA 2HWVA 3D0SA 1FP2A 3C1DA 1IZ1A 5BPIA 2XUBA 1QZYA 3GZ6A 2EA4A 4PDKA 5D8KB 1XSXA 2P7CB 1Z6RA 1VTNC 4KA4A 2DW4A 2IW5A 4XLPF 2OQGA 3E5QA 3V7CA 5HDGA 4KFCA 2PLYA 4UXNA 3GZ5A 2VE9A 2J5OA 1FLIA 4IRHA 2M30A 4MHGA 2STTA 1EH8A 1IF1A 3ZMZA 1J75A 2ZBKA 4KMFA 3V7SA 3P7NA 4FX4A 1X3UA 5E1XA 3HYIA 2BGCA 3BPVA 1IN5A 2Z5UA 4P55A 3U1DA 2HYFA 1FT9A 2QYOA 3QPTA 2ZMEA 1SFXA 4WX9A 4G94A 5CVVA 3KP2A 1WRJA 2OZ6A 3P9KA 3KP7A 2XIGA 1FYMA 1G3WA 2EV0A 2R7FA 5AONA 4N0BA 4A0XA 3VFZA 5BPDA 4NQWA 1R1UA 3HRUA 3RPQA 3CDHA 2CO5A 1ZLJA 2QQ9A 4R1HA 1W5TA 2STWA 1AOYA 4BAYA 1WI9A 4G7OF 2VBXA 2E7XA 2EFQA 1W7PD 2XAFA 3I4PA 1XGMA 4RB3C 3LSTA 3RIRA 1JGSA 1IRFA 1L3LA 5EEGA 5AIPA 2OQRA 3F8CA 2L4MA 5TJJA 2FRHA 2FE3A 3RYRA 3TOBA 1D8JA 1LDKB 2Y48A 4OIPF 2X4HA 3NQOA 4FX0A 3R0JA 2XKPA 3MEXA 4RB1A 3BZ6A 3TO7A 5LHHA 3MFKA 3VOEA 2KKOA 3PQKA 1Z05A 1LDJA 3EDPA 3ZN1A 2IJLA 1IRGA 5ICGA 5FD5A 4WWCA 4JQFA 2G9WA 5CLSA 2V79A 2DQRA 2K86A 1H9TA 4XSZF 4U7BA 2GAUA 2ZJ2A 3K69A 1FSEA 2XRNA 3K0LA 4FT8A 4KIGA 4A6EA 3HHHA 5L3FA 3F21A 4IF4A 3T1BA 2DLLA 2A3SA 5ED4A 2FA5A 1BM9A 2OU2A 4HLYA 4EJUA 1O3RA 3REOA 4UUVA 4KIBA 5K1YA 1LJ9A 4M6XA 4AVPA 3D5LA 1QPMA 3GFJA 1HW2A 3GLXA 4E70A 1PDNC 2KJBA 2YU3A 1MDMA 2M45A 4HBLA 1IN7A 2PMHA 1FBSA 3KEOA 4ENNA 1ULYA 1HQCA 4M73A 5K5RA 5D6EA 4ESFA 2DQLA 2E1CA 3IKTA 2K7LA 2VXZA 1YLFA 1WQ2A 5DDGA 4B09A 3WODF 1HKQA 1TTYA 3F3XA 2IP2A 4XBFA 1XSVA 4KYWA 5D5VB 1GXPA 4KICA 1T39A 3V8JA 5D8LB 3WU0A 4ZYHA 3V4GA 1FY7A 3SXYA 5L3EA 4JBAA 4KT5C 2LKPA 2CSOA 2RC4A 2H94A 1FBQA 3SZTA 3BPXA 1YS7A 3DPTA 2BYVE 3OV8A 2V1UA 3L2CA 1ODDA 4HZFA 3IHUA 4AIHA 4HYEA 5HS8A 1CF7B 4P5OA 3ROUA 5CVIA 2UWMA 1EV7A 3RTRA 2F5EA 5CJ9A 3SZPA 3IKVA 4LLLA 3KP3A 4LG0A 4BYYA 4KMUX 3R60A 3TQNA 4HX4A 1SD4A 3O3KA 1QZZA 1IAWA 2UXNA 3WTXC 4Y17A 1YW8A 1T6SA 3I0TA 5EEHA 1F1ZA 2A5YB 2FF4A 4EJWA 3IL2A 2ELHA 2MH9A 2BV6A 2RV8A 2XKOA 1NHAA 5L3BA 1UHWA 2L02A 2JSCA 2XAHA 1QGPA 2QLZA 5KVRA 4Q48A 1IN8A 2CWEA 1KYWA 2RN7A 4L9TA 2NRAC 1W4MA 1QNTA 3FXQA 4M71A 5FB2A 2HR3A 4BH9A 2JRTA 2Z33A 3WTTC 2WTEA 4Z2YA 4I7HA 1T38A 1UFMA 4RB2C 2HDCA 1KU9A 2O61A 5D4RA 3I71A 4RB0A 2Z3YA 1R1VA 2TDXA 2GQQA 3V8LA 2HQRA 2WC2A 2A68F 5DUKA 5JFRA 3IC7A 2QENA 4CYDA 2QBYB 2XGXA 3O6BB 3ZMTA 1O7FA 2H27A 2OAZA 1RI7A 2XAQA 3E3VA 1YW9A 2HZTA 1MDMB 1R22A 3FM5A 5H6QA 4R79A 2EB7A 4A0ZA 5LEKA 3K9TA 2NAZA 1JE8A 3HOTA 4ZZDA 1YG2A 4HDVA 4YIFA 4EVIA 2W24A 4XSXF 1JHHA 4N9HA 3E6MA 3ECHA 5E8GA 1G3YA 1I27A 2D2WA 2VBYA 4BXUA 5KK1A 5BOXA 4EGYA 3Q9SA 5H6RA 4L9NA 1UHMA 3CUQC 4A6DA 1WKMA 3NEUA 1Z1DA 2O03A 1UB9A 3MZYA 4HAMA 4CGZA 4GYIA 2VOPA 3FMRA 1XDUA 4A2UA 1REPC 1O7LA 1S6LA 5DV5A 1HKSA 2P7VB 4O6JA 3WGIA 1KYZA 5CYVA 1KQ8A 1U6GA 4S04A 3NRVA 2DI3A 3I54A 2DK5A 2ZCWA 4Y13A 1SFUA 3JW4A 2EJRA 5L3CA 5BMZA 2YX7A 4XRFA 2G7HA 2RQPA 3CJNA 1V3FA 2OZUA 2RDPA 2VT3A 3E5XA 2L54A 4U0VA 1HBXG 5LGTA 2L4AA 3GX4X 5LBQA 4UVBA 1BIAA 1ZG3A 4ENJA 4HA8A 1LB2A 2VBWA 4AD9A 5ILUA 4M9ZA 4ASNA 2YPRA 3RDIA 3VB2A 1MZBA 2HTSA 1P92A 2ZO4A 4O3MA 1TW2A 1RUNA 4L9VA 2CYYA 1GXQA 1ONVA 2JPCA 4IVNA 2MBFA 1B9MA 4M72A 3ABTA 2CW0F 5FFZA 2QUFA 1XGNA 1MJBA 3Q5FA 4L18B 3HTUA 4K2EA 2K02A 1U2WA 4KDPA 4OIOF 4I0AA 4S05A 2A07F 5E1WA 4PCQA 1SMYF 3S2WA 1G6NA 1MJ9A 4G8XA 2LF7A 1RZ4A 3FXUA 3KETA 2H6CA 3KE2A 3GYHX 3HRSA 1BI3A 2DT5A 4L0ZB 2L3DA 1T98A 4U0YA 1D8KA 2IPQX 3DEUA 1ZRCA 1BI2A 2NNNA 2JZYA 1GHCA 1E2XA 5HS9A 2HGCA 5D5WB 2P6SA 2GA2A 5K5QA 1YW7A 3TDZC 4LB5A 3LQRA 2RGVA 2BE5F 3M1EA 1T2KA 5LHIA 1JHFA 2GA1A 4IHTA 1I5ZA 3FM3A 4BHCA 3F72A 5E18F 1K79A 2Q2EA 4CDGA 1J5YA 1S7OA 2YSRA 5D4SA 2C6YA 2IT0A 3RJPA 3CUQA 1MGTA 2MLGA 1P2FA 3T5XA 2ZNYA 1PUEE 1ZGJA 1DPRA 2EWNA 1ZREA 3K1PA 1DDNA 1SFEA 1U8RA 5J6XA 4RAYA 2QM3A 1QBJA 2JPBA 1O3QA 3QU6A 1QQIA 4Q4ZF
chains in the Genus database with same CATH superfamily
3QPHA 1LQ1A 2V1XA 5FO5A 2DODA 1R00A 2Z99A 1V5EA 3QQAA 1K78A 3HTSB 2X0LA 1BL0A 1W7PA 1DPUA 2IS4A 1WJ5A 1ZRFA 4HF2A 5CVRA 1OMIA 3FIWA 2M7BA 3MWMA 3QRFF 3OYLA 2XF6A 3IRRA 3GTJJ 1TQIA 2RQQA 4EM1A 1DUXC 3HKZN 1GVDA 1B72B 2VBZA 3J80K 2M8EA 2R5YB 4IQJA 3LA2A 3IWFA 1RUOA 5ICCA 2H8RA 1OQYA 2F4MB 3PFYA 4BY1J 5FKLA 5DS9A 3LSMA 5ILSA 4FE4A 2CRGA 4GYGA 3AG3H 1ZKGA 3ABMH 4AU7A 3FXLA 5TRDA 2P8TA 2BY1A 1BJAA 3WGHA 2ZMEB 4ON0A 4HDUA 2L9SA 1D5VA 1U5TB 1W36D 2IGNA 1ZG1A 4G9YA 5JVTA 2GIZA 5FKOA 1VQ9I 2HI3A 2UZKA 2K85A 2Y9ZA 1TNTA 2JA6J 2VT2A 3C18A 2EFWA 2PMZN 3K4MA 5FLXK 3EYIA 2E60A 2PMUA 1S7AA 2E35A 1B4AA 1S3JA 5J1YA 1PP8F 1TWFJ 2CQ7A 2MC3A 4N4NB 4A0YA 3BJAA 3KP5A 5B5EC 3ZMSA 3I53A 1C0WA 2EK5A 2KIMA 1KU2A 1W5CC 3RKYA 1U5TC 3DKYA 5CKTA 1OISA 2GLOA 1FX7A 4EV0A 2VB6A 3TOAA 3GZNB 4HQEA 1X4PA 2JMWA 4AIDA 5IP9J 3P9CA 3WTVC 3CMYA 3CP8A 2OBPA 3M8FA 2VPLA 1BBYA 2WV1A 4ZTFA 1WCMJ 1ZGWA 1WHUA 1OR7A 2EV5A 4IHSA 5JHUA 1Q1VA 5FFXA 1F9NA 4A3JJ 1D3YA 2XSDC 3AL0B 1BW5A 5JI6A 5M5WJ 1D1AA 1KGSA 2NS7A 2RREA 4F52A 1FIPA 2VKVA 2BVMA 2ZFWA 1ZARA 4EGZA 2NOGA 2RVCA 3FHZA 2DA4A 4WF2A 4BY7J 3JREA 5IYDJ 1BC7C 2RKHA 3E0JB 3CTAA 4XN3A 5E1ZB 2IGKA 5HDNA 3JTGA 2ME6A 4LITA 2KQRA 3S3NA 2DPUA 1OLTA 1MBEA 4RGRA 3ERMA 4OIRF 3K4JA 2XB0X 4MLOA 4C3HJ 3BG6A 2COMA 2VONA 3SHFA 3LA7A 3SFIA 2OC6A 2ZFUA 3H5NA 4ZYEA 3O2PE 2X6OA 5CQEA 1XX5A 5FGMA 3I59B 2W48A 1JT0A 3BR2A 3F23A 1Y6IA 2DJNA 3FMQA 4UHTA 1VQPI 3N97A 4DGWB 3E5UA 1KU7A 4E7SA 1E3HA 1K6YA 2X1CA 4MO7A 1EH6A 3SQNA 1X1DA 4A12A 4ZH4F 2VXDA 4G7HF 4KISA 3RQ4A 2NOJB 5ICEA 1XCBA 2NNYA 3CJRB 3F8MA 1IXRC 2LRDA 3F8FA 1X1CA 4C3IJ 1H8AC 1MSEC 2BVLA 1TQPA 2DTZA 3ZOBA 1UZCA 1S9HA 1KQ9A 4BHPA 3LNQA 1CF7A 2VUMJ 2F6CA 3BQZA 3TL4X 4M74A 4XLHA 3A4CA 3EETA 3S15J 4NBQA 5A2QK 3GVAA 1H89C 2W82A 4R8HA 3J80Z 1OR7C 4KN4X 1X1PA 3WGGA 3CCRI 3IV5A 1R49A 1K78B 1ZYRF 2XGCA 1WFXA 1K7AA 3IH4A 1B8IA 3LFUA 4XLEA 2M8GX 2HXOA 2PG4A 3E6CC 1W7PB 1XMKA 2Z1DA 1BR4A 5F6FA 4EM2A 1TQMA 2MABA 4F92B 3E6BA 5IYBJ 3M3YJ 2A69F 2GBYA 1DGRM 3A0HC 1I6XA 3PIPF 1J0RA 1RESA 3TKYA 3ZQIA 2JA8J 1I39A 1FYKA 1BI1A 3DXJF 4ZZLA 4Q47A 3QYFA 2JA7J 2QQBA 2DBBA 2CQNA 3GO5A 1WJFA 1F36A 2AXLA 3AFHA 1TC3C 2MLKA 2EFNA 1IRZA 3W6KB 5FJ8J 3AG1H 5C4JJ 4GGGA 1K83J 3H9QA 1OCOH 2HKOA 3MD2A 2RAEA 1B59A 3GTLJ 2FOKA 3QYBA 2YR2A 4BHBA 2R7TA 2L9NA 2PN6A 3RKQA 2O5RA 4L9JA 4XK4A 1IC8A 2PEXA 3DTKA 2ACJA 2EV6A 1ZLKA 1O4XA 3L2UA 4BXXJ 1S8NA 1XCVA 4DBRA 3AAFA 2MD5A 2ZNZA 1ZH5A 4G12A 1ENHA 3FK7A 2Q1ZB 1QRYA 2TCTA 1R58A 3Q9VA 1YS6A 4C30A 2ZMEC 3LSKA 4XLNF 2F5FA 3CO7C 2PJRB 3UNGC 3AL0C 1UJ8A 2W85A 1IUYA 3F0CA 4UV8A 3S17J 4NQWB 5J47A 2IA2A 2QSFX 3K4BA 2QF7A 2DOEA 3OS0A 3Q0UA 2OF7A 1KU3A 2VE8A 2FX0A 4XLCA 2BXZA 2XPVA 3G1MA 3RKWA 4ABZA 2MYSA 4OOIA 3WTWC 4MTEA 4WXCA 1N77A 1R36A 2O0YA 2W4SA 3CCVI 1Z21A 3WG9A 3S16J 3GEZA 3OS1A 1Z7LA 4ESJA 1T33A 3H3UA 4Y7NJ 1ZG5A 3TGNA 2R5ZA 4RS8A 3ZMDA 4OIQF 4MFDA 1X2NA 3GTOJ 3GUDA 3M8EA 1E3PA 4QIWN 1SD7A 3S14J 3EUKL 2F2EA 3I55I 3I59A 1IXCA 5HNFA 3FXKA 4HLXA 2E1MC 4IHWA 2DDBA 4XORA 1H9GA 2VI6A 4OAZA 3TW7A 2CQKA 3HRMA 4OWRB 3C2GA 1DP3A 3BTJA 3I58A 3G6EI 2M1BA 4EM0B 5GAEJ 2WWYA 1LNWA 3ZCOA 1MMGA 3ZMVA 4HOBA 3JAMZ 2WAEA 4Q5SF 1T0FC 4HNTA 3FXMA 3ZQQA 4EJVA 2Q0OA 2ESNA 1ON2A 2P6TA 2M5WA 3QAHA 3VYSB 5LGUA 4DYCA 3J7AO 4IXAA 3OYEA 1HA8A 4A3KJ 1P4XA 2JK3A 3BG3A 3B6CA 2IBDA 1W36C 2K4JA 1TWAJ 1SFOJ 2Y69H 2Z16A 2B9SA 1LE8B 3KZZA 4YFXF 3ESWB 2N8GA 1OYIA 1ZN2A 4PJ0C 4JK1X 2QA4I 4A3BJ 1ETKA 1IXSB 1R5GA 4OMZA 3VODA 2F5DA 4ANJA 2LREA 5B1AH 2COBA 2EFPA 3HSEA 1V55H 3PO2J 4HF0A 1YRNB 3SYTA 5LRSA 5EEAA 2EILH 3KCCA 4IJAA 5J8FA 4DOZA 1I1GA 1XB4A 3GFMA 3HSFA 3I64A 5IOZA 1RETA 2R7OA 3AG4H 3H9JA 4AYBA 3H92A 5B66C 1SAXA 4FHTA 3EUHA 2HZDA 1Y1WJ 3FF5A 1U3EM 3TMOA 2Q8KA 3HDDA 2DA3A 1R23A 4BNCA 4LD5A 2HYGD 4LK1F 1W0TA 1MJAA 1U78A 1FSHA 5CVUA 5FLXZ 4EQQA 1LPQA 3C7JA 3ZN0A 3RCOA 4C9YA 2B0LA 5L3DA 4B43A 1YJNI 3DFGA 5IP6A 1FYLA 4B48A 1IN4A 1I50J 4XRSA 4BE0A 3G71I 2XF7A 5DCFA 2IEKA 2EZKA 3SFZA 4E7KA 3EPZA 2W1OA 3R0AA 2Z9OA 1BC8C 1ETOA 3JRAA 4G7ZF 1R4MB 2EA2A 2K4BA 2R3SA 3H36A 5FROA 3ZQHA 4J00A 4W1UA 1K4SA 3T8TA 1FOWA 1SVOA 4ENMA 4L0YB 1HXDA 5C3EJ 2R7WA 2AO9A 2IA1A 2V9PA 5F1RA 1IW7F 3DU6A 1F4KA 5GP9A 3OYFA 1QO0D 3QWLA 4OINF 1KONA 2DK8A 2HQNA 1YO5C 2FMYA 2QZ8A 1XN7A 4HV5A 1YFHA 3DKWA 1XGSA 2MA3A 2P4WA 4QPQA 2L0KA 4AM3A 2DU9A 3HOSA 3FBIB 3TDUC 4ZYGA 1D5YA 1V4RA 3JCUC 1U0JA 5GPAA 5LRRA 3RZDJ 2D1VA 2IVMA 1WJCA 4ETSA 5HS7A 4BUPA 1AKHB 1HSTA 1SD5A 1U5TA 3ZGKA 4A5NA 4UVCA 1LVKA 2HFHA 1OCRH 5D5UB 4IHYA 1MH3A 2UUZA 4LGWA 1EJ9A 1O57A 1B9NA 2AS5F 2R93J 2PJPA 4MNUA 2QBYA 1YI2I 3LQQA 5L3GA 5LHGA 3DTEA 1JKOC 1TWCJ 3I4NJ 3BY6A 1RKTA 4DYRA 3S2DJ 3L09A 2KIUA 1NG7A 4P9UA 3GF2A 3HGYA 3CLOA 1Z7UA 4I01A 1D0ZA 2VJJA 3KZIC 4I6ZA 4GO1A 2GM4A 5DCMB 2WAQN 1PYVA 3F22A 2K27A 1SMTA 1FJLA 3A01A 1MMSA 3CMMA 2DYSH 1A5JA 3OYCA 5E20A 3BWGA 3L2WA 1HSJA 1MNEA 1EA3A 1X58A 2JTVA 2GWRA 3OOUA 2P0WA 2L7ZA 2CFXA 5HOOA 3K70D 1IJWC 3E6DA 1BOBA 1J7KA 4C2UA 3HHGA 1J59A 2VQGA 1IN6A 3DBHB 3K4CA 4P9FA 3IP4B 5F0CA 5HLGA 2HEOA 4MIMA 4RLQA 5K5OA 4MGRA 4U88A 4E7LA 3ABUA 4CCNA 2JVHA 3RQIA 4ZC3A 5FKMA 2V1DA 3Q0WA 3OIOA 4MQVA 5DTDA 1WSUA 4QLCU 4U0WA 1YIJI 4LIVA 2ISZA 4OMYA 4L5EA 1DU6A 2XF5A 3KYLA 1FOYA 1DU0A 3LSJA 1IDYA 2FEZA 3KPHA 3HZJA 4HV6A 4RAZA 3LSPA 3ZP5A 4CICA 2XAGA 1A35A 2A6EF 3ABLH 1ITYA 1UHSA 3BR5A 3DV8A 3ISPA 1RNLA 5GADJ 1MW7A 1R1TA 3OYDA 1KA8A 2GZWA 3LWFA 1UCRA 4Y33A 2F5CA 3F8BA 2W00A 4HNUA 1LFBA 2K9NA 2OCEA 1J2XA 2LR8A 2HNHA 3HG9A 4II3A 1Y1VJ 2BY0A 2HOEA 1JXSA 4LFUA 4Y15A 2FOWA 2Y31A 2ISYA 4HRIA 3N4MA 1XSDA 4QPOA 4CCJA 3P9IA 1G3SA 3IH3A 3JRCA 1D1CA 4GFBA 2E1MB 2LF8A 1JJ8C 1TWGJ 3L9FA 2CUEA 2D1HA 1YQAA 1Z3XA 3TO9A 4H0EA 1J9IA 1Z77A 2DA1A 4E4HA 3KZYA 4V2FA 4NC8A 5DD4A 1MBKA 4PJLA 6PAXA 3W6JB 2XHKA 2E71A 4GDFA 2FU4A 2ID6A 4B1RA 2HVSA 1YOVB 2X9DA 3H3VK 5F0FA 3PSFA 1YRNA 1FNNA 2MH2A 4CO8A 2R7DA 2JT1A 3M7GA 2JRMA 3IAM2 1RPWA 1SFKA 1ACIA 3WTUC 3C3WA 4DNCA 1MMDA 1USSA 3KP4A 2XRLA 1YIOA 1W5SA 5BNGA 1TW3A 4HX8A 5DD8A 2DA7A 3OYIA 2NXNB 3BDDA 1U9NA 2CS3A 3LA3A 3DF8A 4XKWA 2BBYA 2DFHA 3RPUA 3CJTB 3DWLE 4IZZA 2ZXIA 1JKRC 3HBLA 1TWHJ 5D6FA 3KLNA 3VSLA 1T08B 5J1UA 2HQAA 1X1BA 1NH3A 3QOPA 2PJRA 3RZOJ 1MMAA 3FZVA 5LEJA 2LNBA 3HC7A 1VQ7I 4HF1A 2O3FA 1GVJA 4FASD 1SC7A 2DMQA 2E36A 3LAPA 1OPCA 1VQ5I 4OU0A 3WE3A 3KP6A 2FMLA 3FXRA 1STZA 1LEAA 2JUCA 4EJOA 1ETVA 2GOXB 2D45A 3PSIA 5A2QZ 1SEUA 1ZRDA 2CV1A 3J7ZI 4LB6B 2A6HF 4AIJA 4A3CJ 1R5HA 3BR0A 3LSRA 2OA4A 2ECCA 2PMZA 4BACA 2XV4S 3J81Z 4I09A 3F6VA 2OUMA 1W1WE 3W2AA 3CJQB 2AXTC 5CPRB 2KZGA 4NB5A 3CC7I 1OYWA 4ESBA 3DTIA 2HOAA 2HS5A 2CU7A 3FMSA 3LL7A 1SANA 3KLOA 2FQ3A 3ELKA 2O6GE 3QYEA 2LBFB 1GLNA 1BW6A 4E7ZA 4LLGF 2H09A 4GCVA 2UV1A 2YX4A 2M87A 2KIFA 2PX9A 4XR6A 1N75A 3PIOF 1YTYA 1LFPA 3CO6C 4XICA 1FPQA 4HPQA 4M3BA 3OYJA 2KRCA 3BOQA 3S8PA 5IT9Z 4Y4RA 4S0HB 3JTHA 2P5KA 4UB8C 4PJMA 2Y0SN 3BROA 3M9AA 1FOKA 3F8NA 2RNJA 4BE2A 2CG4A 2QQ8A 3BG9A 5IY5H 3S3MA 3PNTA 2H1KA 1BOAA 2P5VA 4UUSA 2ZJRF 1Y0UA 5FRMA 1F43A 5DCMA 1ZGAA 3GLLA 1QHHD 4I02A 2QQAA 3WU1B 3G3ZA 2ESHA 1LE8A 2ADUA 4A3EJ 3WTZA 4CZZA 1ORKA 2L7FP 2VC0A 4E7HA 4CHUA 4PK4A 3LAJA 2CQQA 2CUFA 3S1RJ 1S5LC 2ZXWH 3IH2A 1F5TA 3MCZA 2ME0A 3ERED 5FLVA 2HKXA 2DTRA 2QWWA 5BS6A 3ASNH 2XGDA 2HTJA 4CCMA 2I8DA 2K40A 3WTSC 3HB9A 3DP7A 4KUMA 3GWZA 1GDTA 3FX3A 4AWXB 3QPSA 4B3AA 4E7IA 2QKLB 2Y75A 5H2FC 1NTCA 4EJTA 1XC5A 3CESA 5LGNA 1FC3A 2L5QA 3U2RA 4BU2A 5E8IA 5D5XB 1HW1A 1XDSA 3L00A 1TBXA 2LSOA 4BKXA 1DGWY 2R7ZJ 1Z9CA 3CLQA 1ON1A 1FWZA 1OYYA 3HXLA 5LLQA 2WB1A 4FE7A 3GXOA 4DJAA 1SD6A 3MZHA 4M3GA 1FTTA 2BY2A 2PBIA 2XROA 4F91B 4GXOA 4RDUA 4I0BA 4YFNF 2AHQA 1V5GA 2IA0A 4N4OB 1QU3A 1VZ0A 4TV7A 3QP5A 4MQ9F 1FZPB 2VOOA 1YJ9I 4KIFA 4W97A 3R61A 1OKRA 2KLOA 3FXJA 4D0PA 5HLHA 2HVQA 4FETA 2E7WA 2JA2A 3HUGA 3R4KA 4KNYA 2WA0A 2WV0A 3EYYA 3IAS2 4YIRX 2K3PA 3PQJA 5HVQC 2Y2ZA 3HOUJ 1YX3A 5J4VA 4XLFA 4M9SA 4UV9A 2DAOA 4DZPA 1CGPA 1L0OC 4NC7A 1FBUA 2FNAA 1PP7U 1TNSA 1XMAA 3LSGA 2ZKZA 5H20A 2X48A 3V8KA 2LY9A 4LJZF 4ZYDA 1AWCA 2ZB9A 4PGGA 3M1CA 1JGGA 2VN2A 2VQHA 3OL3A 3PFIA 2K3FA 1RIOH 4LLNA 1N25A 5CQGA 2FSWA 5IT3A 3C2HA 4WXDA 1WJBA 3JSPA 3BR1A 2G7UA 2LK2A 4D5CA 1JUMA 4DBQA 3QP6A 4ZDOA 1Q1HA 1WH7A 2GXBA 4LK0F 1NK2P 3BG7A 3PM1A 2EIJH 1H88C 2O8XA 3DEWA 5J8CA 3OYBA 3D1NI 3CUOA 4XRMA 2XAJA 4XL9A 2K9MA 3JSOA 4EMSA 1D0YA 3HM5A 1ZELA 4JX6A 1UG2A 3ULQB 3W2WA 3CD6I 1TLHB 2V6CA 1G3TA 1D0XA 4YFKF 3BJ6A 4B8XA 1H0MA 1AU7A 3K7AJ 1LDDA 2QVOA 2OTLI 2JUGA 1OFCX 1QPIA 3H5RA 3MAJA 3BT9A 2H6BA 2P5LC 2XC7A 1JKPC 1EH7A 1QZEA 1SAUA 1BIBA 1P6RA 2IS1A 3LFKA 2K9SA 3DBRB 3CF5F 3CF2A 4L5IA 2Y0MA 1LVAA 2Y9YA 5K7ZA 5M3MJ 3JRBA 3H3ZA 1I1SA 1O3SA 1IRXA 2LOOA 2PFBA 3ZQFA 4A5MA 2LY2A 3HIFA 3L2VA 1XG1A 3S2HJ 2XVCA 3ZQ7A 1WJEA 2YS9A 3KFWX 1P4AA 4X1EA 2R7QA 1JTYA 3K10A 4E7JA 1DP7P 2JA5J 3PNVA 2PQ8A 1ZR4A 5E79C 1BI0A 1WWXA 5B1BH 3Q3SA 4J19A 3H9GA 2XSJC 5K7FA 2WAFA 1JJ6C 3FKIJ 4WCGA 5EGOB 2HXIA 3VPRA 5DEQA 2NYXA 4U7DA 4ENKA 2MSYA 2KMUA 1XD7A 2ETHA 1GT0C 4MEXF 2VODA 2EZIA 2E19A 2BY3A 3OL4A 4F55A 2ZJPF 3RSNA 5E17F 1WPKA 2DPDA 2UXXA 2W7NA 2W25A 3BTIA 2OD5A 3EQLF 4HX7A 4PGHA 4AIKA 1RC9A 5DYMA 1UAAA 2LP0A 3T8RA 1USTA 2MW8A 1LKXA 4YIIA 2WY8Q 4CSWA 2MFZA 4UVAA 1LEBA 2DFIA 2DJIA 4HQMA 2ELJA 3OOPA 1ETXA 2OV7A 4A93J 4RAGA 1PUFA 3S93A 3ZPLA 3G73A 1HLVA 1OJLA 4B44A 4PFOA 4I2OA 2Y30A 5ICFA 1E3OC 3L7WA 3SZGA 3MVPA 4IRIA 3U9GA 2O8KA 2HQ5A 3HL2A 3HRTA 1Z91A 3KEQA 4L5JA 4PZJA 3ZQGA 3S1QJ 1ZAOA 1FTZA 2CGPA 4D7NA 3QU3A 3OIQA 2BOLA 3IWZA 2I5UA 4M3DA 1Z67A 3F6OA 1TL8A 1G4DA 3ABKH 2B63J 1BN5A 1P9QC 5FD6A 3CUQB 2E1OA 4G6DA 4RGSA 2BZTA 1T0FA 4I98B 1A6QA 2FBKA 4JX5A 4IPAA 1JUPA 2X85A 5J3LA 3COAC 3DQVC 2LKXA 1ZHFA 3RKXA 1KQ0A 2J5PA 4UNOA 3IRQA 2A61A 3G2BA 1SVMA 3DPLC 1XGOA 3MKWB 1B1BA 3CP2A 2X51A 1K6OA 2XASA 4RGXA 2FBIA 1T56A 3K1MA 1Z6TA 3U1KA 5F08A 2JN6A 2ZXJA 4MTDA 2L01A 4GRIA 4NHJA 2W57A 3KX2A 2NS0A 2OCCH 4F7ZA 3GTMJ 4MEYF 2HYJA 3OMYA 2YU9J 4A3GJ 1E17A 3L2QA 4IHXA 3T0YA 3D5SC 4C3JJ 2PI0A 4D5FA 3L2RA 3V7RA 5GPCA 1A04A 2FBHA 2LDUA 2IRFG 2ID3A 2O7OA 2M0MA 4YG2F 4AVZA 2V7FA 1MKMA 2FNPA 3ML6A 2KJCA 3BJOA 4BJ5C 4IO9F 2E1NA 2VKDA 1LFUP 5EZGA 3VEPA 1R7JA 2E5NA 5F04A 2DMPA 1BA5A 3GFLA 2FJ1A 4IRGA 5DUIA 4A3DJ 2A5WA 2JJ7A 4D9JA 2F48A 1YYVA 4P1WA 5IT9K 3S1MJ 2IXSA 4LMYA 2BHZA 1X3WB 1P4WA 3GW2A 1JUSA 3B02A 3K1NA 1MNDA 4BQNA 3G1OA 2CMPA 2CJJA 2QKMB 3BCAA 1AKHA 1FMVA 4JP0A 4AC0A 4CXFA 3G4SI 3TO6A 3ZMUA 1G8XA 3R6SA 3RYPA 3SDGA 4B47A 1HKTA 4QWQA 3H1CA 3WE2A 5BQTA 5F1JA 5AIQA 4RGUA 2FXAA 2KRHA 5HDKA 4QTRA 2LD5A 3GTKJ 4LIUA 3FISA 2DFFA 2GIVA 3HSRA 1IV8A 2DA5A 4DQ2A 3WTYC 1ETWA 1R71A 4WK8F 5HLTA 5F64A 4XN0A 2QSHX 3CCYA 3CQZJ 2OPTA 5CVJA 1S29A 2Z2SB 3B73A 1GV2A 2K5CA 2VKHA 2W84A 3FDYA 3E97A 1HF0A 4Y3OA 1B6AA 2V9VA 3SEQA 1MD0A 4BQAA 2KRFA 2GXGA 3BP8A 3I5UA 2BEOA 3FWEA 4G6QA 4HW0A 1O3TA 3MQ0A 5GAGJ 3J81K 4UUSB 3DLAA 3JAMK 2ZC2A 5ILVA 4X6AJ 3K2ZA 2JQ7A 4P96A 4QSHA 2CW8A 2VC1A 5JR3A 2R92J 4PJJA 3A0BC 4LG0B 1R5ID 1A36A 4N9IA 5ERIA 2LMDA 2X1DA 1FP1D 4G6TB 4O5VA 2VQCA 4BEHB 2DOFA 3CMEI 3HOZJ 3DBLB 3FHNA 3K4NA 4M6YA 5JLXA 3RI4A 2EFOA 5E3OA 2QEXI 2LYCA 2DO7A 2JSPA 3BQYA 4WXHA 3GFIA 1W0UA 4M9XA 4KN7X 1HW5A 5HLIA 2Q2EB 4XKBA 2E2JJ 5TISC 2HDDA 1VI0A 3ECOA 5EYRA 2HWVA 3D0SA 3KEYA 1FP2A 3C1DA 2XB5A 4M6VA 2R7UA 1IZ1A 5BPIA 1WH5A 2XUBA 1QZYA 3GZ6A 1YE9A 2EA4A 4PDKA 5D8KB 2ZSIB 2EZHA 1XSXA 2WBMA 1DQUA 3DEEA 4CZCA 2P7CB 1Z6RA 2LKSA 1VTNC 4KA4A 5K7HA 2DW4A 3G1LA 2IW5A 4XLPF 1MMNA 2OQGA 2HOSA 4E6KG 1V54H 3E5QA 2B7EA 3V7CA 4ZYAA 2VJ5A 5HDGA 4DYQA 4KFCA 2PLYA 4UXNA 3ZRGA 4HG2A 3GZ5A 1YX5A 3PO3J 2VE9A 2J5OA 1FLIA 4IRHA 2LH9A 3MKZA 1ZQ3P 2JVGA 2M30A 4MHGA 3MKYB 1GUUA 2STTA 2WY7Q 2XAUA 1EH8A 1PUFB 1JT6A 2L9RA 4YELA 3ZMZA 1J75A 4ITVA 3CMAI 5FKKA 3HKZA 1IF1A 3M4OJ 1XPXA 2HPMA 2ZBKA 3K2AA 3OYGA 4KMFA 3V7SA 3P7NA 4FX4A 1X3UA 5E1XA 1FEXA 3HYIA 3LSIA 3H0DA 2BGCA 2NVUB 3BPVA 2L7KA 1A31A 4A3FJ 2WAQA 5DM6F 4IOAF 2IGMA 4XKVA 4HEA2 4NDLA 3W3CA 1IN5A 2Z5UA 4P55A 3U1DA 2HYFA 2HOTA 1FT9A 2QYOA 1TP4A 3QPTA 4YEJA 2ZMEA 3TW6A 1SFXA 4BXFA 4WX9A 4G94A 3VWBA 5CVVA 2IAIA 3KP2A 1P7IA 1WRJA 3PJRA 2EQRA 2OZ6A 5M5XJ 3N05A 3P9KA 4H4KC 3KP7A 2NS8A 2A05A 1ZK8A 2CUJA 5IOYA 2XIGA 1FYMA 2A6TA 2EZLA 1ETYA 1WJAA 1G3WA 2EV0A 1HC8A 3HOXJ 2R7FA 1TT5B 2OJED 5AONA 3H35A 1Z3YA 4N0BA 2EINH 3HJEA 3VFZA 4A0XA 5E3NA 5BPDA 3J7AY 4CYCB 4NQWA 1R1UA 3C2BA 5EDNA 3HRUA 3RPQA 3CDHA 4DW6A 5KAFC 2CO5A 1ZLJA 2QQ9A 3OYMA 4R1HA 1W5TA 2STWA 1AOYA 1RR7A 4BAYA 1WI9A 2AQFA 1UMQA 4G7OF 1AHDP 3GTGJ 2VBXA 2R7VA 2E7XA 4A3LJ 1APLC 2EFQA 1W7PD 2XAFA 2M7AA 2M9HA 3I4PA 1X2MA 3OYAA 1XGMA 2BHYA 4RB3C 4IKFA 3LSTA 1IV6A 2V26A 3CCUI 2M2EA 4RLFA 3RIRA 2LBFA 1JGSA 1IRFA 1L3LA 5EEGA 2DMTA 5AIPA 2OQRA 1JI8A 3F8CA 2OTJI 2L4MA 5TJJA 2FRHA 5JVGF 2FE3A 3RYRA 4U87A 3TOBA 1WVRA 2FUG2 2VJIA 1UG0A 3TEDA 3K70C 3OIPA 5TGTA 1D8JA 1LDKB 2Y48A 5E3MA 1WGXA 3K6GA 1EKEA 3WG7H 4A3IJ 4OIPF 2X4HA 4RAFA 3NQOA 5EF6A 3QOEA 3D5RC 3V42A 2F4OB 3CCMI 3HOVJ 4PUSA 2I10A 4FX0A 3R0JA 2XKPA 3TP0A 4BQOA 3MEXA 4RB1A 3BZ6A 4YRVA 3TO7A 1ZTRA 5IPAA 1POGA 2CUZA 4XOTA 5LHHA 3MFKA 4HSRA 3I4MJ 1HCRA 3VOEA 4UB6C 2KKOA 3PQKA 1Z05A 3HOYJ 1LDJA 2LC2A 3EDPA 3JRFA 1MBGA 2IJLA 3ZN1A 5ICGA 1IRGA 4JOMA 1BJZA 3OR2C 3BR6A 1BR1A 2BW3B 2MGQA 3IUOA 2DXIA 2LTPA 4MFEA 5FD5A 4EATA 3SDBA 4WWCA 4JQFA 4A3MJ 2G9WA 5CLSA 4XMYA 3Q0VA 2V79A 2DQRA 3JRHA 2K86A 1H9TA 2TRTA 2DMUA 3L1PA 4XSZF 4U7BA 2GAUA 4V19K 1U8BA 4PSWA 2ZJ2A 3K69A 1FSEA 2DFEA 5JHFA 2M4KA 2JWTA 2XRNA 1K4TA 2LFBA 3K0LA 4FT8A 4KIGA 1X4OA 4A6EA 2XDVA 3HHHA 5EZHA 5FKNA 5L3FA 3F21A 2RNGA 5HNHA 4FTHA 4IF4A 3T1BA 3E7LA 2KT0A 1TT0A 4NUBA 3W2VA 2DLLA 2A3SA 5ED4A 5EG0A 5EG0B 5F0HA 4DZJA 4BQQA 2FA5A 3J7YJ 1BM9A 2OU2A 4HLYA 4EJUA 1O3RA 2R5YA 1MBFA 3BC8A 3SJMA 3WHBA 2CFOA 3REOA 3CC4I 4UUVA 4KIBA 3CC2I 5K1YA 3X2QH 1LJ9A 4M6XA 4AVPA 4JYKA 4NNJA 3EUHC 1IG7A 3D5LA 1QPMA 3GFJA 1HW2A 3GLXA 4E70A 2FQ4A 2KHMA 1PDNC 2KJBA 3ONQA 4IQ4A 2DT7B 5GTHC 2M4GA 5FLMJ 2YU3A 1MDMA 3JRGA 3OWTA 2M45A 5IP7J 4XRSG 4HBLA 3OSGA 3PUFA 1IN7A 4Z6YA 4B3XA 2PMHA 1FBSA 2LLKA 3KEOA 1VQLI 5B3SH 1I6HJ 4BBSJ 5J40A 3GMEA 4ENNA 1ULYA 1HQCA 4M73A 1OCTC 5K5RA 5E3LA 2MD0A 2R7RA 5D6EA 2EH3A 4BJ6C 2VL8A 4ESFA 2DQLA 5GTIC 2E1CA 3IKTA 2VQLA 2K7LA 2VXZA 3A2KA 1YLFA 5F27A 3VDXA 1WQ2A 5DDGA 2DT6A 4B09A 1QVUA 3HEFA 3WODF 1HKQA 5KCMA 1TTYA 3OYHA 3F3XA 2IP2A 4XBFA 1VQOI 1XSVA 1AA7A 4KYWA 3EUAA 4DIQA 5D5VB 3OYKA 1GXPA 1KZHA 3BZKA 4KICA 1T39A 2V4JC 3V8JA 1RKWA 3FKJA 3PNYA 4JX4A 1CQTA 2NVQJ 2GXAA 3E1SA 2DOAA 5D8LB 1VNDA 5J4YA 3WU0A 4ZYHA 3V4GA 1FY7A 3SXYA 5L3EA 4FISA 2HU9A 4JBAA 4KT5C 2LKPA 2CSOA 2RC4A 3FXOA 2H94A 4LG3A 2VJ4A 2VKEA 3LOCA 1Y39A 1RR8C 3O8HA 1FBQA 4RBOA 3SZTA 4AUXA 3BPXA 4OAYA 1YS7A 3DPTA 2BYVE 3OV8A 2ECBA 2V1UA 2ICWG 3L2CA 4BDZA 5EGOA 1BR2A 1ODDA 4HZFA 4V2GA 1I3QJ 2F4IA 2EIKH 3IHUA 4AIHA 4HYEA 5HS8A 3ZQLA 1HOMA 1CF7B 4P5OA 3ROUA 2ZSHB 1MSFC 5CVIA 2UWMA 1EV7A 2EPFA 3RTRA 2F5EA 5CJ9A 3SZPA 3IKVA 4LLLA 3KP3A 5C44J 4LG0A 4BYYA 4KMUX 1HDDC 3R60A 4XNFA 3TQNA 2VASA 4HX4A 1SD4A 2BW3A 3O3KA 1QZZA 1IAWA 1FMWA 2UXNA 4BJTA 3WTXC 1VQ6I 3AG2H 4Y17A 1YW8A 3HGGA 1T6SA 1LUJB 2X1EA 3I0TA 3S1NJ 2DDAA 5EEHA 1F1ZA 1NG6A 4IL6C 1S72I 4NC6A 5LD2C 2A5YB 3MKLA 4D7MA 2FF4A 2M0CA 4EJWA 4I99C 2VLAA 1U9OA 3IL2A 2ELHA 2MH9A 4C2TA 4IEJA 2BV6A 2QGUA 4CCLA 1K61A 2RV8A 1Y56A 1ZR2A 4HSTA 2V1NA 1Y0NA 3H0GJ 1WZ2A 2XKOA 3F9KA 1NHAA 5L3BA 9ANTA 3U21A 3QODA 1UHWA 2L02A 2JSCA 2XAHA 3CCSI 1QGPA 2QLZA 5KVRA 4Q48A 1IN8A 5IYCJ 2CWEA 1MH4A 1ERDA 1YITI 1KYWA 3JR9A 1EF4A 2LVSA 1IDZA 3WHCA 4PSXA 1VQMI 1OCPA 1QA6A 2RN7A 2AQEA 2CV0A 4L9TA 2NRAC 1W4MA 1QNTA 3FXQA 3ZXSA 4M71A 2DCEA 5FB2A 2HR3A 4A69C 4BH9A 2JRTA 2Z33A 3WTTC 2WTEA 4Z2YA 4I7HA 1T38A 3A1YA 1X19A 2KDOA 1UFMA 4RB2C 1YJWI 2HDCA 1YHQI 3CCQI 1KU9A 2CV2A 2O61A 5D4RA 1Z0XA 2X6WA 4IOCF 3I71A 4RB0A 3S3OA 1T8IA 3HPHA 3DU5A 4ZDPA 2Z3YA 1R1VA 2H8WA 2TDXA 1T95A 3MN2A 4XM3A 2XPUA 3FBNB 4IX7A 2GQQA 3V8LA 2HQRA 2WC2A 2A68F 3HUGB 5DUKA 5JFRA 2R7XA 1RRJA 3IC7A 1FIAA 2QENA 4CYDA 4CCOA 5KNLA 1MIJA 3BZCA 4F93B 2EBIA 4LOCA 2E2HJ 3O6BB 2XGXA 2QBYB 3ZMTA 1O7FA 2ELKA 2H27A 2R7SA 2OAZA 1ETQA 1Y8QB 5GAHJ 1PVEA 1RI7A 2XAQA 3E3VA 1TZLA 1YW9A 3VYUB 2HZTA 1MDMB 1R22A 3OSFA 1SVLA 1WI3A 3FM5A 5H6QA 4R79A 2EB7A 2D5VA 4A0ZA 5LEKA 2DMNA 3K9TA 2NAZA 2R5ZB 4CYCA 3A01B 1JE8A 2DYRH 3HOTA 4ZZDA 1YG2A 4HDVA 4YIFA 4EVIA 3DLLF 2W24A 3LSHA 4XSXF 1JHHA 4N9HA 3E6MA 4XONA 2Y0SA 3NWSA 3ECHA 2NVXJ 3DCFA 4II2A 1VF9A 5E8GA 1G3YA 4BBRJ 1I27A 2D2WA 4KJZA 4ZTJA 3M07A 1FOXA 2VBYA 2E2IJ 4BXUA 1P7JA 4M3EA 3I56I 5KK1A 5BOXA 4EGYA 3Q9SA 5H6RA 4RM3A 5KHDA 4L9NA 3DPUA 1UHMA 2LY1A 3CUQC 2K9LA 4A6DA 2F5VA 1WKMA 4CCKA 3NEUA 2VPRA 1Z1DA 3PUBA 2O03A 1UB9A 3MZYA 4HAMA 4BDYA 2V6EA 5HODA 3K4KA 3HPGA 1N78A 4CGZA 4M3FA 2CH0A 3BLYA 3ASOH 4GYIA 3OY9A 2VOPA 3FMRA 3JRIA 3BG5A 4FCYA 1PJRA 1XDUA 4A2UA 4F3QA 1REPC 3GTQJ 1O7LA 3OR1C 1S6LA 5DV5A 3ZQCA 1S7EA 5M3FJ 5FRNA 1HKSA 2GOMA 2P7VB 3SEZA 4O6JA 2IGOA 3WGIA 1KYZA 4D1QA 5CYVA 5EJCA 1KQ8A 2R0QC 2NVTJ 1U6GA 4S04A 2CW7A 3K4LA 2DI3A 3NRVA 4C2MJ 2HDWA 2MC4A 4IHVA 3CZ6A 3I9V2 3I54A 4RA2A 2VIXA 1JKQC 3NAUA 3S32A 2KISA 2WB1N 3M8JA 2DK5A 4Y52J 2ZCWA 3QPLA 4Y13A 1SFUA 3JW4A 2EJRA 4KITB 5L3CA 2ZJQF 5BMZA 4BEHA 2YX7A 3NARA 4XRFA 2G7HA 2HVRA 2RQPA 3CJNA 2LG4A 3I3LA 3BTLA 3OS2A 1V3FA 2OZUA 2RDPA 2VT3A 3E5XA 2L54A 4HNVA 3W6VA 2ZXHA 4U0VA 1HBXG 5LGTA 4XKCA 3OYNA 2K9QA 3VYRB 1Y8RB 2L4AA 1R9TJ 2CQXA 1D1BA 3GX4X 5LBQA 4UVBA 1BIAA 2G0EA 4XIDA 1ZG3A 3DKXA 4ENJA 2L7MP 3LMMA 3CDIA 4HA8A 1LB2A 2MG4A 3TP3A 2VBWA 1QVTA 3A03A 3RPUD 4AD9A 5ILUA 5JLWA 4M9ZA 4ASNA 2YPRA 3FK6A 4BE1A 1B72A 3RDIA 3VB2A 1MZBA 2HTSA 4RMNA 1P92A 2ZO4A 1X3ZB 4XQFA 4O3MA 2R4GA 3UKGA 3MZ8A 1TW2A 1M1EB 1RUNA 1VFCA 4L9VA 2CYYA 3PL8A 1GXQA 1ONVA 1MBHA 2JPCA 4IVNA 1A6IA 2MBFA 1B9MA 4M72A 3ABTA 2CW0F 5FFZA 2QUFA 4BGDA 3JRDA 1J09A 1XGNA 1MJBA 2KP6A 2DN0A 3CCLI 3Q5FA 4CH7A 4I76A 3CDLA 4CA0A 4L18B 3ZR8X 4UUTA 1UELB 3HTUA 2P81A 4K2EA 1OCZH 4AYBN 2K02A 2EIMH 4B4CA 1U2WA 3KYDB 4J01A 1NK3P 2KZVA 4KDPA 4OIOF 2M3AA 2QCOA 3O8GA 5KAIC 3GCMA 1R6RA 4XOPA 4I0AA 1JTXA 3A02A 4S05A 4ZDLA 2A07F 2X6YA 2O9LA 1I3AA 5E1WA 3B6AA 1MNMC 3KYCB 1IUFA 4PCQA 1MBJA 1E0EA 1SMYF 3S2WA 2E34A 1G6NA 3KIOA 1MJ9A 3WU2C 2H1LA 4G8XA 1GV5A 5C4XJ 2LF7A 1VQ4I 1RZ4A 3HOWJ 3FXUA 3KETA 2H6CA 1R4NB 4KT6A 3KE2A 1XTAA 2DA6A 3BTCA 3GYHX 3HRSA 1BI3A 2L9VA 1XMXA 2DT5A 4L0ZB 5J1RA 2L3DA 1X1AA 2E5ZA 2QSGX 1T98A 4U0YA 1D8KA 3UR3C 2IPQX 3DEUA 1ZRCA 1BI2A 2NNNA 3VSKA 2JZYA 2XPWA 4XLAA 1GHCA 1E2XA 5HS9A 2HGCA 2KFDA 2YUSA 3MMYB 3GTPJ 5D5WB 4ZJZA 2WADA 2M34A 2P6SA 2GA2A 3AKZA 5K5QA 1YW7A 3TDZC 3BR3A 4LB5A 1G59A 1G2HA 5LFAA 3LQRA 2RGVA 1IGNA 3NWTA 2BE5F 3M1EA 2FD5A 1T2KA 2KDZA 2KPMA 5LHIA 1JHFA 2KL4A 2V9KA 2GA1A 4IHTA 1I5ZA 3GBGA 3FM3A 2HPIA 2IS6A 5DM7F 4CUGA 3H5AA 4BHCA 2NVYJ 3F72A 4PFPA 5E18F 1B8IB 1K79A 1WJDA 1QHGA 2Q2EA 4CDGA 1IO2A 1J5YA 1S7OA 2YSRA 1V5FA 5D4SA 2XGEA 5M5YJ 3P5JA 2IS2A 2C6YA 1HDPA 3VYTB 3TBIA 2IT0A 4UY8I 3RJPA 1VQKI 3CUQA 4EEFG 4PJNA 1MGTA 2BXYA 1OCCH 2MLGA 1XS9A 1P2FA 3T5XA 2ZNYA 2L2OA 4FQGA 1PUEE 1ZGJA 1DPRA 4RM2A 2EWNA 1ZREA 3K1PA 1DDNA 1SFEA 3CCEI 1U8RA 5J6XA 4RAYA 3BCBA 2QM3A 4BL0B 4BS9A 3CCJI 1QBJA 2JPBA 2DA2A 2X6XA 2KIQA 1VQ8I 1O3QA 3QU6A 1QQIA 4X0GA 4Q4ZF 1VQNI
chains in the Genus database with same CATH topology
3QPHA 1LQ1A 2V1XA 5FO5A 1R00A 2Z99A 1K78A 3HTSB 2X0LA 1W7PA 1DPUA 1ZRFA 4HF2A 5CVRA 1OMIA 3MWMA 3QRFF 3IRRA 1TQIA 4EM1A 1DUXC 2VBZA 3J80K 2M8EA 3LA2A 3IWFA 1RUOA 5ICCA 5ILSA 4GYGA 5TRDA 2P8TA 1BJAA 3WGHA 2ZMEB 4ON0A 4HDUA 1D5VA 1U5TB 1ZG1A 4G9YA 5JVTA 2UZKA 1TNTA 2VT2A 3C18A 2EFWA 5FLXK 3EYIA 2PMUA 1S7AA 1B4AA 1S3JA 1PP8F 2MC3A 4A0YA 3BJAA 3KP5A 3ZMSA 3I53A 1C0WA 2EK5A 2KIMA 1KU2A 3RKYA 1U5TC 1FX7A 4EV0A 3TOAA 4HQEA 3P9CA 3WTVC 2OBPA 3M8FA 1BBYA 1OR7A 2EV5A 4IHSA 5JHUA 5FFXA 1F9NA 1D3YA 5JI6A 1KGSA 2ZFWA 1ZARA 4EGZA 2RVCA 3FHZA 4WF2A 1BC7C 2RKHA 3CTAA 5E1ZB 5HDNA 3JTGA 2DPUA 4RGRA 4OIRF 2COMA 2VONA 3SHFA 3LA7A 4ZYEA 3O2PE 5FGMA 3I59B 3F23A 3FMQA 4UHTA 3N97A 3E5UA 1KU7A 1EH6A 3SQNA 4A12A 4ZH4F 4G7HF 5ICEA 1XCBA 2NNYA 3F8MA 1IXRC 3F8FA 1TQPA 1KQ9A 4BHPA 1CF7A 4M74A 3EETA 5A2QK 3GVAA 4R8HA 3J80Z 4KN4X 3WGGA 1K78B 1ZYRF 1K7AA 3E6CC 2PG4A 1W7PB 1XMKA 5F6FA 4EM2A 1TQMA 3E6BA 2A69F 1I6XA 1J0RA 3TKYA 1FYKA 1BI1A 3DXJF 4ZZLA 4Q47A 2QQBA 2DBBA 3GO5A 2AXLA 2MLKA 2EFNA 3W6KB 4GGGA 2HKOA 1B59A 2FOKA 2YR2A 4BHBA 2PN6A 4L9JA 2PEXA 2ACJA 2EV6A 1ZLKA 1S8NA 1XCVA 3AAFA 1ZH5A 2MD5A 2ZNZA 1R58A 3Q9VA 1YS6A 4XLNF 2F5FA 3CO7C 2W85A 1IUYA 4UV8A 2IA2A 1KU3A 2VE8A 3RKWA 4OOIA 3WTWC 4MTEA 4WXCA 1R36A 2O0YA 3WG9A 3GEZA 4ESJA 3H3UA 1ZG5A 3TGNA 4RS8A 3ZMDA 4OIQF 3GUDA 3M8EA 1SD7A 2F2EA 3I59A 1IXCA 4HLXA 1H9GA 2CQKA 3HRMA 3I58A 2M1BA 4EM0B 2WWYA 1LNWA 3ZMVA 4HOBA 3JAMZ 4Q5SF 4EJVA 2Q0OA 2ESNA 1ON2A 2P6TA 2M5WA 3QAHA 5LGUA 3J7AO 4IXAA 1P4XA 2K4JA 3KZZA 4YFXF 1OYIA 1ZN2A 4JK1X 1IXSB 1R5GA 4OMZA 3VODA 2F5DA 2EFPA 3HSEA 4HF0A 5LRSA 3KCCA 4IJAA 5J8FA 1I1GA 1XB4A 3GFMA 3HSFA 3I64A 3H92A 1SAXA 4FHTA 3EUHA 3FF5A 1U3EM 2Q8KA 1R23A 4BNCA 4LD5A 2HYGD 4LK1F 1MJAA 1U78A 1FSHA 5CVUA 5FLXZ 4EQQA 3C7JA 3ZN0A 2B0LA 5L3DA 3DFGA 1FYLA 1IN4A 5DCFA 3SFZA 3R0AA 2Z9OA 1BC8C 4G7ZF 2EA2A 2K4BA 2R3SA 3T8TA 4ENMA 4L0YB 1HXDA 2IA1A 5F1RA 1IW7F 1F4KA 1QO0D 4OINF 1YO5C 2DK8A 2HQNA 2FMYA 2QZ8A 1XN7A 4HV5A 1YFHA 3DKWA 1XGSA 2MA3A 2P4WA 2DU9A 3HOSA 3TDUC 4ZYGA 1V4RA 5LRRA 2D1VA 2IVMA 4ETSA 5HS7A 1HSTA 1SD5A 1U5TA 4A5NA 4UVCA 2HFHA 5D5UB 4LGWA 1O57A 1B9NA 2AS5F 2PJPA 4MNUA 2QBYA 3LQQA 5L3GA 5LHGA 3BY6A 3L09A 2KIUA 4P9UA 3GF2A 3CLOA 1Z7UA 4I01A 4GO1A 5DCMB 3F22A 2K27A 1SMTA 5E20A 3BWGA 1HSJA 2JTVA 2GWRA 2CFXA 5HOOA 3E6DA 1J7KA 3HHGA 1J59A 1IN6A 4P9FA 5HLGA 2HEOA 5K5OA 4MGRA 4U88A 3ABUA 2V1DA 1WSUA 4MQVA 4QLCU 4U0WA 2ISZA 4OMYA 2FEZA 4HV6A 4RAZA 3ZP5A 4CICA 2XAGA 2A6EF 3DV8A 3ISPA 1RNLA 1R1TA 1KA8A 2GZWA 3LWFA 1UCRA 2F5CA 3F8BA 1J2XA 2HOEA 1JXSA 4LFUA 4Y15A 2ISYA 3N4MA 1XSDA 3P9IA 1G3SA 2LF8A 3L9FA 2D1HA 1YQAA 3TO9A 4H0EA 1J9IA 3KZYA 5DD4A 6PAXA 3W6JB 2XHKA 2FU4A 1FNNA 2MH2A 4CO8A 2R7DA 2JT1A 3M7GA 3WTUC 3C3WA 4DNCA 1USSA 3KP4A 1YIOA 1W5SA 1TW3A 4HX8A 5DD8A 3BDDA 3LA3A 3DF8A 2BBYA 3RPUA 5D6FA 3KLNA 3QOPA 3FZVA 5LEJA 2LNBA 4HF1A 2O3FA 1GVJA 3LAPA 1OPCA 4OU0A 3WE3A 3KP6A 2FMLA 3FXRA 1STZA 1LEAA 4EJOA 2D45A 5A2QZ 1ZRDA 4AIJA 4LB6B 2A6HF 1R5HA 2OA4A 2XV4S 3J81Z 4I09A 3F6VA 4NB5A 1OYWA 4ESBA 2HS5A 3FMSA 3KLOA 2FQ3A 3ELKA 2O6GE 4LLGF 2H09A 4GCVA 2YX4A 2M87A 2KIFA 1YTYA 3CO6C 1FPQA 3BOQA 5IT9Z 3JTHA 2P5KA 3BROA 3M9AA 1FOKA 3F8NA 2RNJA 2CG4A 1BOAA 2P5VA 1Y0UA 5DCMA 1ZGAA 4I02A 2QQAA 3WU1B 3G3ZA 2ESHA 2ADUA 3WTZA 4CZZA 2VC0A 4CHUA 3LAJA 1F5TA 3MCZA 3ERED 2HKXA 2DTRA 2QWWA 5BS6A 2HTJA 3WTSC 3DP7A 4KUMA 3GWZA 3FX3A 4AWXB 2Y75A 4EJTA 5LGNA 1FC3A 3U2RA 5E8IA 5D5XB 1HW1A 1XDSA 3L00A 1TBXA 2LSOA 1Z9CA 1ON1A 1FWZA 1OYYA 5LLQA 3GXOA 1SD6A 3MZHA 2XROA 2PBIA 4GXOA 4I0BA 4YFNF 2IA0A 4TV7A 3QP5A 4MQ9F 1FZPB 2VOOA 4KIFA 3R61A 1OKRA 5HLHA 4D0PA 2E7WA 3HUGA 3R4KA 4KNYA 3EYYA 2WV0A 3PQJA 5HVQC 4M9SA 4UV9A 2DAOA 1CGPA 1L0OC 1FBUA 2FNAA 1PP7U 1TNSA 1XMAA 2ZKZA 5H20A 3V8KA 1AWCA 4LJZF 4ZYDA 4PGGA 2VN2A 3PFIA 1RIOH 4LLNA 2FSWA 5IT3A 4WXDA 3JSPA 2G7UA 3QP6A 1Q1HA 2GXBA 4LK0F 2O8XA 5J8CA 3CUOA 2XAJA 3JSOA 4EMSA 3ULQB 1TLHB 2V6CA 1G3TA 4YFKF 3BJ6A 4B8XA 1H0MA 1LDDA 2QVOA 3MAJA 2P5LC 2H6BA 1EH7A 1BIBA 1P6RA 3LFKA 4L5IA 2Y0MA 1LVAA 3H3ZA 1I1SA 1O3SA 2PFBA 4A5MA 3HIFA 2XVCA 3ZQ7A 3KFWX 1P4AA 1DP7P 2PQ8A 1BI0A 1WWXA 4WCGA 5DEQA 2NYXA 4U7DA 4ENKA 1XD7A 2ETHA 4MEXF 2VODA 5E17F 2DPDA 2UXXA 2W25A 2OD5A 3EQLF 4HX7A 4PGHA 4AIKA 5DYMA 3T8RA 1USTA 4YIIA 4UVAA 1LEBA 2DFIA 4HQMA 3OOPA 3ZPLA 3G73A 4I2OA 5ICFA 3L7WA 4IRIA 3U9GA 3HRTA 1Z91A 3KEQA 4L5JA 4PZJA 1ZAOA 2CGPA 3QU3A 3IWZA 1G4DA 3F6OA 1BN5A 5FD6A 3CUQB 4RGSA 4G6DA 1T0FA 4I98B 2FBKA 4IPAA 3COAC 3DQVC 1ZHFA 3RKXA 1KQ0A 2J5PA 4UNOA 3IRQA 2A61A 3DPLC 1XGOA 1B1BA 1K6OA 2XASA 4RGXA 2FBIA 3K1MA 1Z6TA 2ZXJA 4MTDA 2L01A 4NHJA 2W57A 2NS0A 4F7ZA 4MEYF 1E17A 3T0YA 2PI0A 3V7RA 1A04A 2FBHA 2LDUA 2IRFG 4YG2F 1MKMA 2FNPA 3ML6A 2KJCA 3BJOA 2E1NA 3VEPA 1R7JA 3GFLA 4IRGA 5DUIA 1YYVA 5IT9K 4LMYA 1P4WA 3GW2A 3B02A 3K1NA 4CXFA 3TO6A 3ZMUA 3R6SA 3RYPA 1HKTA 4QWQA 3WE2A 5BQTA 5AIQA 4RGUA 2FXAA 5HDKA 2GIVA 3HSRA 4DQ2A 3WTYC 4WK8F 5F64A 5CVJA 1S29A 3B73A 2W84A 3E97A 1B6AA 2V9VA 4BQAA 1MD0A 2KRFA 2GXGA 3BP8A 3I5UA 2BEOA 3FWEA 4G6QA 4HW0A 1O3TA 3MQ0A 3J81K 3JAMK 5ILVA 3K2ZA 4P96A 2VC1A 5JR3A 4LG0B 4N9IA 5ERIA 1FP1D 4O5VA 3RI4A 4M6YA 2EFOA 2DO7A 4WXHA 3GFIA 4M9XA 4KN7X 1HW5A 5HLIA 3ECOA 2HWVA 3D0SA 1FP2A 3C1DA 1IZ1A 5BPIA 2XUBA 1QZYA 3GZ6A 2EA4A 4PDKA 5D8KB 1XSXA 2P7CB 1Z6RA 1VTNC 4KA4A 2DW4A 2IW5A 4XLPF 2OQGA 3E5QA 3V7CA 5HDGA 4KFCA 2PLYA 4UXNA 3GZ5A 2VE9A 2J5OA 1FLIA 4IRHA 2M30A 4MHGA 2STTA 1EH8A 1IF1A 3ZMZA 1J75A 2ZBKA 4KMFA 3V7SA 3P7NA 4FX4A 1X3UA 5E1XA 3HYIA 2BGCA 3BPVA 1IN5A 2Z5UA 4P55A 3U1DA 2HYFA 1FT9A 2QYOA 3QPTA 2ZMEA 1SFXA 4WX9A 4G94A 5CVVA 3KP2A 1WRJA 2OZ6A 3P9KA 3KP7A 2XIGA 1FYMA 1G3WA 2EV0A 2R7FA 5AONA 4N0BA 4A0XA 3VFZA 5BPDA 4NQWA 1R1UA 3HRUA 3RPQA 3CDHA 2CO5A 1ZLJA 2QQ9A 4R1HA 1W5TA 2STWA 1AOYA 4BAYA 1WI9A 4G7OF 2VBXA 2E7XA 2EFQA 1W7PD 2XAFA 3I4PA 1XGMA 4RB3C 3LSTA 3RIRA 1JGSA 1IRFA 1L3LA 5EEGA 5AIPA 2OQRA 3F8CA 2L4MA 5TJJA 2FRHA 2FE3A 3RYRA 3TOBA 1D8JA 1LDKB 2Y48A 4OIPF 2X4HA 3NQOA 4FX0A 3R0JA 2XKPA 3MEXA 4RB1A 3BZ6A 3TO7A 5LHHA 3MFKA 3VOEA 2KKOA 3PQKA 1Z05A 1LDJA 3EDPA 3ZN1A 2IJLA 1IRGA 5ICGA 5FD5A 4WWCA 4JQFA 2G9WA 5CLSA 2V79A 2DQRA 2K86A 1H9TA 4XSZF 4U7BA 2GAUA 2ZJ2A 3K69A 1FSEA 2XRNA 3K0LA 4FT8A 4KIGA 4A6EA 3HHHA 5L3FA 3F21A 4IF4A 3T1BA 2DLLA 2A3SA 5ED4A 2FA5A 1BM9A 2OU2A 4HLYA 4EJUA 1O3RA 3REOA 4UUVA 4KIBA 5K1YA 1LJ9A 4M6XA 4AVPA 3D5LA 1QPMA 3GFJA 1HW2A 3GLXA 4E70A 1PDNC 2KJBA 2YU3A 1MDMA 2M45A 4HBLA 1IN7A 2PMHA 1FBSA 3KEOA 4ENNA 1ULYA 1HQCA 4M73A 5K5RA 5D6EA 4ESFA 2DQLA 2E1CA 3IKTA 2K7LA 2VXZA 1YLFA 1WQ2A 5DDGA 4B09A 3WODF 1HKQA 1TTYA 3F3XA 2IP2A 4XBFA 1XSVA 4KYWA 5D5VB 1GXPA 4KICA 1T39A 3V8JA 5D8LB 3WU0A 4ZYHA 3V4GA 1FY7A 3SXYA 5L3EA 4JBAA 4KT5C 2LKPA 2CSOA 2RC4A 2H94A 1FBQA 3SZTA 3BPXA 1YS7A 3DPTA 2BYVE 3OV8A 2V1UA 3L2CA 1ODDA 4HZFA 3IHUA 4AIHA 4HYEA 5HS8A 1CF7B 4P5OA 3ROUA 5CVIA 2UWMA 1EV7A 3RTRA 2F5EA 5CJ9A 3SZPA 3IKVA 4LLLA 3KP3A 4LG0A 4BYYA 4KMUX 3R60A 3TQNA 4HX4A 1SD4A 3O3KA 1QZZA 1IAWA 2UXNA 3WTXC 4Y17A 1YW8A 1T6SA 3I0TA 5EEHA 1F1ZA 2A5YB 2FF4A 4EJWA 3IL2A 2ELHA 2MH9A 2BV6A 2RV8A 2XKOA 1NHAA 5L3BA 1UHWA 2L02A 2JSCA 2XAHA 1QGPA 2QLZA 5KVRA 4Q48A 1IN8A 2CWEA 1KYWA 2RN7A 4L9TA 2NRAC 1W4MA 1QNTA 3FXQA 4M71A 5FB2A 2HR3A 4BH9A 2JRTA 2Z33A 3WTTC 2WTEA 4Z2YA 4I7HA 1T38A 1UFMA 4RB2C 2HDCA 1KU9A 2O61A 5D4RA 3I71A 4RB0A 2Z3YA 1R1VA 2TDXA 2GQQA 3V8LA 2HQRA 2WC2A 2A68F 5DUKA 5JFRA 3IC7A 2QENA 4CYDA 2QBYB 2XGXA 3O6BB 3ZMTA 1O7FA 2H27A 2OAZA 1RI7A 2XAQA 3E3VA 1YW9A 2HZTA 1MDMB 1R22A 3FM5A 5H6QA 4R79A 2EB7A 4A0ZA 5LEKA 3K9TA 2NAZA 1JE8A 3HOTA 4ZZDA 1YG2A 4HDVA 4YIFA 4EVIA 2W24A 4XSXF 1JHHA 4N9HA 3E6MA 3ECHA 5E8GA 1G3YA 1I27A 2D2WA 2VBYA 4BXUA 5KK1A 5BOXA 4EGYA 3Q9SA 5H6RA 4L9NA 1UHMA 3CUQC 4A6DA 1WKMA 3NEUA 1Z1DA 2O03A 1UB9A 3MZYA 4HAMA 4CGZA 4GYIA 2VOPA 3FMRA 1XDUA 4A2UA 1REPC 1O7LA 1S6LA 5DV5A 1HKSA 2P7VB 4O6JA 3WGIA 1KYZA 5CYVA 1KQ8A 1U6GA 4S04A 3NRVA 2DI3A 3I54A 2DK5A 2ZCWA 4Y13A 1SFUA 3JW4A 2EJRA 5L3CA 5BMZA 2YX7A 4XRFA 2G7HA 2RQPA 3CJNA 1V3FA 2OZUA 2RDPA 2VT3A 3E5XA 2L54A 4U0VA 1HBXG 5LGTA 2L4AA 3GX4X 5LBQA 4UVBA 1BIAA 1ZG3A 4ENJA 4HA8A 1LB2A 2VBWA 4AD9A 5ILUA 4M9ZA 4ASNA 2YPRA 3RDIA 3VB2A 1MZBA 2HTSA 1P92A 2ZO4A 4O3MA 1TW2A 1RUNA 4L9VA 2CYYA 1GXQA 1ONVA 2JPCA 4IVNA 2MBFA 1B9MA 4M72A 3ABTA 2CW0F 5FFZA 2QUFA 1XGNA 1MJBA 3Q5FA 4L18B 3HTUA 4K2EA 2K02A 1U2WA 4KDPA 4OIOF 4I0AA 4S05A 2A07F 5E1WA 4PCQA 1SMYF 3S2WA 1G6NA 1MJ9A 4G8XA 2LF7A 1RZ4A 3FXUA 3KETA 2H6CA 3KE2A 3GYHX 3HRSA 1BI3A 2DT5A 4L0ZB 2L3DA 1T98A 4U0YA 1D8KA 2IPQX 3DEUA 1ZRCA 1BI2A 2NNNA 2JZYA 1GHCA 1E2XA 5HS9A 2HGCA 5D5WB 2P6SA 2GA2A 5K5QA 1YW7A 3TDZC 4LB5A 3LQRA 2RGVA 2BE5F 3M1EA 1T2KA 5LHIA 1JHFA 2GA1A 4IHTA 1I5ZA 3FM3A 4BHCA 3F72A 5E18F 1K79A 2Q2EA 4CDGA 1J5YA 1S7OA 2YSRA 5D4SA 2C6YA 2IT0A 3RJPA 3CUQA 1MGTA 2MLGA 1P2FA 3T5XA 2ZNYA 1PUEE 1ZGJA 1DPRA 2EWNA 1ZREA 3K1PA 1DDNA 1SFEA 1U8RA 5J6XA 4RAYA 2QM3A 1QBJA 2JPBA 1O3QA 3QU6A 1QQIA 4Q4ZF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QPH A;  1LQ1 A;  2V1X A;  5FO5 A;  1R00 A;  2Z99 A;  1K78 A;  3HTS B;  2X0L A;  1W7P A;  1DPU A;  1ZRF A;  4HF2 A;  5CVR A;  1OMI A;  3MWM A;  3QRF F;  3IRR A;  1TQI A;  4EM1 A;  1DUX C;  2VBZ A;  3J80 K;  2M8E A;  3LA2 A;  3IWF A;  1RUO A;  5ICC A;  5ILS A;  4GYG A;  5TRD A;  2P8T A;  1BJA A;  3WGH A;  2ZME B;  4ON0 A;  4HDU A;  1D5V A;  1U5T B;  1ZG1 A;  4G9Y A;  5JVT A;  2UZK A;  1TNT A;  2VT2 A;  3C18 A;  2EFW A;  5FLX K;  3EYI A;  2PMU A;  1S7A A;  1B4A A;  1S3J A;  1PP8 F;  2MC3 A;  4A0Y A;  3BJA A;  3KP5 A;  3ZMS A;  3I53 A;  1C0W A;  2EK5 A;  2KIM A;  1KU2 A;  3RKY A;  1U5T C;  1FX7 A;  4EV0 A;  3TOA A;  4HQE A;  3P9C A;  3WTV C;  2OBP A;  3M8F A;  1BBY A;  1OR7 A;  2EV5 A;  4IHS A;  5JHU A;  5FFX A;  1F9N A;  1D3Y A;  5JI6 A;  1KGS A;  2ZFW A;  1ZAR A;  4EGZ A;  2RVC A;  3FHZ A;  4WF2 A;  1BC7 C;  2RKH A;  3CTA A;  5E1Z B;  5HDN A;  3JTG A;  2DPU A;  4RGR A;  4OIR F;  2COM A;  2VON A;  3SHF A;  3LA7 A;  4ZYE A;  3O2P E;  5FGM A;  3I59 B;  3F23 A;  3FMQ A;  4UHT A;  3N97 A;  3E5U A;  1KU7 A;  1EH6 A;  3SQN A;  4A12 A;  4ZH4 F;  4G7H F;  5ICE A;  1XCB A;  2NNY A;  3F8M A;  1IXR C;  3F8F A;  1TQP A;  1KQ9 A;  4BHP A;  1CF7 A;  4M74 A;  3EET A;  5A2Q K;  3GVA A;  4R8H A;  3J80 Z;  4KN4 X;  3WGG A;  1K78 B;  1ZYR F;  1K7A A;  3E6C C;  2PG4 A;  1W7P B;  1XMK A;  5F6F A;  4EM2 A;  1TQM A;  3E6B A;  2A69 F;  1I6X A;  1J0R A;  3TKY A;  1FYK A;  1BI1 A;  3DXJ F;  4ZZL A;  4Q47 A;  2QQB A;  2DBB A;  3GO5 A;  2AXL A;  2MLK A;  2EFN A;  3W6K B;  4GGG A;  2HKO A;  1B59 A;  2FOK A;  2YR2 A;  4BHB A;  2PN6 A;  4L9J A;  2PEX A;  2ACJ A;  2EV6 A;  1ZLK A;  1S8N A;  1XCV A;  3AAF A;  1ZH5 A;  2MD5 A;  2ZNZ A;  1R58 A;  3Q9V A;  1YS6 A;  4XLN F;  2F5F A;  3CO7 C;  2W85 A;  1IUY A;  4UV8 A;  2IA2 A;  1KU3 A;  2VE8 A;  3RKW A;  4OOI A;  3WTW C;  4MTE A;  4WXC A;  1R36 A;  2O0Y A;  3WG9 A;  3GEZ A;  4ESJ A;  3H3U A;  1ZG5 A;  3TGN A;  4RS8 A;  3ZMD A;  4OIQ F;  3GUD A;  3M8E A;  1SD7 A;  2F2E A;  3I59 A;  1IXC A;  4HLX A;  1H9G A;  2CQK A;  3HRM A;  3I58 A;  2M1B A;  4EM0 B;  2WWY A;  1LNW A;  3ZMV A;  4HOB A;  3JAM Z;  4Q5S F;  4EJV A;  2Q0O A;  2ESN A;  1ON2 A;  2P6T A;  2M5W A;  3QAH A;  5LGU A;  3J7A O;  4IXA A;  1P4X A;  2K4J A;  3KZZ A;  4YFX F;  1OYI A;  1ZN2 A;  4JK1 X;  1IXS B;  1R5G A;  4OMZ A;  3VOD A;  2F5D A;  2EFP A;  3HSE A;  4HF0 A;  5LRS A;  3KCC A;  4IJA A;  5J8F A;  1I1G A;  1XB4 A;  3GFM A;  3HSF A;  3I64 A;  3H92 A;  1SAX A;  4FHT A;  3EUH A;  3FF5 A;  1U3E M;  2Q8K A;  1R23 A;  4BNC A;  4LD5 A;  2HYG D;  4LK1 F;  1MJA A;  1U78 A;  1FSH A;  5CVU A;  5FLX Z;  4EQQ A;  3C7J A;  3ZN0 A;  2B0L A;  5L3D A;  3DFG A;  1FYL A;  1IN4 A;  5DCF A;  3SFZ A;  3R0A A;  2Z9O A;  1BC8 C;  4G7Z F;  2EA2 A;  2K4B A;  2R3S A;  3T8T A;  4ENM A;  4L0Y B;  1HXD A;  2IA1 A;  5F1R A;  1IW7 F;  1F4K A;  1QO0 D;  4OIN F;  1YO5 C;  2DK8 A;  2HQN A;  2FMY A;  2QZ8 A;  1XN7 A;  4HV5 A;  1YFH A;  3DKW A;  1XGS A;  2MA3 A;  2P4W A;  2DU9 A;  3HOS A;  3TDU C;  4ZYG A;  1V4R A;  5LRR A;  2D1V A;  2IVM A;  4ETS A;  5HS7 A;  1HST A;  1SD5 A;  1U5T A;  4A5N A;  4UVC A;  2HFH A;  5D5U B;  4LGW A;  1O57 A;  1B9N A;  2AS5 F;  2PJP A;  4MNU A;  2QBY A;  3LQQ A;  5L3G A;  5LHG A;  3BY6 A;  3L09 A;  2KIU A;  4P9U A;  3GF2 A;  3CLO A;  1Z7U A;  4I01 A;  4GO1 A;  5DCM B;  3F22 A;  2K27 A;  1SMT A;  5E20 A;  3BWG A;  1HSJ A;  2JTV A;  2GWR A;  2CFX A;  5HOO A;  3E6D A;  1J7K A;  3HHG A;  1J59 A;  1IN6 A;  4P9F A;  5HLG A;  2HEO A;  5K5O A;  4MGR A;  4U88 A;  3ABU A;  2V1D A;  1WSU A;  4MQV A;  4QLC U;  4U0W A;  2ISZ A;  4OMY A;  2FEZ A;  4HV6 A;  4RAZ A;  3ZP5 A;  4CIC A;  2XAG A;  2A6E F;  3DV8 A;  3ISP A;  1RNL A;  1R1T A;  1KA8 A;  2GZW A;  3LWF A;  1UCR A;  2F5C A;  3F8B A;  1J2X A;  2HOE A;  1JXS A;  4LFU A;  4Y15 A;  2ISY A;  3N4M A;  1XSD A;  3P9I A;  1G3S A;  2LF8 A;  3L9F A;  2D1H A;  1YQA A;  3TO9 A;  4H0E A;  1J9I A;  3KZY A;  5DD4 A;  6PAX A;  3W6J B;  2XHK A;  2FU4 A;  1FNN A;  2MH2 A;  4CO8 A;  2R7D A;  2JT1 A;  3M7G A;  3WTU C;  3C3W A;  4DNC A;  1USS A;  3KP4 A;  1YIO A;  1W5S A;  1TW3 A;  4HX8 A;  5DD8 A;  3BDD A;  3LA3 A;  3DF8 A;  2BBY A;  3RPU A;  5D6F A;  3KLN A;  3QOP A;  3FZV A;  5LEJ A;  2LNB A;  4HF1 A;  2O3F A;  1GVJ A;  3LAP A;  1OPC A;  4OU0 A;  3WE3 A;  3KP6 A;  2FML A;  3FXR A;  1STZ A;  1LEA A;  4EJO A;  2D45 A;  5A2Q Z;  1ZRD A;  4AIJ A;  4LB6 B;  2A6H F;  1R5H A;  2OA4 A;  2XV4 S;  3J81 Z;  4I09 A;  3F6V A;  4NB5 A;  1OYW A;  4ESB A;  2HS5 A;  3FMS A;  3KLO A;  2FQ3 A;  3ELK A;  2O6G E;  4LLG F;  2H09 A;  4GCV A;  2YX4 A;  2M87 A;  2KIF A;  1YTY A;  3CO6 C;  1FPQ A;  3BOQ A;  5IT9 Z;  3JTH A;  2P5K A;  3BRO A;  3M9A A;  1FOK A;  3F8N A;  2RNJ A;  2CG4 A;  1BOA A;  2P5V A;  1Y0U A;  5DCM A;  1ZGA A;  4I02 A;  2QQA A;  3WU1 B;  3G3Z A;  2ESH A;  2ADU A;  3WTZ A;  4CZZ A;  2VC0 A;  4CHU A;  3LAJ A;  1F5T A;  3MCZ A;  3ERE D;  2HKX A;  2DTR A;  2QWW A;  5BS6 A;  2HTJ A;  3WTS C;  3DP7 A;  4KUM A;  3GWZ A;  3FX3 A;  4AWX B;  2Y75 A;  4EJT A;  5LGN A;  1FC3 A;  3U2R A;  5E8I A;  5D5X B;  1HW1 A;  1XDS A;  3L00 A;  1TBX A;  2LSO A;  1Z9C A;  1ON1 A;  1FWZ A;  1OYY A;  5LLQ A;  3GXO A;  1SD6 A;  3MZH A;  2XRO A;  2PBI A;  4GXO A;  4I0B A;  4YFN F;  2IA0 A;  4TV7 A;  3QP5 A;  4MQ9 F;  1FZP B;  2VOO A;  4KIF A;  3R61 A;  1OKR A;  5HLH A;  4D0P A;  2E7W A;  3HUG A;  3R4K A;  4KNY A;  3EYY A;  2WV0 A;  3PQJ A;  5HVQ C;  4M9S A;  4UV9 A;  2DAO A;  1CGP A;  1L0O C;  1FBU A;  2FNA A;  1PP7 U;  1TNS A;  1XMA A;  2ZKZ A;  5H20 A;  3V8K A;  1AWC A;  4LJZ F;  4ZYD A;  4PGG A;  2VN2 A;  3PFI A;  1RIO H;  4LLN A;  2FSW A;  5IT3 A;  4WXD A;  3JSP A;  2G7U A;  3QP6 A;  1Q1H A;  2GXB A;  4LK0 F;  2O8X A;  5J8C A;  3CUO A;  2XAJ A;  3JSO A;  4EMS A;  3ULQ B;  1TLH B;  2V6C A;  1G3T A;  4YFK F;  3BJ6 A;  4B8X A;  1H0M A;  1LDD A;  2QVO A;  3MAJ A;  2P5L C;  2H6B A;  1EH7 A;  1BIB A;  1P6R A;  3LFK A;  4L5I A;  2Y0M A;  1LVA A;  3H3Z A;  1I1S A;  1O3S A;  2PFB A;  4A5M A;  3HIF A;  2XVC A;  3ZQ7 A;  3KFW X;  1P4A A;  1DP7 P;  2PQ8 A;  1BI0 A;  1WWX A;  4WCG A;  5DEQ A;  2NYX A;  4U7D A;  4ENK A;  1XD7 A;  2ETH A;  4MEX F;  2VOD A;  5E17 F;  2DPD A;  2UXX A;  2W25 A;  2OD5 A;  3EQL F;  4HX7 A;  4PGH A;  4AIK A;  5DYM A;  3T8R A;  1UST A;  4YII A;  4UVA A;  1LEB A;  2DFI A;  4HQM A;  3OOP A;  3ZPL A;  3G73 A;  4I2O A;  5ICF A;  3L7W A;  4IRI A;  3U9G A;  3HRT A;  1Z91 A;  3KEQ A;  4L5J A;  4PZJ A;  1ZAO A;  2CGP A;  3QU3 A;  3IWZ A;  1G4D A;  3F6O A;  1BN5 A;  5FD6 A;  3CUQ B;  4RGS A;  4G6D A;  1T0F A;  4I98 B;  2FBK A;  4IPA A;  3COA C;  3DQV C;  1ZHF A;  3RKX A;  1KQ0 A;  2J5P A;  4UNO A;  3IRQ A;  2A61 A;  3DPL C;  1XGO A;  1B1B A;  1K6O A;  2XAS A;  4RGX A;  2FBI A;  3K1M A;  1Z6T A;  2ZXJ A;  4MTD A;  2L01 A;  4NHJ A;  2W57 A;  2NS0 A;  4F7Z A;  4MEY F;  1E17 A;  3T0Y A;  2PI0 A;  3V7R A;  1A04 A;  2FBH A;  2LDU A;  2IRF G;  4YG2 F;  1MKM A;  2FNP A;  3ML6 A;  2KJC A;  3BJO A;  2E1N A;  3VEP A;  1R7J A;  3GFL A;  4IRG A;  5DUI A;  1YYV A;  5IT9 K;  4LMY A;  1P4W A;  3GW2 A;  3B02 A;  3K1N A;  4CXF A;  3TO6 A;  3ZMU A;  3R6S A;  3RYP A;  1HKT A;  4QWQ A;  3WE2 A;  5BQT A;  5AIQ A;  4RGU A;  2FXA A;  5HDK A;  2GIV A;  3HSR A;  4DQ2 A;  3WTY C;  4WK8 F;  5F64 A;  5CVJ A;  1S29 A;  3B73 A;  2W84 A;  3E97 A;  1B6A A;  2V9V A;  4BQA A;  1MD0 A;  2KRF A;  2GXG A;  3BP8 A;  3I5U A;  2BEO A;  3FWE A;  4G6Q A;  4HW0 A;  1O3T A;  3MQ0 A;  3J81 K;  3JAM K;  5ILV A;  3K2Z A;  4P96 A;  2VC1 A;  5JR3 A;  4LG0 B;  4N9I A;  5ERI A;  1FP1 D;  4O5V A;  3RI4 A;  4M6Y A;  2EFO A;  2DO7 A;  4WXH A;  3GFI A;  4M9X A;  4KN7 X;  1HW5 A;  5HLI A;  3ECO A;  2HWV A;  3D0S A;  1FP2 A;  3C1D A;  1IZ1 A;  5BPI A;  2XUB A;  1QZY A;  3GZ6 A;  2EA4 A;  4PDK A;  5D8K B;  1XSX A;  2P7C B;  1Z6R A;  1VTN C;  4KA4 A;  2DW4 A;  2IW5 A;  4XLP F;  2OQG A;  3E5Q A;  3V7C A;  5HDG A;  4KFC A;  2PLY A;  4UXN A;  3GZ5 A;  2VE9 A;  2J5O A;  1FLI A;  4IRH A;  2M30 A;  4MHG A;  2STT A;  1EH8 A;  1IF1 A;  3ZMZ A;  1J75 A;  2ZBK A;  4KMF A;  3V7S A;  3P7N A;  4FX4 A;  1X3U A;  5E1X A;  3HYI A;  2BGC A;  3BPV A;  1IN5 A;  2Z5U A;  4P55 A;  3U1D A;  2HYF A;  1FT9 A;  2QYO A;  3QPT A;  2ZME A;  1SFX A;  4WX9 A;  4G94 A;  5CVV A;  3KP2 A;  1WRJ A;  2OZ6 A;  3P9K A;  3KP7 A;  2XIG A;  1FYM A;  1G3W A;  2EV0 A;  2R7F A;  5AON A;  4N0B A;  4A0X A;  3VFZ A;  5BPD A;  4NQW A;  1R1U A;  3HRU A;  3RPQ A;  3CDH A;  2CO5 A;  1ZLJ A;  2QQ9 A;  4R1H A;  1W5T A;  2STW A;  1AOY A;  4BAY A;  1WI9 A;  4G7O F;  2VBX A;  2E7X A;  2EFQ A;  1W7P D;  2XAF A;  3I4P A;  1XGM A;  4RB3 C;  3LST A;  3RIR A;  1JGS A;  1IRF A;  1L3L A;  5EEG A;  5AIP A;  2OQR A;  3F8C A;  2L4M A;  5TJJ A;  2FRH A;  2FE3 A;  3RYR A;  3TOB A;  1D8J A;  1LDK B;  2Y48 A;  4OIP F;  2X4H A;  3NQO A;  4FX0 A;  3R0J A;  2XKP A;  3MEX A;  4RB1 A;  3BZ6 A;  3TO7 A;  5LHH A;  3MFK A;  3VOE A;  2KKO A;  3PQK A;  1Z05 A;  1LDJ A;  3EDP A;  3ZN1 A;  2IJL A;  1IRG A;  5ICG A;  5FD5 A;  4WWC A;  4JQF A;  2G9W A;  5CLS A;  2V79 A;  2DQR A;  2K86 A;  1H9T A;  4XSZ F;  4U7B A;  2GAU A;  2ZJ2 A;  3K69 A;  1FSE A;  2XRN A;  3K0L A;  4FT8 A;  4KIG A;  4A6E A;  3HHH A;  5L3F A;  3F21 A;  4IF4 A;  3T1B A;  2DLL A;  2A3S A;  5ED4 A;  2FA5 A;  1BM9 A;  2OU2 A;  4HLY A;  4EJU A;  1O3R A;  3REO A;  4UUV A;  4KIB A;  5K1Y A;  1LJ9 A;  4M6X A;  4AVP A;  3D5L A;  1QPM A;  3GFJ A;  1HW2 A;  3GLX A;  4E70 A;  1PDN C;  2KJB A;  2YU3 A;  1MDM A;  2M45 A;  4HBL A;  1IN7 A;  2PMH A;  1FBS A;  3KEO A;  4ENN A;  1ULY A;  1HQC A;  4M73 A;  5K5R A;  5D6E A;  4ESF A;  2DQL A;  2E1C A;  3IKT A;  2K7L A;  2VXZ A;  1YLF A;  1WQ2 A;  5DDG A;  4B09 A;  3WOD F;  1HKQ A;  1TTY A;  3F3X A;  2IP2 A;  4XBF A;  1XSV A;  4KYW A;  5D5V B;  1GXP A;  4KIC A;  1T39 A;  3V8J A;  5D8L B;  3WU0 A;  4ZYH A;  3V4G A;  1FY7 A;  3SXY A;  5L3E A;  4JBA A;  4KT5 C;  2LKP A;  2CSO A;  2RC4 A;  2H94 A;  1FBQ A;  3SZT A;  3BPX A;  1YS7 A;  3DPT A;  2BYV E;  3OV8 A;  2V1U A;  3L2C A;  1ODD A;  4HZF A;  3IHU A;  4AIH A;  4HYE A;  5HS8 A;  1CF7 B;  4P5O A;  3ROU A;  5CVI A;  2UWM A;  1EV7 A;  3RTR A;  2F5E A;  5CJ9 A;  3SZP A;  3IKV A;  4LLL A;  3KP3 A;  4LG0 A;  4BYY A;  4KMU X;  3R60 A;  3TQN A;  4HX4 A;  1SD4 A;  3O3K A;  1QZZ A;  1IAW A;  2UXN A;  3WTX C;  4Y17 A;  1YW8 A;  1T6S A;  3I0T A;  5EEH A;  1F1Z A;  2A5Y B;  2FF4 A;  4EJW A;  3IL2 A;  2ELH A;  2MH9 A;  2BV6 A;  2RV8 A;  2XKO A;  1NHA A;  5L3B A;  1UHW A;  2L02 A;  2JSC A;  2XAH A;  1QGP A;  2QLZ A;  5KVR A;  4Q48 A;  1IN8 A;  2CWE A;  1KYW A;  2RN7 A;  4L9T A;  2NRA C;  1W4M A;  1QNT A;  3FXQ A;  4M71 A;  5FB2 A;  2HR3 A;  4BH9 A;  2JRT A;  2Z33 A;  3WTT C;  2WTE A;  4Z2Y A;  4I7H A;  1T38 A;  1UFM A;  4RB2 C;  2HDC A;  1KU9 A;  2O61 A;  5D4R A;  3I71 A;  4RB0 A;  2Z3Y A;  1R1V A;  2TDX A;  2GQQ A;  3V8L A;  2HQR A;  2WC2 A;  2A68 F;  5DUK A;  5JFR A;  3IC7 A;  2QEN A;  4CYD A;  2QBY B;  2XGX A;  3O6B B;  3ZMT A;  1O7F A;  2H27 A;  2OAZ A;  1RI7 A;  2XAQ A;  3E3V A;  1YW9 A;  2HZT A;  1MDM B;  1R22 A;  3FM5 A;  5H6Q A;  4R79 A;  2EB7 A;  4A0Z A;  5LEK A;  3K9T A;  2NAZ A;  1JE8 A;  3HOT A;  4ZZD A;  1YG2 A;  4HDV A;  4YIF A;  4EVI A;  2W24 A;  4XSX F;  1JHH A;  4N9H A;  3E6M A;  3ECH A;  5E8G A;  1G3Y A;  1I27 A;  2D2W A;  2VBY A;  4BXU A;  5KK1 A;  5BOX A;  4EGY A;  3Q9S A;  5H6R A;  4L9N A;  1UHM A;  3CUQ C;  4A6D A;  1WKM A;  3NEU A;  1Z1D A;  2O03 A;  1UB9 A;  3MZY A;  4HAM A;  4CGZ A;  4GYI A;  2VOP A;  3FMR A;  1XDU A;  4A2U A;  1REP C;  1O7L A;  1S6L A;  5DV5 A;  1HKS A;  2P7V B;  4O6J A;  3WGI A;  1KYZ A;  5CYV A;  1KQ8 A;  1U6G A;  4S04 A;  3NRV A;  2DI3 A;  3I54 A;  2DK5 A;  2ZCW A;  4Y13 A;  1SFU A;  3JW4 A;  2EJR A;  5L3C A;  5BMZ A;  2YX7 A;  4XRF A;  2G7H A;  2RQP A;  3CJN A;  1V3F A;  2OZU A;  2RDP A;  2VT3 A;  3E5X A;  2L54 A;  4U0V A;  1HBX G;  5LGT A;  2L4A A;  3GX4 X;  5LBQ A;  4UVB A;  1BIA A;  1ZG3 A;  4ENJ A;  4HA8 A;  1LB2 A;  2VBW A;  4AD9 A;  5ILU A;  4M9Z A;  4ASN A;  2YPR A;  3RDI A;  3VB2 A;  1MZB A;  2HTS A;  1P92 A;  2ZO4 A;  4O3M A;  1TW2 A;  1RUN A;  4L9V A;  2CYY A;  1GXQ A;  1ONV A;  2JPC A;  4IVN A;  2MBF A;  1B9M A;  4M72 A;  3ABT A;  2CW0 F;  5FFZ A;  2QUF A;  1XGN A;  1MJB A;  3Q5F A;  4L18 B;  3HTU A;  4K2E A;  2K02 A;  1U2W A;  4KDP A;  4OIO F;  4I0A A;  4S05 A;  2A07 F;  5E1W A;  4PCQ A;  1SMY F;  3S2W A;  1G6N A;  1MJ9 A;  4G8X A;  2LF7 A;  1RZ4 A;  3FXU A;  3KET A;  2H6C A;  3KE2 A;  3GYH X;  3HRS A;  1BI3 A;  2DT5 A;  4L0Z B;  2L3D A;  1T98 A;  4U0Y A;  1D8K A;  2IPQ X;  3DEU A;  1ZRC A;  1BI2 A;  2NNN A;  2JZY A;  1GHC A;  1E2X A;  5HS9 A;  2HGC A;  5D5W B;  2P6S A;  2GA2 A;  5K5Q A;  1YW7 A;  3TDZ C;  4LB5 A;  3LQR A;  2RGV A;  2BE5 F;  3M1E A;  1T2K A;  5LHI A;  1JHF A;  2GA1 A;  4IHT A;  1I5Z A;  3FM3 A;  4BHC A;  3F72 A;  5E18 F;  1K79 A;  2Q2E A;  4CDG A;  1J5Y A;  1S7O A;  2YSR A;  5D4S A;  2C6Y A;  2IT0 A;  3RJP A;  3CUQ A;  1MGT A;  2MLG A;  1P2F A;  3T5X A;  2ZNY A;  1PUE E;  1ZGJ A;  1DPR A;  2EWN A;  1ZRE A;  3K1P A;  1DDN A;  1SFE A;  1U8R A;  5J6X A;  4RAY A;  2QM3 A;  1QBJ A;  2JPB A;  1O3Q A;  3QU6 A;  1QQI A;  4Q4Z F; 
#chains in the Genus database with same CATH topology
 3QPH A;  1LQ1 A;  2V1X A;  5FO5 A;  2DOD A;  1R00 A;  2Z99 A;  1V5E A;  3QQA A;  1K78 A;  3HTS B;  2X0L A;  1BL0 A;  1W7P A;  1DPU A;  2IS4 A;  1WJ5 A;  1ZRF A;  4HF2 A;  5CVR A;  1OMI A;  3FIW A;  2M7B A;  3MWM A;  3QRF F;  3OYL A;  2XF6 A;  3IRR A;  3GTJ J;  1TQI A;  2RQQ A;  4EM1 A;  1DUX C;  3HKZ N;  1GVD A;  1B72 B;  2VBZ A;  3J80 K;  2M8E A;  2R5Y B;  4IQJ A;  3LA2 A;  3IWF A;  1RUO A;  5ICC A;  2H8R A;  1OQY A;  2F4M B;  3PFY A;  4BY1 J;  5FKL A;  5DS9 A;  3LSM A;  5ILS A;  4FE4 A;  2CRG A;  4GYG A;  3AG3 H;  1ZKG A;  3ABM H;  4AU7 A;  3FXL A;  5TRD A;  2P8T A;  2BY1 A;  1BJA A;  3WGH A;  2ZME B;  4ON0 A;  4HDU A;  2L9S A;  1D5V A;  1U5T B;  1W36 D;  2IGN A;  1ZG1 A;  4G9Y A;  5JVT A;  2GIZ A;  5FKO A;  1VQ9 I;  2HI3 A;  2UZK A;  2K85 A;  2Y9Z A;  1TNT A;  2JA6 J;  2VT2 A;  3C18 A;  2EFW A;  2PMZ N;  3K4M A;  5FLX K;  3EYI A;  2E60 A;  2PMU A;  1S7A A;  2E35 A;  1B4A A;  1S3J A;  5J1Y A;  1PP8 F;  1TWF J;  2CQ7 A;  2MC3 A;  4N4N B;  4A0Y A;  3BJA A;  3KP5 A;  5B5E C;  3ZMS A;  3I53 A;  1C0W A;  2EK5 A;  2KIM A;  1KU2 A;  1W5C C;  3RKY A;  1U5T C;  3DKY A;  5CKT A;  1OIS A;  2GLO A;  1FX7 A;  4EV0 A;  2VB6 A;  3TOA A;  3GZN B;  4HQE A;  1X4P A;  2JMW A;  4AID A;  5IP9 J;  3P9C A;  3WTV C;  3CMY A;  3CP8 A;  2OBP A;  3M8F A;  2VPL A;  1BBY A;  2WV1 A;  4ZTF A;  1WCM J;  1ZGW A;  1WHU A;  1OR7 A;  2EV5 A;  4IHS A;  5JHU A;  1Q1V A;  5FFX A;  1F9N A;  4A3J J;  1D3Y A;  2XSD C;  3AL0 B;  1BW5 A;  5JI6 A;  5M5W J;  1D1A A;  1KGS A;  2NS7 A;  2RRE A;  4F52 A;  1FIP A;  2VKV A;  2BVM A;  2ZFW A;  1ZAR A;  4EGZ A;  2NOG A;  2RVC A;  3FHZ A;  2DA4 A;  4WF2 A;  4BY7 J;  3JRE A;  5IYD J;  1BC7 C;  2RKH A;  3E0J B;  3CTA A;  4XN3 A;  5E1Z B;  2IGK A;  5HDN A;  3JTG A;  2ME6 A;  4LIT A;  2KQR A;  3S3N A;  2DPU A;  1OLT A;  1MBE A;  4RGR A;  3ERM A;  4OIR F;  3K4J A;  2XB0 X;  4MLO A;  4C3H J;  3BG6 A;  2COM A;  2VON A;  3SHF A;  3LA7 A;  3SFI A;  2OC6 A;  2ZFU A;  3H5N A;  4ZYE A;  3O2P E;  2X6O A;  5CQE A;  1XX5 A;  5FGM A;  3I59 B;  2W48 A;  1JT0 A;  3BR2 A;  3F23 A;  1Y6I A;  2DJN A;  3FMQ A;  4UHT A;  1VQP I;  3N97 A;  4DGW B;  3E5U A;  1KU7 A;  4E7S A;  1E3H A;  1K6Y A;  2X1C A;  4MO7 A;  1EH6 A;  3SQN A;  1X1D A;  4A12 A;  4ZH4 F;  2VXD A;  4G7H F;  4KIS A;  3RQ4 A;  2NOJ B;  5ICE A;  1XCB A;  2NNY A;  3CJR B;  3F8M A;  1IXR C;  2LRD A;  3F8F A;  1X1C A;  4C3I J;  1H8A C;  1MSE C;  2BVL A;  1TQP A;  2DTZ A;  3ZOB A;  1UZC A;  1S9H A;  1KQ9 A;  4BHP A;  3LNQ A;  1CF7 A;  2VUM J;  2F6C A;  3BQZ A;  3TL4 X;  4M74 A;  4XLH A;  3A4C A;  3EET A;  3S15 J;  4NBQ A;  5A2Q K;  3GVA A;  1H89 C;  2W82 A;  4R8H A;  3J80 Z;  1OR7 C;  4KN4 X;  1X1P A;  3WGG A;  3CCR I;  3IV5 A;  1R49 A;  1K78 B;  1ZYR F;  2XGC A;  1WFX A;  1K7A A;  3IH4 A;  1B8I A;  3LFU A;  4XLE A;  2M8G X;  2HXO A;  2PG4 A;  3E6C C;  1W7P B;  1XMK A;  2Z1D A;  1BR4 A;  5F6F A;  4EM2 A;  1TQM A;  2MAB A;  4F92 B;  3E6B A;  5IYB J;  3M3Y J;  2A69 F;  2GBY A;  1DGR M;  3A0H C;  1I6X A;  3PIP F;  1J0R A;  1RES A;  3TKY A;  3ZQI A;  2JA8 J;  1I39 A;  1FYK A;  1BI1 A;  3DXJ F;  4ZZL A;  4Q47 A;  3QYF A;  2JA7 J;  2QQB A;  2DBB A;  2CQN A;  3GO5 A;  1WJF A;  1F36 A;  2AXL A;  3AFH A;  1TC3 C;  2MLK A;  2EFN A;  1IRZ A;  3W6K B;  5FJ8 J;  3AG1 H;  5C4J J;  4GGG A;  1K83 J;  3H9Q A;  1OCO H;  2HKO A;  3MD2 A;  2RAE A;  1B59 A;  3GTL J;  2FOK A;  3QYB A;  2YR2 A;  4BHB A;  2R7T A;  2L9N A;  2PN6 A;  3RKQ A;  2O5R A;  4L9J A;  4XK4 A;  1IC8 A;  2PEX A;  3DTK A;  2ACJ A;  2EV6 A;  1ZLK A;  1O4X A;  3L2U A;  4BXX J;  1S8N A;  1XCV A;  4DBR A;  3AAF A;  2MD5 A;  2ZNZ A;  1ZH5 A;  4G12 A;  1ENH A;  3FK7 A;  2Q1Z B;  1QRY A;  2TCT A;  1R58 A;  3Q9V A;  1YS6 A;  4C30 A;  2ZME C;  3LSK A;  4XLN F;  2F5F A;  3CO7 C;  2PJR B;  3UNG C;  3AL0 C;  1UJ8 A;  2W85 A;  1IUY A;  3F0C A;  4UV8 A;  3S17 J;  4NQW B;  5J47 A;  2IA2 A;  2QSF X;  3K4B A;  2QF7 A;  2DOE A;  3OS0 A;  3Q0U A;  2OF7 A;  1KU3 A;  2VE8 A;  2FX0 A;  4XLC A;  2BXZ A;  2XPV A;  3G1M A;  3RKW A;  4ABZ A;  2MYS A;  4OOI A;  3WTW C;  4MTE A;  4WXC A;  1N77 A;  1R36 A;  2O0Y A;  2W4S A;  3CCV I;  1Z21 A;  3WG9 A;  3S16 J;  3GEZ A;  3OS1 A;  1Z7L A;  4ESJ A;  1T33 A;  3H3U A;  4Y7N J;  1ZG5 A;  3TGN A;  2R5Z A;  4RS8 A;  3ZMD A;  4OIQ F;  4MFD A;  1X2N A;  3GTO J;  3GUD A;  3M8E A;  1E3P A;  4QIW N;  1SD7 A;  3S14 J;  3EUK L;  2F2E A;  3I55 I;  3I59 A;  1IXC A;  5HNF A;  3FXK A;  4HLX A;  2E1M C;  4IHW A;  2DDB A;  4XOR A;  1H9G A;  2VI6 A;  4OAZ A;  3TW7 A;  2CQK A;  3HRM A;  4OWR B;  3C2G A;  1DP3 A;  3BTJ A;  3I58 A;  3G6E I;  2M1B A;  4EM0 B;  5GAE J;  2WWY A;  1LNW A;  3ZCO A;  1MMG A;  3ZMV A;  4HOB A;  3JAM Z;  2WAE A;  4Q5S F;  1T0F C;  4HNT A;  3FXM A;  3ZQQ A;  4EJV A;  2Q0O A;  2ESN A;  1ON2 A;  2P6T A;  2M5W A;  3QAH A;  3VYS B;  5LGU A;  4DYC A;  3J7A O;  4IXA A;  3OYE A;  1HA8 A;  4A3K J;  1P4X A;  2JK3 A;  3BG3 A;  3B6C A;  2IBD A;  1W36 C;  2K4J A;  1TWA J;  1SFO J;  2Y69 H;  2Z16 A;  2B9S A;  1LE8 B;  3KZZ A;  4YFX F;  3ESW B;  2N8G A;  1OYI A;  1ZN2 A;  4PJ0 C;  4JK1 X;  2QA4 I;  4A3B J;  1ETK A;  1IXS B;  1R5G A;  4OMZ A;  3VOD A;  2F5D A;  4ANJ A;  2LRE A;  5B1A H;  2COB A;  2EFP A;  3HSE A;  1V55 H;  3PO2 J;  4HF0 A;  1YRN B;  3SYT A;  5LRS A;  5EEA A;  2EIL H;  3KCC A;  4IJA A;  5J8F A;  4DOZ A;  1I1G A;  1XB4 A;  3GFM A;  3HSF A;  3I64 A;  5IOZ A;  1RET A;  2R7O A;  3AG4 H;  3H9J A;  4AYB A;  3H92 A;  5B66 C;  1SAX A;  4FHT A;  3EUH A;  2HZD A;  1Y1W J;  3FF5 A;  1U3E M;  3TMO A;  2Q8K A;  3HDD A;  2DA3 A;  1R23 A;  4BNC A;  4LD5 A;  2HYG D;  4LK1 F;  1W0T A;  1MJA A;  1U78 A;  1FSH A;  5CVU A;  5FLX Z;  4EQQ A;  1LPQ A;  3C7J A;  3ZN0 A;  3RCO A;  4C9Y A;  2B0L A;  5L3D A;  4B43 A;  1YJN I;  3DFG A;  5IP6 A;  1FYL A;  4B48 A;  1IN4 A;  1I50 J;  4XRS A;  4BE0 A;  3G71 I;  2XF7 A;  5DCF A;  2IEK A;  2EZK A;  3SFZ A;  4E7K A;  3EPZ A;  2W1O A;  3R0A A;  2Z9O A;  1BC8 C;  1ETO A;  3JRA A;  4G7Z F;  1R4M B;  2EA2 A;  2K4B A;  2R3S A;  3H36 A;  5FRO A;  3ZQH A;  4J00 A;  4W1U A;  1K4S A;  3T8T A;  1FOW A;  1SVO A;  4ENM A;  4L0Y B;  1HXD A;  5C3E J;  2R7W A;  2AO9 A;  2IA1 A;  2V9P A;  5F1R A;  1IW7 F;  3DU6 A;  1F4K A;  5GP9 A;  3OYF A;  1QO0 D;  3QWL A;  4OIN F;  1KON A;  2DK8 A;  2HQN A;  1YO5 C;  2FMY A;  2QZ8 A;  1XN7 A;  4HV5 A;  1YFH A;  3DKW A;  1XGS A;  2MA3 A;  2P4W A;  4QPQ A;  2L0K A;  4AM3 A;  2DU9 A;  3HOS A;  3FBI B;  3TDU C;  4ZYG A;  1D5Y A;  1V4R A;  3JCU C;  1U0J A;  5GPA A;  5LRR A;  3RZD J;  2D1V A;  2IVM A;  1WJC A;  4ETS A;  5HS7 A;  4BUP A;  1AKH B;  1HST A;  1SD5 A;  1U5T A;  3ZGK A;  4A5N A;  4UVC A;  1LVK A;  2HFH A;  1OCR H;  5D5U B;  4IHY A;  1MH3 A;  2UUZ A;  4LGW A;  1EJ9 A;  1O57 A;  1B9N A;  2AS5 F;  2R93 J;  2PJP A;  4MNU A;  2QBY A;  1YI2 I;  3LQQ A;  5L3G A;  5LHG A;  3DTE A;  1JKO C;  1TWC J;  3I4N J;  3BY6 A;  1RKT A;  4DYR A;  3S2D J;  3L09 A;  2KIU A;  1NG7 A;  4P9U A;  3GF2 A;  3HGY A;  3CLO A;  1Z7U A;  4I01 A;  1D0Z A;  2VJJ A;  3KZI C;  4I6Z A;  4GO1 A;  2GM4 A;  5DCM B;  2WAQ N;  1PYV A;  3F22 A;  2K27 A;  1SMT A;  1FJL A;  3A01 A;  1MMS A;  3CMM A;  2DYS H;  1A5J A;  3OYC A;  5E20 A;  3BWG A;  3L2W A;  1HSJ A;  1MNE A;  1EA3 A;  1X58 A;  2JTV A;  2GWR A;  3OOU A;  2P0W A;  2L7Z A;  2CFX A;  5HOO A;  3K70 D;  1IJW C;  3E6D A;  1BOB A;  1J7K A;  4C2U A;  3HHG A;  1J59 A;  2VQG A;  1IN6 A;  3DBH B;  3K4C A;  4P9F A;  3IP4 B;  5F0C A;  5HLG A;  2HEO A;  4MIM A;  4RLQ A;  5K5O A;  4MGR A;  4U88 A;  4E7L A;  3ABU A;  4CCN A;  2JVH A;  3RQI A;  4ZC3 A;  5FKM A;  2V1D A;  3Q0W A;  3OIO A;  4MQV A;  5DTD A;  1WSU A;  4QLC U;  4U0W A;  1YIJ I;  4LIV A;  2ISZ A;  4OMY A;  4L5E A;  1DU6 A;  2XF5 A;  3KYL A;  1FOY A;  1DU0 A;  3LSJ A;  1IDY A;  2FEZ A;  3KPH A;  3HZJ A;  4HV6 A;  4RAZ A;  3LSP A;  3ZP5 A;  4CIC A;  2XAG A;  1A35 A;  2A6E F;  3ABL H;  1ITY A;  1UHS A;  3BR5 A;  3DV8 A;  3ISP A;  1RNL A;  5GAD J;  1MW7 A;  1R1T A;  3OYD A;  1KA8 A;  2GZW A;  3LWF A;  1UCR A;  4Y33 A;  2F5C A;  3F8B A;  2W00 A;  4HNU A;  1LFB A;  2K9N A;  2OCE A;  1J2X A;  2LR8 A;  2HNH A;  3HG9 A;  4II3 A;  1Y1V J;  2BY0 A;  2HOE A;  1JXS A;  4LFU A;  4Y15 A;  2FOW A;  2Y31 A;  2ISY A;  4HRI A;  3N4M A;  1XSD A;  4QPO A;  4CCJ A;  3P9I A;  1G3S A;  3IH3 A;  3JRC A;  1D1C A;  4GFB A;  2E1M B;  2LF8 A;  1JJ8 C;  1TWG J;  3L9F A;  2CUE A;  2D1H A;  1YQA A;  1Z3X A;  3TO9 A;  4H0E A;  1J9I A;  1Z77 A;  2DA1 A;  4E4H A;  3KZY A;  4V2F A;  4NC8 A;  5DD4 A;  1MBK A;  4PJL A;  6PAX A;  3W6J B;  2XHK A;  2E71 A;  4GDF A;  2FU4 A;  2ID6 A;  4B1R A;  2HVS A;  1YOV B;  2X9D A;  3H3V K;  5F0F A;  3PSF A;  1YRN A;  1FNN A;  2MH2 A;  4CO8 A;  2R7D A;  2JT1 A;  3M7G A;  2JRM A;  3IAM 2;  1RPW A;  1SFK A;  1ACI A;  3WTU C;  3C3W A;  4DNC A;  1MMD A;  1USS A;  3KP4 A;  2XRL A;  1YIO A;  1W5S A;  5BNG A;  1TW3 A;  4HX8 A;  5DD8 A;  2DA7 A;  3OYI A;  2NXN B;  3BDD A;  1U9N A;  2CS3 A;  3LA3 A;  3DF8 A;  4XKW A;  2BBY A;  2DFH A;  3RPU A;  3CJT B;  3DWL E;  4IZZ A;  2ZXI A;  1JKR C;  3HBL A;  1TWH J;  5D6F A;  3KLN A;  3VSL A;  1T08 B;  5J1U A;  2HQA A;  1X1B A;  1NH3 A;  3QOP A;  2PJR A;  3RZO J;  1MMA A;  3FZV A;  5LEJ A;  2LNB A;  3HC7 A;  1VQ7 I;  4HF1 A;  2O3F A;  1GVJ A;  4FAS D;  1SC7 A;  2DMQ A;  2E36 A;  3LAP A;  1OPC A;  1VQ5 I;  4OU0 A;  3WE3 A;  3KP6 A;  2FML A;  3FXR A;  1STZ A;  1LEA A;  2JUC A;  4EJO A;  1ETV A;  2GOX B;  2D45 A;  3PSI A;  5A2Q Z;  1SEU A;  1ZRD A;  2CV1 A;  3J7Z I;  4LB6 B;  2A6H F;  4AIJ A;  4A3C J;  1R5H A;  3BR0 A;  3LSR A;  2OA4 A;  2ECC A;  2PMZ A;  4BAC A;  2XV4 S;  3J81 Z;  4I09 A;  3F6V A;  2OUM A;  1W1W E;  3W2A A;  3CJQ B;  2AXT C;  5CPR B;  2KZG A;  4NB5 A;  3CC7 I;  1OYW A;  4ESB A;  3DTI A;  2HOA A;  2HS5 A;  2CU7 A;  3FMS A;  3LL7 A;  1SAN A;  3KLO A;  2FQ3 A;  3ELK A;  2O6G E;  3QYE A;  2LBF B;  1GLN A;  1BW6 A;  4E7Z A;  4LLG F;  2H09 A;  4GCV A;  2UV1 A;  2YX4 A;  2M87 A;  2KIF A;  2PX9 A;  4XR6 A;  1N75 A;  3PIO F;  1YTY A;  1LFP A;  3CO6 C;  4XIC A;  1FPQ A;  4HPQ A;  4M3B A;  3OYJ A;  2KRC A;  3BOQ A;  3S8P A;  5IT9 Z;  4Y4R A;  4S0H B;  3JTH A;  2P5K A;  4UB8 C;  4PJM A;  2Y0S N;  3BRO A;  3M9A A;  1FOK A;  3F8N A;  2RNJ A;  4BE2 A;  2CG4 A;  2QQ8 A;  3BG9 A;  5IY5 H;  3S3M A;  3PNT A;  2H1K A;  1BOA A;  2P5V A;  4UUS A;  2ZJR F;  1Y0U A;  5FRM A;  1F43 A;  5DCM A;  1ZGA A;  3GLL A;  1QHH D;  4I02 A;  2QQA A;  3WU1 B;  3G3Z A;  2ESH A;  1LE8 A;  2ADU A;  4A3E J;  3WTZ A;  4CZZ A;  1ORK A;  2L7F P;  2VC0 A;  4E7H A;  4CHU A;  4PK4 A;  3LAJ A;  2CQQ A;  2CUF A;  3S1R J;  1S5L C;  2ZXW H;  3IH2 A;  1F5T A;  3MCZ A;  2ME0 A;  3ERE D;  5FLV A;  2HKX A;  2DTR A;  2QWW A;  5BS6 A;  3ASN H;  2XGD A;  2HTJ A;  4CCM A;  2I8D A;  2K40 A;  3WTS C;  3HB9 A;  3DP7 A;  4KUM A;  3GWZ A;  1GDT A;  3FX3 A;  4AWX B;  3QPS A;  4B3A A;  4E7I A;  2QKL B;  2Y75 A;  5H2F C;  1NTC A;  4EJT A;  1XC5 A;  3CES A;  5LGN A;  1FC3 A;  2L5Q A;  3U2R A;  4BU2 A;  5E8I A;  5D5X B;  1HW1 A;  1XDS A;  3L00 A;  1TBX A;  2LSO A;  4BKX A;  1DGW Y;  2R7Z J;  1Z9C A;  3CLQ A;  1ON1 A;  1FWZ A;  1OYY A;  3HXL A;  5LLQ A;  2WB1 A;  4FE7 A;  3GXO A;  4DJA A;  1SD6 A;  3MZH A;  4M3G A;  1FTT A;  2BY2 A;  2PBI A;  2XRO A;  4F91 B;  4GXO A;  4RDU A;  4I0B A;  4YFN F;  2AHQ A;  1V5G A;  2IA0 A;  4N4O B;  1QU3 A;  1VZ0 A;  4TV7 A;  3QP5 A;  4MQ9 F;  1FZP B;  2VOO A;  1YJ9 I;  4KIF A;  4W97 A;  3R61 A;  1OKR A;  2KLO A;  3FXJ A;  4D0P A;  5HLH A;  2HVQ A;  4FET A;  2E7W A;  2JA2 A;  3HUG A;  3R4K A;  4KNY A;  2WA0 A;  2WV0 A;  3EYY A;  3IAS 2;  4YIR X;  2K3P A;  3PQJ A;  5HVQ C;  2Y2Z A;  3HOU J;  1YX3 A;  5J4V A;  4XLF A;  4M9S A;  4UV9 A;  2DAO A;  4DZP A;  1CGP A;  1L0O C;  4NC7 A;  1FBU A;  2FNA A;  1PP7 U;  1TNS A;  1XMA A;  3LSG A;  2ZKZ A;  5H20 A;  2X48 A;  3V8K A;  2LY9 A;  4LJZ F;  4ZYD A;  1AWC A;  2ZB9 A;  4PGG A;  3M1C A;  1JGG A;  2VN2 A;  2VQH A;  3OL3 A;  3PFI A;  2K3F A;  1RIO H;  4LLN A;  1N25 A;  5CQG A;  2FSW A;  5IT3 A;  3C2H A;  4WXD A;  1WJB A;  3JSP A;  3BR1 A;  2G7U A;  2LK2 A;  4D5C A;  1JUM A;  4DBQ A;  3QP6 A;  4ZDO A;  1Q1H A;  1WH7 A;  2GXB A;  4LK0 F;  1NK2 P;  3BG7 A;  3PM1 A;  2EIJ H;  1H88 C;  2O8X A;  3DEW A;  5J8C A;  3OYB A;  3D1N I;  3CUO A;  4XRM A;  2XAJ A;  4XL9 A;  2K9M A;  3JSO A;  4EMS A;  1D0Y A;  3HM5 A;  1ZEL A;  4JX6 A;  1UG2 A;  3ULQ B;  3W2W A;  3CD6 I;  1TLH B;  2V6C A;  1G3T A;  1D0X A;  4YFK F;  3BJ6 A;  4B8X A;  1H0M A;  1AU7 A;  3K7A J;  1LDD A;  2QVO A;  2OTL I;  2JUG A;  1OFC X;  1QPI A;  3H5R A;  3MAJ A;  3BT9 A;  2H6B A;  2P5L C;  2XC7 A;  1JKP C;  1EH7 A;  1QZE A;  1SAU A;  1BIB A;  1P6R A;  2IS1 A;  3LFK A;  2K9S A;  3DBR B;  3CF5 F;  3CF2 A;  4L5I A;  2Y0M A;  1LVA A;  2Y9Y A;  5K7Z A;  5M3M J;  3JRB A;  3H3Z A;  1I1S A;  1O3S A;  1IRX A;  2LOO A;  2PFB A;  3ZQF A;  4A5M A;  2LY2 A;  3HIF A;  3L2V A;  1XG1 A;  3S2H J;  2XVC A;  3ZQ7 A;  1WJE A;  2YS9 A;  3KFW X;  1P4A A;  4X1E A;  2R7Q A;  1JTY A;  3K10 A;  4E7J A;  1DP7 P;  2JA5 J;  3PNV A;  2PQ8 A;  1ZR4 A;  5E79 C;  1BI0 A;  1WWX A;  5B1B H;  3Q3S A;  4J19 A;  3H9G A;  2XSJ C;  5K7F A;  2WAF A;  1JJ6 C;  3FKI J;  4WCG A;  5EGO B;  2HXI A;  3VPR A;  5DEQ A;  2NYX A;  4U7D A;  4ENK A;  2MSY A;  2KMU A;  1XD7 A;  2ETH A;  1GT0 C;  4MEX F;  2VOD A;  2EZI A;  2E19 A;  2BY3 A;  3OL4 A;  4F55 A;  2ZJP F;  3RSN A;  5E17 F;  1WPK A;  2DPD A;  2UXX A;  2W7N A;  2W25 A;  3BTI A;  2OD5 A;  3EQL F;  4HX7 A;  4PGH A;  4AIK A;  1RC9 A;  5DYM A;  1UAA A;  2LP0 A;  3T8R A;  1UST A;  2MW8 A;  1LKX A;  4YII A;  2WY8 Q;  4CSW A;  2MFZ A;  4UVA A;  1LEB A;  2DFI A;  2DJI A;  4HQM A;  2ELJ A;  3OOP A;  1ETX A;  2OV7 A;  4A93 J;  4RAG A;  1PUF A;  3S93 A;  3ZPL A;  3G73 A;  1HLV A;  1OJL A;  4B44 A;  4PFO A;  4I2O A;  2Y30 A;  5ICF A;  1E3O C;  3L7W A;  3SZG A;  3MVP A;  4IRI A;  3U9G A;  2O8K A;  2HQ5 A;  3HL2 A;  3HRT A;  1Z91 A;  3KEQ A;  4L5J A;  4PZJ A;  3ZQG A;  3S1Q J;  1ZAO A;  1FTZ A;  2CGP A;  4D7N A;  3QU3 A;  3OIQ A;  2BOL A;  3IWZ A;  2I5U A;  4M3D A;  1Z67 A;  3F6O A;  1TL8 A;  1G4D A;  3ABK H;  2B63 J;  1BN5 A;  1P9Q C;  5FD6 A;  3CUQ B;  2E1O A;  4G6D A;  4RGS A;  2BZT A;  1T0F A;  4I98 B;  1A6Q A;  2FBK A;  4JX5 A;  4IPA A;  1JUP A;  2X85 A;  5J3L A;  3COA C;  3DQV C;  2LKX A;  1ZHF A;  3RKX A;  1KQ0 A;  2J5P A;  4UNO A;  3IRQ A;  2A61 A;  3G2B A;  1SVM A;  3DPL C;  1XGO A;  3MKW B;  1B1B A;  3CP2 A;  2X51 A;  1K6O A;  2XAS A;  4RGX A;  2FBI A;  1T56 A;  3K1M A;  1Z6T A;  3U1K A;  5F08 A;  2JN6 A;  2ZXJ A;  4MTD A;  2L01 A;  4GRI A;  4NHJ A;  2W57 A;  3KX2 A;  2NS0 A;  2OCC H;  4F7Z A;  3GTM J;  4MEY F;  2HYJ A;  3OMY A;  2YU9 J;  4A3G J;  1E17 A;  3L2Q A;  4IHX A;  3T0Y A;  3D5S C;  4C3J J;  2PI0 A;  4D5F A;  3L2R A;  3V7R A;  5GPC A;  1A04 A;  2FBH A;  2LDU A;  2IRF G;  2ID3 A;  2O7O A;  2M0M A;  4YG2 F;  4AVZ A;  2V7F A;  1MKM A;  2FNP A;  3ML6 A;  2KJC A;  3BJO A;  4BJ5 C;  4IO9 F;  2E1N A;  2VKD A;  1LFU P;  5EZG A;  3VEP A;  1R7J A;  2E5N A;  5F04 A;  2DMP A;  1BA5 A;  3GFL A;  2FJ1 A;  4IRG A;  5DUI A;  4A3D J;  2A5W A;  2JJ7 A;  4D9J A;  2F48 A;  1YYV A;  4P1W A;  5IT9 K;  3S1M J;  2IXS A;  4LMY A;  2BHZ A;  1X3W B;  1P4W A;  3GW2 A;  1JUS A;  3B02 A;  3K1N A;  1MND A;  4BQN A;  3G1O A;  2CMP A;  2CJJ A;  2QKM B;  3BCA A;  1AKH A;  1FMV A;  4JP0 A;  4AC0 A;  4CXF A;  3G4S I;  3TO6 A;  3ZMU A;  1G8X A;  3R6S A;  3RYP A;  3SDG A;  4B47 A;  1HKT A;  4QWQ A;  3H1C A;  3WE2 A;  5BQT A;  5F1J A;  5AIQ A;  4RGU A;  2FXA A;  2KRH A;  5HDK A;  4QTR A;  2LD5 A;  3GTK J;  4LIU A;  3FIS A;  2DFF A;  2GIV A;  3HSR A;  1IV8 A;  2DA5 A;  4DQ2 A;  3WTY C;  1ETW A;  1R71 A;  4WK8 F;  5HLT A;  5F64 A;  4XN0 A;  2QSH X;  3CCY A;  3CQZ J;  2OPT A;  5CVJ A;  1S29 A;  2Z2S B;  3B73 A;  1GV2 A;  2K5C A;  2VKH A;  2W84 A;  3FDY A;  3E97 A;  1HF0 A;  4Y3O A;  1B6A A;  2V9V A;  3SEQ A;  1MD0 A;  4BQA A;  2KRF A;  2GXG A;  3BP8 A;  3I5U A;  2BEO A;  3FWE A;  4G6Q A;  4HW0 A;  1O3T A;  3MQ0 A;  5GAG J;  3J81 K;  4UUS B;  3DLA A;  3JAM K;  2ZC2 A;  5ILV A;  4X6A J;  3K2Z A;  2JQ7 A;  4P96 A;  4QSH A;  2CW8 A;  2VC1 A;  5JR3 A;  2R92 J;  4PJJ A;  3A0B C;  4LG0 B;  1R5I D;  1A36 A;  4N9I A;  5ERI A;  2LMD A;  2X1D A;  1FP1 D;  4G6T B;  4O5V A;  2VQC A;  4BEH B;  2DOF A;  3CME I;  3HOZ J;  3DBL B;  3FHN A;  3K4N A;  4M6Y A;  5JLX A;  3RI4 A;  2EFO A;  5E3O A;  2QEX I;  2LYC A;  2DO7 A;  2JSP A;  3BQY A;  4WXH A;  3GFI A;  1W0U A;  4M9X A;  4KN7 X;  1HW5 A;  5HLI A;  2Q2E B;  4XKB A;  2E2J J;  5TIS C;  2HDD A;  1VI0 A;  3ECO A;  5EYR A;  2HWV A;  3D0S A;  3KEY A;  1FP2 A;  3C1D A;  2XB5 A;  4M6V A;  2R7U A;  1IZ1 A;  5BPI A;  1WH5 A;  2XUB A;  1QZY A;  3GZ6 A;  1YE9 A;  2EA4 A;  4PDK A;  5D8K B;  2ZSI B;  2EZH A;  1XSX A;  2WBM A;  1DQU A;  3DEE A;  4CZC A;  2P7C B;  1Z6R A;  2LKS A;  1VTN C;  4KA4 A;  5K7H A;  2DW4 A;  3G1L A;  2IW5 A;  4XLP F;  1MMN A;  2OQG A;  2HOS A;  4E6K G;  1V54 H;  3E5Q A;  2B7E A;  3V7C A;  4ZYA A;  2VJ5 A;  5HDG A;  4DYQ A;  4KFC A;  2PLY A;  4UXN A;  3ZRG A;  4HG2 A;  3GZ5 A;  1YX5 A;  3PO3 J;  2VE9 A;  2J5O A;  1FLI A;  4IRH A;  2LH9 A;  3MKZ A;  1ZQ3 P;  2JVG A;  2M30 A;  4MHG A;  3MKY B;  1GUU A;  2STT A;  2WY7 Q;  2XAU A;  1EH8 A;  1PUF B;  1JT6 A;  2L9R A;  4YEL A;  3ZMZ A;  1J75 A;  4ITV A;  3CMA I;  5FKK A;  3HKZ A;  1IF1 A;  3M4O J;  1XPX A;  2HPM A;  2ZBK A;  3K2A A;  3OYG A;  4KMF A;  3V7S A;  3P7N A;  4FX4 A;  1X3U A;  5E1X A;  1FEX A;  3HYI A;  3LSI A;  3H0D A;  2BGC A;  2NVU B;  3BPV A;  2L7K A;  1A31 A;  4A3F J;  2WAQ A;  5DM6 F;  4IOA F;  2IGM A;  4XKV A;  4HEA 2;  4NDL A;  3W3C A;  1IN5 A;  2Z5U A;  4P55 A;  3U1D A;  2HYF A;  2HOT A;  1FT9 A;  2QYO A;  1TP4 A;  3QPT A;  4YEJ A;  2ZME A;  3TW6 A;  1SFX A;  4BXF A;  4WX9 A;  4G94 A;  3VWB A;  5CVV A;  2IAI A;  3KP2 A;  1P7I A;  1WRJ A;  3PJR A;  2EQR A;  2OZ6 A;  5M5X J;  3N05 A;  3P9K A;  4H4K C;  3KP7 A;  2NS8 A;  2A05 A;  1ZK8 A;  2CUJ A;  5IOY A;  2XIG A;  1FYM A;  2A6T A;  2EZL A;  1ETY A;  1WJA A;  1G3W A;  2EV0 A;  1HC8 A;  3HOX J;  2R7F A;  1TT5 B;  2OJE D;  5AON A;  3H35 A;  1Z3Y A;  4N0B A;  2EIN H;  3HJE A;  3VFZ A;  4A0X A;  5E3N A;  5BPD A;  3J7A Y;  4CYC B;  4NQW A;  1R1U A;  3C2B A;  5EDN A;  3HRU A;  3RPQ A;  3CDH A;  4DW6 A;  5KAF C;  2CO5 A;  1ZLJ A;  2QQ9 A;  3OYM A;  4R1H A;  1W5T A;  2STW A;  1AOY A;  1RR7 A;  4BAY A;  1WI9 A;  2AQF A;  1UMQ A;  4G7O F;  1AHD P;  3GTG J;  2VBX A;  2R7V A;  2E7X A;  4A3L J;  1APL C;  2EFQ A;  1W7P D;  2XAF A;  2M7A A;  2M9H A;  3I4P A;  1X2M A;  3OYA A;  1XGM A;  2BHY A;  4RB3 C;  4IKF A;  3LST A;  1IV6 A;  2V26 A;  3CCU I;  2M2E A;  4RLF A;  3RIR A;  2LBF A;  1JGS A;  1IRF A;  1L3L A;  5EEG A;  2DMT A;  5AIP A;  2OQR A;  1JI8 A;  3F8C A;  2OTJ I;  2L4M A;  5TJJ A;  2FRH A;  5JVG F;  2FE3 A;  3RYR A;  4U87 A;  3TOB A;  1WVR A;  2FUG 2;  2VJI A;  1UG0 A;  3TED A;  3K70 C;  3OIP A;  5TGT A;  1D8J A;  1LDK B;  2Y48 A;  5E3M A;  1WGX A;  3K6G A;  1EKE A;  3WG7 H;  4A3I J;  4OIP F;  2X4H A;  4RAF A;  3NQO A;  5EF6 A;  3QOE A;  3D5R C;  3V42 A;  2F4O B;  3CCM I;  3HOV J;  4PUS A;  2I10 A;  4FX0 A;  3R0J A;  2XKP A;  3TP0 A;  4BQO A;  3MEX A;  4RB1 A;  3BZ6 A;  4YRV A;  3TO7 A;  1ZTR A;  5IPA A;  1POG A;  2CUZ A;  4XOT A;  5LHH A;  3MFK A;  4HSR A;  3I4M J;  1HCR A;  3VOE A;  4UB6 C;  2KKO A;  3PQK A;  1Z05 A;  3HOY J;  1LDJ A;  2LC2 A;  3EDP A;  3JRF A;  1MBG A;  2IJL A;  3ZN1 A;  5ICG A;  1IRG A;  4JOM A;  1BJZ A;  3OR2 C;  3BR6 A;  1BR1 A;  2BW3 B;  2MGQ A;  3IUO A;  2DXI A;  2LTP A;  4MFE A;  5FD5 A;  4EAT A;  3SDB A;  4WWC A;  4JQF A;  4A3M J;  2G9W A;  5CLS A;  4XMY A;  3Q0V A;  2V79 A;  2DQR A;  3JRH A;  2K86 A;  1H9T A;  2TRT A;  2DMU A;  3L1P A;  4XSZ F;  4U7B A;  2GAU A;  4V19 K;  1U8B A;  4PSW A;  2ZJ2 A;  3K69 A;  1FSE A;  2DFE A;  5JHF A;  2M4K A;  2JWT A;  2XRN A;  1K4T A;  2LFB A;  3K0L A;  4FT8 A;  4KIG A;  1X4O A;  4A6E A;  2XDV A;  3HHH A;  5EZH A;  5FKN A;  5L3F A;  3F21 A;  2RNG A;  5HNH A;  4FTH A;  4IF4 A;  3T1B A;  3E7L A;  2KT0 A;  1TT0 A;  4NUB A;  3W2V A;  2DLL A;  2A3S A;  5ED4 A;  5EG0 A;  5EG0 B;  5F0H A;  4DZJ A;  4BQQ A;  2FA5 A;  3J7Y J;  1BM9 A;  2OU2 A;  4HLY A;  4EJU A;  1O3R A;  2R5Y A;  1MBF A;  3BC8 A;  3SJM A;  3WHB A;  2CFO A;  3REO A;  3CC4 I;  4UUV A;  4KIB A;  3CC2 I;  5K1Y A;  3X2Q H;  1LJ9 A;  4M6X A;  4AVP A;  4JYK A;  4NNJ A;  3EUH C;  1IG7 A;  3D5L A;  1QPM A;  3GFJ A;  1HW2 A;  3GLX A;  4E70 A;  2FQ4 A;  2KHM A;  1PDN C;  2KJB A;  3ONQ A;  4IQ4 A;  2DT7 B;  5GTH C;  2M4G A;  5FLM J;  2YU3 A;  1MDM A;  3JRG A;  3OWT A;  2M45 A;  5IP7 J;  4XRS G;  4HBL A;  3OSG A;  3PUF A;  1IN7 A;  4Z6Y A;  4B3X A;  2PMH A;  1FBS A;  2LLK A;  3KEO A;  1VQL I;  5B3S H;  1I6H J;  4BBS J;  5J40 A;  3GME A;  4ENN A;  1ULY A;  1HQC A;  4M73 A;  1OCT C;  5K5R A;  5E3L A;  2MD0 A;  2R7R A;  5D6E A;  2EH3 A;  4BJ6 C;  2VL8 A;  4ESF A;  2DQL A;  5GTI C;  2E1C A;  3IKT A;  2VQL A;  2K7L A;  2VXZ A;  3A2K A;  1YLF A;  5F27 A;  3VDX A;  1WQ2 A;  5DDG A;  2DT6 A;  4B09 A;  1QVU A;  3HEF A;  3WOD F;  1HKQ A;  5KCM A;  1TTY A;  3OYH A;  3F3X A;  2IP2 A;  4XBF A;  1VQO I;  1XSV A;  1AA7 A;  4KYW A;  3EUA A;  4DIQ A;  5D5V B;  3OYK A;  1GXP A;  1KZH A;  3BZK A;  4KIC A;  1T39 A;  2V4J C;  3V8J A;  1RKW A;  3FKJ A;  3PNY A;  4JX4 A;  1CQT A;  2NVQ J;  2GXA A;  3E1S A;  2DOA A;  5D8L B;  1VND A;  5J4Y A;  3WU0 A;  4ZYH A;  3V4G A;  1FY7 A;  3SXY A;  5L3E A;  4FIS A;  2HU9 A;  4JBA A;  4KT5 C;  2LKP A;  2CSO A;  2RC4 A;  3FXO A;  2H94 A;  4LG3 A;  2VJ4 A;  2VKE A;  3LOC A;  1Y39 A;  1RR8 C;  3O8H A;  1FBQ A;  4RBO A;  3SZT A;  4AUX A;  3BPX A;  4OAY A;  1YS7 A;  3DPT A;  2BYV E;  3OV8 A;  2ECB A;  2V1U A;  2ICW G;  3L2C A;  4BDZ A;  5EGO A;  1BR2 A;  1ODD A;  4HZF A;  4V2G A;  1I3Q J;  2F4I A;  2EIK H;  3IHU A;  4AIH A;  4HYE A;  5HS8 A;  3ZQL A;  1HOM A;  1CF7 B;  4P5O A;  3ROU A;  2ZSH B;  1MSF C;  5CVI A;  2UWM A;  1EV7 A;  2EPF A;  3RTR A;  2F5E A;  5CJ9 A;  3SZP A;  3IKV A;  4LLL A;  3KP3 A;  5C44 J;  4LG0 A;  4BYY A;  4KMU X;  1HDD C;  3R60 A;  4XNF A;  3TQN A;  2VAS A;  4HX4 A;  1SD4 A;  2BW3 A;  3O3K A;  1QZZ A;  1IAW A;  1FMW A;  2UXN A;  4BJT A;  3WTX C;  1VQ6 I;  3AG2 H;  4Y17 A;  1YW8 A;  3HGG A;  1T6S A;  1LUJ B;  2X1E A;  3I0T A;  3S1N J;  2DDA A;  5EEH A;  1F1Z A;  1NG6 A;  4IL6 C;  1S72 I;  4NC6 A;  5LD2 C;  2A5Y B;  3MKL A;  4D7M A;  2FF4 A;  2M0C A;  4EJW A;  4I99 C;  2VLA A;  1U9O A;  3IL2 A;  2ELH A;  2MH9 A;  4C2T A;  4IEJ A;  2BV6 A;  2QGU A;  4CCL A;  1K61 A;  2RV8 A;  1Y56 A;  1ZR2 A;  4HST A;  2V1N A;  1Y0N A;  3H0G J;  1WZ2 A;  2XKO A;  3F9K A;  1NHA A;  5L3B A;  9ANT A;  3U21 A;  3QOD A;  1UHW A;  2L02 A;  2JSC A;  2XAH A;  3CCS I;  1QGP A;  2QLZ A;  5KVR A;  4Q48 A;  1IN8 A;  5IYC J;  2CWE A;  1MH4 A;  1ERD A;  1YIT I;  1KYW A;  3JR9 A;  1EF4 A;  2LVS A;  1IDZ A;  3WHC A;  4PSX A;  1VQM I;  1OCP A;  1QA6 A;  2RN7 A;  2AQE A;  2CV0 A;  4L9T A;  2NRA C;  1W4M A;  1QNT A;  3FXQ A;  3ZXS A;  4M71 A;  2DCE A;  5FB2 A;  2HR3 A;  4A69 C;  4BH9 A;  2JRT A;  2Z33 A;  3WTT C;  2WTE A;  4Z2Y A;  4I7H A;  1T38 A;  3A1Y A;  1X19 A;  2KDO A;  1UFM A;  4RB2 C;  1YJW I;  2HDC A;  1YHQ I;  3CCQ I;  1KU9 A;  2CV2 A;  2O61 A;  5D4R A;  1Z0X A;  2X6W A;  4IOC F;  3I71 A;  4RB0 A;  3S3O A;  1T8I A;  3HPH A;  3DU5 A;  4ZDP A;  2Z3Y A;  1R1V A;  2H8W A;  2TDX A;  1T95 A;  3MN2 A;  4XM3 A;  2XPU A;  3FBN B;  4IX7 A;  2GQQ A;  3V8L A;  2HQR A;  2WC2 A;  2A68 F;  3HUG B;  5DUK A;  5JFR A;  2R7X A;  1RRJ A;  3IC7 A;  1FIA A;  2QEN A;  4CYD A;  4CCO A;  5KNL A;  1MIJ A;  3BZC A;  4F93 B;  2EBI A;  4LOC A;  2E2H J;  3O6B B;  2XGX A;  2QBY B;  3ZMT A;  1O7F A;  2ELK A;  2H27 A;  2R7S A;  2OAZ A;  1ETQ A;  1Y8Q B;  5GAH J;  1PVE A;  1RI7 A;  2XAQ A;  3E3V A;  1TZL A;  1YW9 A;  3VYU B;  2HZT A;  1MDM B;  1R22 A;  3OSF A;  1SVL A;  1WI3 A;  3FM5 A;  5H6Q A;  4R79 A;  2EB7 A;  2D5V A;  4A0Z A;  5LEK A;  2DMN A;  3K9T A;  2NAZ A;  2R5Z B;  4CYC A;  3A01 B;  1JE8 A;  2DYR H;  3HOT A;  4ZZD A;  1YG2 A;  4HDV A;  4YIF A;  4EVI A;  3DLL F;  2W24 A;  3LSH A;  4XSX F;  1JHH A;  4N9H A;  3E6M A;  4XON A;  2Y0S A;  3NWS A;  3ECH A;  2NVX J;  3DCF A;  4II2 A;  1VF9 A;  5E8G A;  1G3Y A;  4BBR J;  1I27 A;  2D2W A;  4KJZ A;  4ZTJ A;  3M07 A;  1FOX A;  2VBY A;  2E2I J;  4BXU A;  1P7J A;  4M3E A;  3I56 I;  5KK1 A;  5BOX A;  4EGY A;  3Q9S A;  5H6R A;  4RM3 A;  5KHD A;  4L9N A;  3DPU A;  1UHM A;  2LY1 A;  3CUQ C;  2K9L A;  4A6D A;  2F5V A;  1WKM A;  4CCK A;  3NEU A;  2VPR A;  1Z1D A;  3PUB A;  2O03 A;  1UB9 A;  3MZY A;  4HAM A;  4BDY A;  2V6E A;  5HOD A;  3K4K A;  3HPG A;  1N78 A;  4CGZ A;  4M3F A;  2CH0 A;  3BLY A;  3ASO H;  4GYI A;  3OY9 A;  2VOP A;  3FMR A;  3JRI A;  3BG5 A;  4FCY A;  1PJR A;  1XDU A;  4A2U A;  4F3Q A;  1REP C;  3GTQ J;  1O7L A;  3OR1 C;  1S6L A;  5DV5 A;  3ZQC A;  1S7E A;  5M3F J;  5FRN A;  1HKS A;  2GOM A;  2P7V B;  3SEZ A;  4O6J A;  2IGO A;  3WGI A;  1KYZ A;  4D1Q A;  5CYV A;  5EJC A;  1KQ8 A;  2R0Q C;  2NVT J;  1U6G A;  4S04 A;  2CW7 A;  3K4L A;  2DI3 A;  3NRV A;  4C2M J;  2HDW A;  2MC4 A;  4IHV A;  3CZ6 A;  3I9V 2;  3I54 A;  4RA2 A;  2VIX A;  1JKQ C;  3NAU A;  3S32 A;  2KIS A;  2WB1 N;  3M8J A;  2DK5 A;  4Y52 J;  2ZCW A;  3QPL A;  4Y13 A;  1SFU A;  3JW4 A;  2EJR A;  4KIT B;  5L3C A;  2ZJQ F;  5BMZ A;  4BEH A;  2YX7 A;  3NAR A;  4XRF A;  2G7H A;  2HVR A;  2RQP A;  3CJN A;  2LG4 A;  3I3L A;  3BTL A;  3OS2 A;  1V3F A;  2OZU A;  2RDP A;  2VT3 A;  3E5X A;  2L54 A;  4HNV A;  3W6V A;  2ZXH A;  4U0V A;  1HBX G;  5LGT A;  4XKC A;  3OYN A;  2K9Q A;  3VYR B;  1Y8R B;  2L4A A;  1R9T J;  2CQX A;  1D1B A;  3GX4 X;  5LBQ A;  4UVB A;  1BIA A;  2G0E A;  4XID A;  1ZG3 A;  3DKX A;  4ENJ A;  2L7M P;  3LMM A;  3CDI A;  4HA8 A;  1LB2 A;  2MG4 A;  3TP3 A;  2VBW A;  1QVT A;  3A03 A;  3RPU D;  4AD9 A;  5ILU A;  5JLW A;  4M9Z A;  4ASN A;  2YPR A;  3FK6 A;  4BE1 A;  1B72 A;  3RDI A;  3VB2 A;  1MZB A;  2HTS A;  4RMN A;  1P92 A;  2ZO4 A;  1X3Z B;  4XQF A;  4O3M A;  2R4G A;  3UKG A;  3MZ8 A;  1TW2 A;  1M1E B;  1RUN A;  1VFC A;  4L9V A;  2CYY A;  3PL8 A;  1GXQ A;  1ONV A;  1MBH A;  2JPC A;  4IVN A;  1A6I A;  2MBF A;  1B9M A;  4M72 A;  3ABT A;  2CW0 F;  5FFZ A;  2QUF A;  4BGD A;  3JRD A;  1J09 A;  1XGN A;  1MJB A;  2KP6 A;  2DN0 A;  3CCL I;  3Q5F A;  4CH7 A;  4I76 A;  3CDL A;  4CA0 A;  4L18 B;  3ZR8 X;  4UUT A;  1UEL B;  3HTU A;  2P81 A;  4K2E A;  1OCZ H;  4AYB N;  2K02 A;  2EIM H;  4B4C A;  1U2W A;  3KYD B;  4J01 A;  1NK3 P;  2KZV A;  4KDP A;  4OIO F;  2M3A A;  2QCO A;  3O8G A;  5KAI C;  3GCM A;  1R6R A;  4XOP A;  4I0A A;  1JTX A;  3A02 A;  4S05 A;  4ZDL A;  2A07 F;  2X6Y A;  2O9L A;  1I3A A;  5E1W A;  3B6A A;  1MNM C;  3KYC B;  1IUF A;  4PCQ A;  1MBJ A;  1E0E A;  1SMY F;  3S2W A;  2E34 A;  1G6N A;  3KIO A;  1MJ9 A;  3WU2 C;  2H1L A;  4G8X A;  1GV5 A;  5C4X J;  2LF7 A;  1VQ4 I;  1RZ4 A;  3HOW J;  3FXU A;  3KET A;  2H6C A;  1R4N B;  4KT6 A;  3KE2 A;  1XTA A;  2DA6 A;  3BTC A;  3GYH X;  3HRS A;  1BI3 A;  2L9V A;  1XMX A;  2DT5 A;  4L0Z B;  5J1R A;  2L3D A;  1X1A A;  2E5Z A;  2QSG X;  1T98 A;  4U0Y A;  1D8K A;  3UR3 C;  2IPQ X;  3DEU A;  1ZRC A;  1BI2 A;  2NNN A;  3VSK A;  2JZY A;  2XPW A;  4XLA A;  1GHC A;  1E2X A;  5HS9 A;  2HGC A;  2KFD A;  2YUS A;  3MMY B;  3GTP J;  5D5W B;  4ZJZ A;  2WAD A;  2M34 A;  2P6S A;  2GA2 A;  3AKZ A;  5K5Q A;  1YW7 A;  3TDZ C;  3BR3 A;  4LB5 A;  1G59 A;  1G2H A;  5LFA A;  3LQR A;  2RGV A;  1IGN A;  3NWT A;  2BE5 F;  3M1E A;  2FD5 A;  1T2K A;  2KDZ A;  2KPM A;  5LHI A;  1JHF A;  2KL4 A;  2V9K A;  2GA1 A;  4IHT A;  1I5Z A;  3GBG A;  3FM3 A;  2HPI A;  2IS6 A;  5DM7 F;  4CUG A;  3H5A A;  4BHC A;  2NVY J;  3F72 A;  4PFP A;  5E18 F;  1B8I B;  1K79 A;  1WJD A;  1QHG A;  2Q2E A;  4CDG A;  1IO2 A;  1J5Y A;  1S7O A;  2YSR A;  1V5F A;  5D4S A;  2XGE A;  5M5Y J;  3P5J A;  2IS2 A;  2C6Y A;  1HDP A;  3VYT B;  3TBI A;  2IT0 A;  4UY8 I;  3RJP A;  1VQK I;  3CUQ A;  4EEF G;  4PJN A;  1MGT A;  2BXY A;  1OCC H;  2MLG A;  1XS9 A;  1P2F A;  3T5X A;  2ZNY A;  2L2O A;  4FQG A;  1PUE E;  1ZGJ A;  1DPR A;  4RM2 A;  2EWN A;  1ZRE A;  3K1P A;  1DDN A;  1SFE A;  3CCE I;  1U8R A;  5J6X A;  4RAY A;  3BCB A;  2QM3 A;  4BL0 B;  4BS9 A;  3CCJ I;  1QBJ A;  2JPB A;  2DA2 A;  2X6X A;  2KIQ A;  1VQ8 I;  1O3Q A;  3QU6 A;  1QQI A;  4X0G A;  4Q4Z F;  1VQN I; 
#chains in the Genus database with same CATH homology
 3QPH A;  1LQ1 A;  2V1X A;  5FO5 A;  1R00 A;  2Z99 A;  1K78 A;  3HTS B;  2X0L A;  1W7P A;  1DPU A;  1ZRF A;  4HF2 A;  5CVR A;  1OMI A;  3MWM A;  3QRF F;  3IRR A;  1TQI A;  4EM1 A;  1DUX C;  2VBZ A;  3J80 K;  2M8E A;  3LA2 A;  3IWF A;  1RUO A;  5ICC A;  5ILS A;  4GYG A;  5TRD A;  2P8T A;  1BJA A;  3WGH A;  2ZME B;  4ON0 A;  4HDU A;  1D5V A;  1U5T B;  1ZG1 A;  4G9Y A;  5JVT A;  2UZK A;  1TNT A;  2VT2 A;  3C18 A;  2EFW A;  5FLX K;  3EYI A;  2PMU A;  1S7A A;  1B4A A;  1S3J A;  1PP8 F;  2MC3 A;  4A0Y A;  3BJA A;  3KP5 A;  3ZMS A;  3I53 A;  1C0W A;  2EK5 A;  2KIM A;  1KU2 A;  3RKY A;  1U5T C;  1FX7 A;  4EV0 A;  3TOA A;  4HQE A;  3P9C A;  3WTV C;  2OBP A;  3M8F A;  1BBY A;  1OR7 A;  2EV5 A;  4IHS A;  5JHU A;  5FFX A;  1F9N A;  1D3Y A;  5JI6 A;  1KGS A;  2ZFW A;  1ZAR A;  4EGZ A;  2RVC A;  3FHZ A;  4WF2 A;  1BC7 C;  2RKH A;  3CTA A;  5E1Z B;  5HDN A;  3JTG A;  2DPU A;  4RGR A;  4OIR F;  2COM A;  2VON A;  3SHF A;  3LA7 A;  4ZYE A;  3O2P E;  5FGM A;  3I59 B;  3F23 A;  3FMQ A;  4UHT A;  3N97 A;  3E5U A;  1KU7 A;  1EH6 A;  3SQN A;  4A12 A;  4ZH4 F;  4G7H F;  5ICE A;  1XCB A;  2NNY A;  3F8M A;  1IXR C;  3F8F A;  1TQP A;  1KQ9 A;  4BHP A;  1CF7 A;  4M74 A;  3EET A;  5A2Q K;  3GVA A;  4R8H A;  3J80 Z;  4KN4 X;  3WGG A;  1K78 B;  1ZYR F;  1K7A A;  3E6C C;  2PG4 A;  1W7P B;  1XMK A;  5F6F A;  4EM2 A;  1TQM A;  3E6B A;  2A69 F;  1I6X A;  1J0R A;  3TKY A;  1FYK A;  1BI1 A;  3DXJ F;  4ZZL A;  4Q47 A;  2QQB A;  2DBB A;  3GO5 A;  2AXL A;  2MLK A;  2EFN A;  3W6K B;  4GGG A;  2HKO A;  1B59 A;  2FOK A;  2YR2 A;  4BHB A;  2PN6 A;  4L9J A;  2PEX A;  2ACJ A;  2EV6 A;  1ZLK A;  1S8N A;  1XCV A;  3AAF A;  1ZH5 A;  2MD5 A;  2ZNZ A;  1R58 A;  3Q9V A;  1YS6 A;  4XLN F;  2F5F A;  3CO7 C;  2W85 A;  1IUY A;  4UV8 A;  2IA2 A;  1KU3 A;  2VE8 A;  3RKW A;  4OOI A;  3WTW C;  4MTE A;  4WXC A;  1R36 A;  2O0Y A;  3WG9 A;  3GEZ A;  4ESJ A;  3H3U A;  1ZG5 A;  3TGN A;  4RS8 A;  3ZMD A;  4OIQ F;  3GUD A;  3M8E A;  1SD7 A;  2F2E A;  3I59 A;  1IXC A;  4HLX A;  1H9G A;  2CQK A;  3HRM A;  3I58 A;  2M1B A;  4EM0 B;  2WWY A;  1LNW A;  3ZMV A;  4HOB A;  3JAM Z;  4Q5S F;  4EJV A;  2Q0O A;  2ESN A;  1ON2 A;  2P6T A;  2M5W A;  3QAH A;  5LGU A;  3J7A O;  4IXA A;  1P4X A;  2K4J A;  3KZZ A;  4YFX F;  1OYI A;  1ZN2 A;  4JK1 X;  1IXS B;  1R5G A;  4OMZ A;  3VOD A;  2F5D A;  2EFP A;  3HSE A;  4HF0 A;  5LRS A;  3KCC A;  4IJA A;  5J8F A;  1I1G A;  1XB4 A;  3GFM A;  3HSF A;  3I64 A;  3H92 A;  1SAX A;  4FHT A;  3EUH A;  3FF5 A;  1U3E M;  2Q8K A;  1R23 A;  4BNC A;  4LD5 A;  2HYG D;  4LK1 F;  1MJA A;  1U78 A;  1FSH A;  5CVU A;  5FLX Z;  4EQQ A;  3C7J A;  3ZN0 A;  2B0L A;  5L3D A;  3DFG A;  1FYL A;  1IN4 A;  5DCF A;  3SFZ A;  3R0A A;  2Z9O A;  1BC8 C;  4G7Z F;  2EA2 A;  2K4B A;  2R3S A;  3T8T A;  4ENM A;  4L0Y B;  1HXD A;  2IA1 A;  5F1R A;  1IW7 F;  1F4K A;  1QO0 D;  4OIN F;  1YO5 C;  2DK8 A;  2HQN A;  2FMY A;  2QZ8 A;  1XN7 A;  4HV5 A;  1YFH A;  3DKW A;  1XGS A;  2MA3 A;  2P4W A;  2DU9 A;  3HOS A;  3TDU C;  4ZYG A;  1V4R A;  5LRR A;  2D1V A;  2IVM A;  4ETS A;  5HS7 A;  1HST A;  1SD5 A;  1U5T A;  4A5N A;  4UVC A;  2HFH A;  5D5U B;  4LGW A;  1O57 A;  1B9N A;  2AS5 F;  2PJP A;  4MNU A;  2QBY A;  3LQQ A;  5L3G A;  5LHG A;  3BY6 A;  3L09 A;  2KIU A;  4P9U A;  3GF2 A;  3CLO A;  1Z7U A;  4I01 A;  4GO1 A;  5DCM B;  3F22 A;  2K27 A;  1SMT A;  5E20 A;  3BWG A;  1HSJ A;  2JTV A;  2GWR A;  2CFX A;  5HOO A;  3E6D A;  1J7K A;  3HHG A;  1J59 A;  1IN6 A;  4P9F A;  5HLG A;  2HEO A;  5K5O A;  4MGR A;  4U88 A;  3ABU A;  2V1D A;  1WSU A;  4MQV A;  4QLC U;  4U0W A;  2ISZ A;  4OMY A;  2FEZ A;  4HV6 A;  4RAZ A;  3ZP5 A;  4CIC A;  2XAG A;  2A6E F;  3DV8 A;  3ISP A;  1RNL A;  1R1T A;  1KA8 A;  2GZW A;  3LWF A;  1UCR A;  2F5C A;  3F8B A;  1J2X A;  2HOE A;  1JXS A;  4LFU A;  4Y15 A;  2ISY A;  3N4M A;  1XSD A;  3P9I A;  1G3S A;  2LF8 A;  3L9F A;  2D1H A;  1YQA A;  3TO9 A;  4H0E A;  1J9I A;  3KZY A;  5DD4 A;  6PAX A;  3W6J B;  2XHK A;  2FU4 A;  1FNN A;  2MH2 A;  4CO8 A;  2R7D A;  2JT1 A;  3M7G A;  3WTU C;  3C3W A;  4DNC A;  1USS A;  3KP4 A;  1YIO A;  1W5S A;  1TW3 A;  4HX8 A;  5DD8 A;  3BDD A;  3LA3 A;  3DF8 A;  2BBY A;  3RPU A;  5D6F A;  3KLN A;  3QOP A;  3FZV A;  5LEJ A;  2LNB A;  4HF1 A;  2O3F A;  1GVJ A;  3LAP A;  1OPC A;  4OU0 A;  3WE3 A;  3KP6 A;  2FML A;  3FXR A;  1STZ A;  1LEA A;  4EJO A;  2D45 A;  5A2Q Z;  1ZRD A;  4AIJ A;  4LB6 B;  2A6H F;  1R5H A;  2OA4 A;  2XV4 S;  3J81 Z;  4I09 A;  3F6V A;  4NB5 A;  1OYW A;  4ESB A;  2HS5 A;  3FMS A;  3KLO A;  2FQ3 A;  3ELK A;  2O6G E;  4LLG F;  2H09 A;  4GCV A;  2YX4 A;  2M87 A;  2KIF A;  1YTY A;  3CO6 C;  1FPQ A;  3BOQ A;  5IT9 Z;  3JTH A;  2P5K A;  3BRO A;  3M9A A;  1FOK A;  3F8N A;  2RNJ A;  2CG4 A;  1BOA A;  2P5V A;  1Y0U A;  5DCM A;  1ZGA A;  4I02 A;  2QQA A;  3WU1 B;  3G3Z A;  2ESH A;  2ADU A;  3WTZ A;  4CZZ A;  2VC0 A;  4CHU A;  3LAJ A;  1F5T A;  3MCZ A;  3ERE D;  2HKX A;  2DTR A;  2QWW A;  5BS6 A;  2HTJ A;  3WTS C;  3DP7 A;  4KUM A;  3GWZ A;  3FX3 A;  4AWX B;  2Y75 A;  4EJT A;  5LGN A;  1FC3 A;  3U2R A;  5E8I A;  5D5X B;  1HW1 A;  1XDS A;  3L00 A;  1TBX A;  2LSO A;  1Z9C A;  1ON1 A;  1FWZ A;  1OYY A;  5LLQ A;  3GXO A;  1SD6 A;  3MZH A;  2XRO A;  2PBI A;  4GXO A;  4I0B A;  4YFN F;  2IA0 A;  4TV7 A;  3QP5 A;  4MQ9 F;  1FZP B;  2VOO A;  4KIF A;  3R61 A;  1OKR A;  5HLH A;  4D0P A;  2E7W A;  3HUG A;  3R4K A;  4KNY A;  3EYY A;  2WV0 A;  3PQJ A;  5HVQ C;  4M9S A;  4UV9 A;  2DAO A;  1CGP A;  1L0O C;  1FBU A;  2FNA A;  1PP7 U;  1TNS A;  1XMA A;  2ZKZ A;  5H20 A;  3V8K A;  1AWC A;  4LJZ F;  4ZYD A;  4PGG A;  2VN2 A;  3PFI A;  1RIO H;  4LLN A;  2FSW A;  5IT3 A;  4WXD A;  3JSP A;  2G7U A;  3QP6 A;  1Q1H A;  2GXB A;  4LK0 F;  2O8X A;  5J8C A;  3CUO A;  2XAJ A;  3JSO A;  4EMS A;  3ULQ B;  1TLH B;  2V6C A;  1G3T A;  4YFK F;  3BJ6 A;  4B8X A;  1H0M A;  1LDD A;  2QVO A;  3MAJ A;  2P5L C;  2H6B A;  1EH7 A;  1BIB A;  1P6R A;  3LFK A;  4L5I A;  2Y0M A;  1LVA A;  3H3Z A;  1I1S A;  1O3S A;  2PFB A;  4A5M A;  3HIF A;  2XVC A;  3ZQ7 A;  3KFW X;  1P4A A;  1DP7 P;  2PQ8 A;  1BI0 A;  1WWX A;  4WCG A;  5DEQ A;  2NYX A;  4U7D A;  4ENK A;  1XD7 A;  2ETH A;  4MEX F;  2VOD A;  5E17 F;  2DPD A;  2UXX A;  2W25 A;  2OD5 A;  3EQL F;  4HX7 A;  4PGH A;  4AIK A;  5DYM A;  3T8R A;  1UST A;  4YII A;  4UVA A;  1LEB A;  2DFI A;  4HQM A;  3OOP A;  3ZPL A;  3G73 A;  4I2O A;  5ICF A;  3L7W A;  4IRI A;  3U9G A;  3HRT A;  1Z91 A;  3KEQ A;  4L5J A;  4PZJ A;  1ZAO A;  2CGP A;  3QU3 A;  3IWZ A;  1G4D A;  3F6O A;  1BN5 A;  5FD6 A;  3CUQ B;  4RGS A;  4G6D A;  1T0F A;  4I98 B;  2FBK A;  4IPA A;  3COA C;  3DQV C;  1ZHF A;  3RKX A;  1KQ0 A;  2J5P A;  4UNO A;  3IRQ A;  2A61 A;  3DPL C;  1XGO A;  1B1B A;  1K6O A;  2XAS A;  4RGX A;  2FBI A;  3K1M A;  1Z6T A;  2ZXJ A;  4MTD A;  2L01 A;  4NHJ A;  2W57 A;  2NS0 A;  4F7Z A;  4MEY F;  1E17 A;  3T0Y A;  2PI0 A;  3V7R A;  1A04 A;  2FBH A;  2LDU A;  2IRF G;  4YG2 F;  1MKM A;  2FNP A;  3ML6 A;  2KJC A;  3BJO A;  2E1N A;  3VEP A;  1R7J A;  3GFL A;  4IRG A;  5DUI A;  1YYV A;  5IT9 K;  4LMY A;  1P4W A;  3GW2 A;  3B02 A;  3K1N A;  4CXF A;  3TO6 A;  3ZMU A;  3R6S A;  3RYP A;  1HKT A;  4QWQ A;  3WE2 A;  5BQT A;  5AIQ A;  4RGU A;  2FXA A;  5HDK A;  2GIV A;  3HSR A;  4DQ2 A;  3WTY C;  4WK8 F;  5F64 A;  5CVJ A;  1S29 A;  3B73 A;  2W84 A;  3E97 A;  1B6A A;  2V9V A;  4BQA A;  1MD0 A;  2KRF A;  2GXG A;  3BP8 A;  3I5U A;  2BEO A;  3FWE A;  4G6Q A;  4HW0 A;  1O3T A;  3MQ0 A;  3J81 K;  3JAM K;  5ILV A;  3K2Z A;  4P96 A;  2VC1 A;  5JR3 A;  4LG0 B;  4N9I A;  5ERI A;  1FP1 D;  4O5V A;  3RI4 A;  4M6Y A;  2EFO A;  2DO7 A;  4WXH A;  3GFI A;  4M9X A;  4KN7 X;  1HW5 A;  5HLI A;  3ECO A;  2HWV A;  3D0S A;  1FP2 A;  3C1D A;  1IZ1 A;  5BPI A;  2XUB A;  1QZY A;  3GZ6 A;  2EA4 A;  4PDK A;  5D8K B;  1XSX A;  2P7C B;  1Z6R A;  1VTN C;  4KA4 A;  2DW4 A;  2IW5 A;  4XLP F;  2OQG A;  3E5Q A;  3V7C A;  5HDG A;  4KFC A;  2PLY A;  4UXN A;  3GZ5 A;  2VE9 A;  2J5O A;  1FLI A;  4IRH A;  2M30 A;  4MHG A;  2STT A;  1EH8 A;  1IF1 A;  3ZMZ A;  1J75 A;  2ZBK A;  4KMF A;  3V7S A;  3P7N A;  4FX4 A;  1X3U A;  5E1X A;  3HYI A;  2BGC A;  3BPV A;  1IN5 A;  2Z5U A;  4P55 A;  3U1D A;  2HYF A;  1FT9 A;  2QYO A;  3QPT A;  2ZME A;  1SFX A;  4WX9 A;  4G94 A;  5CVV A;  3KP2 A;  1WRJ A;  2OZ6 A;  3P9K A;  3KP7 A;  2XIG A;  1FYM A;  1G3W A;  2EV0 A;  2R7F A;  5AON A;  4N0B A;  4A0X A;  3VFZ A;  5BPD A;  4NQW A;  1R1U A;  3HRU A;  3RPQ A;  3CDH A;  2CO5 A;  1ZLJ A;  2QQ9 A;  4R1H A;  1W5T A;  2STW A;  1AOY A;  4BAY A;  1WI9 A;  4G7O F;  2VBX A;  2E7X A;  2EFQ A;  1W7P D;  2XAF A;  3I4P A;  1XGM A;  4RB3 C;  3LST A;  3RIR A;  1JGS A;  1IRF A;  1L3L A;  5EEG A;  5AIP A;  2OQR A;  3F8C A;  2L4M A;  5TJJ A;  2FRH A;  2FE3 A;  3RYR A;  3TOB A;  1D8J A;  1LDK B;  2Y48 A;  4OIP F;  2X4H A;  3NQO A;  4FX0 A;  3R0J A;  2XKP A;  3MEX A;  4RB1 A;  3BZ6 A;  3TO7 A;  5LHH A;  3MFK A;  3VOE A;  2KKO A;  3PQK A;  1Z05 A;  1LDJ A;  3EDP A;  3ZN1 A;  2IJL A;  1IRG A;  5ICG A;  5FD5 A;  4WWC A;  4JQF A;  2G9W A;  5CLS A;  2V79 A;  2DQR A;  2K86 A;  1H9T A;  4XSZ F;  4U7B A;  2GAU A;  2ZJ2 A;  3K69 A;  1FSE A;  2XRN A;  3K0L A;  4FT8 A;  4KIG A;  4A6E A;  3HHH A;  5L3F A;  3F21 A;  4IF4 A;  3T1B A;  2DLL A;  2A3S A;  5ED4 A;  2FA5 A;  1BM9 A;  2OU2 A;  4HLY A;  4EJU A;  1O3R A;  3REO A;  4UUV A;  4KIB A;  5K1Y A;  1LJ9 A;  4M6X A;  4AVP A;  3D5L A;  1QPM A;  3GFJ A;  1HW2 A;  3GLX A;  4E70 A;  1PDN C;  2KJB A;  2YU3 A;  1MDM A;  2M45 A;  4HBL A;  1IN7 A;  2PMH A;  1FBS A;  3KEO A;  4ENN A;  1ULY A;  1HQC A;  4M73 A;  5K5R A;  5D6E A;  4ESF A;  2DQL A;  2E1C A;  3IKT A;  2K7L A;  2VXZ A;  1YLF A;  1WQ2 A;  5DDG A;  4B09 A;  3WOD F;  1HKQ A;  1TTY A;  3F3X A;  2IP2 A;  4XBF A;  1XSV A;  4KYW A;  5D5V B;  1GXP A;  4KIC A;  1T39 A;  3V8J A;  5D8L B;  3WU0 A;  4ZYH A;  3V4G A;  1FY7 A;  3SXY A;  5L3E A;  4JBA A;  4KT5 C;  2LKP A;  2CSO A;  2RC4 A;  2H94 A;  1FBQ A;  3SZT A;  3BPX A;  1YS7 A;  3DPT A;  2BYV E;  3OV8 A;  2V1U A;  3L2C A;  1ODD A;  4HZF A;  3IHU A;  4AIH A;  4HYE A;  5HS8 A;  1CF7 B;  4P5O A;  3ROU A;  5CVI A;  2UWM A;  1EV7 A;  3RTR A;  2F5E A;  5CJ9 A;  3SZP A;  3IKV A;  4LLL A;  3KP3 A;  4LG0 A;  4BYY A;  4KMU X;  3R60 A;  3TQN A;  4HX4 A;  1SD4 A;  3O3K A;  1QZZ A;  1IAW A;  2UXN A;  3WTX C;  4Y17 A;  1YW8 A;  1T6S A;  3I0T A;  5EEH A;  1F1Z A;  2A5Y B;  2FF4 A;  4EJW A;  3IL2 A;  2ELH A;  2MH9 A;  2BV6 A;  2RV8 A;  2XKO A;  1NHA A;  5L3B A;  1UHW A;  2L02 A;  2JSC A;  2XAH A;  1QGP A;  2QLZ A;  5KVR A;  4Q48 A;  1IN8 A;  2CWE A;  1KYW A;  2RN7 A;  4L9T A;  2NRA C;  1W4M A;  1QNT A;  3FXQ A;  4M71 A;  5FB2 A;  2HR3 A;  4BH9 A;  2JRT A;  2Z33 A;  3WTT C;  2WTE A;  4Z2Y A;  4I7H A;  1T38 A;  1UFM A;  4RB2 C;  2HDC A;  1KU9 A;  2O61 A;  5D4R A;  3I71 A;  4RB0 A;  2Z3Y A;  1R1V A;  2TDX A;  2GQQ A;  3V8L A;  2HQR A;  2WC2 A;  2A68 F;  5DUK A;  5JFR A;  3IC7 A;  2QEN A;  4CYD A;  2QBY B;  2XGX A;  3O6B B;  3ZMT A;  1O7F A;  2H27 A;  2OAZ A;  1RI7 A;  2XAQ A;  3E3V A;  1YW9 A;  2HZT A;  1MDM B;  1R22 A;  3FM5 A;  5H6Q A;  4R79 A;  2EB7 A;  4A0Z A;  5LEK A;  3K9T A;  2NAZ A;  1JE8 A;  3HOT A;  4ZZD A;  1YG2 A;  4HDV A;  4YIF A;  4EVI A;  2W24 A;  4XSX F;  1JHH A;  4N9H A;  3E6M A;  3ECH A;  5E8G A;  1G3Y A;  1I27 A;  2D2W A;  2VBY A;  4BXU A;  5KK1 A;  5BOX A;  4EGY A;  3Q9S A;  5H6R A;  4L9N A;  1UHM A;  3CUQ C;  4A6D A;  1WKM A;  3NEU A;  1Z1D A;  2O03 A;  1UB9 A;  3MZY A;  4HAM A;  4CGZ A;  4GYI A;  2VOP A;  3FMR A;  1XDU A;  4A2U A;  1REP C;  1O7L A;  1S6L A;  5DV5 A;  1HKS A;  2P7V B;  4O6J A;  3WGI A;  1KYZ A;  5CYV A;  1KQ8 A;  1U6G A;  4S04 A;  3NRV A;  2DI3 A;  3I54 A;  2DK5 A;  2ZCW A;  4Y13 A;  1SFU A;  3JW4 A;  2EJR A;  5L3C A;  5BMZ A;  2YX7 A;  4XRF A;  2G7H A;  2RQP A;  3CJN A;  1V3F A;  2OZU A;  2RDP A;  2VT3 A;  3E5X A;  2L54 A;  4U0V A;  1HBX G;  5LGT A;  2L4A A;  3GX4 X;  5LBQ A;  4UVB A;  1BIA A;  1ZG3 A;  4ENJ A;  4HA8 A;  1LB2 A;  2VBW A;  4AD9 A;  5ILU A;  4M9Z A;  4ASN A;  2YPR A;  3RDI A;  3VB2 A;  1MZB A;  2HTS A;  1P92 A;  2ZO4 A;  4O3M A;  1TW2 A;  1RUN A;  4L9V A;  2CYY A;  1GXQ A;  1ONV A;  2JPC A;  4IVN A;  2MBF A;  1B9M A;  4M72 A;  3ABT A;  2CW0 F;  5FFZ A;  2QUF A;  1XGN A;  1MJB A;  3Q5F A;  4L18 B;  3HTU A;  4K2E A;  2K02 A;  1U2W A;  4KDP A;  4OIO F;  4I0A A;  4S05 A;  2A07 F;  5E1W A;  4PCQ A;  1SMY F;  3S2W A;  1G6N A;  1MJ9 A;  4G8X A;  2LF7 A;  1RZ4 A;  3FXU A;  3KET A;  2H6C A;  3KE2 A;  3GYH X;  3HRS A;  1BI3 A;  2DT5 A;  4L0Z B;  2L3D A;  1T98 A;  4U0Y A;  1D8K A;  2IPQ X;  3DEU A;  1ZRC A;  1BI2 A;  2NNN A;  2JZY A;  1GHC A;  1E2X A;  5HS9 A;  2HGC A;  5D5W B;  2P6S A;  2GA2 A;  5K5Q A;  1YW7 A;  3TDZ C;  4LB5 A;  3LQR A;  2RGV A;  2BE5 F;  3M1E A;  1T2K A;  5LHI A;  1JHF A;  2GA1 A;  4IHT A;  1I5Z A;  3FM3 A;  4BHC A;  3F72 A;  5E18 F;  1K79 A;  2Q2E A;  4CDG A;  1J5Y A;  1S7O A;  2YSR A;  5D4S A;  2C6Y A;  2IT0 A;  3RJP A;  3CUQ A;  1MGT A;  2MLG A;  1P2F A;  3T5X A;  2ZNY A;  1PUE E;  1ZGJ A;  1DPR A;  2EWN A;  1ZRE A;  3K1P A;  1DDN A;  1SFE A;  1U8R A;  5J6X A;  4RAY A;  2QM3 A;  1QBJ A;  2JPB A;  1O3Q A;  3QU6 A;  1QQI A;  4Q4Z F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...