1QGPA

Nmr structure of the z-alpha domain of adar1, 15 structures
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
76
structure length
76
Chain Sequence
LSSHFQELSIYQDQEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIAVSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The solution structure of the Zalpha domain of the human RNA editing enzyme ADAR1 reveals a prepositioned binding surface for Z-DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords PROTEIN (DOUBLE STRANDED RNA ADENOSINE DEAMINASE)
total genus 18
structure length 76
sequence length 76
ec nomenclature ec 3.5.4.37: Double-stranded RNA adenine deaminase.
pdb deposition date 1999-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02295 z-alpha Adenosine deaminase z-alpha domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1qgpA00
3R0AA 3VOEA 4A5NA 3V7SA 3CLOA 1FX7A 1G3WA 2QQBA 4IRGA 2XV4S 1R5HA 3U1DA 2WC2A 1MDMB 4XSZF 2DTRA 2W24A 5FFZA 2FRHA 1JE8A 4CYDA 2Y48A 5L3BA 2AXLA 5BS6A 2YSRA 5E20A 4Z2YA 2O03A 1TQPA 4ON0A 4EMSA 4IRHA 3KP3A 3SHFA 2MC3A 3HOSA 3BROA 2PEXA 2LKPA 1PP7U 2FMYA 3MFKA 1ZGJA 2V79A 4IF4A 1IN8A 1GXPA 2K4JA 2VE9A 2O6GE 1DP7P 1MDMA 4E70A 1O3RA 4HZFA 2OU2A 3E97A 3IWFA 1IXRC 1F1ZA 2LNBA 3R4KA 1TTYA 4WWCA 1LEAA 3N4MA 3PQJA 3EUHA 1LB2A 1W4MA 4G9YA 1IZ1A 1SFXA 1SMYF 2X4HA 1XDSA 2CGPA 1SFUA 2QZ8A 5E17F 1BI2A 1BIBA 5FLXZ 1BI1A 3I53A 3FMRA 3M1EA 1W7PA 3K0LA 3TOAA 2FSWA 1O7LA 5ICEA 4R1HA 3DPLC 4ENKA 3O2PE 2OZ6A 2EK5A 5LGNA 4TV7A 5CVRA 4U7BA 1J0RA 2CQKA 1G6NA 1KU2A 2GAUA 1Z6TA 2IA2A 3I59A 3KP6A 2OA4A 3LA3A 2D2WA 4I0BA 1TNSA 1FP1D 2COMA 1W7PD 2HKOA 4CGZA 2K86A 1OKRA 4HLXA 1RUNA 3DQVC 1QNTA 5FD5A 3IL2A 3ML6A 2RVCA 2LSOA 1P2FA 5BPDA 3DXJF 4NQWA 1R23A 4EJVA 1YIOA 2MD5A 1FWZA 5IT9K 2HYFA 2DT5A 4EM2A 5K5RA 1UHWA 4F7ZA 4L18B 1LNWA 3TO6A 2XAFA 4CICA 5BPIA 1BM9A 1IAWA 3ISPA 3ERED 4KIBA 1IN7A 4YFNF 4I98B 4YFXF 4JBAA 1JHHA 3LQQA 3KFWX 3IC7A 1HSJA 2EFQA 1CF7A 1Y0UA 4EVIA 5D5UB 3JSPA 2JPCA 1ZARA 2XAJA 2BBYA 2HGCA 5F64A 4I09A 5L3EA 1ZGAA 2O3FA 3VB2A 3ZMTA 1LDKB 3E6DA 2LDUA 2L54A 3KLOA 1ZG3A 2Z5UA 3ZN1A 1G4DA 1LDJA 2GXBA 2NNYA 1T38A 1TQMA 3CJNA 1BIAA 4OU0A 2VBYA 5J6XA 2UWMA 4EGZA 3M7GA 2ESNA 4LLLA 3R6SA 1VTNC 2Z99A 2QUFA 3ZP5A 2RQPA 4G94A 3QRFF 3HRMA 1XMAA 4MNUA 5HVQC 1CGPA 2LF8A 1B9MA 2VOPA 1I1SA 4EJTA 4FT8A 4ETSA 3T1BA 4S04A 2IA1A 4BNCA 2UXNA 4AVPA 5F1RA 2L02A 3DKWA 4IVNA 2FNAA 1FT9A 3GWZA 4M6YA 1RI7A 4EV0A 4M6XA 5CLSA 2RGVA 1G3TA 2FF4A 3T8TA 2IP2A 1OYYA 3KP2A 2P7VB 4IJAA 2O8XA 3ECOA 1O7FA 5BMZA 5E8IA 5K5OA 3E6CC 3W6KB 2VT2A 1TQIA 3LA2A 3R61A 4KNYA 2VT3A 1BI3A 2HS5A 2XKOA 4LLGF 1RZ4A 4PGGA 4R8HA 1HBXG 5J8FA 3ZMDA 5DDGA 3I0TA 3HYIA 4H0EA 1E17A 2PBIA 4ESFA 1OYIA 4BAYA 2FBIA 3ZMUA 5HS8A 2L4AA 1ZN2A 4EQQA 1H9TA 3LSTA 1YW7A 3RI4A 3I71A 2NRAC 4WXHA 4A5MA 3E5UA 1YW8A 1CF7B 4ZYDA 3G3ZA 2ESHA 3KE2A 1LJ9A 2GXGA 4ZYEA 3TKYA 1TBXA 3H92A 4U0VA 3BOQA 2K7LA 1KGSA 3HHHA 2HQRA 3DF8A 1XCVA 1IRFA 2HR3A 2ZNZA 4P96A 5H6RA 5H20A 4YG2F 2ZNYA 3DFGA 1B4AA 2V1UA 3B73A 2G7HA 3HSEA 3WODF 4KT5C 3I59B 3Q9VA 3RKWA 2JRTA 3G73A 3NQOA 1SFEA 3TO7A 1ZAOA 1KQ9A 1BBYA 2Q8KA 1PUEE 1RUOA 2H09A 4GYIA 3D0SA 4AWXB 4BXUA 1DPRA 3M8FA 1U5TC 1DPUA 2C6YA 1SD4A 5D6FA 5HS7A 1LVAA 1ULYA 3CUQA 3RJPA 3KZZA 2IT0A 5A2QK 2AS5F 4RGSA 1XGMA 5E1ZB 3Q5FA 2E7WA 3COAC 3E5XA 3C7JA 4KMFA 4HQEA 3WU0A 1K78A 4BH9A 3GFJA 2QYOA 1S7AA 4P9FA 3EYYA 3HRTA 2IRFG 4EM1A 1R1VA 3T5XA 4HF2A 1D3YA 4WF2A 2BYVE 3SFZA 5BQTA 2FE3A 4L0ZB 2PI0A 1BOAA 1K7AA 4HF0A 4FHTA 4HV6A 1F4KA 3RKXA 3CUQC 1ODDA 1GVJA 1QZYA 1JGSA 2OAZA 4WK8F 2W85A 4LB5A 1WSUA 1BI0A 4M71A 4KUMA 2J5PA 4XLPF 1JXSA 4RS8A 1R00A 1MJAA 1B59A 1E2XA 4KYWA 4ESJA 3BJAA 2ZKZA 3E6MA 3F8MA 5LGUA 4FX4A 2H6BA 2RNJA 1XDUA 3L2CA 2RN7A 1P92A 1Q1HA 1W7PB 2ZMEB 3F8CA 3N97A 4ESBA 3EQLF 2HTSA 4EGYA 1ZREA 2K27A 1J2XA 1KYZA 1HKSA 1U5TB 1KQ0A 2GA1A 4L0YB 4LGWA 4R79A 1B9NA 4OIOF 3P9IA 4EM0B 4CZZA 2BEOA 4N9IA 4G7OF 2P4WA 3JAMZ 1K6OA 4GGGA 5J8CA 3KETA 1TW3A 2BV6A 2A68F 5HLIA 3T0YA 5HOOA 3L09A 1FBUA 4YIFA 1W5TA 2OZUA 3CO6C 1R36A 4LD5A 4RGUA 4M74A 2R3SA 2RV8A 3HRSA 3QU6A 4KA4A 4MGRA 2QBYA 3E5QA 4HV5A 5A2QZ 1IW7F 1SD6A 3WTWC 2YX4A 4WX9A 1B6AA 3HSFA 1NHAA 3QAHA 1IF1A 2FOKA 3BJ6A 3WTVC 3GZ6A 4N9HA 5EEHA 2K4BA 2YR2A 5LRRA 3C3WA 2F5DA 3DV8A 5TJJA 1C0WA 3U2RA 4EJOA 5D4RA 4UVBA 3ZN0A 3K1PA 1J59A 1EH6A 1ZG5A 4M9ZA 4BHPA 1FSEA 1U8RA 1AOYA 3GW2A 3CDHA 6PAXA 4ZYHA 3FMQA 2A07F 1YW9A 2DFIA 4BQAA 4MEXF 3W6JB 2Z9OA 4WCGA 3TGNA 5HDKA 2KKOA 5LGTA 3ZQ7A 3QPTA 3REOA 2F5EA 2CSOA 4O6JA 2ZO4A 3K69A 4Q4ZF 1U3EM 1U5TA 5ERIA 4I01A 2XROA 1U6GA 5FFXA 2QQAA 1QZZA 4U0WA 3NRVA 2A5YB 4A6EA 5H6QA 2EA4A 3KLNA 1EH7A 4ENNA 1KU9A 2W25A 2M45A 3VEPA 1UFMA 3K2ZA 4JQFA 2F5FA 3F8NA 4CDGA 2FQ3A 2PLYA 2PMHA 1OR7A 2P5VA 2KIMA 2XRNA 2NNNA 3GUDA 2VC0A 3ZMSA 3WE3A 2QENA 2R7DA 3DEUA 1QPMA 3F21A 4I02A 2Q0OA 4AIKA 3F72A 3FM5A 1BN5A 3RPQA 2MH9A 3RYRA 1OYWA 4NHJA 4ENJA 3HSRA 1I5ZA 1XGSA 2R7FA 4M9XA 4NB5A 3JTHA 4M9SA 1Z9CA 4HX7A 1HSTA 3OOPA 2WV0A 2H27A 2DQLA 2D45A 3BY6A 3FXQA 1MKMA 2H94A 2VBWA 3CUQB 2HYGD 1YLFA 4DNCA 2JPBA 1FBQA 3C18A 4ZYGA 3V4GA 4MQ9F 2HQNA 3WTYC 2HKXA 2CO5A 4I7HA 1ZLKA 2DAOA 1XMKA 2FMLA 3WTSC 4XRFA 2EFOA 2XKPA 3RPUA 2JT1A 5DV5A 2FEZA 1G3SA 2ADUA 4BHBA 5JR3A 3EYIA 3GFIA 3JAMK 1D8KA 2STTA 1IN4A 4Y13A 2A69F 1ZRCA 4Q5SF 4LK0F 2KIUA 3F6VA 1R1TA 3WU1B 3I5UA 2M87A 3J7AO 3I54A 5D5WB 1DDNA 3M9AA 3MWMA 4BHCA 2XUBA 1V4RA 4P5OA 1FYKA 3FWEA 1P6RA 1KU7A 3IKVA 5KVRA 2FBHA 3BJOA 2FNPA 5DD8A 4ZH4F 4PCQA 1O3QA 5IT3A 1J75A 2DK8A 1L3LA 1TW2A 2ISZA 1W5SA 1Z05A 2CFXA 4YFKF 4UV8A 2PMUA 2W84A 1YTYA 4KN7X 3I58A 4HQMA 4HX4A 3WTXC 3LAJA 4A6DA 5FLXK 1FBSA 1QQIA 2G7UA 2O0YA 1YFHA 5JHUA 3TO9A 3JW4A 1T98A 3HIFA 1S3JA 4O3MA 2NYXA 2VONA 1HKTA 2CG4A 2HDCA 5D6EA 2DK5A 1XD7A 2ACJA 4IRIA 1ZRFA 4OIQF 2V9VA 2M8EA 5CVIA 3PQKA 4DQ2A 1ON2A 1FY7A 1I6XA 4L9NA 5ICFA 4XLNF 1REPC 4UVAA 4IPAA 2NAZA 2DPUA 2P5KA 4LLNA 4RB1A 3AAFA 5KK1A 1P4WA 3E3VA 4IHTA 4M73A 3FM3A 3FHZA 2UXXA 2ZCWA 3BZ6A 3MZYA 2EFPA 5HLHA 2ZMEA 3WTZA 2A6EF 3LA7A 2WTEA 2YPRA 3NEUA 3J80K 5FD6A 4AIHA 5E8GA 1BJAA 4GYGA 1J9IA 4XBFA 5CJ9A 2GWRA 3BDDA 2HOEA 1YO5C 4G7ZF 1YS7A 3IHUA 2FA5A 5HDGA 4LB6B 2QLZA 1B1BA 2K02A 4L9VA 3BP8A 2KJCA 2Z33A 1IXSB 1R7JA 5LEKA 3M8EA 4MQVA 3WGIA 3L9FA 4D0PA 1YG2A 3V8JA 4UHTA 5E1WA 2CW0F 4B09A 1Z6RA 1J5YA 5E18F 3V7CA 3KCCA 1F5TA 5L3FA 3QPHA 4RGRA 3MEXA 5D8KB 5F6FA 2P6SA 1IUYA 1SD7A 4KDPA 3E6BA 2F2EA 2V1DA 4OIRF 4G8XA 4KIFA 5IT9Z 3V8LA 2JSCA 2A61A 4Q48A 4Y17A 3MAJA 1T6SA 4L5JA 1WWXA 3SXYA 2ZBKA 4CHUA 3I64A 3R0JA 2XGXA 2IVMA 2E1CA 3IRRA 4GXOA 3HOTA 4O5VA 1D5VA 4LG0B 5CVJA 1P4XA 4HDUA 2MA3A 4RB3C 4A2UA 4RGXA 3ECHA 3FZVA 5FB2A 5TRDA 2XIGA 2PN6A 3S2WA 2KJBA 1FC3A 1RNLA 3KZYA 3HRUA 2G9WA 3GX4X 2GA2A 5E1XA 2ZJ2A 2QVOA 4MTEA 1MZBA 4IXAA 2QQ9A 3WE2A 4QLCU 2YU3A 1EH8A 1MD0A 2KRFA 4IHSA 2UZKA 5HDNA 4HW0A 4HDVA 2VXZA 3BPVA 4A0YA 2NS0A 2P7CB 4OOIA 3WG9A 1ONVA 4U88A 4LJZF 3L7WA 5DYMA 3WTTC 1IRGA 1L0OC 1MGTA 1T39A 1HW5A 3J81K 3JSOA 1STZA 1XB4A 4LG0A 3P7NA 3GO5A 4RAYA 2FU4A 4BYYA 1I27A 5LLQA 4LFUA 2PG4A 1V3FA 2PJPA 5ED4A 1UCRA 2L3DA 3TDZC 4MEYF 4N0BA 1TNTA 4HF1A 1XN7A 2OBPA 1SD5A 4MHGA 2P8TA 3F3XA 2EFWA 4K2EA 3V7RA 1USTA 4G6QA 2Y0MA 2CWEA 2ZFWA 4L9TA 4KICA 3C1DA 1MJ9A 1R22A 2GZWA 2EFNA 4HAMA 2H6CA 5K1YA 1FPQA 1SMTA 3GVAA 4L9JA 3TOBA 3JTGA 3HTUA 1R1UA 4B8XA 4HOBA 4ZZDA 4MTDA 1PDNC 3ABUA 1LEBA 1KQ8A 2DLLA 4U0YA 3WTUC 4LK1F 2X0LA 3QU3A 1IN5A 2OD5A 3SZTA 1XGOA 3VODA 4LMYA 1IN6A 1Z91A 3F22A 2STWA 3ABTA 2MBFA 1U2WA 2XAQA 4OMZA 3TQNA 3GZ5A 3EDPA 2XAGA 1RIOH 3FMSA 3KP7A 5LHIA 1Z1DA 4S05A 4UV9A 4RAZA 3GEZA 1S29A 2DI3A 3CUOA 2Z3YA 1SAXA 3I4PA 4Y15A 4XSXF 2XVCA 3SZPA 2D1HA 4P55A 3KP4A 1LDDA 1FLIA 5L3CA 3CTAA 3IWZA 2PFBA 1ZG1A 5AONA 2JZYA 1WKMA 1USSA 5JI6A 2HZTA 4RB0A 4U7DA 2KIFA 4I0AA 1T2KA 4YIIA 1T0FA 2LF7A 5D5VB 3GYHX 4CO8A 5D4SA 3KEQA 2GQQA 2IW5A 4GCVA 3RKYA 5DUKA 3FF5A 1IXCA 2ELHA 2IJLA 2MLKA 2OQRA 3LWFA 4PDKA 1KA8A 5JFRA 1K78B 3FXRA 3IRQA 5DCFA 2EWNA 3J81Z 2JTVA 5ICCA 4OIPF 5ILVA 4M72A 3MQ0A 1OMIA 2J5OA 1HW2A 3K1MA 3K9TA 1R5GA 2RC4A 1ZYRF 5FO5A 1S8NA 2DBBA 4KMUX 1GXQA 1K79A 3R60A 3MCZA 1X3UA 4UUVA 1BC8C 1D8JA 2VBXA 3T8RA 3FX3A 1WQ2A 5DUIA 4HA8A 4WXCA 1EV7A 4GO1A 2EV0A 2DU9A 2YX7A 1HKQA 3ZMVA 1FP2A 4ENMA 1FZPB 2XASA 1WRJA 2E1NA 1S6LA 1R58A 1J7KA 1PP8F 3HUGA 3KP5A 3QP6A 5FGMA 3ZMZA 2RDPA 4HBLA 4G7HF 5EEGA 1HW1A 2ETHA 2BGCA 2M1BA 4A0XA 4PZJA 4UNOA 3P9KA 3QP5A 3D5LA 1XGNA 2MH2A 2VC1A 1UB9A 3Q9SA 2TDXA 3IKTA 3GLXA 2ZXJA 3EETA 2W57A 5AIPA 5D5XB 1H9GA 1FSHA 2M5WA 5AIQA 1JHFA 5CYVA 2L01A 4WXDA 1HQCA 4FX0A 2GIVA 3H3ZA 3KEOA 1FYLA 1P4AA 2A6HF 2B0LA 2HEOA 1ZRDA 1WI9A 1AWCA 2XAHA 2RKHA 1QGPA 1F9NA 2CYYA 3P9CA 1FNNA 1G3YA 5LHGA 3LAPA 3GFLA 3TDUC 3L00A 3ZPLA 4KN4X 3RYPA 5CVUA 3OV8A 4L5IA 4CXFA 1YS6A 3J80Z 1QBJA 3CO7C 2ISYA 1FOKA 2VOOA 2BE5F 4RB2C 3DPTA 2VN2A 1QO0D 5ICGA 3H3UA 3B02A 5K5QA 4P9UA 2PQ8A 4A12A 5JVTA 2D1VA 2MLGA 2HFHA 3F23A 2IA0A 3F8BA 4AIJA 3F8FA 5DCMA 3BWGA 4I2OA 3GF2A 5HLGA 3F6OA 2QWWA 4UXNA 3GXOA 2Q2EA 3O6BB 1XSXA 3FXUA 5LRSA 1KU3A 4Q47A 1HXDA 1TLHB 4HLYA 1XSDA 2O61A 5L3DA 4OMYA 1XCBA 3ROUA 3LQRA 2VE8A 1S7OA 4KIGA 5LBQA 1OPCA 4QWQA 2HTJA 4JK1X 1FYMA 3QOPA 3SQNA 4ASNA 2F5CA 2A3SA 2DW4A 1LQ1A 2M30A 2EB7A 1ZH5A 2DPDA 5DD4A 3RIRA 2P5LC 3HTSB 2V1XA 2VODA 1A04A 1ZHFA 5LHHA 4A0ZA 3RDIA 1MJBA 3DP7A 2E7XA 3WGHA 4ZZLA 4HX8A 2L4MA 3K1NA 2WWYA 3RTRA 3O3KA 1Z7UA 4HYEA 2VBZA 3ULQB 1XSVA 5DCMB 4KFCA 5CVVA 1U78A 2XHKA 2FXAA 4EJWA 1UHMA 1DUXC 2HWVA 5HS9A 1BC7C 2EA2A 4OINF 1ON1A 2OQGA 3HHGA 3LFKA 5ILSA 1O3TA 2DO7A 3BPXA 2EV6A 2P6TA 3PFIA 4PGHA 5L3GA 5LEJA 2QM3A 2EJRA 3MZHA 3V8KA 1ZLJA 1YQAA 1YYVA 4G6DA 3VFZA 4AD9A 1GHCA 2V6CA 1KYWA 2DQRA 4EJUA 2EV5A 2QBYB 3GFMA 2FBKA 5BOXA 5DEQA 4UVCA 1O57A 2IPQX 3WGGA 3U9GA 1O3SA 1I1GA 5ILUA 2Y75A 3ELKA 5D8LB 1H0MA
chains in the Genus database with same CATH superfamily
3R0AA 1V5GA 1CQTA 3NAUA 2B7EA 3VOEA 4A5NA 3V7SA 2VQCA 1JGGA 3CLOA 1DU0A 4XMYA 3TL4X 1FX7A 1G3WA 4GRIA 3SDGA 2QQBA 4IRGA 3D5SC 4M3DA 3OIQA 2XV4S 1W0TA 2K85A 5IYDJ 1R5HA 3U1DA 2WC2A 3FKJA 2BY0A 3JRCA 2ZJQF 3CCRI 5H2FC 2BY3A 4YEJA 1D0YA 3CCYA 3ZCOA 3L2UA 1MDMB 5EYRA 4XSZF 2DTRA 1VNDA 2W24A 1D1BA 3DTEA 1LVKA 1I50J 2FRHA 1FMWA 5FFZA 4CYDA 1JE8A 3BCAA 2CUEA 4IOCF 1KONA 1QHHD 2JWTA 2JA8J 2MFZA 2Y48A 3QYFA 5L3BA 2QKLB 4JX4A 3DLAA 2X1CA 3H9QA 1W36C 1PJRA 2AXLA 5BS6A 1JUPA 4DBQA 2YSRA 5E20A 4CH7A 4Z2YA 2O03A 1TQPA 2JA2A 4ON0A 4EMSA 2M2EA 2BHZA 2KT0A 2AHQA 4IRHA 3KP3A 3SHFA 4XRSG 3OYIA 2VUMJ 1TL8A 2YS9A 2MC3A 3H0GJ 4KITB 5J1YA 3HOSA 4BDYA 3BROA 2PEXA 2LKPA 1PP7U 2FMYA 3MFKA 1ZGJA 2LTPA 2IGNA 2VIXA 2V79A 1A36A 5EZHA 3SFIA 4IF4A 1IN8A 5J47A 1GXPA 2K4JA 5EZGA 3CLQA 2VE9A 2O6GE 1DP7P 3BZCA 1MDMA 3CMAI 4E70A 4M3BA 1PUFA 2XPVA 1PUFB 2R0QC 5F08A 1VQ5I 1X1AA 1O3RA 4BBRJ 9ANTA 1T95A 1POGA 4HZFA 2OU2A 2F6CA 1UJ8A 5E3MA 3E97A 3IWFA 3MKLA 1IXRC 2A05A 1F1ZA 5GAGJ 2BXYA 2I8DA 2LNBA 3R4KA 1TTYA 2E5ZA 1V5FA 4WWCA 1LEAA 3N4MA 5KHDA 3PQJA 2LY1A 3EUHA 3CCSI 1W4MA 1LB2A 3OOUA 3CCQI 1E3PA 4G9YA 5J1UA 2DA1A 1IZ1A 1SFXA 1SMYF 2DJNA 2X4HA 3OSFA 1XDSA 3BG6A 2CGPA 1SFUA 2LD5A 4V2FA 2QZ8A 2LLKA 2CUZA 5E17F 1BI2A 1ENHA 2I10A 1BIBA 4CYCA 2IS1A 5FLXZ 1BI1A 3I53A 3FMRA 3M1EA 4YELA 1W7PA 3J7AY 3K0LA 3H5AA 2VB6A 3TOAA 2FSWA 4LIUA 5DTDA 1O7LA 1OQYA 5ICEA 4R1HA 3DPLC 4ENKA 2DODA 3O2PE 4DW6A 2BVLA 2R7QA 2L9RA 2OZ6A 2EK5A 3CDLA 5LGNA 4TV7A 5CVRA 1UHSA 4U7BA 1J0RA 2CQKA 4DIQA 3AL0C 1G6NA 3OSGA 3GTPJ 1KU2A 2LREA 2GAUA 1X1BA 2I5UA 3EPZA 5K7HA 1FTZA 1Z6TA 2IA2A 3I59A 3KP6A 1T33A 2OF7A 2OA4A 3LA3A 3ZGKA 4CCMA 2D2WA 4I0BA 1TNSA 3DWLE 1B8IA 1LE8B 3ONQA 1K61A 1FP1D 3U21A 2COMA 2HVQA 5JHFA 5CKTA 1W7PD 2LFBA 4BACA 2EIKH 4IOAF 2HKOA 4CGZA 4E7LA 2K86A 1OKRA 4HLXA 1RUNA 3DQVC 2KZGA 4F93B 1QNTA 1QRYA 5FD5A 3QYEA 3IL2A 3OYHA 4BXFA 4F55A 2CV2A 3IH3A 5EF6A 3ML6A 2L7MP 2RVCA 2JJ7A 1S9HA 2ZMEC 1K83J 5B1BH 3FBIB 2V26A 2LSOA 5FKNA 4UY8I 1ITYA 3WHCA 1P2FA 5BPDA 3DXJF 4NQWA 1R23A 4NQWB 4FETA 4EJVA 3VSLA 2XGEA 4KISA 4RA2A 1YIOA 2MD5A 2QSHX 1FWZA 5IT9K 2HYFA 2DT5A 4EM2A 4BEHA 4B1RA 1B72B 5K5RA 1UHWA 2KRHA 4F7ZA 4L18B 1LNWA 3LSPA 1K4SA 2LOOA 2XF7A 2ECBA 5GAHJ 1OCRH 3TO6A 2UUZA 2XAFA 3FDYA 5TISC 4CICA 3SYTA 5BPIA 1UMQA 3CCVI 1BM9A 3S8PA 5M3MJ 1IAWA 1ZK8A 3ISPA 3ERED 1MMAA 4KIBA 3DEEA 4OAZA 1IN7A 2WAEA 4I98B 3ZXSA 4YFXF 4YFNF 4JBAA 4AC0A 1JHHA 3LQQA 3KFWX 3IC7A 3ZQLA 5F0CA 1HSJA 3VYSB 2EFQA 1CF7A 1Y0UA 1IG7A 1WZ2A 4EVIA 2R5ZB 3BTIA 5D5UB 3JSPA 1HLVA 2JPCA 3GZNB 3LSRA 1ZARA 2XAJA 2XPUA 2LP0A 4PFPA 4IKFA 1RRJA 2BBYA 2HGCA 1H8AC 5F64A 4I09A 1HDPA 5L3EA 4BE0A 1ZGAA 3OYFA 2O3FA 2K5CA 3VB2A 2H1KA 2FUG2 3ZMTA 1BW5A 1VFCA 3S3MA 2MGQA 1LDKB 4M3GA 3E6DA 2LDUA 2L54A 3CMEI 1H0MA 3KLOA 2Z5UA 1ZG3A 1Y56A 3ZN1A 2HQAA 2L2OA 4ZTFA 4DOZA 2KQRA 3HKZN 1G4DA 1LDJA 1I6HJ 4MLOA 5IP9J 1WH5A 2BVMA 4AIDA 2EZHA 4PJ0C 2O7OA 2GXBA 5IY5H 1JKPC 4MIMA 3GMEA 2NNYA 1T38A 1TQMA 3CJNA 4DZJA 1BIAA 4H4KC 1MMNA 4OU0A 2M4KA 2VBYA 3HB9A 5J6XA 2UWMA 4EEFG 1P9QC 1QZEA 4EGZA 3CQZJ 3M7GA 1R6RA 2ESNA 2HQ5A 4LLLA 2M4GA 3J7ZI 1WJAA 2ZB9A 3UR3C 3R6SA 1W5CC 1VTNC 2Z99A 3A02A 2QUFA 2E1OA 4UB8C 2R4GA 4E7ZA 2DJIA 3ZP5A 3F9KA 2ELKA 2RQPA 4G94A 3QRFF 4IHYA 3HRMA 1XMAA 2E34A 4MNUA 3D1NI 4XN3A 3CCMI 2X1DA 5HVQC 1CGPA 3FXKA 2GBYA 2LF8A 1B9MA 2VOPA 1I1SA 2OV7A 2Z16A 2DA3A 4EJTA 4FT8A 4ETSA 3T1BA 4BDZA 5C3EJ 1GDTA 2RAEA 2R7ZJ 1ETWA 2KISA 2VJIA 2K3FA 4S04A 2IA1A 2XAUA 2K3PA 2XF5A 4BNCA 2UXNA 2V9KA 2JVGA 1AA7A 2VQGA 4AVPA 3S1QJ 2VASA 2VPRA 5F1RA 2L02A 4XKBA 4ZJZA 2P81A 2VLAA 3DKWA 4BJ6C 4IVNA 3HEFA 2FNAA 1FT9A 3IP4B 4J19A 3GWZA 4M6YA 5M3FJ 1RI7A 4EV0A 1T8IA 4M6XA 2OPTA 4CUGA 5CLSA 2RGVA 4FE4A 1XC5A 1G3TA 2FF4A 2DCEA 2LH9A 3T8TA 2IP2A 5IPAA 1YITI 1OYYA 3KP2A 2P7VB 3SEZA 4IJAA 2O8XA 3ECOA 1O7FA 1R5ID 1X4PA 2F4IA 3PSFA 5BMZA 5E8IA 2KHMA 3H9JA 5K5OA 3E6CC 5JVGF 3RZOJ 2HXOA 1IUFA 3IAM2 2OTLI 3W6KB 2VT2A 3HOZJ 1TQIA 1TT0A 3LA2A 3R61A 1H89C 4KNYA 2VT3A 5IYCJ 3HOVJ 1BI3A 3HOWJ 2HS5A 2XKOA 1FOXA 4LLGF 1RZ4A 2BZTA 4ABZA 4PGGA 4R8HA 1HBXG 1EF4A 5J8FA 3ZMDA 4A3MJ 3CDIA 5DDGA 3I0TA 4G12A 3HYIA 1F36A 3PO2J 4UUSA 4H0EA 1E17A 1JKRC 2PBIA 4ESFA 1OYIA 2EPFA 4A3CJ 1JJ6C 3M07A 1LE8A 4IZZA 4BAYA 2DYRH 1Q1VA 4JYKA 2FBIA 3HPGA 2X6OA 3ZMUA 4RLFA 5HS8A 2R7TA 2L4AA 1ZN2A 4BE2A 4EQQA 1H9TA 3LSTA 1YW7A 3RI4A 3I71A 3IH2A 4P1WA 2NRAC 1ZKGA 4WXHA 3E5UA 4A5MA 1YW8A 3JRBA 3OYAA 3E7LA 2L9SA 1CF7B 4ZYDA 4PUSA 2N8GA 3G3ZA 2ESHA 5CPRB 3GLLA 2Y31A 3KE2A 1LJ9A 2GXGA 2MC4A 3TKYA 4ZYEA 1TBXA 5E3NA 3UKGA 3TEDA 2JA6J 3LSHA 3H92A 4U0VA 5EG0A 3CF5F 1BR1A 3BOQA 5GTIC 3CMMA 2K7LA 5KAIC 1KGSA 3HHHA 2HQRA 3OS1A 3DF8A 1XCVA 1IRFA 3RPUD 2E1MC 2O9LA 1E3OC 2LYCA 2HR3A 2LBFA 2VKVA 2ZNZA 4P96A 5H6RA 5H20A 4YG2F 2ZNYA 3DFGA 4HRIA 3Q3SA 4ZYAA 1B4AA 3RQIA 3G4SI 2V1UA 3B73A 2G7HA 4BQQA 3QPSA 3PNTA 3HSEA 3FISA 3WODF 2P0WA 4KT5C 3I59B 3FK7A 3Q9VA 2HXIA 2NVXJ 1E3HA 1XTAA 2JRMA 2KDOA 3BTJA 3RKWA 2JRTA 3G73A 3NQOA 1SFEA 1T08B 3TO7A 1ZAOA 1KQ9A 2BXZA 1BBYA 2IXSA 2Q8KA 1RC9A 4FE7A 1PUEE 1RUOA 3E0JB 2CQQA 2DDBA 2H09A 1OR7C 4GYIA 3D0SA 1VQOI 4AWXB 4BXUA 1DPRA 3M8FA 1U5TC 4X1EA 2JN6A 3C2GA 1DPUA 5FLMJ 2C6YA 2E36A 2VKDA 1SD4A 1U8BA 5GPAA 1UG2A 5D6FA 5HS7A 1MMSA 1LVAA 1ZGWA 4J01A 4IX7A 1ULYA 3LFUA 2BW3A 2E5NA 2Y69H 3CUQA 3RJPA 1H88C 1U9OA 3KZZA 4LIVA 3ZQCA 3BC8A 1I3AA 2IT0A 5A2QK 4QPOA 2DFEA 3DTKA 2AS5F 4RGSA 3DLLF 1XGMA 5JLXA 5E1ZB 3Q5FA 1BW6A 2R7XA 1SVMA 2E7WA 3COAC 3E5XA 3C7JA 4KMFA 2K9NA 2A5WA 3BTCA 2PJRA 3K4LA 2ZC2A 4BXXJ 2KFDA 4I76A 3CESA 1IRZA 2DDAA 4HQEA 3Q0VA 3WU0A 2FJ1A 4RBOA 1K78A 4BH9A 3GFJA 4RM2A 4ZDLA 2QYOA 4NNJA 1S7AA 4P9FA 1PVEA 4CCOA 1MBGA 2Y30A 2W48A 3EYYA 3HRTA 2IRFG 4EM1A 4JX6A 3U1KA 3H5RA 1R1VA 3T5XA 4RDUA 3GTGJ 3FBNB 4HF2A 2WAFA 3N05A 1D3YA 3FHNA 3KPHA 4WF2A 2BYVE 2L7KA 3SFZA 4F3QA 2FE3A 5BQTA 4L0ZB 2PI0A 1MNMC 2VXDA 4HG2A 1BOAA 1K7AA 4DYRA 1P7IA 1A6QA 4HF0A 4FHTA 2E60A 2XB5A 4HV6A 3V42A 1F4KA 3RKXA 4FTHA 3H9GA 1DGWY 3CUQC 3K7AJ 3PIOF 1ODDA 3BQYA 4C3JJ 1GVJA 1QZYA 3QPLA 1G2HA 3MVPA 1JGSA 2OAZA 2DMUA 4Y52J 4WK8F 2V1NA 3I3LA 3E1SA 4E7SA 1FTTA 3EUKL 2W85A 4AYBN 1X1CA 2CS3A 4LB5A 3HOXJ 1WSUA 1BI0A 5FKLA 4M71A 1TC3C 4KUMA 2J5PA 4XLPF 3HOUJ 1JXSA 2L7FP 2XRLA 4RS8A 5J40A 1R00A 3MMYB 4C3IJ 1MJAA 2VI6A 1B59A 1Y0NA 5IYBJ 2WBMA 2XPWA 2Q2EB 1E2XA 2KDZA 3K70D 1A6IA 1KZHA 4KYWA 4ESJA 4DYQA 3BJAA 2ZKZA 3FXLA 3E6MA 3F8MA 5J3LA 5LGUA 3HUGB 3K6GA 4FX4A 2A6TA 3CZ6A 3X2QH 1VQPI 2R7VA 2H6BA 4LG3A 2L9NA 3S2DJ 2RNJA 1XDUA 5HLTA 3K10A 1PYVA 4FCYA 3L2CA 2RN7A 1MMDA 1P92A 1Q1HA 1S72I 4AM3A 1W7PB 2ZMEB 3H5NA 3F8CA 4XRSA 4ESBA 2QF7A 3N97A 2BW3B 3EQLF 5CQEA 1HOMA 3S1MJ 1ETYA 2HTSA 4EGYA 2EZIA 2LR8A 4C9YA 5C4JJ 1ZREA 2K27A 1Y1WJ 2ID3A 2NVTJ 4UUTA 1J2XA 2Z2SB 2VJJA 1KYZA 4D5CA 1HKSA 1U5TB 1KQ0A 2GA1A 4L0YB 3LNQA 3S17J 1GVDA 4LGWA 3LSGA 4R79A 1B9NA 4OIOF 3P9IA 4IQ4A 4EM0B 2BY2A 1IDYA 3BG5A 3DCFA 4NUBA 4CZZA 2BEOA 3HL2A 4N9IA 4G7OF 2P4WA 3A2KA 4RAFA 3JAMZ 2LKSA 1WPKA 1K6OA 4GGGA 5J8CA 3KETA 4CSWA 1TW3A 2BV6A 2A68F 4KT6A 3VYRB 1SVLA 3L1PA 3OYGA 5HLIA 4A69C 3T0YA 2XSJC 5K7ZA 4CZCA 5HOOA 2DFHA 3L09A 4BY1J 1FBUA 4YIFA 1W5TA 2OZUA 3JRFA 3CO6C 1R36A 1APLC 4XK4A 3W3CA 4LD5A 1Y8RB 4M74A 4RGUA 2R3SA 2RV8A 3CC2I 3AG4H 1XPXA 3QWLA 3HRSA 3LSMA 3HOYJ 3QU6A 4XKVA 2JMWA 3GTKJ 1QPIA 4KA4A 2DA7A 4MGRA 2QBYA 3E5QA 2JA5J 4HV5A 1LKXA 4C2MJ 1IW7F 1SD6A 5A2QZ 3JRDA 1SAUA 1EJ9A 5CQGA 4Y33A 3WTWC 5F04A 2YX4A 4WX9A 4PSXA 3KX2A 1B6AA 3HSFA 1NHAA 3QAHA 1FJLA 1IF1A 3S3NA 2FOKA 3BJ6A 3WTVC 4B4CA 1IJWC 5IOZA 1UG0A 4HNVA 5KAFC 4A3JJ 3M8JA 3GZ6A 3A0HC 4N9HA 3KIOA 5EEHA 2K4BA 2FOWA 2KRCA 2YR2A 3A03A 5LRRA 3RKQA 1S5LC 3AG2H 1MIJA 2WAQA 3CF2A 3C3WA 2F5DA 3DV8A 2DMPA 1T0FC 5M5WJ 2RREA 1NK2P 5TJJA 1C0WA 1VF9A 2WB1N 3U2RA 4BU2A 4EJOA 3BT9A 5D4RA 2EIJH 3LSIA 3I56I 4UVBA 3ZN0A 3K1PA 1J59A 1EH6A 1ZG5A 4M9ZA 4QPQA 4BHPA 3H0DA 1FSEA 3HZJA 4N4OB 1U8RA 1AOYA 3OL3A 3K4CA 3GW2A 1UAAA 1ZQ3P 3S1NJ 3CDHA 6PAXA 2QEXI 2M3AA 4ZYHA 4BGDA 3FMQA 1S7EA 2A07F 1YW9A 2PMZN 1WJEA 1G59A 2MYSA 1WI3A 4IQJA 4YIRX 4A93J 2DFIA 2NXNB 2LKXA 1N75A 4BQAA 4MEXF 3W6JB 3AG1H 2Z9OA 4D1QA 1TT5B 3TGNA 4WCGA 5HDKA 2KKOA 5LGTA 3ZQ7A 3QPTA 3JRIA 3REOA 1VQMI 1Z3YA 2F5EA 2CSOA 4O6JA 4PJNA 2ZO4A 1GV2A 2VQHA 4B3AA 3K69A 2WB1A 4U87A 4E7IA 4XQFA 4Q4ZF 3TBIA 1U3EM 1A31A 1U5TA 1D0XA 5ERIA 1FIPA 4I01A 4FISA 2XROA 3FK6A 2ELJA 1GUUA 2CU7A 1U6GA 5DM6F 5FFXA 2QQAA 3A01B 1QZZA 4U0WA 1DU6A 3PSIA 3AG3H 1MNDA 3BLYA 2IS2A 3PUFA 3NRVA 2JVHA 3O8HA 2A5YB 4XOTA 3M1CA 4A6EA 5H6QA 2EA4A 4B3XA 3KLNA 3LSJA 1EH7A 4ENNA 3BR3A 1KU9A 1MH4A 2W25A 3AFHA 2R7UA 2M45A 1MH3A 3VEPA 2X85A 1EKEA 1UFMA 2V6EA 5FLVA 3PL8A 3HDDA 3K2ZA 4JQFA 2F4MB 2F5FA 1VQ7I 3ABMH 3F8NA 2E2JJ 4CDGA 1R9TJ 5FKMA 1D1AA 4LITA 3JREA 2FQ3A 2R5YA 1W1WE 2PLYA 2PMHA 2X51A 1OR7A 2P5VA 3Q0WA 2KIMA 2XRNA 2M8GX 2NNNA 3GUDA 2VC0A 4NC6A 4XLCA 2BY1A 3ZMSA 3BR1A 1JJ8C 4DZPA 3BG9A 3WE3A 4II3A 1OJLA 1QA6A 2QENA 2R7DA 3DEUA 5IP7J 2DOFA 1QPMA 3F21A 4I02A 2Q0OA 4AIKA 2K9QA 3FM5A 3F72A 1BN5A 3RPQA 2MH9A 2QKMB 3RYRA 1OYWA 4NHJA 4ENJA 2JUCA 1FMVA 3HSRA 1VI0A 2JSPA 1I5ZA 1XGSA 2DTZA 3DU5A 4BJTA 2R7FA 4M9XA 5DS9A 2O5RA 2MD0A 4NB5A 3W2WA 4NC8A 2OJED 3JTHA 4M9SA 3QQAA 1Z9CA 4JX5A 4HX7A 5IOYA 1HSTA 1HA8A 3OOPA 2YUSA 2WV0A 2H27A 1X1PA 1W0UA 2DQLA 2D45A 2IEKA 2L5QA 3BY6A 1XS9A 3FXQA 4CYCB 2E2HJ 4D9JA 1MKMA 1SC7A 5E79C 2H94A 2VBWA 3VPRA 3AL0B 1FOYA 1NTCA 1Z67A 3CUQB 2XF6A 2HYGD 4B43A 1YLFA 2HDDA 4BY7J 3ZQFA 3UNGC 4DNCA 2JPBA 1FBQA 5LFAA 4ITVA 3C18A 4E7HA 1RR8C 2G0EA 2KIQA 4W1UA 4XNFA 4ZYGA 3V4GA 4MQ9F 2HQNA 3WTYC 3OIOA 2LK2A 2HKXA 2CO5A 3DU6A 1LPQA 1A35A 4I7HA 2HI3A 1W36D 4CCJA 3CP8A 2R7WA 1ZLKA 2DAOA 1XMKA 2FMLA 4HNTA 3WTSC 4XRFA 4M3EA 2EFOA 1TWHJ 2XKPA 3RPUA 2HOSA 2JT1A 5FRMA 1U9NA 2TCTA 5DV5A 3W2VA 2FEZA 1WVRA 1G3SA 5FKKA 4RAGA 3RCOA 3VYTB 4Y4RA 2ADUA 4BHBA 5JR3A 1WGXA 3EYIA 3GFIA 3JAMK 1ZELA 3PM1A 1D8KA 2STTA 1X1DA 1IN4A 1IDZA 4Y13A 2A69F 1ZRCA 4Q5SF 4LK0F 4W97A 5JLWA 2KIUA 3IUOA 3SJMA 3F6VA 2CH0A 1R1TA 2Y9ZA 3WU1B 2IS6A 3I5UA 2L0KA 3KYCB 1I3QJ 2M87A 5GPCA 3J7AO 3I54A 3J7YJ 3MZ8A 5D5WB 3OYLA 2M0MA 5FROA 2X1EA 1JUMA 1DDNA 3M9AA 1SFOJ 3MWMA 3EUHC 4BHCA 4UB6C 2XUBA 1V4RA 4P5OA 1FYKA 3FWEA 3OR1C 1P6RA 2D5VA 1RESA 1KU7A 3IKVA 5KVRA 2FBHA 3BJOA 2FNPA 5DD8A 4ZH4F 4PCQA 1OISA 2IGOA 1O3QA 1T56A 3S14J 2VL8A 5IT3A 4JOMA 1J75A 2GM4A 2DK8A 1L3LA 1TW2A 2ISZA 1W5SA 2NOGA 2DN0A 3PO3J 1Z05A 2CFXA 5EGOA 4A3LJ 1N25A 1GV5A 1YJNI 4X0GA 4YFKF 4UV8A 2PMUA 2W84A 1ETKA 1YRNB 2EH3A 1YTYA 4IHVA 1VQ9I 4D7NA 5J1RA 4KN7X 2H1LA 2LY9A 3BCBA 3I58A 4HQMA 4HX4A 4QTRA 3WTXC 3LAJA 4A6DA 5FLXK 1WJBA 2NOJB 2Q1ZB 1FBSA 1QQIA 2G7UA 2O0YA 1YFHA 2HU9A 1ETQA 2MABA 3D5RC 4OWRB 2V9PA 3C2BA 4CCKA 4XICA 5JHUA 4XLAA 2E2IJ 3TO9A 1WJ5A 3JW4A 1T98A 4B48A 3HIFA 3MKWB 1S3JA 4O3MA 2VKEA 2NYXA 4PJLA 3L2VA 2HZDA 2IGKA 2VONA 1HKTA 2CG4A 1YE9A 2HDCA 4XLHA 5D6EA 2PJRB 2DK5A 1YJWI 1TWGJ 1XD7A 3SZGA 2ACJA 4IRIA 4Z6YA 1JTYA 1ZRFA 4OIQF 2CRGA 2V9VA 1A5JA 2M8EA 5CVIA 2ME6A 4B47A 2HOTA 1N78A 1KQ8A 4B44A 5C4XJ 4RLQA 3PQKA 4I6ZA 2BOLA 4DQ2A 5HNFA 1SANA 1ON2A 3MKYB 2KZVA 1U0JA 5B5EC 3F0CA 1FY7A 1OCTC 3K2AA 3LOCA 1I6XA 4ZTJA 3A4CA 3OYEA 1RKTA 4L9NA 5ICFA 1VQ4I 4XLNF 1REPC 3I4MJ 2ICWG 4UVAA 4IPAA 2NAZA 2WA0A 2P5KA 2R5YB 2DPUA 4RB1A 1Z0XA 4LLNA 3AAFA 5KK1A 1P4WA 3ASNH 3E3VA 1R4NB 4IHTA 4F91B 4M73A 2CW8A 3FXMA 3FM3A 3G71I 2IS4A 3DKXA 2HDWA 3FHZA 4BS9A 2UXXA 3ZOBA 1FOWA 3C2HA 2ZCWA 3BZ6A 3MZYA 2F48A 4BL0B 4BBSJ 2EFPA 5HLHA 2NS7A 3MD2A 2ZMEA 3NWSA 3HXLA 5EDNA 4M6VA 2DA5A 3WTZA 2A6EF 3LA7A 2WTEA 5F27A 2YPRA 3GTOJ 3NEUA 3J80K 5FD6A 4AIHA 5E8GA 1BJAA 1QVTA 4GYGA 1J9IA 2ZSIB 2WY8Q 4XBFA 4IO9F 5CJ9A 2O8KA 2JK3A 2GWRA 1J09A 3BDDA 2HOEA 3PFYA 1YO5C 1ZR2A 4C30A 4G7ZF 3Q0UA 1YS7A 4RM3A 1MBEA 1YIJI 2B9SA 3GTMJ 5IP6A 4D7MA 2K9MA 2NVYJ 3IHUA 2R7RA 2EINH 4RMNA 2FA5A 3B6AA 5HDGA 2DT7B 4LB6B 2B63J 3OYNA 2QLZA 1B1BA 1I39A 2K02A 1P7JA 4L9VA 3BP8A 1LFPA 1RPWA 2KJCA 1MSEC 2Z33A 1IXSB 1R7JA 1JUSA 5LEKA 3OYKA 3CCEI 3M8EA 4MQVA 3WGIA 1HC8A 2ME0A 2LG4A 2VPLA 3L9FA 4D0PA 1G8XA 1YG2A 3V8JA 4UHTA 2HYJA 3LL7A 5E1WA 1MW7A 2CMPA 2CW0F 2OCEA 2V4JC 1Z6RA 4B09A 1J5YA 5E18F 3V7CA 1NK3P 3KCCA 4UUSB 1F5TA 2UV1A 5L3FA 4C2UA 1JTXA 2IAIA 3QPHA 4RGRA 1JKOC 3MEXA 2HVRA 5D8KB 5F6FA 3H35A 2P6SA 3KYLA 1IUYA 1SD7A 3OL4A 4KDPA 3E6BA 2F2EA 2WY7Q 2DMQA 1YOVB 2V1DA 3L2QA 3VYUB 5J4VA 4OIRF 4E7JA 4G8XA 4KIFA 5IT9Z 3V8LA 2AO9A 1ORKA 2W1OA 2JSCA 1ETXA 2A61A 4Q48A 4Y17A 3MAJA 1T6SA 3DBRB 4L5JA 1WWXA 2FD5A 3SXYA 3BR5A 5M5XJ 2QCOA 2FQ4A 2WV1A 2ZBKA 4HPQA 4CHUA 4A3DJ 3I64A 2HOAA 3R0JA 1VQNI 2HVSA 3TMOA 2XGXA 1R71A 4A3IJ 1QU3A 1X2MA 2IVMA 3G1LA 3IRRA 2E1CA 2H8RA 4NC7A 5E3OA 4GXOA 2COBA 2XB0X 3HOTA 1IV8A 4O5VA 1D5VA 4LG0B 1V55H 5CVJA 1Y39A 1P4XA 3OYCA 3S32A 4HDUA 2MA3A 4RB3C 3OYDA 3PNVA 3TW7A 4RGXA 4A2UA 3FXOA 3ECHA 4CA0A 2R5ZA 3FZVA 3ZRGA 5FB2A 5TRDA 2PMZA 4II2A 1GT0C 4HEA2 2JUGA 4BQNA 5DM7F 2ZFUA 2EZLA 2XIGA 2PN6A 3OWTA 3ZQGA 3S2WA 1IO2A 2KJBA 4Y3OA 3CCLI 1FC3A 1RNLA 4FASD 3KZYA 2R7SA 3HRUA 3SEQA 2G9WA 3GX4X 2GA2A 4C3HJ 2K9LA 3BZKA 5E1XA 2ZJ2A 2QVOA 1B8IB 3CP2A 1MZBA 4MTEA 4IXAA 3L2RA 2QQ9A 3WE2A 4QLCU 2YU3A 1EH8A 1MD0A 1Z7LA 2KRFA 4IHSA 1X4OA 1ETVA 2UZKA 5HDNA 3WU2C 4BEHB 1B72A 4HW0A 2KLOA 3GTJJ 4HDVA 1WJCA 4XM3A 4JP0A 2VXZA 3BPVA 4OAYA 4A0YA 3A01A 2DA2A 2NS0A 2P7CB 1K4TA 2Y0SA 3CC4I 3ZQIA 3OY9A 4OOIA 3WG9A 1JI8A 1ONVA 2X48A 3HM5A 1JT6A 3HC7A 4AVZA 4U88A 4LJZF 3L7WA 3OYBA 2Z1DA 5DYMA 1BL0A 3WTTC 3CMYA 2DOAA 1IRGA 1BJZA 3TP0A 1L0OC 3BR0A 1MGTA 1T39A 3QOEA 1HW5A 3K4MA 3J81K 1MNEA 3OYMA 1EA3A 3JSOA 1STZA 1XB4A 4LG0A 3ZR8X 1NH3A 3P7NA 3GO5A 4I99C 2FU4A 4RAYA 4BYYA 1YJ9I 1I27A 1UELB 5LLQA 2DOEA 4LFUA 4XN0A 3DBHB 2XDVA 4A3EJ 2PG4A 1V3FA 5EGOB 1VQ8I 5ED4A 2PJPA 2OUMA 1UCRA 2L3DA 4DGWB 4N4NB 2EZKA 4MEYF 3TDZC 4N0BA 1TNTA 1OCOH 4HF1A 1R4MB 1XN7A 2OBPA 1SD5A 1QVUA 4MHGA 1SFKA 3HBLA 3RZDJ 2X6XA 2DT6A 2P8TA 3F3XA 2EFWA 3JRGA 1BOBA 1D0ZA 4K2EA 5GTHC 3V7RA 1USTA 4G6QA 2Y0MA 2CWEA 2ZFWA 4L9TA 1Y6IA 4KICA 5B66C 1Y1VJ 2JQ7A 4MFDA 3C1DA 5EEAA 1MJ9A 1R22A 2GZWA 2EFNA 4J00A 1ACIA 5M5YJ 4HAMA 2VKHA 2H6CA 2ID6A 4MFEA 5K1YA 1FPQA 1SMTA 1RR7A 3GVAA 3JCUC 2OTJI 3FXJA 4L9JA 3TOBA 3JTGA 4GFBA 1F43A 3HTUA 1R1UA 4B8XA 1VQLI 4HOBA 1WHUA 4ZZDA 4MTDA 1PDNC 5FRNA 2GXAA 2XGCA 3ABUA 2DA4A 3ZQHA 2DYSH 2CFOA 2DLLA 4IEJA 4U0YA 2TRTA 3WTUC 3BG3A 4LK1F 2L7ZA 4PJMA 2X0LA 1YI2I 3GTQJ 3QU3A 1IN5A 2OD5A 3SZTA 1XGOA 2DMNA 3VODA 4LMYA 3PIPF 1IN6A 1Z91A 4S0HB 3RSNA 3OS2A 3F22A 2W00A 2MBFA 3ABTA 1U2WA 2STWA 2XAQA 3VDXA 4OMZA 3TQNA 3GZ5A 3EDPA 3M4OJ 2XAGA 1RIOH 4A3FJ 3G1OA 3FMSA 3KP7A 1BA5A 5LHIA 2HNHA 1WFXA 1Z1DA 4S05A 1TP4A 4UV9A 4RAZA 3GEZA 1S29A 2DI3A 3CUOA 1MBJA 2JA7J 2Z3YA 1SAXA 2LMDA 3HGYA 4PK4A 3I4PA 4Y15A 2M9HA 2CUFA 4E7KA 4XSXF 2X9DA 3GCMA 1MBKA 3NARA 3S15J 4M3FA 2XVCA 3SZPA 1UZCA 1VQKI 2D1HA 1TWFJ 3KP4A 4P55A 1LDDA 2ZSHB 2V7FA 4AYBA 3H1CA 5GAEJ 2LRDA 1FLIA 5L3CA 3CTAA 3IWZA 4IHWA 1X3WB 2IGMA 1X3ZB 2PFBA 1ZG1A 3I55I 5AONA 2JZYA 4ANJA 1WKMA 3BG7A 2BHYA 2ZXHA 1USSA 5JI6A 2HZTA 4RB0A 1NG6A 4U7DA 2KIFA 3OR2C 1RKWA 2F4OB 4I0AA 1T2KA 4L5EA 4YIIA 1T0FA 1ERDA 2LF7A 1MMGA 5D5VB 3GYHX 4CO8A 5D4SA 3KEQA 2GQQA 2CW7A 4FQGA 2IW5A 2Y0SN 4XLFA 4GCVA 3RKYA 5DUKA 3FF5A 2ZXWH 1IXCA 2ELHA 2QA4I 2IJLA 2MLKA 2OQRA 3DBLB 1YHQI 3LWFA 4PDKA 1KA8A 1IC8A 2E19A 5JFRA 1K78B 1XMXA 3FXRA 3JR9A 3IRQA 3A1YA 3G6EI 5DCFA 2EWNA 3J81Z 1AKHA 3VWBA 3PJRA 3KYDB 2JTVA 4A3BJ 5ICCA 4OIPF 5ILVA 1OCZH 3MQ0A 4M72A 4XRMA 3S1RJ 4QIWN 2CUJA 1OMIA 1TWCJ 2EBIA 2J5OA 5F0FA 1HW2A 1K6YA 3K1MA 2FX0A 3K9TA 1Z77A 2LY2A 2R93J 4V2GA 2KL4A 2RNGA 3VSKA 1HCRA 1R5GA 1XX5A 2RC4A 1ZYRF 2LC2A 2ZJRF 5FO5A 4HNUA 4XIDA 1S8NA 2CQ7A 1QHGA 2DBBA 3QYBA 4XORA 2E71A 4KMUX 3LSKA 1V5EA 1GXQA 5LD2C 2ECCA 1K79A 3R60A 1BR2A 1AU7A 1XG1A 5B3SH 5HODA 3MCZA 4YRVA 2W7NA 2LBFB 1X3UA 3CJQB 4BE1A 4EATA 4UUVA 1BC8C 1D8JA 3ERMA 1M1EB 2VBXA 3T8RA 2VQLA 3FX3A 2VJ5A 3CJTB 1MSFC 1SVOA 2WAQN 2YU9J 5EG0B 1WQ2A 5DUIA 2DA6A 4HA8A 2K9SA 4WXCA 3W6VA 1EV7A 1Y8QB 3P5JA 3K4JA 3BTLA 4GO1A 2EV0A 2CQXA 2DU9A 2YX7A 3TW6A 1HKQA 3ZMVA 4NDLA 2X6WA 3S93A 1N77A 2Y9YA 1FP2A 3K4KA 3OYJA 5B1AH 4ENMA 3IAS2 2W82A 4HSTA 3WHBA 3MN2A 4D5FA 4XONA 4DJAA 2XASA 1FZPB 1WRJA 2E1NA 1AHDP 4PSWA 1S6LA 1R58A 1J7KA 1PP8F 3O8GA 3NWTA 2WADA 4IL6C 3HUGA 2CJJA 3KP5A 3QP6A 5FGMA 3ZMZA 2CV0A 2RDPA 3CD6I 1YRNA 4HBLA 1O4XA 4G7HF 5EEGA 1HW1A 2ETHA 4F52A 2BGCA 1ETOA 2M1BA 4A0XA 4AUXA 4PZJA 1OLTA 3OS0A 4UNOA 3P9KA 2AXTC 3QP5A 1V54H 1RETA 5GP9A 5EJCA 3L2WA 3D5LA 2KP6A 1XGNA 3HPHA 2AQFA 2MH2A 2ZJPF 2VC1A 2PX9A 2NVQJ 1UB9A 2R7OA 3Q9SA 2TDXA 3IKTA 1LEBA 3HGGA 3GLXA 2NVUB 2ZXJA 3EETA 1WJDA 2W57A 4C2TA 5AIPA 5D5XB 1H9GA 2KMUA 2EILH 4Y7NJ 3GTLJ 3K4NA 1DQUA 1D1CA 1FSHA 3DEWA 5K7FA 2M5WA 5AIQA 2CV1A 1JHFA 1TZLA 5CYVA 2L01A 4WXDA 1HQCA 4FX0A 2GIVA 3H3ZA 2QGUA 3KEOA 5FJ8J 1P4AA 2A6HF 2B0LA 1FYLA 2XC7A 2HEOA 1ZRDA 1WI9A 2M7BA 1Z21A 2VJ4A 1OCPA 2M34A 1AWCA 4NBQA 1YX5A 5KCMA 2XAHA 1FEXA 2RKHA 1DP3A 1QGPA 1F9NA 2CYYA 2HPIA 3P9CA 1FNNA 1G3YA 5LHGA 3LAPA 3GFLA 4E6KG 3TDUC 3L00A 5FKOA 1VQ6I 3BQZA 3ZPLA 1DGRM 4KN4X 3RYPA 5CVUA 3EUAA 2NS8A 3OV8A 1JT0A 4L5IA 4CXFA 2MG4A 4XLEA 2X6YA 1YS6A 3J80Z 1SEUA 4BUPA 3MKZA 1QBJA 5C44J 2F5VA 3JRAA 3CO7C 2ISYA 1FOKA 2VOOA 2BE5F 5E3LA 3DPTA 4E4HA 4RB2C 1VZ0A 2VN2A 4GDFA 2IBDA 1X2NA 1QO0D 3G1MA 5ICGA 1E0EA 3H3UA 2RQQA 3B02A 5K5QA 4P9UA 2PQ8A 1BR4A 2M7AA 4A12A 5JVTA 1IGNA 2D1VA 2MLGA 2HFHA 3F23A 2IA0A 3F8BA 4AIJA 3F8FA 3DPUA 3BWGA 5DCMA 2MW8A 4I2OA 3GF2A 2K40A 5HLGA 3F6OA 4XR6A 2QWWA 4UXNA 2EQRA 3GXOA 2Q2EA 3O6BB 1XSXA 3FXUA 1X58A 3M3YJ 5LRSA 1KU3A 4LOCA 4Q47A 3K70C 2QSFX 2GLOA 2XSDC 3PNYA 4QSHA 1HXDA 1TLHB 1ZR4A 4HLYA 1XSDA 2GIZA 1IV6A 2O61A 2GOXB 2QQ8A 5L3DA 4OMYA 4AU7A 3FIWA 1XCBA 3ROUA 3LQRA 3PUBA 1WH7A 2VE8A 1S7OA 5J4YA 4IHXA 3DKYA 4ZDPA 4KIGA 5LBQA 2OCCH 3OIPA 1OPCA 4XKCA 4QWQA 4BQOA 1Z3XA 3OMYA 3H3VK 4KJZA 2HPMA 5BNGA 2HTJA 4JK1X 3ABKH 1FYMA 3QOPA 3SQNA 3QODA 4BJ5C 4ASNA 2F5CA 3CJRB 3H36A 2A3SA 4CCNA 2DW4A 3S16J 3S2HJ 1LQ1A 1GLNA 2M30A 3IV5A 1JKQC 2KPMA 2EB7A 1ZH5A 3DTIA 3HJEA 1NG7A 2DPDA 5DD4A 3RIRA 2P5LC 1ZTRA 1D5YA 3HKZA 1LFUP 5GADJ 2L9VA 3HTSB 3KZIC 3ZQQA 2V1XA 3AKZA 1A04A 2VODA 2H8WA 1ZHFA 5LHHA 4A0ZA 3RDIA 1MJBA 3BR6A 3DP7A 2E7XA 2ZXIA 3ABLH 3WGHA 4ZZLA 1YX3A 3WG7H 4HX8A 2L4MA 4DBRA 3K1NA 4X6AJ 2WWYA 3RTRA 5F0HA 3O3KA 2XGDA 2LVSA 3G2BA 1MBFA 3I4NJ 1Z7UA 4HYEA 4F92B 1MBHA 1WCMJ 1AKHB 2VBZA 1R49A 1TWAJ 3ULQB 1XSVA 5DCMB 3GBGA 1X19A 4KFCA 4XKWA 3CC7I 5CVVA 1U78A 2XHKA 2FXAA 4EJWA 4A3GJ 1UHMA 2MSYA 2HWVA 3CCJI 5HS9A 1BC7C 2EA2A 1DUXC 4OINF 1ON1A 3W2AA 4ZC3A 1OFCX 3SDBA 4ZDOA 3B6CA 2OQGA 5TGTA 3HHGA 4PFOA 3LFKA 5ILSA 1HDDC 1O3TA 2DO7A 2E1MB 4DYCA 3BPXA 3HG9A 4MO7A 2AQEA 2EV6A 4CCLA 3S3OA 2P6TA 3LMMA 5KNLA 1FIAA 3PFIA 4A3KJ 4HSRA 1LFBA 4PGHA 5L3GA 4XOPA 5LEJA 3A0BC 2QM3A 1LUJB 2EJRA 2QSGX 3MZHA 3TP3A 2M0CA 3V8KA 1ZLJA 1YQAA 1YYVA 3FKIJ 4G6DA 3VFZA 3ESWB 2W4SA 3RQ4A 4AD9A 3I9V2 2GOMA 1GHCA 2V6CA 1KYWA 2DQRA 4EJUA 3CCUI 2OC6A 2EV5A 2QBYB 2Y2ZA 3GFMA 4V19K 2DMTA 4PJJA 1WJFA 2CQNA 2FBKA 5BOXA 2EIMH 4BKXA 2DFFA 5DEQA 3K4BA 4UVCA 1O57A 2IPQX 1IRXA 3BR2A 1HF0A 3WGGA 3IH4A 3U9GA 1O3SA 2R92J 1I1GA 5ILUA 3KEYA 2Y75A 4G6TB 1OCCH 3ELKA 5HNHA 2E35A 5D8LB 4XL9A 5F1JA 2DXIA 3JRHA 3ASOH
chains in the Genus database with same CATH topology
3R0AA 3VOEA 4A5NA 3V7SA 3CLOA 1FX7A 1G3WA 2QQBA 4IRGA 2XV4S 1R5HA 3U1DA 2WC2A 1MDMB 4XSZF 2DTRA 2W24A 5FFZA 2FRHA 1JE8A 4CYDA 2Y48A 5L3BA 2AXLA 5BS6A 2YSRA 5E20A 4Z2YA 2O03A 1TQPA 4ON0A 4EMSA 4IRHA 3KP3A 3SHFA 2MC3A 3HOSA 3BROA 2PEXA 2LKPA 1PP7U 2FMYA 3MFKA 1ZGJA 2V79A 4IF4A 1IN8A 1GXPA 2K4JA 2VE9A 2O6GE 1DP7P 1MDMA 4E70A 1O3RA 4HZFA 2OU2A 3E97A 3IWFA 1IXRC 1F1ZA 2LNBA 3R4KA 1TTYA 4WWCA 1LEAA 3N4MA 3PQJA 3EUHA 1LB2A 1W4MA 4G9YA 1IZ1A 1SFXA 1SMYF 2X4HA 1XDSA 2CGPA 1SFUA 2QZ8A 5E17F 1BI2A 1BIBA 5FLXZ 1BI1A 3I53A 3FMRA 3M1EA 1W7PA 3K0LA 3TOAA 2FSWA 1O7LA 5ICEA 4R1HA 3DPLC 4ENKA 3O2PE 2OZ6A 2EK5A 5LGNA 4TV7A 5CVRA 4U7BA 1J0RA 2CQKA 1G6NA 1KU2A 2GAUA 1Z6TA 2IA2A 3I59A 3KP6A 2OA4A 3LA3A 2D2WA 4I0BA 1TNSA 1FP1D 2COMA 1W7PD 2HKOA 4CGZA 2K86A 1OKRA 4HLXA 1RUNA 3DQVC 1QNTA 5FD5A 3IL2A 3ML6A 2RVCA 2LSOA 1P2FA 5BPDA 3DXJF 4NQWA 1R23A 4EJVA 1YIOA 2MD5A 1FWZA 5IT9K 2HYFA 2DT5A 4EM2A 5K5RA 1UHWA 4F7ZA 4L18B 1LNWA 3TO6A 2XAFA 4CICA 5BPIA 1BM9A 1IAWA 3ISPA 3ERED 4KIBA 1IN7A 4YFNF 4I98B 4YFXF 4JBAA 1JHHA 3LQQA 3KFWX 3IC7A 1HSJA 2EFQA 1CF7A 1Y0UA 4EVIA 5D5UB 3JSPA 2JPCA 1ZARA 2XAJA 2BBYA 2HGCA 5F64A 4I09A 5L3EA 1ZGAA 2O3FA 3VB2A 3ZMTA 1LDKB 3E6DA 2LDUA 2L54A 3KLOA 1ZG3A 2Z5UA 3ZN1A 1G4DA 1LDJA 2GXBA 2NNYA 1T38A 1TQMA 3CJNA 1BIAA 4OU0A 2VBYA 5J6XA 2UWMA 4EGZA 3M7GA 2ESNA 4LLLA 3R6SA 1VTNC 2Z99A 2QUFA 3ZP5A 2RQPA 4G94A 3QRFF 3HRMA 1XMAA 4MNUA 5HVQC 1CGPA 2LF8A 1B9MA 2VOPA 1I1SA 4EJTA 4FT8A 4ETSA 3T1BA 4S04A 2IA1A 4BNCA 2UXNA 4AVPA 5F1RA 2L02A 3DKWA 4IVNA 2FNAA 1FT9A 3GWZA 4M6YA 1RI7A 4EV0A 4M6XA 5CLSA 2RGVA 1G3TA 2FF4A 3T8TA 2IP2A 1OYYA 3KP2A 2P7VB 4IJAA 2O8XA 3ECOA 1O7FA 5BMZA 5E8IA 5K5OA 3E6CC 3W6KB 2VT2A 1TQIA 3LA2A 3R61A 4KNYA 2VT3A 1BI3A 2HS5A 2XKOA 4LLGF 1RZ4A 4PGGA 4R8HA 1HBXG 5J8FA 3ZMDA 5DDGA 3I0TA 3HYIA 4H0EA 1E17A 2PBIA 4ESFA 1OYIA 4BAYA 2FBIA 3ZMUA 5HS8A 2L4AA 1ZN2A 4EQQA 1H9TA 3LSTA 1YW7A 3RI4A 3I71A 2NRAC 4WXHA 4A5MA 3E5UA 1YW8A 1CF7B 4ZYDA 3G3ZA 2ESHA 3KE2A 1LJ9A 2GXGA 4ZYEA 3TKYA 1TBXA 3H92A 4U0VA 3BOQA 2K7LA 1KGSA 3HHHA 2HQRA 3DF8A 1XCVA 1IRFA 2HR3A 2ZNZA 4P96A 5H6RA 5H20A 4YG2F 2ZNYA 3DFGA 1B4AA 2V1UA 3B73A 2G7HA 3HSEA 3WODF 4KT5C 3I59B 3Q9VA 3RKWA 2JRTA 3G73A 3NQOA 1SFEA 3TO7A 1ZAOA 1KQ9A 1BBYA 2Q8KA 1PUEE 1RUOA 2H09A 4GYIA 3D0SA 4AWXB 4BXUA 1DPRA 3M8FA 1U5TC 1DPUA 2C6YA 1SD4A 5D6FA 5HS7A 1LVAA 1ULYA 3CUQA 3RJPA 3KZZA 2IT0A 5A2QK 2AS5F 4RGSA 1XGMA 5E1ZB 3Q5FA 2E7WA 3COAC 3E5XA 3C7JA 4KMFA 4HQEA 3WU0A 1K78A 4BH9A 3GFJA 2QYOA 1S7AA 4P9FA 3EYYA 3HRTA 2IRFG 4EM1A 1R1VA 3T5XA 4HF2A 1D3YA 4WF2A 2BYVE 3SFZA 5BQTA 2FE3A 4L0ZB 2PI0A 1BOAA 1K7AA 4HF0A 4FHTA 4HV6A 1F4KA 3RKXA 3CUQC 1ODDA 1GVJA 1QZYA 1JGSA 2OAZA 4WK8F 2W85A 4LB5A 1WSUA 1BI0A 4M71A 4KUMA 2J5PA 4XLPF 1JXSA 4RS8A 1R00A 1MJAA 1B59A 1E2XA 4KYWA 4ESJA 3BJAA 2ZKZA 3E6MA 3F8MA 5LGUA 4FX4A 2H6BA 2RNJA 1XDUA 3L2CA 2RN7A 1P92A 1Q1HA 1W7PB 2ZMEB 3F8CA 3N97A 4ESBA 3EQLF 2HTSA 4EGYA 1ZREA 2K27A 1J2XA 1KYZA 1HKSA 1U5TB 1KQ0A 2GA1A 4L0YB 4LGWA 4R79A 1B9NA 4OIOF 3P9IA 4EM0B 4CZZA 2BEOA 4N9IA 4G7OF 2P4WA 3JAMZ 1K6OA 4GGGA 5J8CA 3KETA 1TW3A 2BV6A 2A68F 5HLIA 3T0YA 5HOOA 3L09A 1FBUA 4YIFA 1W5TA 2OZUA 3CO6C 1R36A 4LD5A 4RGUA 4M74A 2R3SA 2RV8A 3HRSA 3QU6A 4KA4A 4MGRA 2QBYA 3E5QA 4HV5A 5A2QZ 1IW7F 1SD6A 3WTWC 2YX4A 4WX9A 1B6AA 3HSFA 1NHAA 3QAHA 1IF1A 2FOKA 3BJ6A 3WTVC 3GZ6A 4N9HA 5EEHA 2K4BA 2YR2A 5LRRA 3C3WA 2F5DA 3DV8A 5TJJA 1C0WA 3U2RA 4EJOA 5D4RA 4UVBA 3ZN0A 3K1PA 1J59A 1EH6A 1ZG5A 4M9ZA 4BHPA 1FSEA 1U8RA 1AOYA 3GW2A 3CDHA 6PAXA 4ZYHA 3FMQA 2A07F 1YW9A 2DFIA 4BQAA 4MEXF 3W6JB 2Z9OA 4WCGA 3TGNA 5HDKA 2KKOA 5LGTA 3ZQ7A 3QPTA 3REOA 2F5EA 2CSOA 4O6JA 2ZO4A 3K69A 4Q4ZF 1U3EM 1U5TA 5ERIA 4I01A 2XROA 1U6GA 5FFXA 2QQAA 1QZZA 4U0WA 3NRVA 2A5YB 4A6EA 5H6QA 2EA4A 3KLNA 1EH7A 4ENNA 1KU9A 2W25A 2M45A 3VEPA 1UFMA 3K2ZA 4JQFA 2F5FA 3F8NA 4CDGA 2FQ3A 2PLYA 2PMHA 1OR7A 2P5VA 2KIMA 2XRNA 2NNNA 3GUDA 2VC0A 3ZMSA 3WE3A 2QENA 2R7DA 3DEUA 1QPMA 3F21A 4I02A 2Q0OA 4AIKA 3F72A 3FM5A 1BN5A 3RPQA 2MH9A 3RYRA 1OYWA 4NHJA 4ENJA 3HSRA 1I5ZA 1XGSA 2R7FA 4M9XA 4NB5A 3JTHA 4M9SA 1Z9CA 4HX7A 1HSTA 3OOPA 2WV0A 2H27A 2DQLA 2D45A 3BY6A 3FXQA 1MKMA 2H94A 2VBWA 3CUQB 2HYGD 1YLFA 4DNCA 2JPBA 1FBQA 3C18A 4ZYGA 3V4GA 4MQ9F 2HQNA 3WTYC 2HKXA 2CO5A 4I7HA 1ZLKA 2DAOA 1XMKA 2FMLA 3WTSC 4XRFA 2EFOA 2XKPA 3RPUA 2JT1A 5DV5A 2FEZA 1G3SA 2ADUA 4BHBA 5JR3A 3EYIA 3GFIA 3JAMK 1D8KA 2STTA 1IN4A 4Y13A 2A69F 1ZRCA 4Q5SF 4LK0F 2KIUA 3F6VA 1R1TA 3WU1B 3I5UA 2M87A 3J7AO 3I54A 5D5WB 1DDNA 3M9AA 3MWMA 4BHCA 2XUBA 1V4RA 4P5OA 1FYKA 3FWEA 1P6RA 1KU7A 3IKVA 5KVRA 2FBHA 3BJOA 2FNPA 5DD8A 4ZH4F 4PCQA 1O3QA 5IT3A 1J75A 2DK8A 1L3LA 1TW2A 2ISZA 1W5SA 1Z05A 2CFXA 4YFKF 4UV8A 2PMUA 2W84A 1YTYA 4KN7X 3I58A 4HQMA 4HX4A 3WTXC 3LAJA 4A6DA 5FLXK 1FBSA 1QQIA 2G7UA 2O0YA 1YFHA 5JHUA 3TO9A 3JW4A 1T98A 3HIFA 1S3JA 4O3MA 2NYXA 2VONA 1HKTA 2CG4A 2HDCA 5D6EA 2DK5A 1XD7A 2ACJA 4IRIA 1ZRFA 4OIQF 2V9VA 2M8EA 5CVIA 3PQKA 4DQ2A 1ON2A 1FY7A 1I6XA 4L9NA 5ICFA 4XLNF 1REPC 4UVAA 4IPAA 2NAZA 2DPUA 2P5KA 4LLNA 4RB1A 3AAFA 5KK1A 1P4WA 3E3VA 4IHTA 4M73A 3FM3A 3FHZA 2UXXA 2ZCWA 3BZ6A 3MZYA 2EFPA 5HLHA 2ZMEA 3WTZA 2A6EF 3LA7A 2WTEA 2YPRA 3NEUA 3J80K 5FD6A 4AIHA 5E8GA 1BJAA 4GYGA 1J9IA 4XBFA 5CJ9A 2GWRA 3BDDA 2HOEA 1YO5C 4G7ZF 1YS7A 3IHUA 2FA5A 5HDGA 4LB6B 2QLZA 1B1BA 2K02A 4L9VA 3BP8A 2KJCA 2Z33A 1IXSB 1R7JA 5LEKA 3M8EA 4MQVA 3WGIA 3L9FA 4D0PA 1YG2A 3V8JA 4UHTA 5E1WA 2CW0F 4B09A 1Z6RA 1J5YA 5E18F 3V7CA 3KCCA 1F5TA 5L3FA 3QPHA 4RGRA 3MEXA 5D8KB 5F6FA 2P6SA 1IUYA 1SD7A 4KDPA 3E6BA 2F2EA 2V1DA 4OIRF 4G8XA 4KIFA 5IT9Z 3V8LA 2JSCA 2A61A 4Q48A 4Y17A 3MAJA 1T6SA 4L5JA 1WWXA 3SXYA 2ZBKA 4CHUA 3I64A 3R0JA 2XGXA 2IVMA 2E1CA 3IRRA 4GXOA 3HOTA 4O5VA 1D5VA 4LG0B 5CVJA 1P4XA 4HDUA 2MA3A 4RB3C 4A2UA 4RGXA 3ECHA 3FZVA 5FB2A 5TRDA 2XIGA 2PN6A 3S2WA 2KJBA 1FC3A 1RNLA 3KZYA 3HRUA 2G9WA 3GX4X 2GA2A 5E1XA 2ZJ2A 2QVOA 4MTEA 1MZBA 4IXAA 2QQ9A 3WE2A 4QLCU 2YU3A 1EH8A 1MD0A 2KRFA 4IHSA 2UZKA 5HDNA 4HW0A 4HDVA 2VXZA 3BPVA 4A0YA 2NS0A 2P7CB 4OOIA 3WG9A 1ONVA 4U88A 4LJZF 3L7WA 5DYMA 3WTTC 1IRGA 1L0OC 1MGTA 1T39A 1HW5A 3J81K 3JSOA 1STZA 1XB4A 4LG0A 3P7NA 3GO5A 4RAYA 2FU4A 4BYYA 1I27A 5LLQA 4LFUA 2PG4A 1V3FA 2PJPA 5ED4A 1UCRA 2L3DA 3TDZC 4MEYF 4N0BA 1TNTA 4HF1A 1XN7A 2OBPA 1SD5A 4MHGA 2P8TA 3F3XA 2EFWA 4K2EA 3V7RA 1USTA 4G6QA 2Y0MA 2CWEA 2ZFWA 4L9TA 4KICA 3C1DA 1MJ9A 1R22A 2GZWA 2EFNA 4HAMA 2H6CA 5K1YA 1FPQA 1SMTA 3GVAA 4L9JA 3TOBA 3JTGA 3HTUA 1R1UA 4B8XA 4HOBA 4ZZDA 4MTDA 1PDNC 3ABUA 1LEBA 1KQ8A 2DLLA 4U0YA 3WTUC 4LK1F 2X0LA 3QU3A 1IN5A 2OD5A 3SZTA 1XGOA 3VODA 4LMYA 1IN6A 1Z91A 3F22A 2STWA 3ABTA 2MBFA 1U2WA 2XAQA 4OMZA 3TQNA 3GZ5A 3EDPA 2XAGA 1RIOH 3FMSA 3KP7A 5LHIA 1Z1DA 4S05A 4UV9A 4RAZA 3GEZA 1S29A 2DI3A 3CUOA 2Z3YA 1SAXA 3I4PA 4Y15A 4XSXF 2XVCA 3SZPA 2D1HA 4P55A 3KP4A 1LDDA 1FLIA 5L3CA 3CTAA 3IWZA 2PFBA 1ZG1A 5AONA 2JZYA 1WKMA 1USSA 5JI6A 2HZTA 4RB0A 4U7DA 2KIFA 4I0AA 1T2KA 4YIIA 1T0FA 2LF7A 5D5VB 3GYHX 4CO8A 5D4SA 3KEQA 2GQQA 2IW5A 4GCVA 3RKYA 5DUKA 3FF5A 1IXCA 2ELHA 2IJLA 2MLKA 2OQRA 3LWFA 4PDKA 1KA8A 5JFRA 1K78B 3FXRA 3IRQA 5DCFA 2EWNA 3J81Z 2JTVA 5ICCA 4OIPF 5ILVA 4M72A 3MQ0A 1OMIA 2J5OA 1HW2A 3K1MA 3K9TA 1R5GA 2RC4A 1ZYRF 5FO5A 1S8NA 2DBBA 4KMUX 1GXQA 1K79A 3R60A 3MCZA 1X3UA 4UUVA 1BC8C 1D8JA 2VBXA 3T8RA 3FX3A 1WQ2A 5DUIA 4HA8A 4WXCA 1EV7A 4GO1A 2EV0A 2DU9A 2YX7A 1HKQA 3ZMVA 1FP2A 4ENMA 1FZPB 2XASA 1WRJA 2E1NA 1S6LA 1R58A 1J7KA 1PP8F 3HUGA 3KP5A 3QP6A 5FGMA 3ZMZA 2RDPA 4HBLA 4G7HF 5EEGA 1HW1A 2ETHA 2BGCA 2M1BA 4A0XA 4PZJA 4UNOA 3P9KA 3QP5A 3D5LA 1XGNA 2MH2A 2VC1A 1UB9A 3Q9SA 2TDXA 3IKTA 3GLXA 2ZXJA 3EETA 2W57A 5AIPA 5D5XB 1H9GA 1FSHA 2M5WA 5AIQA 1JHFA 5CYVA 2L01A 4WXDA 1HQCA 4FX0A 2GIVA 3H3ZA 3KEOA 1FYLA 1P4AA 2A6HF 2B0LA 2HEOA 1ZRDA 1WI9A 1AWCA 2XAHA 2RKHA 1QGPA 1F9NA 2CYYA 3P9CA 1FNNA 1G3YA 5LHGA 3LAPA 3GFLA 3TDUC 3L00A 3ZPLA 4KN4X 3RYPA 5CVUA 3OV8A 4L5IA 4CXFA 1YS6A 3J80Z 1QBJA 3CO7C 2ISYA 1FOKA 2VOOA 2BE5F 4RB2C 3DPTA 2VN2A 1QO0D 5ICGA 3H3UA 3B02A 5K5QA 4P9UA 2PQ8A 4A12A 5JVTA 2D1VA 2MLGA 2HFHA 3F23A 2IA0A 3F8BA 4AIJA 3F8FA 5DCMA 3BWGA 4I2OA 3GF2A 5HLGA 3F6OA 2QWWA 4UXNA 3GXOA 2Q2EA 3O6BB 1XSXA 3FXUA 5LRSA 1KU3A 4Q47A 1HXDA 1TLHB 4HLYA 1XSDA 2O61A 5L3DA 4OMYA 1XCBA 3ROUA 3LQRA 2VE8A 1S7OA 4KIGA 5LBQA 1OPCA 4QWQA 2HTJA 4JK1X 1FYMA 3QOPA 3SQNA 4ASNA 2F5CA 2A3SA 2DW4A 1LQ1A 2M30A 2EB7A 1ZH5A 2DPDA 5DD4A 3RIRA 2P5LC 3HTSB 2V1XA 2VODA 1A04A 1ZHFA 5LHHA 4A0ZA 3RDIA 1MJBA 3DP7A 2E7XA 3WGHA 4ZZLA 4HX8A 2L4MA 3K1NA 2WWYA 3RTRA 3O3KA 1Z7UA 4HYEA 2VBZA 3ULQB 1XSVA 5DCMB 4KFCA 5CVVA 1U78A 2XHKA 2FXAA 4EJWA 1UHMA 1DUXC 2HWVA 5HS9A 1BC7C 2EA2A 4OINF 1ON1A 2OQGA 3HHGA 3LFKA 5ILSA 1O3TA 2DO7A 3BPXA 2EV6A 2P6TA 3PFIA 4PGHA 5L3GA 5LEJA 2QM3A 2EJRA 3MZHA 3V8KA 1ZLJA 1YQAA 1YYVA 4G6DA 3VFZA 4AD9A 1GHCA 2V6CA 1KYWA 2DQRA 4EJUA 2EV5A 2QBYB 3GFMA 2FBKA 5BOXA 5DEQA 4UVCA 1O57A 2IPQX 3WGGA 3U9GA 1O3SA 1I1GA 5ILUA 2Y75A 3ELKA 5D8LB 1H0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R0A A;  3VOE A;  4A5N A;  3V7S A;  3CLO A;  1FX7 A;  1G3W A;  2QQB A;  4IRG A;  2XV4 S;  1R5H A;  3U1D A;  2WC2 A;  1MDM B;  4XSZ F;  2DTR A;  2W24 A;  5FFZ A;  2FRH A;  1JE8 A;  4CYD A;  2Y48 A;  5L3B A;  2AXL A;  5BS6 A;  2YSR A;  5E20 A;  4Z2Y A;  2O03 A;  1TQP A;  4ON0 A;  4EMS A;  4IRH A;  3KP3 A;  3SHF A;  2MC3 A;  3HOS A;  3BRO A;  2PEX A;  2LKP A;  1PP7 U;  2FMY A;  3MFK A;  1ZGJ A;  2V79 A;  4IF4 A;  1IN8 A;  1GXP A;  2K4J A;  2VE9 A;  2O6G E;  1DP7 P;  1MDM A;  4E70 A;  1O3R A;  4HZF A;  2OU2 A;  3E97 A;  3IWF A;  1IXR C;  1F1Z A;  2LNB A;  3R4K A;  1TTY A;  4WWC A;  1LEA A;  3N4M A;  3PQJ A;  3EUH A;  1LB2 A;  1W4M A;  4G9Y A;  1IZ1 A;  1SFX A;  1SMY F;  2X4H A;  1XDS A;  2CGP A;  1SFU A;  2QZ8 A;  5E17 F;  1BI2 A;  1BIB A;  5FLX Z;  1BI1 A;  3I53 A;  3FMR A;  3M1E A;  1W7P A;  3K0L A;  3TOA A;  2FSW A;  1O7L A;  5ICE A;  4R1H A;  3DPL C;  4ENK A;  3O2P E;  2OZ6 A;  2EK5 A;  5LGN A;  4TV7 A;  5CVR A;  4U7B A;  1J0R A;  2CQK A;  1G6N A;  1KU2 A;  2GAU A;  1Z6T A;  2IA2 A;  3I59 A;  3KP6 A;  2OA4 A;  3LA3 A;  2D2W A;  4I0B A;  1TNS A;  1FP1 D;  2COM A;  1W7P D;  2HKO A;  4CGZ A;  2K86 A;  1OKR A;  4HLX A;  1RUN A;  3DQV C;  1QNT A;  5FD5 A;  3IL2 A;  3ML6 A;  2RVC A;  2LSO A;  1P2F A;  5BPD A;  3DXJ F;  4NQW A;  1R23 A;  4EJV A;  1YIO A;  2MD5 A;  1FWZ A;  5IT9 K;  2HYF A;  2DT5 A;  4EM2 A;  5K5R A;  1UHW A;  4F7Z A;  4L18 B;  1LNW A;  3TO6 A;  2XAF A;  4CIC A;  5BPI A;  1BM9 A;  1IAW A;  3ISP A;  3ERE D;  4KIB A;  1IN7 A;  4YFN F;  4I98 B;  4YFX F;  4JBA A;  1JHH A;  3LQQ A;  3KFW X;  3IC7 A;  1HSJ A;  2EFQ A;  1CF7 A;  1Y0U A;  4EVI A;  5D5U B;  3JSP A;  2JPC A;  1ZAR A;  2XAJ A;  2BBY A;  2HGC A;  5F64 A;  4I09 A;  5L3E A;  1ZGA A;  2O3F A;  3VB2 A;  3ZMT A;  1LDK B;  3E6D A;  2LDU A;  2L54 A;  3KLO A;  1ZG3 A;  2Z5U A;  3ZN1 A;  1G4D A;  1LDJ A;  2GXB A;  2NNY A;  1T38 A;  1TQM A;  3CJN A;  1BIA A;  4OU0 A;  2VBY A;  5J6X A;  2UWM A;  4EGZ A;  3M7G A;  2ESN A;  4LLL A;  3R6S A;  1VTN C;  2Z99 A;  2QUF A;  3ZP5 A;  2RQP A;  4G94 A;  3QRF F;  3HRM A;  1XMA A;  4MNU A;  5HVQ C;  1CGP A;  2LF8 A;  1B9M A;  2VOP A;  1I1S A;  4EJT A;  4FT8 A;  4ETS A;  3T1B A;  4S04 A;  2IA1 A;  4BNC A;  2UXN A;  4AVP A;  5F1R A;  2L02 A;  3DKW A;  4IVN A;  2FNA A;  1FT9 A;  3GWZ A;  4M6Y A;  1RI7 A;  4EV0 A;  4M6X A;  5CLS A;  2RGV A;  1G3T A;  2FF4 A;  3T8T A;  2IP2 A;  1OYY A;  3KP2 A;  2P7V B;  4IJA A;  2O8X A;  3ECO A;  1O7F A;  5BMZ A;  5E8I A;  5K5O A;  3E6C C;  3W6K B;  2VT2 A;  1TQI A;  3LA2 A;  3R61 A;  4KNY A;  2VT3 A;  1BI3 A;  2HS5 A;  2XKO A;  4LLG F;  1RZ4 A;  4PGG A;  4R8H A;  1HBX G;  5J8F A;  3ZMD A;  5DDG A;  3I0T A;  3HYI A;  4H0E A;  1E17 A;  2PBI A;  4ESF A;  1OYI A;  4BAY A;  2FBI A;  3ZMU A;  5HS8 A;  2L4A A;  1ZN2 A;  4EQQ A;  1H9T A;  3LST A;  1YW7 A;  3RI4 A;  3I71 A;  2NRA C;  4WXH A;  4A5M A;  3E5U A;  1YW8 A;  1CF7 B;  4ZYD A;  3G3Z A;  2ESH A;  3KE2 A;  1LJ9 A;  2GXG A;  4ZYE A;  3TKY A;  1TBX A;  3H92 A;  4U0V A;  3BOQ A;  2K7L A;  1KGS A;  3HHH A;  2HQR A;  3DF8 A;  1XCV A;  1IRF A;  2HR3 A;  2ZNZ A;  4P96 A;  5H6R A;  5H20 A;  4YG2 F;  2ZNY A;  3DFG A;  1B4A A;  2V1U A;  3B73 A;  2G7H A;  3HSE A;  3WOD F;  4KT5 C;  3I59 B;  3Q9V A;  3RKW A;  2JRT A;  3G73 A;  3NQO A;  1SFE A;  3TO7 A;  1ZAO A;  1KQ9 A;  1BBY A;  2Q8K A;  1PUE E;  1RUO A;  2H09 A;  4GYI A;  3D0S A;  4AWX B;  4BXU A;  1DPR A;  3M8F A;  1U5T C;  1DPU A;  2C6Y A;  1SD4 A;  5D6F A;  5HS7 A;  1LVA A;  1ULY A;  3CUQ A;  3RJP A;  3KZZ A;  2IT0 A;  5A2Q K;  2AS5 F;  4RGS A;  1XGM A;  5E1Z B;  3Q5F A;  2E7W A;  3COA C;  3E5X A;  3C7J A;  4KMF A;  4HQE A;  3WU0 A;  1K78 A;  4BH9 A;  3GFJ A;  2QYO A;  1S7A A;  4P9F A;  3EYY A;  3HRT A;  2IRF G;  4EM1 A;  1R1V A;  3T5X A;  4HF2 A;  1D3Y A;  4WF2 A;  2BYV E;  3SFZ A;  5BQT A;  2FE3 A;  4L0Z B;  2PI0 A;  1BOA A;  1K7A A;  4HF0 A;  4FHT A;  4HV6 A;  1F4K A;  3RKX A;  3CUQ C;  1ODD A;  1GVJ A;  1QZY A;  1JGS A;  2OAZ A;  4WK8 F;  2W85 A;  4LB5 A;  1WSU A;  1BI0 A;  4M71 A;  4KUM A;  2J5P A;  4XLP F;  1JXS A;  4RS8 A;  1R00 A;  1MJA A;  1B59 A;  1E2X A;  4KYW A;  4ESJ A;  3BJA A;  2ZKZ A;  3E6M A;  3F8M A;  5LGU A;  4FX4 A;  2H6B A;  2RNJ A;  1XDU A;  3L2C A;  2RN7 A;  1P92 A;  1Q1H A;  1W7P B;  2ZME B;  3F8C A;  3N97 A;  4ESB A;  3EQL F;  2HTS A;  4EGY A;  1ZRE A;  2K27 A;  1J2X A;  1KYZ A;  1HKS A;  1U5T B;  1KQ0 A;  2GA1 A;  4L0Y B;  4LGW A;  4R79 A;  1B9N A;  4OIO F;  3P9I A;  4EM0 B;  4CZZ A;  2BEO A;  4N9I A;  4G7O F;  2P4W A;  3JAM Z;  1K6O A;  4GGG A;  5J8C A;  3KET A;  1TW3 A;  2BV6 A;  2A68 F;  5HLI A;  3T0Y A;  5HOO A;  3L09 A;  1FBU A;  4YIF A;  1W5T A;  2OZU A;  3CO6 C;  1R36 A;  4LD5 A;  4RGU A;  4M74 A;  2R3S A;  2RV8 A;  3HRS A;  3QU6 A;  4KA4 A;  4MGR A;  2QBY A;  3E5Q A;  4HV5 A;  5A2Q Z;  1IW7 F;  1SD6 A;  3WTW C;  2YX4 A;  4WX9 A;  1B6A A;  3HSF A;  1NHA A;  3QAH A;  1IF1 A;  2FOK A;  3BJ6 A;  3WTV C;  3GZ6 A;  4N9H A;  5EEH A;  2K4B A;  2YR2 A;  5LRR A;  3C3W A;  2F5D A;  3DV8 A;  5TJJ A;  1C0W A;  3U2R A;  4EJO A;  5D4R A;  4UVB A;  3ZN0 A;  3K1P A;  1J59 A;  1EH6 A;  1ZG5 A;  4M9Z A;  4BHP A;  1FSE A;  1U8R A;  1AOY A;  3GW2 A;  3CDH A;  6PAX A;  4ZYH A;  3FMQ A;  2A07 F;  1YW9 A;  2DFI A;  4BQA A;  4MEX F;  3W6J B;  2Z9O A;  4WCG A;  3TGN A;  5HDK A;  2KKO A;  5LGT A;  3ZQ7 A;  3QPT A;  3REO A;  2F5E A;  2CSO A;  4O6J A;  2ZO4 A;  3K69 A;  4Q4Z F;  1U3E M;  1U5T A;  5ERI A;  4I01 A;  2XRO A;  1U6G A;  5FFX A;  2QQA A;  1QZZ A;  4U0W A;  3NRV A;  2A5Y B;  4A6E A;  5H6Q A;  2EA4 A;  3KLN A;  1EH7 A;  4ENN A;  1KU9 A;  2W25 A;  2M45 A;  3VEP A;  1UFM A;  3K2Z A;  4JQF A;  2F5F A;  3F8N A;  4CDG A;  2FQ3 A;  2PLY A;  2PMH A;  1OR7 A;  2P5V A;  2KIM A;  2XRN A;  2NNN A;  3GUD A;  2VC0 A;  3ZMS A;  3WE3 A;  2QEN A;  2R7D A;  3DEU A;  1QPM A;  3F21 A;  4I02 A;  2Q0O A;  4AIK A;  3F72 A;  3FM5 A;  1BN5 A;  3RPQ A;  2MH9 A;  3RYR A;  1OYW A;  4NHJ A;  4ENJ A;  3HSR A;  1I5Z A;  1XGS A;  2R7F A;  4M9X A;  4NB5 A;  3JTH A;  4M9S A;  1Z9C A;  4HX7 A;  1HST A;  3OOP A;  2WV0 A;  2H27 A;  2DQL A;  2D45 A;  3BY6 A;  3FXQ A;  1MKM A;  2H94 A;  2VBW A;  3CUQ B;  2HYG D;  1YLF A;  4DNC A;  2JPB A;  1FBQ A;  3C18 A;  4ZYG A;  3V4G A;  4MQ9 F;  2HQN A;  3WTY C;  2HKX A;  2CO5 A;  4I7H A;  1ZLK A;  2DAO A;  1XMK A;  2FML A;  3WTS C;  4XRF A;  2EFO A;  2XKP A;  3RPU A;  2JT1 A;  5DV5 A;  2FEZ A;  1G3S A;  2ADU A;  4BHB A;  5JR3 A;  3EYI A;  3GFI A;  3JAM K;  1D8K A;  2STT A;  1IN4 A;  4Y13 A;  2A69 F;  1ZRC A;  4Q5S F;  4LK0 F;  2KIU A;  3F6V A;  1R1T A;  3WU1 B;  3I5U A;  2M87 A;  3J7A O;  3I54 A;  5D5W B;  1DDN A;  3M9A A;  3MWM A;  4BHC A;  2XUB A;  1V4R A;  4P5O A;  1FYK A;  3FWE A;  1P6R A;  1KU7 A;  3IKV A;  5KVR A;  2FBH A;  3BJO A;  2FNP A;  5DD8 A;  4ZH4 F;  4PCQ A;  1O3Q A;  5IT3 A;  1J75 A;  2DK8 A;  1L3L A;  1TW2 A;  2ISZ A;  1W5S A;  1Z05 A;  2CFX A;  4YFK F;  4UV8 A;  2PMU A;  2W84 A;  1YTY A;  4KN7 X;  3I58 A;  4HQM A;  4HX4 A;  3WTX C;  3LAJ A;  4A6D A;  5FLX K;  1FBS A;  1QQI A;  2G7U A;  2O0Y A;  1YFH A;  5JHU A;  3TO9 A;  3JW4 A;  1T98 A;  3HIF A;  1S3J A;  4O3M A;  2NYX A;  2VON A;  1HKT A;  2CG4 A;  2HDC A;  5D6E A;  2DK5 A;  1XD7 A;  2ACJ A;  4IRI A;  1ZRF A;  4OIQ F;  2V9V A;  2M8E A;  5CVI A;  3PQK A;  4DQ2 A;  1ON2 A;  1FY7 A;  1I6X A;  4L9N A;  5ICF A;  4XLN F;  1REP C;  4UVA A;  4IPA A;  2NAZ A;  2DPU A;  2P5K A;  4LLN A;  4RB1 A;  3AAF A;  5KK1 A;  1P4W A;  3E3V A;  4IHT A;  4M73 A;  3FM3 A;  3FHZ A;  2UXX A;  2ZCW A;  3BZ6 A;  3MZY A;  2EFP A;  5HLH A;  2ZME A;  3WTZ A;  2A6E F;  3LA7 A;  2WTE A;  2YPR A;  3NEU A;  3J80 K;  5FD6 A;  4AIH A;  5E8G A;  1BJA A;  4GYG A;  1J9I A;  4XBF A;  5CJ9 A;  2GWR A;  3BDD A;  2HOE A;  1YO5 C;  4G7Z F;  1YS7 A;  3IHU A;  2FA5 A;  5HDG A;  4LB6 B;  2QLZ A;  1B1B A;  2K02 A;  4L9V A;  3BP8 A;  2KJC A;  2Z33 A;  1IXS B;  1R7J A;  5LEK A;  3M8E A;  4MQV A;  3WGI A;  3L9F A;  4D0P A;  1YG2 A;  3V8J A;  4UHT A;  5E1W A;  2CW0 F;  4B09 A;  1Z6R A;  1J5Y A;  5E18 F;  3V7C A;  3KCC A;  1F5T A;  5L3F A;  3QPH A;  4RGR A;  3MEX A;  5D8K B;  5F6F A;  2P6S A;  1IUY A;  1SD7 A;  4KDP A;  3E6B A;  2F2E A;  2V1D A;  4OIR F;  4G8X A;  4KIF A;  5IT9 Z;  3V8L A;  2JSC A;  2A61 A;  4Q48 A;  4Y17 A;  3MAJ A;  1T6S A;  4L5J A;  1WWX A;  3SXY A;  2ZBK A;  4CHU A;  3I64 A;  3R0J A;  2XGX A;  2IVM A;  2E1C A;  3IRR A;  4GXO A;  3HOT A;  4O5V A;  1D5V A;  4LG0 B;  5CVJ A;  1P4X A;  4HDU A;  2MA3 A;  4RB3 C;  4A2U A;  4RGX A;  3ECH A;  3FZV A;  5FB2 A;  5TRD A;  2XIG A;  2PN6 A;  3S2W A;  2KJB A;  1FC3 A;  1RNL A;  3KZY A;  3HRU A;  2G9W A;  3GX4 X;  2GA2 A;  5E1X A;  2ZJ2 A;  2QVO A;  4MTE A;  1MZB A;  4IXA A;  2QQ9 A;  3WE2 A;  4QLC U;  2YU3 A;  1EH8 A;  1MD0 A;  2KRF A;  4IHS A;  2UZK A;  5HDN A;  4HW0 A;  4HDV A;  2VXZ A;  3BPV A;  4A0Y A;  2NS0 A;  2P7C B;  4OOI A;  3WG9 A;  1ONV A;  4U88 A;  4LJZ F;  3L7W A;  5DYM A;  3WTT C;  1IRG A;  1L0O C;  1MGT A;  1T39 A;  1HW5 A;  3J81 K;  3JSO A;  1STZ A;  1XB4 A;  4LG0 A;  3P7N A;  3GO5 A;  4RAY A;  2FU4 A;  4BYY A;  1I27 A;  5LLQ A;  4LFU A;  2PG4 A;  1V3F A;  2PJP A;  5ED4 A;  1UCR A;  2L3D A;  3TDZ C;  4MEY F;  4N0B A;  1TNT A;  4HF1 A;  1XN7 A;  2OBP A;  1SD5 A;  4MHG A;  2P8T A;  3F3X A;  2EFW A;  4K2E A;  3V7R A;  1UST A;  4G6Q A;  2Y0M A;  2CWE A;  2ZFW A;  4L9T A;  4KIC A;  3C1D A;  1MJ9 A;  1R22 A;  2GZW A;  2EFN A;  4HAM A;  2H6C A;  5K1Y A;  1FPQ A;  1SMT A;  3GVA A;  4L9J A;  3TOB A;  3JTG A;  3HTU A;  1R1U A;  4B8X A;  4HOB A;  4ZZD A;  4MTD A;  1PDN C;  3ABU A;  1LEB A;  1KQ8 A;  2DLL A;  4U0Y A;  3WTU C;  4LK1 F;  2X0L A;  3QU3 A;  1IN5 A;  2OD5 A;  3SZT A;  1XGO A;  3VOD A;  4LMY A;  1IN6 A;  1Z91 A;  3F22 A;  2STW A;  3ABT A;  2MBF A;  1U2W A;  2XAQ A;  4OMZ A;  3TQN A;  3GZ5 A;  3EDP A;  2XAG A;  1RIO H;  3FMS A;  3KP7 A;  5LHI A;  1Z1D A;  4S05 A;  4UV9 A;  4RAZ A;  3GEZ A;  1S29 A;  2DI3 A;  3CUO A;  2Z3Y A;  1SAX A;  3I4P A;  4Y15 A;  4XSX F;  2XVC A;  3SZP A;  2D1H A;  4P55 A;  3KP4 A;  1LDD A;  1FLI A;  5L3C A;  3CTA A;  3IWZ A;  2PFB A;  1ZG1 A;  5AON A;  2JZY A;  1WKM A;  1USS A;  5JI6 A;  2HZT A;  4RB0 A;  4U7D A;  2KIF A;  4I0A A;  1T2K A;  4YII A;  1T0F A;  2LF7 A;  5D5V B;  3GYH X;  4CO8 A;  5D4S A;  3KEQ A;  2GQQ A;  2IW5 A;  4GCV A;  3RKY A;  5DUK A;  3FF5 A;  1IXC A;  2ELH A;  2IJL A;  2MLK A;  2OQR A;  3LWF A;  4PDK A;  1KA8 A;  5JFR A;  1K78 B;  3FXR A;  3IRQ A;  5DCF A;  2EWN A;  3J81 Z;  2JTV A;  5ICC A;  4OIP F;  5ILV A;  4M72 A;  3MQ0 A;  1OMI A;  2J5O A;  1HW2 A;  3K1M A;  3K9T A;  1R5G A;  2RC4 A;  1ZYR F;  5FO5 A;  1S8N A;  2DBB A;  4KMU X;  1GXQ A;  1K79 A;  3R60 A;  3MCZ A;  1X3U A;  4UUV A;  1BC8 C;  1D8J A;  2VBX A;  3T8R A;  3FX3 A;  1WQ2 A;  5DUI A;  4HA8 A;  4WXC A;  1EV7 A;  4GO1 A;  2EV0 A;  2DU9 A;  2YX7 A;  1HKQ A;  3ZMV A;  1FP2 A;  4ENM A;  1FZP B;  2XAS A;  1WRJ A;  2E1N A;  1S6L A;  1R58 A;  1J7K A;  1PP8 F;  3HUG A;  3KP5 A;  3QP6 A;  5FGM A;  3ZMZ A;  2RDP A;  4HBL A;  4G7H F;  5EEG A;  1HW1 A;  2ETH A;  2BGC A;  2M1B A;  4A0X A;  4PZJ A;  4UNO A;  3P9K A;  3QP5 A;  3D5L A;  1XGN A;  2MH2 A;  2VC1 A;  1UB9 A;  3Q9S A;  2TDX A;  3IKT A;  3GLX A;  2ZXJ A;  3EET A;  2W57 A;  5AIP A;  5D5X B;  1H9G A;  1FSH A;  2M5W A;  5AIQ A;  1JHF A;  5CYV A;  2L01 A;  4WXD A;  1HQC A;  4FX0 A;  2GIV A;  3H3Z A;  3KEO A;  1FYL A;  1P4A A;  2A6H F;  2B0L A;  2HEO A;  1ZRD A;  1WI9 A;  1AWC A;  2XAH A;  2RKH A;  1QGP A;  1F9N A;  2CYY A;  3P9C A;  1FNN A;  1G3Y A;  5LHG A;  3LAP A;  3GFL A;  3TDU C;  3L00 A;  3ZPL A;  4KN4 X;  3RYP A;  5CVU A;  3OV8 A;  4L5I A;  4CXF A;  1YS6 A;  3J80 Z;  1QBJ A;  3CO7 C;  2ISY A;  1FOK A;  2VOO A;  2BE5 F;  4RB2 C;  3DPT A;  2VN2 A;  1QO0 D;  5ICG A;  3H3U A;  3B02 A;  5K5Q A;  4P9U A;  2PQ8 A;  4A12 A;  5JVT A;  2D1V A;  2MLG A;  2HFH A;  3F23 A;  2IA0 A;  3F8B A;  4AIJ A;  3F8F A;  5DCM A;  3BWG A;  4I2O A;  3GF2 A;  5HLG A;  3F6O A;  2QWW A;  4UXN A;  3GXO A;  2Q2E A;  3O6B B;  1XSX A;  3FXU A;  5LRS A;  1KU3 A;  4Q47 A;  1HXD A;  1TLH B;  4HLY A;  1XSD A;  2O61 A;  5L3D A;  4OMY A;  1XCB A;  3ROU A;  3LQR A;  2VE8 A;  1S7O A;  4KIG A;  5LBQ A;  1OPC A;  4QWQ A;  2HTJ A;  4JK1 X;  1FYM A;  3QOP A;  3SQN A;  4ASN A;  2F5C A;  2A3S A;  2DW4 A;  1LQ1 A;  2M30 A;  2EB7 A;  1ZH5 A;  2DPD A;  5DD4 A;  3RIR A;  2P5L C;  3HTS B;  2V1X A;  2VOD A;  1A04 A;  1ZHF A;  5LHH A;  4A0Z A;  3RDI A;  1MJB A;  3DP7 A;  2E7X A;  3WGH A;  4ZZL A;  4HX8 A;  2L4M A;  3K1N A;  2WWY A;  3RTR A;  3O3K A;  1Z7U A;  4HYE A;  2VBZ A;  3ULQ B;  1XSV A;  5DCM B;  4KFC A;  5CVV A;  1U78 A;  2XHK A;  2FXA A;  4EJW A;  1UHM A;  1DUX C;  2HWV A;  5HS9 A;  1BC7 C;  2EA2 A;  4OIN F;  1ON1 A;  2OQG A;  3HHG A;  3LFK A;  5ILS A;  1O3T A;  2DO7 A;  3BPX A;  2EV6 A;  2P6T A;  3PFI A;  4PGH A;  5L3G A;  5LEJ A;  2QM3 A;  2EJR A;  3MZH A;  3V8K A;  1ZLJ A;  1YQA A;  1YYV A;  4G6D A;  3VFZ A;  4AD9 A;  1GHC A;  2V6C A;  1KYW A;  2DQR A;  4EJU A;  2EV5 A;  2QBY B;  3GFM A;  2FBK A;  5BOX A;  5DEQ A;  4UVC A;  1O57 A;  2IPQ X;  3WGG A;  3U9G A;  1O3S A;  1I1G A;  5ILU A;  2Y75 A;  3ELK A;  5D8L B;  1H0M A; 
#chains in the Genus database with same CATH topology
 3R0A A;  1V5G A;  1CQT A;  3NAU A;  2B7E A;  3VOE A;  4A5N A;  3V7S A;  2VQC A;  1JGG A;  3CLO A;  1DU0 A;  4XMY A;  3TL4 X;  1FX7 A;  1G3W A;  4GRI A;  3SDG A;  2QQB A;  4IRG A;  3D5S C;  4M3D A;  3OIQ A;  2XV4 S;  1W0T A;  2K85 A;  5IYD J;  1R5H A;  3U1D A;  2WC2 A;  3FKJ A;  2BY0 A;  3JRC A;  2ZJQ F;  3CCR I;  5H2F C;  2BY3 A;  4YEJ A;  1D0Y A;  3CCY A;  3ZCO A;  3L2U A;  1MDM B;  5EYR A;  4XSZ F;  2DTR A;  1VND A;  2W24 A;  1D1B A;  3DTE A;  1LVK A;  1I50 J;  2FRH A;  1FMW A;  5FFZ A;  4CYD A;  1JE8 A;  3BCA A;  2CUE A;  4IOC F;  1KON A;  1QHH D;  2JWT A;  2JA8 J;  2MFZ A;  2Y48 A;  3QYF A;  5L3B A;  2QKL B;  4JX4 A;  3DLA A;  2X1C A;  3H9Q A;  1W36 C;  1PJR A;  2AXL A;  5BS6 A;  1JUP A;  4DBQ A;  2YSR A;  5E20 A;  4CH7 A;  4Z2Y A;  2O03 A;  1TQP A;  2JA2 A;  4ON0 A;  4EMS A;  2M2E A;  2BHZ A;  2KT0 A;  2AHQ A;  4IRH A;  3KP3 A;  3SHF A;  4XRS G;  3OYI A;  2VUM J;  1TL8 A;  2YS9 A;  2MC3 A;  3H0G J;  4KIT B;  5J1Y A;  3HOS A;  4BDY A;  3BRO A;  2PEX A;  2LKP A;  1PP7 U;  2FMY A;  3MFK A;  1ZGJ A;  2LTP A;  2IGN A;  2VIX A;  2V79 A;  1A36 A;  5EZH A;  3SFI A;  4IF4 A;  1IN8 A;  5J47 A;  1GXP A;  2K4J A;  5EZG A;  3CLQ A;  2VE9 A;  2O6G E;  1DP7 P;  3BZC A;  1MDM A;  3CMA I;  4E70 A;  4M3B A;  1PUF A;  2XPV A;  1PUF B;  2R0Q C;  5F08 A;  1VQ5 I;  1X1A A;  1O3R A;  4BBR J;  9ANT A;  1T95 A;  1POG A;  4HZF A;  2OU2 A;  2F6C A;  1UJ8 A;  5E3M A;  3E97 A;  3IWF A;  3MKL A;  1IXR C;  2A05 A;  1F1Z A;  5GAG J;  2BXY A;  2I8D A;  2LNB A;  3R4K A;  1TTY A;  2E5Z A;  1V5F A;  4WWC A;  1LEA A;  3N4M A;  5KHD A;  3PQJ A;  2LY1 A;  3EUH A;  3CCS I;  1W4M A;  1LB2 A;  3OOU A;  3CCQ I;  1E3P A;  4G9Y A;  5J1U A;  2DA1 A;  1IZ1 A;  1SFX A;  1SMY F;  2DJN A;  2X4H A;  3OSF A;  1XDS A;  3BG6 A;  2CGP A;  1SFU A;  2LD5 A;  4V2F A;  2QZ8 A;  2LLK A;  2CUZ A;  5E17 F;  1BI2 A;  1ENH A;  2I10 A;  1BIB A;  4CYC A;  2IS1 A;  5FLX Z;  1BI1 A;  3I53 A;  3FMR A;  3M1E A;  4YEL A;  1W7P A;  3J7A Y;  3K0L A;  3H5A A;  2VB6 A;  3TOA A;  2FSW A;  4LIU A;  5DTD A;  1O7L A;  1OQY A;  5ICE A;  4R1H A;  3DPL C;  4ENK A;  2DOD A;  3O2P E;  4DW6 A;  2BVL A;  2R7Q A;  2L9R A;  2OZ6 A;  2EK5 A;  3CDL A;  5LGN A;  4TV7 A;  5CVR A;  1UHS A;  4U7B A;  1J0R A;  2CQK A;  4DIQ A;  3AL0 C;  1G6N A;  3OSG A;  3GTP J;  1KU2 A;  2LRE A;  2GAU A;  1X1B A;  2I5U A;  3EPZ A;  5K7H A;  1FTZ A;  1Z6T A;  2IA2 A;  3I59 A;  3KP6 A;  1T33 A;  2OF7 A;  2OA4 A;  3LA3 A;  3ZGK A;  4CCM A;  2D2W A;  4I0B A;  1TNS A;  3DWL E;  1B8I A;  1LE8 B;  3ONQ A;  1K61 A;  1FP1 D;  3U21 A;  2COM A;  2HVQ A;  5JHF A;  5CKT A;  1W7P D;  2LFB A;  4BAC A;  2EIK H;  4IOA F;  2HKO A;  4CGZ A;  4E7L A;  2K86 A;  1OKR A;  4HLX A;  1RUN A;  3DQV C;  2KZG A;  4F93 B;  1QNT A;  1QRY A;  5FD5 A;  3QYE A;  3IL2 A;  3OYH A;  4BXF A;  4F55 A;  2CV2 A;  3IH3 A;  5EF6 A;  3ML6 A;  2L7M P;  2RVC A;  2JJ7 A;  1S9H A;  2ZME C;  1K83 J;  5B1B H;  3FBI B;  2V26 A;  2LSO A;  5FKN A;  4UY8 I;  1ITY A;  3WHC A;  1P2F A;  5BPD A;  3DXJ F;  4NQW A;  1R23 A;  4NQW B;  4FET A;  4EJV A;  3VSL A;  2XGE A;  4KIS A;  4RA2 A;  1YIO A;  2MD5 A;  2QSH X;  1FWZ A;  5IT9 K;  2HYF A;  2DT5 A;  4EM2 A;  4BEH A;  4B1R A;  1B72 B;  5K5R A;  1UHW A;  2KRH A;  4F7Z A;  4L18 B;  1LNW A;  3LSP A;  1K4S A;  2LOO A;  2XF7 A;  2ECB A;  5GAH J;  1OCR H;  3TO6 A;  2UUZ A;  2XAF A;  3FDY A;  5TIS C;  4CIC A;  3SYT A;  5BPI A;  1UMQ A;  3CCV I;  1BM9 A;  3S8P A;  5M3M J;  1IAW A;  1ZK8 A;  3ISP A;  3ERE D;  1MMA A;  4KIB A;  3DEE A;  4OAZ A;  1IN7 A;  2WAE A;  4I98 B;  3ZXS A;  4YFX F;  4YFN F;  4JBA A;  4AC0 A;  1JHH A;  3LQQ A;  3KFW X;  3IC7 A;  3ZQL A;  5F0C A;  1HSJ A;  3VYS B;  2EFQ A;  1CF7 A;  1Y0U A;  1IG7 A;  1WZ2 A;  4EVI A;  2R5Z B;  3BTI A;  5D5U B;  3JSP A;  1HLV A;  2JPC A;  3GZN B;  3LSR A;  1ZAR A;  2XAJ A;  2XPU A;  2LP0 A;  4PFP A;  4IKF A;  1RRJ A;  2BBY A;  2HGC A;  1H8A C;  5F64 A;  4I09 A;  1HDP A;  5L3E A;  4BE0 A;  1ZGA A;  3OYF A;  2O3F A;  2K5C A;  3VB2 A;  2H1K A;  2FUG 2;  3ZMT A;  1BW5 A;  1VFC A;  3S3M A;  2MGQ A;  1LDK B;  4M3G A;  3E6D A;  2LDU A;  2L54 A;  3CME I;  1H0M A;  3KLO A;  2Z5U A;  1ZG3 A;  1Y56 A;  3ZN1 A;  2HQA A;  2L2O A;  4ZTF A;  4DOZ A;  2KQR A;  3HKZ N;  1G4D A;  1LDJ A;  1I6H J;  4MLO A;  5IP9 J;  1WH5 A;  2BVM A;  4AID A;  2EZH A;  4PJ0 C;  2O7O A;  2GXB A;  5IY5 H;  1JKP C;  4MIM A;  3GME A;  2NNY A;  1T38 A;  1TQM A;  3CJN A;  4DZJ A;  1BIA A;  4H4K C;  1MMN A;  4OU0 A;  2M4K A;  2VBY A;  3HB9 A;  5J6X A;  2UWM A;  4EEF G;  1P9Q C;  1QZE A;  4EGZ A;  3CQZ J;  3M7G A;  1R6R A;  2ESN A;  2HQ5 A;  4LLL A;  2M4G A;  3J7Z I;  1WJA A;  2ZB9 A;  3UR3 C;  3R6S A;  1W5C C;  1VTN C;  2Z99 A;  3A02 A;  2QUF A;  2E1O A;  4UB8 C;  2R4G A;  4E7Z A;  2DJI A;  3ZP5 A;  3F9K A;  2ELK A;  2RQP A;  4G94 A;  3QRF F;  4IHY A;  3HRM A;  1XMA A;  2E34 A;  4MNU A;  3D1N I;  4XN3 A;  3CCM I;  2X1D A;  5HVQ C;  1CGP A;  3FXK A;  2GBY A;  2LF8 A;  1B9M A;  2VOP A;  1I1S A;  2OV7 A;  2Z16 A;  2DA3 A;  4EJT A;  4FT8 A;  4ETS A;  3T1B A;  4BDZ A;  5C3E J;  1GDT A;  2RAE A;  2R7Z J;  1ETW A;  2KIS A;  2VJI A;  2K3F A;  4S04 A;  2IA1 A;  2XAU A;  2K3P A;  2XF5 A;  4BNC A;  2UXN A;  2V9K A;  2JVG A;  1AA7 A;  2VQG A;  4AVP A;  3S1Q J;  2VAS A;  2VPR A;  5F1R A;  2L02 A;  4XKB A;  4ZJZ A;  2P81 A;  2VLA A;  3DKW A;  4BJ6 C;  4IVN A;  3HEF A;  2FNA A;  1FT9 A;  3IP4 B;  4J19 A;  3GWZ A;  4M6Y A;  5M3F J;  1RI7 A;  4EV0 A;  1T8I A;  4M6X A;  2OPT A;  4CUG A;  5CLS A;  2RGV A;  4FE4 A;  1XC5 A;  1G3T A;  2FF4 A;  2DCE A;  2LH9 A;  3T8T A;  2IP2 A;  5IPA A;  1YIT I;  1OYY A;  3KP2 A;  2P7V B;  3SEZ A;  4IJA A;  2O8X A;  3ECO A;  1O7F A;  1R5I D;  1X4P A;  2F4I A;  3PSF A;  5BMZ A;  5E8I A;  2KHM A;  3H9J A;  5K5O A;  3E6C C;  5JVG F;  3RZO J;  2HXO A;  1IUF A;  3IAM 2;  2OTL I;  3W6K B;  2VT2 A;  3HOZ J;  1TQI A;  1TT0 A;  3LA2 A;  3R61 A;  1H89 C;  4KNY A;  2VT3 A;  5IYC J;  3HOV J;  1BI3 A;  3HOW J;  2HS5 A;  2XKO A;  1FOX A;  4LLG F;  1RZ4 A;  2BZT A;  4ABZ A;  4PGG A;  4R8H A;  1HBX G;  1EF4 A;  5J8F A;  3ZMD A;  4A3M J;  3CDI A;  5DDG A;  3I0T A;  4G12 A;  3HYI A;  1F36 A;  3PO2 J;  4UUS A;  4H0E A;  1E17 A;  1JKR C;  2PBI A;  4ESF A;  1OYI A;  2EPF A;  4A3C J;  1JJ6 C;  3M07 A;  1LE8 A;  4IZZ A;  4BAY A;  2DYR H;  1Q1V A;  4JYK A;  2FBI A;  3HPG A;  2X6O A;  3ZMU A;  4RLF A;  5HS8 A;  2R7T A;  2L4A A;  1ZN2 A;  4BE2 A;  4EQQ A;  1H9T A;  3LST A;  1YW7 A;  3RI4 A;  3I71 A;  3IH2 A;  4P1W A;  2NRA C;  1ZKG A;  4WXH A;  3E5U A;  4A5M A;  1YW8 A;  3JRB A;  3OYA A;  3E7L A;  2L9S A;  1CF7 B;  4ZYD A;  4PUS A;  2N8G A;  3G3Z A;  2ESH A;  5CPR B;  3GLL A;  2Y31 A;  3KE2 A;  1LJ9 A;  2GXG A;  2MC4 A;  3TKY A;  4ZYE A;  1TBX A;  5E3N A;  3UKG A;  3TED A;  2JA6 J;  3LSH A;  3H92 A;  4U0V A;  5EG0 A;  3CF5 F;  1BR1 A;  3BOQ A;  5GTI C;  3CMM A;  2K7L A;  5KAI C;  1KGS A;  3HHH A;  2HQR A;  3OS1 A;  3DF8 A;  1XCV A;  1IRF A;  3RPU D;  2E1M C;  2O9L A;  1E3O C;  2LYC A;  2HR3 A;  2LBF A;  2VKV A;  2ZNZ A;  4P96 A;  5H6R A;  5H20 A;  4YG2 F;  2ZNY A;  3DFG A;  4HRI A;  3Q3S A;  4ZYA A;  1B4A A;  3RQI A;  3G4S I;  2V1U A;  3B73 A;  2G7H A;  4BQQ A;  3QPS A;  3PNT A;  3HSE A;  3FIS A;  3WOD F;  2P0W A;  4KT5 C;  3I59 B;  3FK7 A;  3Q9V A;  2HXI A;  2NVX J;  1E3H A;  1XTA A;  2JRM A;  2KDO A;  3BTJ A;  3RKW A;  2JRT A;  3G73 A;  3NQO A;  1SFE A;  1T08 B;  3TO7 A;  1ZAO A;  1KQ9 A;  2BXZ A;  1BBY A;  2IXS A;  2Q8K A;  1RC9 A;  4FE7 A;  1PUE E;  1RUO A;  3E0J B;  2CQQ A;  2DDB A;  2H09 A;  1OR7 C;  4GYI A;  3D0S A;  1VQO I;  4AWX B;  4BXU A;  1DPR A;  3M8F A;  1U5T C;  4X1E A;  2JN6 A;  3C2G A;  1DPU A;  5FLM J;  2C6Y A;  2E36 A;  2VKD A;  1SD4 A;  1U8B A;  5GPA A;  1UG2 A;  5D6F A;  5HS7 A;  1MMS A;  1LVA A;  1ZGW A;  4J01 A;  4IX7 A;  1ULY A;  3LFU A;  2BW3 A;  2E5N A;  2Y69 H;  3CUQ A;  3RJP A;  1H88 C;  1U9O A;  3KZZ A;  4LIV A;  3ZQC A;  3BC8 A;  1I3A A;  2IT0 A;  5A2Q K;  4QPO A;  2DFE A;  3DTK A;  2AS5 F;  4RGS A;  3DLL F;  1XGM A;  5JLX A;  5E1Z B;  3Q5F A;  1BW6 A;  2R7X A;  1SVM A;  2E7W A;  3COA C;  3E5X A;  3C7J A;  4KMF A;  2K9N A;  2A5W A;  3BTC A;  2PJR A;  3K4L A;  2ZC2 A;  4BXX J;  2KFD A;  4I76 A;  3CES A;  1IRZ A;  2DDA A;  4HQE A;  3Q0V A;  3WU0 A;  2FJ1 A;  4RBO A;  1K78 A;  4BH9 A;  3GFJ A;  4RM2 A;  4ZDL A;  2QYO A;  4NNJ A;  1S7A A;  4P9F A;  1PVE A;  4CCO A;  1MBG A;  2Y30 A;  2W48 A;  3EYY A;  3HRT A;  2IRF G;  4EM1 A;  4JX6 A;  3U1K A;  3H5R A;  1R1V A;  3T5X A;  4RDU A;  3GTG J;  3FBN B;  4HF2 A;  2WAF A;  3N05 A;  1D3Y A;  3FHN A;  3KPH A;  4WF2 A;  2BYV E;  2L7K A;  3SFZ A;  4F3Q A;  2FE3 A;  5BQT A;  4L0Z B;  2PI0 A;  1MNM C;  2VXD A;  4HG2 A;  1BOA A;  1K7A A;  4DYR A;  1P7I A;  1A6Q A;  4HF0 A;  4FHT A;  2E60 A;  2XB5 A;  4HV6 A;  3V42 A;  1F4K A;  3RKX A;  4FTH A;  3H9G A;  1DGW Y;  3CUQ C;  3K7A J;  3PIO F;  1ODD A;  3BQY A;  4C3J J;  1GVJ A;  1QZY A;  3QPL A;  1G2H A;  3MVP A;  1JGS A;  2OAZ A;  2DMU A;  4Y52 J;  4WK8 F;  2V1N A;  3I3L A;  3E1S A;  4E7S A;  1FTT A;  3EUK L;  2W85 A;  4AYB N;  1X1C A;  2CS3 A;  4LB5 A;  3HOX J;  1WSU A;  1BI0 A;  5FKL A;  4M71 A;  1TC3 C;  4KUM A;  2J5P A;  4XLP F;  3HOU J;  1JXS A;  2L7F P;  2XRL A;  4RS8 A;  5J40 A;  1R00 A;  3MMY B;  4C3I J;  1MJA A;  2VI6 A;  1B59 A;  1Y0N A;  5IYB J;  2WBM A;  2XPW A;  2Q2E B;  1E2X A;  2KDZ A;  3K70 D;  1A6I A;  1KZH A;  4KYW A;  4ESJ A;  4DYQ A;  3BJA A;  2ZKZ A;  3FXL A;  3E6M A;  3F8M A;  5J3L A;  5LGU A;  3HUG B;  3K6G A;  4FX4 A;  2A6T A;  3CZ6 A;  3X2Q H;  1VQP I;  2R7V A;  2H6B A;  4LG3 A;  2L9N A;  3S2D J;  2RNJ A;  1XDU A;  5HLT A;  3K10 A;  1PYV A;  4FCY A;  3L2C A;  2RN7 A;  1MMD A;  1P92 A;  1Q1H A;  1S72 I;  4AM3 A;  1W7P B;  2ZME B;  3H5N A;  3F8C A;  4XRS A;  4ESB A;  2QF7 A;  3N97 A;  2BW3 B;  3EQL F;  5CQE A;  1HOM A;  3S1M J;  1ETY A;  2HTS A;  4EGY A;  2EZI A;  2LR8 A;  4C9Y A;  5C4J J;  1ZRE A;  2K27 A;  1Y1W J;  2ID3 A;  2NVT J;  4UUT A;  1J2X A;  2Z2S B;  2VJJ A;  1KYZ A;  4D5C A;  1HKS A;  1U5T B;  1KQ0 A;  2GA1 A;  4L0Y B;  3LNQ A;  3S17 J;  1GVD A;  4LGW A;  3LSG A;  4R79 A;  1B9N A;  4OIO F;  3P9I A;  4IQ4 A;  4EM0 B;  2BY2 A;  1IDY A;  3BG5 A;  3DCF A;  4NUB A;  4CZZ A;  2BEO A;  3HL2 A;  4N9I A;  4G7O F;  2P4W A;  3A2K A;  4RAF A;  3JAM Z;  2LKS A;  1WPK A;  1K6O A;  4GGG A;  5J8C A;  3KET A;  4CSW A;  1TW3 A;  2BV6 A;  2A68 F;  4KT6 A;  3VYR B;  1SVL A;  3L1P A;  3OYG A;  5HLI A;  4A69 C;  3T0Y A;  2XSJ C;  5K7Z A;  4CZC A;  5HOO A;  2DFH A;  3L09 A;  4BY1 J;  1FBU A;  4YIF A;  1W5T A;  2OZU A;  3JRF A;  3CO6 C;  1R36 A;  1APL C;  4XK4 A;  3W3C A;  4LD5 A;  1Y8R B;  4M74 A;  4RGU A;  2R3S A;  2RV8 A;  3CC2 I;  3AG4 H;  1XPX A;  3QWL A;  3HRS A;  3LSM A;  3HOY J;  3QU6 A;  4XKV A;  2JMW A;  3GTK J;  1QPI A;  4KA4 A;  2DA7 A;  4MGR A;  2QBY A;  3E5Q A;  2JA5 J;  4HV5 A;  1LKX A;  4C2M J;  1IW7 F;  1SD6 A;  5A2Q Z;  3JRD A;  1SAU A;  1EJ9 A;  5CQG A;  4Y33 A;  3WTW C;  5F04 A;  2YX4 A;  4WX9 A;  4PSX A;  3KX2 A;  1B6A A;  3HSF A;  1NHA A;  3QAH A;  1FJL A;  1IF1 A;  3S3N A;  2FOK A;  3BJ6 A;  3WTV C;  4B4C A;  1IJW C;  5IOZ A;  1UG0 A;  4HNV A;  5KAF C;  4A3J J;  3M8J A;  3GZ6 A;  3A0H C;  4N9H A;  3KIO A;  5EEH A;  2K4B A;  2FOW A;  2KRC A;  2YR2 A;  3A03 A;  5LRR A;  3RKQ A;  1S5L C;  3AG2 H;  1MIJ A;  2WAQ A;  3CF2 A;  3C3W A;  2F5D A;  3DV8 A;  2DMP A;  1T0F C;  5M5W J;  2RRE A;  1NK2 P;  5TJJ A;  1C0W A;  1VF9 A;  2WB1 N;  3U2R A;  4BU2 A;  4EJO A;  3BT9 A;  5D4R A;  2EIJ H;  3LSI A;  3I56 I;  4UVB A;  3ZN0 A;  3K1P A;  1J59 A;  1EH6 A;  1ZG5 A;  4M9Z A;  4QPQ A;  4BHP A;  3H0D A;  1FSE A;  3HZJ A;  4N4O B;  1U8R A;  1AOY A;  3OL3 A;  3K4C A;  3GW2 A;  1UAA A;  1ZQ3 P;  3S1N J;  3CDH A;  6PAX A;  2QEX I;  2M3A A;  4ZYH A;  4BGD A;  3FMQ A;  1S7E A;  2A07 F;  1YW9 A;  2PMZ N;  1WJE A;  1G59 A;  2MYS A;  1WI3 A;  4IQJ A;  4YIR X;  4A93 J;  2DFI A;  2NXN B;  2LKX A;  1N75 A;  4BQA A;  4MEX F;  3W6J B;  3AG1 H;  2Z9O A;  4D1Q A;  1TT5 B;  3TGN A;  4WCG A;  5HDK A;  2KKO A;  5LGT A;  3ZQ7 A;  3QPT A;  3JRI A;  3REO A;  1VQM I;  1Z3Y A;  2F5E A;  2CSO A;  4O6J A;  4PJN A;  2ZO4 A;  1GV2 A;  2VQH A;  4B3A A;  3K69 A;  2WB1 A;  4U87 A;  4E7I A;  4XQF A;  4Q4Z F;  3TBI A;  1U3E M;  1A31 A;  1U5T A;  1D0X A;  5ERI A;  1FIP A;  4I01 A;  4FIS A;  2XRO A;  3FK6 A;  2ELJ A;  1GUU A;  2CU7 A;  1U6G A;  5DM6 F;  5FFX A;  2QQA A;  3A01 B;  1QZZ A;  4U0W A;  1DU6 A;  3PSI A;  3AG3 H;  1MND A;  3BLY A;  2IS2 A;  3PUF A;  3NRV A;  2JVH A;  3O8H A;  2A5Y B;  4XOT A;  3M1C A;  4A6E A;  5H6Q A;  2EA4 A;  4B3X A;  3KLN A;  3LSJ A;  1EH7 A;  4ENN A;  3BR3 A;  1KU9 A;  1MH4 A;  2W25 A;  3AFH A;  2R7U A;  2M45 A;  1MH3 A;  3VEP A;  2X85 A;  1EKE A;  1UFM A;  2V6E A;  5FLV A;  3PL8 A;  3HDD A;  3K2Z A;  4JQF A;  2F4M B;  2F5F A;  1VQ7 I;  3ABM H;  3F8N A;  2E2J J;  4CDG A;  1R9T J;  5FKM A;  1D1A A;  4LIT A;  3JRE A;  2FQ3 A;  2R5Y A;  1W1W E;  2PLY A;  2PMH A;  2X51 A;  1OR7 A;  2P5V A;  3Q0W A;  2KIM A;  2XRN A;  2M8G X;  2NNN A;  3GUD A;  2VC0 A;  4NC6 A;  4XLC A;  2BY1 A;  3ZMS A;  3BR1 A;  1JJ8 C;  4DZP A;  3BG9 A;  3WE3 A;  4II3 A;  1OJL A;  1QA6 A;  2QEN A;  2R7D A;  3DEU A;  5IP7 J;  2DOF A;  1QPM A;  3F21 A;  4I02 A;  2Q0O A;  4AIK A;  2K9Q A;  3FM5 A;  3F72 A;  1BN5 A;  3RPQ A;  2MH9 A;  2QKM B;  3RYR A;  1OYW A;  4NHJ A;  4ENJ A;  2JUC A;  1FMV A;  3HSR A;  1VI0 A;  2JSP A;  1I5Z A;  1XGS A;  2DTZ A;  3DU5 A;  4BJT A;  2R7F A;  4M9X A;  5DS9 A;  2O5R A;  2MD0 A;  4NB5 A;  3W2W A;  4NC8 A;  2OJE D;  3JTH A;  4M9S A;  3QQA A;  1Z9C A;  4JX5 A;  4HX7 A;  5IOY A;  1HST A;  1HA8 A;  3OOP A;  2YUS A;  2WV0 A;  2H27 A;  1X1P A;  1W0U A;  2DQL A;  2D45 A;  2IEK A;  2L5Q A;  3BY6 A;  1XS9 A;  3FXQ A;  4CYC B;  2E2H J;  4D9J A;  1MKM A;  1SC7 A;  5E79 C;  2H94 A;  2VBW A;  3VPR A;  3AL0 B;  1FOY A;  1NTC A;  1Z67 A;  3CUQ B;  2XF6 A;  2HYG D;  4B43 A;  1YLF A;  2HDD A;  4BY7 J;  3ZQF A;  3UNG C;  4DNC A;  2JPB A;  1FBQ A;  5LFA A;  4ITV A;  3C18 A;  4E7H A;  1RR8 C;  2G0E A;  2KIQ A;  4W1U A;  4XNF A;  4ZYG A;  3V4G A;  4MQ9 F;  2HQN A;  3WTY C;  3OIO A;  2LK2 A;  2HKX A;  2CO5 A;  3DU6 A;  1LPQ A;  1A35 A;  4I7H A;  2HI3 A;  1W36 D;  4CCJ A;  3CP8 A;  2R7W A;  1ZLK A;  2DAO A;  1XMK A;  2FML A;  4HNT A;  3WTS C;  4XRF A;  4M3E A;  2EFO A;  1TWH J;  2XKP A;  3RPU A;  2HOS A;  2JT1 A;  5FRM A;  1U9N A;  2TCT A;  5DV5 A;  3W2V A;  2FEZ A;  1WVR A;  1G3S A;  5FKK A;  4RAG A;  3RCO A;  3VYT B;  4Y4R A;  2ADU A;  4BHB A;  5JR3 A;  1WGX A;  3EYI A;  3GFI A;  3JAM K;  1ZEL A;  3PM1 A;  1D8K A;  2STT A;  1X1D A;  1IN4 A;  1IDZ A;  4Y13 A;  2A69 F;  1ZRC A;  4Q5S F;  4LK0 F;  4W97 A;  5JLW A;  2KIU A;  3IUO A;  3SJM A;  3F6V A;  2CH0 A;  1R1T A;  2Y9Z A;  3WU1 B;  2IS6 A;  3I5U A;  2L0K A;  3KYC B;  1I3Q J;  2M87 A;  5GPC A;  3J7A O;  3I54 A;  3J7Y J;  3MZ8 A;  5D5W B;  3OYL A;  2M0M A;  5FRO A;  2X1E A;  1JUM A;  1DDN A;  3M9A A;  1SFO J;  3MWM A;  3EUH C;  4BHC A;  4UB6 C;  2XUB A;  1V4R A;  4P5O A;  1FYK A;  3FWE A;  3OR1 C;  1P6R A;  2D5V A;  1RES A;  1KU7 A;  3IKV A;  5KVR A;  2FBH A;  3BJO A;  2FNP A;  5DD8 A;  4ZH4 F;  4PCQ A;  1OIS A;  2IGO A;  1O3Q A;  1T56 A;  3S14 J;  2VL8 A;  5IT3 A;  4JOM A;  1J75 A;  2GM4 A;  2DK8 A;  1L3L A;  1TW2 A;  2ISZ A;  1W5S A;  2NOG A;  2DN0 A;  3PO3 J;  1Z05 A;  2CFX A;  5EGO A;  4A3L J;  1N25 A;  1GV5 A;  1YJN I;  4X0G A;  4YFK F;  4UV8 A;  2PMU A;  2W84 A;  1ETK A;  1YRN B;  2EH3 A;  1YTY A;  4IHV A;  1VQ9 I;  4D7N A;  5J1R A;  4KN7 X;  2H1L A;  2LY9 A;  3BCB A;  3I58 A;  4HQM A;  4HX4 A;  4QTR A;  3WTX C;  3LAJ A;  4A6D A;  5FLX K;  1WJB A;  2NOJ B;  2Q1Z B;  1FBS A;  1QQI A;  2G7U A;  2O0Y A;  1YFH A;  2HU9 A;  1ETQ A;  2MAB A;  3D5R C;  4OWR B;  2V9P A;  3C2B A;  4CCK A;  4XIC A;  5JHU A;  4XLA A;  2E2I J;  3TO9 A;  1WJ5 A;  3JW4 A;  1T98 A;  4B48 A;  3HIF A;  3MKW B;  1S3J A;  4O3M A;  2VKE A;  2NYX A;  4PJL A;  3L2V A;  2HZD A;  2IGK A;  2VON A;  1HKT A;  2CG4 A;  1YE9 A;  2HDC A;  4XLH A;  5D6E A;  2PJR B;  2DK5 A;  1YJW I;  1TWG J;  1XD7 A;  3SZG A;  2ACJ A;  4IRI A;  4Z6Y A;  1JTY A;  1ZRF A;  4OIQ F;  2CRG A;  2V9V A;  1A5J A;  2M8E A;  5CVI A;  2ME6 A;  4B47 A;  2HOT A;  1N78 A;  1KQ8 A;  4B44 A;  5C4X J;  4RLQ A;  3PQK A;  4I6Z A;  2BOL A;  4DQ2 A;  5HNF A;  1SAN A;  1ON2 A;  3MKY B;  2KZV A;  1U0J A;  5B5E C;  3F0C A;  1FY7 A;  1OCT C;  3K2A A;  3LOC A;  1I6X A;  4ZTJ A;  3A4C A;  3OYE A;  1RKT A;  4L9N A;  5ICF A;  1VQ4 I;  4XLN F;  1REP C;  3I4M J;  2ICW G;  4UVA A;  4IPA A;  2NAZ A;  2WA0 A;  2P5K A;  2R5Y B;  2DPU A;  4RB1 A;  1Z0X A;  4LLN A;  3AAF A;  5KK1 A;  1P4W A;  3ASN H;  3E3V A;  1R4N B;  4IHT A;  4F91 B;  4M73 A;  2CW8 A;  3FXM A;  3FM3 A;  3G71 I;  2IS4 A;  3DKX A;  2HDW A;  3FHZ A;  4BS9 A;  2UXX A;  3ZOB A;  1FOW A;  3C2H A;  2ZCW A;  3BZ6 A;  3MZY A;  2F48 A;  4BL0 B;  4BBS J;  2EFP A;  5HLH A;  2NS7 A;  3MD2 A;  2ZME A;  3NWS A;  3HXL A;  5EDN A;  4M6V A;  2DA5 A;  3WTZ A;  2A6E F;  3LA7 A;  2WTE A;  5F27 A;  2YPR A;  3GTO J;  3NEU A;  3J80 K;  5FD6 A;  4AIH A;  5E8G A;  1BJA A;  1QVT A;  4GYG A;  1J9I A;  2ZSI B;  2WY8 Q;  4XBF A;  4IO9 F;  5CJ9 A;  2O8K A;  2JK3 A;  2GWR A;  1J09 A;  3BDD A;  2HOE A;  3PFY A;  1YO5 C;  1ZR2 A;  4C30 A;  4G7Z F;  3Q0U A;  1YS7 A;  4RM3 A;  1MBE A;  1YIJ I;  2B9S A;  3GTM J;  5IP6 A;  4D7M A;  2K9M A;  2NVY J;  3IHU A;  2R7R A;  2EIN H;  4RMN A;  2FA5 A;  3B6A A;  5HDG A;  2DT7 B;  4LB6 B;  2B63 J;  3OYN A;  2QLZ A;  1B1B A;  1I39 A;  2K02 A;  1P7J A;  4L9V A;  3BP8 A;  1LFP A;  1RPW A;  2KJC A;  1MSE C;  2Z33 A;  1IXS B;  1R7J A;  1JUS A;  5LEK A;  3OYK A;  3CCE I;  3M8E A;  4MQV A;  3WGI A;  1HC8 A;  2ME0 A;  2LG4 A;  2VPL A;  3L9F A;  4D0P A;  1G8X A;  1YG2 A;  3V8J A;  4UHT A;  2HYJ A;  3LL7 A;  5E1W A;  1MW7 A;  2CMP A;  2CW0 F;  2OCE A;  2V4J C;  1Z6R A;  4B09 A;  1J5Y A;  5E18 F;  3V7C A;  1NK3 P;  3KCC A;  4UUS B;  1F5T A;  2UV1 A;  5L3F A;  4C2U A;  1JTX A;  2IAI A;  3QPH A;  4RGR A;  1JKO C;  3MEX A;  2HVR A;  5D8K B;  5F6F A;  3H35 A;  2P6S A;  3KYL A;  1IUY A;  1SD7 A;  3OL4 A;  4KDP A;  3E6B A;  2F2E A;  2WY7 Q;  2DMQ A;  1YOV B;  2V1D A;  3L2Q A;  3VYU B;  5J4V A;  4OIR F;  4E7J A;  4G8X A;  4KIF A;  5IT9 Z;  3V8L A;  2AO9 A;  1ORK A;  2W1O A;  2JSC A;  1ETX A;  2A61 A;  4Q48 A;  4Y17 A;  3MAJ A;  1T6S A;  3DBR B;  4L5J A;  1WWX A;  2FD5 A;  3SXY A;  3BR5 A;  5M5X J;  2QCO A;  2FQ4 A;  2WV1 A;  2ZBK A;  4HPQ A;  4CHU A;  4A3D J;  3I64 A;  2HOA A;  3R0J A;  1VQN I;  2HVS A;  3TMO A;  2XGX A;  1R71 A;  4A3I J;  1QU3 A;  1X2M A;  2IVM A;  3G1L A;  3IRR A;  2E1C A;  2H8R A;  4NC7 A;  5E3O A;  4GXO A;  2COB A;  2XB0 X;  3HOT A;  1IV8 A;  4O5V A;  1D5V A;  4LG0 B;  1V55 H;  5CVJ A;  1Y39 A;  1P4X A;  3OYC A;  3S32 A;  4HDU A;  2MA3 A;  4RB3 C;  3OYD A;  3PNV A;  3TW7 A;  4RGX A;  4A2U A;  3FXO A;  3ECH A;  4CA0 A;  2R5Z A;  3FZV A;  3ZRG A;  5FB2 A;  5TRD A;  2PMZ A;  4II2 A;  1GT0 C;  4HEA 2;  2JUG A;  4BQN A;  5DM7 F;  2ZFU A;  2EZL A;  2XIG A;  2PN6 A;  3OWT A;  3ZQG A;  3S2W A;  1IO2 A;  2KJB A;  4Y3O A;  3CCL I;  1FC3 A;  1RNL A;  4FAS D;  3KZY A;  2R7S A;  3HRU A;  3SEQ A;  2G9W A;  3GX4 X;  2GA2 A;  4C3H J;  2K9L A;  3BZK A;  5E1X A;  2ZJ2 A;  2QVO A;  1B8I B;  3CP2 A;  1MZB A;  4MTE A;  4IXA A;  3L2R A;  2QQ9 A;  3WE2 A;  4QLC U;  2YU3 A;  1EH8 A;  1MD0 A;  1Z7L A;  2KRF A;  4IHS A;  1X4O A;  1ETV A;  2UZK A;  5HDN A;  3WU2 C;  4BEH B;  1B72 A;  4HW0 A;  2KLO A;  3GTJ J;  4HDV A;  1WJC A;  4XM3 A;  4JP0 A;  2VXZ A;  3BPV A;  4OAY A;  4A0Y A;  3A01 A;  2DA2 A;  2NS0 A;  2P7C B;  1K4T A;  2Y0S A;  3CC4 I;  3ZQI A;  3OY9 A;  4OOI A;  3WG9 A;  1JI8 A;  1ONV A;  2X48 A;  3HM5 A;  1JT6 A;  3HC7 A;  4AVZ A;  4U88 A;  4LJZ F;  3L7W A;  3OYB A;  2Z1D A;  5DYM A;  1BL0 A;  3WTT C;  3CMY A;  2DOA A;  1IRG A;  1BJZ A;  3TP0 A;  1L0O C;  3BR0 A;  1MGT A;  1T39 A;  3QOE A;  1HW5 A;  3K4M A;  3J81 K;  1MNE A;  3OYM A;  1EA3 A;  3JSO A;  1STZ A;  1XB4 A;  4LG0 A;  3ZR8 X;  1NH3 A;  3P7N A;  3GO5 A;  4I99 C;  2FU4 A;  4RAY A;  4BYY A;  1YJ9 I;  1I27 A;  1UEL B;  5LLQ A;  2DOE A;  4LFU A;  4XN0 A;  3DBH B;  2XDV A;  4A3E J;  2PG4 A;  1V3F A;  5EGO B;  1VQ8 I;  5ED4 A;  2PJP A;  2OUM A;  1UCR A;  2L3D A;  4DGW B;  4N4N B;  2EZK A;  4MEY F;  3TDZ C;  4N0B A;  1TNT A;  1OCO H;  4HF1 A;  1R4M B;  1XN7 A;  2OBP A;  1SD5 A;  1QVU A;  4MHG A;  1SFK A;  3HBL A;  3RZD J;  2X6X A;  2DT6 A;  2P8T A;  3F3X A;  2EFW A;  3JRG A;  1BOB A;  1D0Z A;  4K2E A;  5GTH C;  3V7R A;  1UST A;  4G6Q A;  2Y0M A;  2CWE A;  2ZFW A;  4L9T A;  1Y6I A;  4KIC A;  5B66 C;  1Y1V J;  2JQ7 A;  4MFD A;  3C1D A;  5EEA A;  1MJ9 A;  1R22 A;  2GZW A;  2EFN A;  4J00 A;  1ACI A;  5M5Y J;  4HAM A;  2VKH A;  2H6C A;  2ID6 A;  4MFE A;  5K1Y A;  1FPQ A;  1SMT A;  1RR7 A;  3GVA A;  3JCU C;  2OTJ I;  3FXJ A;  4L9J A;  3TOB A;  3JTG A;  4GFB A;  1F43 A;  3HTU A;  1R1U A;  4B8X A;  1VQL I;  4HOB A;  1WHU A;  4ZZD A;  4MTD A;  1PDN C;  5FRN A;  2GXA A;  2XGC A;  3ABU A;  2DA4 A;  3ZQH A;  2DYS H;  2CFO A;  2DLL A;  4IEJ A;  4U0Y A;  2TRT A;  3WTU C;  3BG3 A;  4LK1 F;  2L7Z A;  4PJM A;  2X0L A;  1YI2 I;  3GTQ J;  3QU3 A;  1IN5 A;  2OD5 A;  3SZT A;  1XGO A;  2DMN A;  3VOD A;  4LMY A;  3PIP F;  1IN6 A;  1Z91 A;  4S0H B;  3RSN A;  3OS2 A;  3F22 A;  2W00 A;  2MBF A;  3ABT A;  1U2W A;  2STW A;  2XAQ A;  3VDX A;  4OMZ A;  3TQN A;  3GZ5 A;  3EDP A;  3M4O J;  2XAG A;  1RIO H;  4A3F J;  3G1O A;  3FMS A;  3KP7 A;  1BA5 A;  5LHI A;  2HNH A;  1WFX A;  1Z1D A;  4S05 A;  1TP4 A;  4UV9 A;  4RAZ A;  3GEZ A;  1S29 A;  2DI3 A;  3CUO A;  1MBJ A;  2JA7 J;  2Z3Y A;  1SAX A;  2LMD A;  3HGY A;  4PK4 A;  3I4P A;  4Y15 A;  2M9H A;  2CUF A;  4E7K A;  4XSX F;  2X9D A;  3GCM A;  1MBK A;  3NAR A;  3S15 J;  4M3F A;  2XVC A;  3SZP A;  1UZC A;  1VQK I;  2D1H A;  1TWF J;  3KP4 A;  4P55 A;  1LDD A;  2ZSH B;  2V7F A;  4AYB A;  3H1C A;  5GAE J;  2LRD A;  1FLI A;  5L3C A;  3CTA A;  3IWZ A;  4IHW A;  1X3W B;  2IGM A;  1X3Z B;  2PFB A;  1ZG1 A;  3I55 I;  5AON A;  2JZY A;  4ANJ A;  1WKM A;  3BG7 A;  2BHY A;  2ZXH A;  1USS A;  5JI6 A;  2HZT A;  4RB0 A;  1NG6 A;  4U7D A;  2KIF A;  3OR2 C;  1RKW A;  2F4O B;  4I0A A;  1T2K A;  4L5E A;  4YII A;  1T0F A;  1ERD A;  2LF7 A;  1MMG A;  5D5V B;  3GYH X;  4CO8 A;  5D4S A;  3KEQ A;  2GQQ A;  2CW7 A;  4FQG A;  2IW5 A;  2Y0S N;  4XLF A;  4GCV A;  3RKY A;  5DUK A;  3FF5 A;  2ZXW H;  1IXC A;  2ELH A;  2QA4 I;  2IJL A;  2MLK A;  2OQR A;  3DBL B;  1YHQ I;  3LWF A;  4PDK A;  1KA8 A;  1IC8 A;  2E19 A;  5JFR A;  1K78 B;  1XMX A;  3FXR A;  3JR9 A;  3IRQ A;  3A1Y A;  3G6E I;  5DCF A;  2EWN A;  3J81 Z;  1AKH A;  3VWB A;  3PJR A;  3KYD B;  2JTV A;  4A3B J;  5ICC A;  4OIP F;  5ILV A;  1OCZ H;  3MQ0 A;  4M72 A;  4XRM A;  3S1R J;  4QIW N;  2CUJ A;  1OMI A;  1TWC J;  2EBI A;  2J5O A;  5F0F A;  1HW2 A;  1K6Y A;  3K1M A;  2FX0 A;  3K9T A;  1Z77 A;  2LY2 A;  2R93 J;  4V2G A;  2KL4 A;  2RNG A;  3VSK A;  1HCR A;  1R5G A;  1XX5 A;  2RC4 A;  1ZYR F;  2LC2 A;  2ZJR F;  5FO5 A;  4HNU A;  4XID A;  1S8N A;  2CQ7 A;  1QHG A;  2DBB A;  3QYB A;  4XOR A;  2E71 A;  4KMU X;  3LSK A;  1V5E A;  1GXQ A;  5LD2 C;  2ECC A;  1K79 A;  3R60 A;  1BR2 A;  1AU7 A;  1XG1 A;  5B3S H;  5HOD A;  3MCZ A;  4YRV A;  2W7N A;  2LBF B;  1X3U A;  3CJQ B;  4BE1 A;  4EAT A;  4UUV A;  1BC8 C;  1D8J A;  3ERM A;  1M1E B;  2VBX A;  3T8R A;  2VQL A;  3FX3 A;  2VJ5 A;  3CJT B;  1MSF C;  1SVO A;  2WAQ N;  2YU9 J;  5EG0 B;  1WQ2 A;  5DUI A;  2DA6 A;  4HA8 A;  2K9S A;  4WXC A;  3W6V A;  1EV7 A;  1Y8Q B;  3P5J A;  3K4J A;  3BTL A;  4GO1 A;  2EV0 A;  2CQX A;  2DU9 A;  2YX7 A;  3TW6 A;  1HKQ A;  3ZMV A;  4NDL A;  2X6W A;  3S93 A;  1N77 A;  2Y9Y A;  1FP2 A;  3K4K A;  3OYJ A;  5B1A H;  4ENM A;  3IAS 2;  2W82 A;  4HST A;  3WHB A;  3MN2 A;  4D5F A;  4XON A;  4DJA A;  2XAS A;  1FZP B;  1WRJ A;  2E1N A;  1AHD P;  4PSW A;  1S6L A;  1R58 A;  1J7K A;  1PP8 F;  3O8G A;  3NWT A;  2WAD A;  4IL6 C;  3HUG A;  2CJJ A;  3KP5 A;  3QP6 A;  5FGM A;  3ZMZ A;  2CV0 A;  2RDP A;  3CD6 I;  1YRN A;  4HBL A;  1O4X A;  4G7H F;  5EEG A;  1HW1 A;  2ETH A;  4F52 A;  2BGC A;  1ETO A;  2M1B A;  4A0X A;  4AUX A;  4PZJ A;  1OLT A;  3OS0 A;  4UNO A;  3P9K A;  2AXT C;  3QP5 A;  1V54 H;  1RET A;  5GP9 A;  5EJC A;  3L2W A;  3D5L A;  2KP6 A;  1XGN A;  3HPH A;  2AQF A;  2MH2 A;  2ZJP F;  2VC1 A;  2PX9 A;  2NVQ J;  1UB9 A;  2R7O A;  3Q9S A;  2TDX A;  3IKT A;  1LEB A;  3HGG A;  3GLX A;  2NVU B;  2ZXJ A;  3EET A;  1WJD A;  2W57 A;  4C2T A;  5AIP A;  5D5X B;  1H9G A;  2KMU A;  2EIL H;  4Y7N J;  3GTL J;  3K4N A;  1DQU A;  1D1C A;  1FSH A;  3DEW A;  5K7F A;  2M5W A;  5AIQ A;  2CV1 A;  1JHF A;  1TZL A;  5CYV A;  2L01 A;  4WXD A;  1HQC A;  4FX0 A;  2GIV A;  3H3Z A;  2QGU A;  3KEO A;  5FJ8 J;  1P4A A;  2A6H F;  2B0L A;  1FYL A;  2XC7 A;  2HEO A;  1ZRD A;  1WI9 A;  2M7B A;  1Z21 A;  2VJ4 A;  1OCP A;  2M34 A;  1AWC A;  4NBQ A;  1YX5 A;  5KCM A;  2XAH A;  1FEX A;  2RKH A;  1DP3 A;  1QGP A;  1F9N A;  2CYY A;  2HPI A;  3P9C A;  1FNN A;  1G3Y A;  5LHG A;  3LAP A;  3GFL A;  4E6K G;  3TDU C;  3L00 A;  5FKO A;  1VQ6 I;  3BQZ A;  3ZPL A;  1DGR M;  4KN4 X;  3RYP A;  5CVU A;  3EUA A;  2NS8 A;  3OV8 A;  1JT0 A;  4L5I A;  4CXF A;  2MG4 A;  4XLE A;  2X6Y A;  1YS6 A;  3J80 Z;  1SEU A;  4BUP A;  3MKZ A;  1QBJ A;  5C44 J;  2F5V A;  3JRA A;  3CO7 C;  2ISY A;  1FOK A;  2VOO A;  2BE5 F;  5E3L A;  3DPT A;  4E4H A;  4RB2 C;  1VZ0 A;  2VN2 A;  4GDF A;  2IBD A;  1X2N A;  1QO0 D;  3G1M A;  5ICG A;  1E0E A;  3H3U A;  2RQQ A;  3B02 A;  5K5Q A;  4P9U A;  2PQ8 A;  1BR4 A;  2M7A A;  4A12 A;  5JVT A;  1IGN A;  2D1V A;  2MLG A;  2HFH A;  3F23 A;  2IA0 A;  3F8B A;  4AIJ A;  3F8F A;  3DPU A;  3BWG A;  5DCM A;  2MW8 A;  4I2O A;  3GF2 A;  2K40 A;  5HLG A;  3F6O A;  4XR6 A;  2QWW A;  4UXN A;  2EQR A;  3GXO A;  2Q2E A;  3O6B B;  1XSX A;  3FXU A;  1X58 A;  3M3Y J;  5LRS A;  1KU3 A;  4LOC A;  4Q47 A;  3K70 C;  2QSF X;  2GLO A;  2XSD C;  3PNY A;  4QSH A;  1HXD A;  1TLH B;  1ZR4 A;  4HLY A;  1XSD A;  2GIZ A;  1IV6 A;  2O61 A;  2GOX B;  2QQ8 A;  5L3D A;  4OMY A;  4AU7 A;  3FIW A;  1XCB A;  3ROU A;  3LQR A;  3PUB A;  1WH7 A;  2VE8 A;  1S7O A;  5J4Y A;  4IHX A;  3DKY A;  4ZDP A;  4KIG A;  5LBQ A;  2OCC H;  3OIP A;  1OPC A;  4XKC A;  4QWQ A;  4BQO A;  1Z3X A;  3OMY A;  3H3V K;  4KJZ A;  2HPM A;  5BNG A;  2HTJ A;  4JK1 X;  3ABK H;  1FYM A;  3QOP A;  3SQN A;  3QOD A;  4BJ5 C;  4ASN A;  2F5C A;  3CJR B;  3H36 A;  2A3S A;  4CCN A;  2DW4 A;  3S16 J;  3S2H J;  1LQ1 A;  1GLN A;  2M30 A;  3IV5 A;  1JKQ C;  2KPM A;  2EB7 A;  1ZH5 A;  3DTI A;  3HJE A;  1NG7 A;  2DPD A;  5DD4 A;  3RIR A;  2P5L C;  1ZTR A;  1D5Y A;  3HKZ A;  1LFU P;  5GAD J;  2L9V A;  3HTS B;  3KZI C;  3ZQQ A;  2V1X A;  3AKZ A;  1A04 A;  2VOD A;  2H8W A;  1ZHF A;  5LHH A;  4A0Z A;  3RDI A;  1MJB A;  3BR6 A;  3DP7 A;  2E7X A;  2ZXI A;  3ABL H;  3WGH A;  4ZZL A;  1YX3 A;  3WG7 H;  4HX8 A;  2L4M A;  4DBR A;  3K1N A;  4X6A J;  2WWY A;  3RTR A;  5F0H A;  3O3K A;  2XGD A;  2LVS A;  3G2B A;  1MBF A;  3I4N J;  1Z7U A;  4HYE A;  4F92 B;  1MBH A;  1WCM J;  1AKH B;  2VBZ A;  1R49 A;  1TWA J;  3ULQ B;  1XSV A;  5DCM B;  3GBG A;  1X19 A;  4KFC A;  4XKW A;  3CC7 I;  5CVV A;  1U78 A;  2XHK A;  2FXA A;  4EJW A;  4A3G J;  1UHM A;  2MSY A;  2HWV A;  3CCJ I;  5HS9 A;  1BC7 C;  2EA2 A;  1DUX C;  4OIN F;  1ON1 A;  3W2A A;  4ZC3 A;  1OFC X;  3SDB A;  4ZDO A;  3B6C A;  2OQG A;  5TGT A;  3HHG A;  4PFO A;  3LFK A;  5ILS A;  1HDD C;  1O3T A;  2DO7 A;  2E1M B;  4DYC A;  3BPX A;  3HG9 A;  4MO7 A;  2AQE A;  2EV6 A;  4CCL A;  3S3O A;  2P6T A;  3LMM A;  5KNL A;  1FIA A;  3PFI A;  4A3K J;  4HSR A;  1LFB A;  4PGH A;  5L3G A;  4XOP A;  5LEJ A;  3A0B C;  2QM3 A;  1LUJ B;  2EJR A;  2QSG X;  3MZH A;  3TP3 A;  2M0C A;  3V8K A;  1ZLJ A;  1YQA A;  1YYV A;  3FKI J;  4G6D A;  3VFZ A;  3ESW B;  2W4S A;  3RQ4 A;  4AD9 A;  3I9V 2;  2GOM A;  1GHC A;  2V6C A;  1KYW A;  2DQR A;  4EJU A;  3CCU I;  2OC6 A;  2EV5 A;  2QBY B;  2Y2Z A;  3GFM A;  4V19 K;  2DMT A;  4PJJ A;  1WJF A;  2CQN A;  2FBK A;  5BOX A;  2EIM H;  4BKX A;  2DFF A;  5DEQ A;  3K4B A;  4UVC A;  1O57 A;  2IPQ X;  1IRX A;  3BR2 A;  1HF0 A;  3WGG A;  3IH4 A;  3U9G A;  1O3S A;  2R92 J;  1I1G A;  5ILU A;  3KEY A;  2Y75 A;  4G6T B;  1OCC H;  3ELK A;  5HNH A;  2E35 A;  5D8L B;  4XL9 A;  5F1J A;  2DXI A;  3JRH A;  3ASO H; 
#chains in the Genus database with same CATH homology
 3R0A A;  3VOE A;  4A5N A;  3V7S A;  3CLO A;  1FX7 A;  1G3W A;  2QQB A;  4IRG A;  2XV4 S;  1R5H A;  3U1D A;  2WC2 A;  1MDM B;  4XSZ F;  2DTR A;  2W24 A;  5FFZ A;  2FRH A;  1JE8 A;  4CYD A;  2Y48 A;  5L3B A;  2AXL A;  5BS6 A;  2YSR A;  5E20 A;  4Z2Y A;  2O03 A;  1TQP A;  4ON0 A;  4EMS A;  4IRH A;  3KP3 A;  3SHF A;  2MC3 A;  3HOS A;  3BRO A;  2PEX A;  2LKP A;  1PP7 U;  2FMY A;  3MFK A;  1ZGJ A;  2V79 A;  4IF4 A;  1IN8 A;  1GXP A;  2K4J A;  2VE9 A;  2O6G E;  1DP7 P;  1MDM A;  4E70 A;  1O3R A;  4HZF A;  2OU2 A;  3E97 A;  3IWF A;  1IXR C;  1F1Z A;  2LNB A;  3R4K A;  1TTY A;  4WWC A;  1LEA A;  3N4M A;  3PQJ A;  3EUH A;  1LB2 A;  1W4M A;  4G9Y A;  1IZ1 A;  1SFX A;  1SMY F;  2X4H A;  1XDS A;  2CGP A;  1SFU A;  2QZ8 A;  5E17 F;  1BI2 A;  1BIB A;  5FLX Z;  1BI1 A;  3I53 A;  3FMR A;  3M1E A;  1W7P A;  3K0L A;  3TOA A;  2FSW A;  1O7L A;  5ICE A;  4R1H A;  3DPL C;  4ENK A;  3O2P E;  2OZ6 A;  2EK5 A;  5LGN A;  4TV7 A;  5CVR A;  4U7B A;  1J0R A;  2CQK A;  1G6N A;  1KU2 A;  2GAU A;  1Z6T A;  2IA2 A;  3I59 A;  3KP6 A;  2OA4 A;  3LA3 A;  2D2W A;  4I0B A;  1TNS A;  1FP1 D;  2COM A;  1W7P D;  2HKO A;  4CGZ A;  2K86 A;  1OKR A;  4HLX A;  1RUN A;  3DQV C;  1QNT A;  5FD5 A;  3IL2 A;  3ML6 A;  2RVC A;  2LSO A;  1P2F A;  5BPD A;  3DXJ F;  4NQW A;  1R23 A;  4EJV A;  1YIO A;  2MD5 A;  1FWZ A;  5IT9 K;  2HYF A;  2DT5 A;  4EM2 A;  5K5R A;  1UHW A;  4F7Z A;  4L18 B;  1LNW A;  3TO6 A;  2XAF A;  4CIC A;  5BPI A;  1BM9 A;  1IAW A;  3ISP A;  3ERE D;  4KIB A;  1IN7 A;  4YFN F;  4I98 B;  4YFX F;  4JBA A;  1JHH A;  3LQQ A;  3KFW X;  3IC7 A;  1HSJ A;  2EFQ A;  1CF7 A;  1Y0U A;  4EVI A;  5D5U B;  3JSP A;  2JPC A;  1ZAR A;  2XAJ A;  2BBY A;  2HGC A;  5F64 A;  4I09 A;  5L3E A;  1ZGA A;  2O3F A;  3VB2 A;  3ZMT A;  1LDK B;  3E6D A;  2LDU A;  2L54 A;  3KLO A;  1ZG3 A;  2Z5U A;  3ZN1 A;  1G4D A;  1LDJ A;  2GXB A;  2NNY A;  1T38 A;  1TQM A;  3CJN A;  1BIA A;  4OU0 A;  2VBY A;  5J6X A;  2UWM A;  4EGZ A;  3M7G A;  2ESN A;  4LLL A;  3R6S A;  1VTN C;  2Z99 A;  2QUF A;  3ZP5 A;  2RQP A;  4G94 A;  3QRF F;  3HRM A;  1XMA A;  4MNU A;  5HVQ C;  1CGP A;  2LF8 A;  1B9M A;  2VOP A;  1I1S A;  4EJT A;  4FT8 A;  4ETS A;  3T1B A;  4S04 A;  2IA1 A;  4BNC A;  2UXN A;  4AVP A;  5F1R A;  2L02 A;  3DKW A;  4IVN A;  2FNA A;  1FT9 A;  3GWZ A;  4M6Y A;  1RI7 A;  4EV0 A;  4M6X A;  5CLS A;  2RGV A;  1G3T A;  2FF4 A;  3T8T A;  2IP2 A;  1OYY A;  3KP2 A;  2P7V B;  4IJA A;  2O8X A;  3ECO A;  1O7F A;  5BMZ A;  5E8I A;  5K5O A;  3E6C C;  3W6K B;  2VT2 A;  1TQI A;  3LA2 A;  3R61 A;  4KNY A;  2VT3 A;  1BI3 A;  2HS5 A;  2XKO A;  4LLG F;  1RZ4 A;  4PGG A;  4R8H A;  1HBX G;  5J8F A;  3ZMD A;  5DDG A;  3I0T A;  3HYI A;  4H0E A;  1E17 A;  2PBI A;  4ESF A;  1OYI A;  4BAY A;  2FBI A;  3ZMU A;  5HS8 A;  2L4A A;  1ZN2 A;  4EQQ A;  1H9T A;  3LST A;  1YW7 A;  3RI4 A;  3I71 A;  2NRA C;  4WXH A;  4A5M A;  3E5U A;  1YW8 A;  1CF7 B;  4ZYD A;  3G3Z A;  2ESH A;  3KE2 A;  1LJ9 A;  2GXG A;  4ZYE A;  3TKY A;  1TBX A;  3H92 A;  4U0V A;  3BOQ A;  2K7L A;  1KGS A;  3HHH A;  2HQR A;  3DF8 A;  1XCV A;  1IRF A;  2HR3 A;  2ZNZ A;  4P96 A;  5H6R A;  5H20 A;  4YG2 F;  2ZNY A;  3DFG A;  1B4A A;  2V1U A;  3B73 A;  2G7H A;  3HSE A;  3WOD F;  4KT5 C;  3I59 B;  3Q9V A;  3RKW A;  2JRT A;  3G73 A;  3NQO A;  1SFE A;  3TO7 A;  1ZAO A;  1KQ9 A;  1BBY A;  2Q8K A;  1PUE E;  1RUO A;  2H09 A;  4GYI A;  3D0S A;  4AWX B;  4BXU A;  1DPR A;  3M8F A;  1U5T C;  1DPU A;  2C6Y A;  1SD4 A;  5D6F A;  5HS7 A;  1LVA A;  1ULY A;  3CUQ A;  3RJP A;  3KZZ A;  2IT0 A;  5A2Q K;  2AS5 F;  4RGS A;  1XGM A;  5E1Z B;  3Q5F A;  2E7W A;  3COA C;  3E5X A;  3C7J A;  4KMF A;  4HQE A;  3WU0 A;  1K78 A;  4BH9 A;  3GFJ A;  2QYO A;  1S7A A;  4P9F A;  3EYY A;  3HRT A;  2IRF G;  4EM1 A;  1R1V A;  3T5X A;  4HF2 A;  1D3Y A;  4WF2 A;  2BYV E;  3SFZ A;  5BQT A;  2FE3 A;  4L0Z B;  2PI0 A;  1BOA A;  1K7A A;  4HF0 A;  4FHT A;  4HV6 A;  1F4K A;  3RKX A;  3CUQ C;  1ODD A;  1GVJ A;  1QZY A;  1JGS A;  2OAZ A;  4WK8 F;  2W85 A;  4LB5 A;  1WSU A;  1BI0 A;  4M71 A;  4KUM A;  2J5P A;  4XLP F;  1JXS A;  4RS8 A;  1R00 A;  1MJA A;  1B59 A;  1E2X A;  4KYW A;  4ESJ A;  3BJA A;  2ZKZ A;  3E6M A;  3F8M A;  5LGU A;  4FX4 A;  2H6B A;  2RNJ A;  1XDU A;  3L2C A;  2RN7 A;  1P92 A;  1Q1H A;  1W7P B;  2ZME B;  3F8C A;  3N97 A;  4ESB A;  3EQL F;  2HTS A;  4EGY A;  1ZRE A;  2K27 A;  1J2X A;  1KYZ A;  1HKS A;  1U5T B;  1KQ0 A;  2GA1 A;  4L0Y B;  4LGW A;  4R79 A;  1B9N A;  4OIO F;  3P9I A;  4EM0 B;  4CZZ A;  2BEO A;  4N9I A;  4G7O F;  2P4W A;  3JAM Z;  1K6O A;  4GGG A;  5J8C A;  3KET A;  1TW3 A;  2BV6 A;  2A68 F;  5HLI A;  3T0Y A;  5HOO A;  3L09 A;  1FBU A;  4YIF A;  1W5T A;  2OZU A;  3CO6 C;  1R36 A;  4LD5 A;  4RGU A;  4M74 A;  2R3S A;  2RV8 A;  3HRS A;  3QU6 A;  4KA4 A;  4MGR A;  2QBY A;  3E5Q A;  4HV5 A;  5A2Q Z;  1IW7 F;  1SD6 A;  3WTW C;  2YX4 A;  4WX9 A;  1B6A A;  3HSF A;  1NHA A;  3QAH A;  1IF1 A;  2FOK A;  3BJ6 A;  3WTV C;  3GZ6 A;  4N9H A;  5EEH A;  2K4B A;  2YR2 A;  5LRR A;  3C3W A;  2F5D A;  3DV8 A;  5TJJ A;  1C0W A;  3U2R A;  4EJO A;  5D4R A;  4UVB A;  3ZN0 A;  3K1P A;  1J59 A;  1EH6 A;  1ZG5 A;  4M9Z A;  4BHP A;  1FSE A;  1U8R A;  1AOY A;  3GW2 A;  3CDH A;  6PAX A;  4ZYH A;  3FMQ A;  2A07 F;  1YW9 A;  2DFI A;  4BQA A;  4MEX F;  3W6J B;  2Z9O A;  4WCG A;  3TGN A;  5HDK A;  2KKO A;  5LGT A;  3ZQ7 A;  3QPT A;  3REO A;  2F5E A;  2CSO A;  4O6J A;  2ZO4 A;  3K69 A;  4Q4Z F;  1U3E M;  1U5T A;  5ERI A;  4I01 A;  2XRO A;  1U6G A;  5FFX A;  2QQA A;  1QZZ A;  4U0W A;  3NRV A;  2A5Y B;  4A6E A;  5H6Q A;  2EA4 A;  3KLN A;  1EH7 A;  4ENN A;  1KU9 A;  2W25 A;  2M45 A;  3VEP A;  1UFM A;  3K2Z A;  4JQF A;  2F5F A;  3F8N A;  4CDG A;  2FQ3 A;  2PLY A;  2PMH A;  1OR7 A;  2P5V A;  2KIM A;  2XRN A;  2NNN A;  3GUD A;  2VC0 A;  3ZMS A;  3WE3 A;  2QEN A;  2R7D A;  3DEU A;  1QPM A;  3F21 A;  4I02 A;  2Q0O A;  4AIK A;  3F72 A;  3FM5 A;  1BN5 A;  3RPQ A;  2MH9 A;  3RYR A;  1OYW A;  4NHJ A;  4ENJ A;  3HSR A;  1I5Z A;  1XGS A;  2R7F A;  4M9X A;  4NB5 A;  3JTH A;  4M9S A;  1Z9C A;  4HX7 A;  1HST A;  3OOP A;  2WV0 A;  2H27 A;  2DQL A;  2D45 A;  3BY6 A;  3FXQ A;  1MKM A;  2H94 A;  2VBW A;  3CUQ B;  2HYG D;  1YLF A;  4DNC A;  2JPB A;  1FBQ A;  3C18 A;  4ZYG A;  3V4G A;  4MQ9 F;  2HQN A;  3WTY C;  2HKX A;  2CO5 A;  4I7H A;  1ZLK A;  2DAO A;  1XMK A;  2FML A;  3WTS C;  4XRF A;  2EFO A;  2XKP A;  3RPU A;  2JT1 A;  5DV5 A;  2FEZ A;  1G3S A;  2ADU A;  4BHB A;  5JR3 A;  3EYI A;  3GFI A;  3JAM K;  1D8K A;  2STT A;  1IN4 A;  4Y13 A;  2A69 F;  1ZRC A;  4Q5S F;  4LK0 F;  2KIU A;  3F6V A;  1R1T A;  3WU1 B;  3I5U A;  2M87 A;  3J7A O;  3I54 A;  5D5W B;  1DDN A;  3M9A A;  3MWM A;  4BHC A;  2XUB A;  1V4R A;  4P5O A;  1FYK A;  3FWE A;  1P6R A;  1KU7 A;  3IKV A;  5KVR A;  2FBH A;  3BJO A;  2FNP A;  5DD8 A;  4ZH4 F;  4PCQ A;  1O3Q A;  5IT3 A;  1J75 A;  2DK8 A;  1L3L A;  1TW2 A;  2ISZ A;  1W5S A;  1Z05 A;  2CFX A;  4YFK F;  4UV8 A;  2PMU A;  2W84 A;  1YTY A;  4KN7 X;  3I58 A;  4HQM A;  4HX4 A;  3WTX C;  3LAJ A;  4A6D A;  5FLX K;  1FBS A;  1QQI A;  2G7U A;  2O0Y A;  1YFH A;  5JHU A;  3TO9 A;  3JW4 A;  1T98 A;  3HIF A;  1S3J A;  4O3M A;  2NYX A;  2VON A;  1HKT A;  2CG4 A;  2HDC A;  5D6E A;  2DK5 A;  1XD7 A;  2ACJ A;  4IRI A;  1ZRF A;  4OIQ F;  2V9V A;  2M8E A;  5CVI A;  3PQK A;  4DQ2 A;  1ON2 A;  1FY7 A;  1I6X A;  4L9N A;  5ICF A;  4XLN F;  1REP C;  4UVA A;  4IPA A;  2NAZ A;  2DPU A;  2P5K A;  4LLN A;  4RB1 A;  3AAF A;  5KK1 A;  1P4W A;  3E3V A;  4IHT A;  4M73 A;  3FM3 A;  3FHZ A;  2UXX A;  2ZCW A;  3BZ6 A;  3MZY A;  2EFP A;  5HLH A;  2ZME A;  3WTZ A;  2A6E F;  3LA7 A;  2WTE A;  2YPR A;  3NEU A;  3J80 K;  5FD6 A;  4AIH A;  5E8G A;  1BJA A;  4GYG A;  1J9I A;  4XBF A;  5CJ9 A;  2GWR A;  3BDD A;  2HOE A;  1YO5 C;  4G7Z F;  1YS7 A;  3IHU A;  2FA5 A;  5HDG A;  4LB6 B;  2QLZ A;  1B1B A;  2K02 A;  4L9V A;  3BP8 A;  2KJC A;  2Z33 A;  1IXS B;  1R7J A;  5LEK A;  3M8E A;  4MQV A;  3WGI A;  3L9F A;  4D0P A;  1YG2 A;  3V8J A;  4UHT A;  5E1W A;  2CW0 F;  4B09 A;  1Z6R A;  1J5Y A;  5E18 F;  3V7C A;  3KCC A;  1F5T A;  5L3F A;  3QPH A;  4RGR A;  3MEX A;  5D8K B;  5F6F A;  2P6S A;  1IUY A;  1SD7 A;  4KDP A;  3E6B A;  2F2E A;  2V1D A;  4OIR F;  4G8X A;  4KIF A;  5IT9 Z;  3V8L A;  2JSC A;  2A61 A;  4Q48 A;  4Y17 A;  3MAJ A;  1T6S A;  4L5J A;  1WWX A;  3SXY A;  2ZBK A;  4CHU A;  3I64 A;  3R0J A;  2XGX A;  2IVM A;  2E1C A;  3IRR A;  4GXO A;  3HOT A;  4O5V A;  1D5V A;  4LG0 B;  5CVJ A;  1P4X A;  4HDU A;  2MA3 A;  4RB3 C;  4A2U A;  4RGX A;  3ECH A;  3FZV A;  5FB2 A;  5TRD A;  2XIG A;  2PN6 A;  3S2W A;  2KJB A;  1FC3 A;  1RNL A;  3KZY A;  3HRU A;  2G9W A;  3GX4 X;  2GA2 A;  5E1X A;  2ZJ2 A;  2QVO A;  4MTE A;  1MZB A;  4IXA A;  2QQ9 A;  3WE2 A;  4QLC U;  2YU3 A;  1EH8 A;  1MD0 A;  2KRF A;  4IHS A;  2UZK A;  5HDN A;  4HW0 A;  4HDV A;  2VXZ A;  3BPV A;  4A0Y A;  2NS0 A;  2P7C B;  4OOI A;  3WG9 A;  1ONV A;  4U88 A;  4LJZ F;  3L7W A;  5DYM A;  3WTT C;  1IRG A;  1L0O C;  1MGT A;  1T39 A;  1HW5 A;  3J81 K;  3JSO A;  1STZ A;  1XB4 A;  4LG0 A;  3P7N A;  3GO5 A;  4RAY A;  2FU4 A;  4BYY A;  1I27 A;  5LLQ A;  4LFU A;  2PG4 A;  1V3F A;  2PJP A;  5ED4 A;  1UCR A;  2L3D A;  3TDZ C;  4MEY F;  4N0B A;  1TNT A;  4HF1 A;  1XN7 A;  2OBP A;  1SD5 A;  4MHG A;  2P8T A;  3F3X A;  2EFW A;  4K2E A;  3V7R A;  1UST A;  4G6Q A;  2Y0M A;  2CWE A;  2ZFW A;  4L9T A;  4KIC A;  3C1D A;  1MJ9 A;  1R22 A;  2GZW A;  2EFN A;  4HAM A;  2H6C A;  5K1Y A;  1FPQ A;  1SMT A;  3GVA A;  4L9J A;  3TOB A;  3JTG A;  3HTU A;  1R1U A;  4B8X A;  4HOB A;  4ZZD A;  4MTD A;  1PDN C;  3ABU A;  1LEB A;  1KQ8 A;  2DLL A;  4U0Y A;  3WTU C;  4LK1 F;  2X0L A;  3QU3 A;  1IN5 A;  2OD5 A;  3SZT A;  1XGO A;  3VOD A;  4LMY A;  1IN6 A;  1Z91 A;  3F22 A;  2STW A;  3ABT A;  2MBF A;  1U2W A;  2XAQ A;  4OMZ A;  3TQN A;  3GZ5 A;  3EDP A;  2XAG A;  1RIO H;  3FMS A;  3KP7 A;  5LHI A;  1Z1D A;  4S05 A;  4UV9 A;  4RAZ A;  3GEZ A;  1S29 A;  2DI3 A;  3CUO A;  2Z3Y A;  1SAX A;  3I4P A;  4Y15 A;  4XSX F;  2XVC A;  3SZP A;  2D1H A;  4P55 A;  3KP4 A;  1LDD A;  1FLI A;  5L3C A;  3CTA A;  3IWZ A;  2PFB A;  1ZG1 A;  5AON A;  2JZY A;  1WKM A;  1USS A;  5JI6 A;  2HZT A;  4RB0 A;  4U7D A;  2KIF A;  4I0A A;  1T2K A;  4YII A;  1T0F A;  2LF7 A;  5D5V B;  3GYH X;  4CO8 A;  5D4S A;  3KEQ A;  2GQQ A;  2IW5 A;  4GCV A;  3RKY A;  5DUK A;  3FF5 A;  1IXC A;  2ELH A;  2IJL A;  2MLK A;  2OQR A;  3LWF A;  4PDK A;  1KA8 A;  5JFR A;  1K78 B;  3FXR A;  3IRQ A;  5DCF A;  2EWN A;  3J81 Z;  2JTV A;  5ICC A;  4OIP F;  5ILV A;  4M72 A;  3MQ0 A;  1OMI A;  2J5O A;  1HW2 A;  3K1M A;  3K9T A;  1R5G A;  2RC4 A;  1ZYR F;  5FO5 A;  1S8N A;  2DBB A;  4KMU X;  1GXQ A;  1K79 A;  3R60 A;  3MCZ A;  1X3U A;  4UUV A;  1BC8 C;  1D8J A;  2VBX A;  3T8R A;  3FX3 A;  1WQ2 A;  5DUI A;  4HA8 A;  4WXC A;  1EV7 A;  4GO1 A;  2EV0 A;  2DU9 A;  2YX7 A;  1HKQ A;  3ZMV A;  1FP2 A;  4ENM A;  1FZP B;  2XAS A;  1WRJ A;  2E1N A;  1S6L A;  1R58 A;  1J7K A;  1PP8 F;  3HUG A;  3KP5 A;  3QP6 A;  5FGM A;  3ZMZ A;  2RDP A;  4HBL A;  4G7H F;  5EEG A;  1HW1 A;  2ETH A;  2BGC A;  2M1B A;  4A0X A;  4PZJ A;  4UNO A;  3P9K A;  3QP5 A;  3D5L A;  1XGN A;  2MH2 A;  2VC1 A;  1UB9 A;  3Q9S A;  2TDX A;  3IKT A;  3GLX A;  2ZXJ A;  3EET A;  2W57 A;  5AIP A;  5D5X B;  1H9G A;  1FSH A;  2M5W A;  5AIQ A;  1JHF A;  5CYV A;  2L01 A;  4WXD A;  1HQC A;  4FX0 A;  2GIV A;  3H3Z A;  3KEO A;  1FYL A;  1P4A A;  2A6H F;  2B0L A;  2HEO A;  1ZRD A;  1WI9 A;  1AWC A;  2XAH A;  2RKH A;  1QGP A;  1F9N A;  2CYY A;  3P9C A;  1FNN A;  1G3Y A;  5LHG A;  3LAP A;  3GFL A;  3TDU C;  3L00 A;  3ZPL A;  4KN4 X;  3RYP A;  5CVU A;  3OV8 A;  4L5I A;  4CXF A;  1YS6 A;  3J80 Z;  1QBJ A;  3CO7 C;  2ISY A;  1FOK A;  2VOO A;  2BE5 F;  4RB2 C;  3DPT A;  2VN2 A;  1QO0 D;  5ICG A;  3H3U A;  3B02 A;  5K5Q A;  4P9U A;  2PQ8 A;  4A12 A;  5JVT A;  2D1V A;  2MLG A;  2HFH A;  3F23 A;  2IA0 A;  3F8B A;  4AIJ A;  3F8F A;  5DCM A;  3BWG A;  4I2O A;  3GF2 A;  5HLG A;  3F6O A;  2QWW A;  4UXN A;  3GXO A;  2Q2E A;  3O6B B;  1XSX A;  3FXU A;  5LRS A;  1KU3 A;  4Q47 A;  1HXD A;  1TLH B;  4HLY A;  1XSD A;  2O61 A;  5L3D A;  4OMY A;  1XCB A;  3ROU A;  3LQR A;  2VE8 A;  1S7O A;  4KIG A;  5LBQ A;  1OPC A;  4QWQ A;  2HTJ A;  4JK1 X;  1FYM A;  3QOP A;  3SQN A;  4ASN A;  2F5C A;  2A3S A;  2DW4 A;  1LQ1 A;  2M30 A;  2EB7 A;  1ZH5 A;  2DPD A;  5DD4 A;  3RIR A;  2P5L C;  3HTS B;  2V1X A;  2VOD A;  1A04 A;  1ZHF A;  5LHH A;  4A0Z A;  3RDI A;  1MJB A;  3DP7 A;  2E7X A;  3WGH A;  4ZZL A;  4HX8 A;  2L4M A;  3K1N A;  2WWY A;  3RTR A;  3O3K A;  1Z7U A;  4HYE A;  2VBZ A;  3ULQ B;  1XSV A;  5DCM B;  4KFC A;  5CVV A;  1U78 A;  2XHK A;  2FXA A;  4EJW A;  1UHM A;  1DUX C;  2HWV A;  5HS9 A;  1BC7 C;  2EA2 A;  4OIN F;  1ON1 A;  2OQG A;  3HHG A;  3LFK A;  5ILS A;  1O3T A;  2DO7 A;  3BPX A;  2EV6 A;  2P6T A;  3PFI A;  4PGH A;  5L3G A;  5LEJ A;  2QM3 A;  2EJR A;  3MZH A;  3V8K A;  1ZLJ A;  1YQA A;  1YYV A;  4G6D A;  3VFZ A;  4AD9 A;  1GHC A;  2V6C A;  1KYW A;  2DQR A;  4EJU A;  2EV5 A;  2QBY B;  3GFM A;  2FBK A;  5BOX A;  5DEQ A;  4UVC A;  1O57 A;  2IPQ X;  3WGG A;  3U9G A;  1O3S A;  1I1G A;  5ILU A;  2Y75 A;  3ELK A;  5D8L B;  1H0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...