1QGQA

Udp-manganese complex of spsa from bacillus subtilis
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
255
structure length
238
Chain Sequence
PKVSVIMTSYNKSDYVAKSISSILSQTFSDFELFIMDDNSNEETLNVIRPFLNDNRVRFYQSDISGVKERTEKTRYAALINQAIEMAEGEYITYATDDNIYMPDRLLKMVRELDTHPEKAVIYSASKTYHLNDIVKETVRPAAQVTWNAPCAIDHCSVMHRYSVLEKVKEKFGSYWDESPAFYRIGDARFFWRVNHFYPFYPLDEELDLNYITEFVRNLPPQRNCRELRESLKKLGMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SPORE COAT POLYSACCHARIDE BIOSYNTHESIS PROTEIN SPSA
publication title Structure of the nucleotide-diphospho-sugar transferase, SpsA from Bacillus subtilis, in native and nucleotide-complexed forms.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 89
structure length 238
sequence length 255
ec nomenclature
pdb deposition date 1999-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00535 Glycos_transf_2 Glycosyl transferase family 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1qgqA00
1SS9A 2A8WA 1ZCTA 2Y4LA 2YCMA 4KC4A 5C4EA 3U2XA 1WVCA 3V8ZA 2X5SA 2A8UA 2I5EA 1HJJA 1WT2A 1ON6A 4EEMA 5AJPA 5C4DA 3OC9A 2AECA 4FRDA 4IRPA 4FRBA 4L41C 4Y7FA 1ZIZA 1EZIA 2X5ZA 3DK5A 1FO9A 2ICYA 5CMGX 3SXEA 4Y7GA 2Y6PA 3SPTA 2AH9A 3V90A 4CJCA 4DE7A 2FFUA 2PA4A 2FYBA 1ZJ0A 1YP2A 2BO6A 3SX8A 3SX5A 4EE4A 4KT7A 2E8BA 5DDTA 2P73A 1H4CA 4GBPA 5C3BA 4FQWA 1VPAA 1ZCYA 1ZJ2A 1W55A 1H5RB 1O7QA 1R7TA 3TQDA 4FRQA 2X65A 3USRA 5IDSA 2JCOA 3OAMA 1XHBA 4KC2A 4J18A 1ZCUA 1H4EA 1ZI3A 1IINA 2VSHA 2W0WA 3ZLLA 1R7YA 3V0PA 5C1HA 2PX7A 1G95A 2BO4A 1VGUA 3ZGGA 5C48A 1W77A 2Y4JA 1S4PA 3I0GA 2VSIA 2WGZA 5EIYA 5JQQA 1H5TA 2MZBA 1G23A 3V0LA 2YESA 1JVGA 5DDVA 1H5SA 1FGGA 1PZYB 1FR8A 2WVKA 1QGSA 1HV9A 2P72A 4KXOA 4HO8A 1NQIB 4HO5A 3T7MA 4B4GA 1KWSA 2QGIA 2YC3A 4D48A 1FWYA 1YROB 3E25A 1WT1A 5AJNA 4P00A 1G9RA 2RJ1A 1IIMA 3JUJA 1G8OA 1INIA 4K6RA 1LZ7A 4NANA 3CKOA 2XMEA 2YC5A 1H3MA 2RITA 2VXLA 4G87A 1YP4A 3V0MA 1VZTA 4MYBA 4AYJA 4CJBA 2JCLA 4KC1A 2I7BA 1R81A 1JV3A 2OEGA 4KNXA 4FRPA 2O1GA 2JCKA 2XWMA 2YQSA 4EVWA 4ASYA 3KIAA 3O3PA 3V0OA 3OKRA 5FV9A 2RJ4A 4ARWA 3V8YA 3V0QA 4NAKA 3I0HA 4DDZA 4B5BA 3F1CA 3I0CA 1ZCVA 1FO8A 3U2UA 2BO7A 3CKQA 1W57A 2CU2A 2RJ6A 1ZHJA 2RJ7A 5CQNX 1INJA 1H7EA 1S4OA 5CMIA 2OI7A 3D98A 5FTVA 1H7GA 2D0JA 2GGQA 3PKPA 3ZLKA 1ZI4A 2Y7AA 4KRVA 2OI6A 4Y62A 1HJLA 1H7TA 1ZJPA 2AESA 1K4VA 1LL0A 4FCEA 3RMVA 2V0JA 3JTJA 2DPWA 1VM8A 2W0VA 4P02A 3F1YA 4HO0A 3U2WA 5J49A 4HO9A 4XWIA 2XMHA 3CKNA 3U2TA 3I0EA 4Y64A 3OH3A 3POLA 3E26A 1R82A 4JISA 2VS4A 2UX8A 3ZF8A 1ZJ3A 3I0IX 1GX0A 4EEGA 1HM8A 2YQJA 5CQMX 1JV1A 1GX4A 1H5RA 3USQA 2ZU8A 4KNRA 3SX3A 5EJ1A 4CJ8A 4DECA 5C1GA 4BMAA 4EE5A 3IOHA 4FRLA 5FTSA 2JCJA 5CQOA 2RIXA 3R2WA 4B3UA 1PZTA 4M2AA 2AM5A 1TW1A 2RJ8A 4AAWA 4YS8A 4AC3A 4D11C 3OGZA 1OMXA 4B4MA 1MC3A 3I0FA 4UEGA 5FU8A 4ECMA 2AM4A 1O7OA 3SXAA 1FRWA 1NKHB 3RMWA 2ZU9A 5CMJA 4M28A 1VGWA 1FGXA 1ZDGA 5CMHA 5I1FA 1H7FA 5BXCA 1WT0A 2AE7A 5L6SA 3ZGFA 1NWGB 1NMMB 5EJZA 1HM9A 4B2XA 4Y63A 1LZJA 1VZUA 1E5KA 1H5TB 1OMZA 4Y6UA 4HG6A 3FOQA 1QWJA 4R7PA 4Y7TA 1H5SB 2PGVA 3BRKX 3Q4SA 4HO6A 5CMFX 4G3SA 5IFYA 1ZJOA 5C1LA 1FXOA 1NF5B 2V0IA 2VFZA 5C47A 1G93A 3HL3A 3I0LA 2Y4KA 1VICA 3OH0A 1VH3A 5FU0A 3D5NA 4NAIA 4M4KA 4AYLA 2AM3A 1FXJA 1V82A 1FOAA 3QVBA 1G97A 3U0YA 2FYAA 4MNDA 3V0NA 3D8VA 2O1HA 3I0DA 3CGXA 1QG8A 4Y6NA 5FYEA 2XWLA 1LL3A 4Y7VA 3V91A 1H7LA 2RIYA 5L6VA 5C49A 3U0XA 3ST8A 2APCA 2GGOA 1GA8A 3Q7UA 4G3PA 4G3QA 4JD0A 5C4BA 4HO4A 1XZ6A 1R7VA 1ZI5A 4FRAA 4HO2A 2V0HA 1ON8A 4NALA 1VGTA 4HOCA 5C8RA 1LZIA 2E3DA 5HS2A 1Z90A 1JYLA 2Y4MA 1GWVA 3CU0A 3K8DA 2VS5A 1VGZA 4EE3A 4FCUA 1TZFA 1YP3A 2VS3A 1TW5A 1ZJ1A 1MP5A 3FWWA 3OH2A 3CKJA 1MP3A 2WE9A 4LW6A 3IOIA 4IRQA 2NXVA 3SXGA 2OI5A 2WVMA 3IOJA 1H5SC 5CQPA 1OQMB 1H5SD 3K8EA 1FG5N 2PGYA 2ZU7A 4KQLA 2Q4JA 2RJ9A 3PKQA 1GQCA 2VXMA 1JYKA 4D0ZA 3I0KA 2X60A 4ASJA 3SXBA 4B42A 2D7IA 2P6WA 2OEFA 3TZTA 4KPZA 3I0JA 1FZWA 3T7NA 1H7QA 2YQHA 3LW6A 4M2BA 1WSZA 4D0TA 2D7RA 2YQCA 3Q80A 1G3LA 1LL2A 1VZXA 4E1KA 3DJ4A 5C36A 4CVHA 3SX7A 2RIZA 1R7XA 4FROA 2WEEA 4FRMA 2Z86A 3RSBA 3T7OA 1ZDFA 5C4FA 4Y7UA 4EEOA 3NGWA 1EYRA 5C4CA 1GQ9A 2AGDA 4HO3A 2QH5A 2I5KA 2ICXA 1O0RA 3U2VA 1G0RA 3GUEA 3OH1A 4C2SA 5C3DA 4B4BA 4Y9XA 1S4NA 2O1FA 1H4DA 2QKXA 4EEAA 1FR9A 2V0LA 3CKVA 3PNNA 4LW3A 1O23B 1VH1A 5FUHA 2FYCB 1R7UA 1I52A 1ZI1A 1WT3A 5IDTA 1G1LA 4FREA 1R80A 3SXDA 5C38A 1V83A 2BO8A 1TVYA 2WVLA 4D11A 2FYDB 3EE5A 3OH4A 2V0KA 4HCQA 1V84A 4BQHA 3R3IA 5C3AA 2XWNA 2FFVA 1QGQA 3BCVA 1G2VA 1HM0A 3DUVA 2RJ5A 5CQLX 3JUKA 1MP4A 1LZ0A 4KPXA 2FY7A 1GWWA 1JVDA 1NHEB 5AJOA 4ZDQA 2WAWA 1H7HA 2VD4A 3N9WA 1LVWA 4B2WA 2RJ0A 3SXCA 4FRHA 2Z87A
chains in the Genus database with same CATH superfamily
1SS9A 2A8WA 1ZCTA 2Y4LA 2YCMA 4KC4A 5C4EA 3U2XA 1WVCA 3V8ZA 2X5SA 2A8UA 2I5EA 1HJJA 1WT2A 1ON6A 4EEMA 5AJPA 4O6MA 5C4DA 3OC9A 2AECA 4FRDA 4IRPA 4FRBA 4L41C 4Y7FA 1ZIZA 1EZIA 2X5ZA 3DK5A 1FO9A 2ICYA 5CMGX 3SXEA 5D91A 4Y7GA 2Y6PA 3SPTA 2AH9A 3V90A 4CJCA 4DE7A 2FFUA 2PA4A 2FYBA 1ZJ0A 1YP2A 2BO6A 3SX8A 3SX5A 4EE4A 4KT7A 2E8BA 5DDTA 2P73A 1H4CA 4GBPA 5C3BA 4FQWA 1VPAA 1ZCYA 1ZJ2A 1W55A 1H5RB 1O7QA 1R7TA 3TQDA 4FRQA 2X65A 3USRA 5IDSA 2JCOA 3OAMA 1XHBA 4KC2A 4J18A 1ZCUA 1H4EA 1ZI3A 1IINA 2VSHA 2W0WA 3ZLLA 1R7YA 3V0PA 5C1HA 2PX7A 1G95A 2BO4A 1VGUA 3ZGGA 5C48A 1W77A 2Y4JA 1S4PA 3I0GA 2VSIA 2WGZA 5EIYA 5JQQA 1H5TA 2MZBA 1G23A 3V0LA 2YESA 1JVGA 5DDVA 1H5SA 1FGGA 1PZYB 1FR8A 2WVKA 1QGSA 1HV9A 2P72A 4KXOA 4HO8A 1NQIB 4HO5A 3T7MA 4B4GA 1KWSA 2QGIA 2YC3A 4D48A 1FWYA 1YROB 3E25A 1WT1A 5AJNA 4P00A 1G9RA 2RJ1A 1IIMA 3JUJA 1G8OA 1INIA 4K6RA 1LZ7A 4NANA 3CKOA 2XMEA 2YC5A 1H3MA 2RITA 2VXLA 4G87A 1YP4A 4Q7CA 1VZTA 3V0MA 4MYBA 4AYJA 4CJBA 2JCLA 4KC1A 2I7BA 1R81A 1JV3A 2OEGA 4KNXA 4FRPA 2O1GA 2JCKA 2XWMA 2YQSA 4EVWA 4ASYA 3KIAA 3O3PA 3V0OA 3OKRA 5FV9A 2RJ4A 4ARWA 3V8YA 3V0QA 4NAKA 3I0HA 4DDZA 4B5BA 3F1CA 3I0CA 1ZCVA 1FO8A 3U2UA 2BO7A 3CKQA 1W57A 2CU2A 2RJ6A 1ZHJA 2RJ7A 5CQNX 1INJA 1H7EA 1S4OA 5CMIA 2OI7A 3D98A 5FTVA 4FIYA 1H7GA 2D0JA 2GGQA 3PKPA 3ZLKA 1ZI4A 2Y7AA 4KRVA 2OI6A 4Y62A 1HJLA 1H7TA 1ZJPA 2AESA 1K4VA 1LL0A 4FCEA 3RMVA 2V0JA 3JTJA 2DPWA 1VM8A 2W0VA 4P02A 3F1YA 4HO0A 3U2WA 5J49A 4HO9A 4XWIA 2XMHA 3CKNA 3U2TA 3I0EA 4Y64A 3OH3A 3POLA 3E26A 1R82A 4JISA 2VS4A 2UX8A 3ZF8A 1ZJ3A 3I0IX 1GX0A 4EEGA 1HM8A 2YQJA 5CQMX 1JV1A 1GX4A 1H5RA 3USQA 2ZU8A 4KNRA 3SX3A 5EJ1A 4CJ8A 4DECA 5C1GA 4BMAA 4EE5A 3IOHA 4FRLA 5FTSA 2JCJA 5CQOA 2RIXA 3R2WA 4B3UA 1PZTA 4M2AA 2AM5A 1TW1A 2RJ8A 4AAWA 4YS8A 4AC3A 4D11C 3OGZA 1OMXA 4B4MA 1MC3A 3I0FA 4UEGA 5FU8A 4ECMA 2AM4A 1O7OA 3SXAA 1FRWA 1NKHB 3RMWA 2ZU9A 5CMJA 4M28A 1VGWA 1FGXA 1ZDGA 5CMHA 5I1FA 1H7FA 5BXCA 1WT0A 2AE7A 5L6SA 3ZGFA 1NWGB 1NMMB 5EJZA 1HM9A 4B2XA 4Y63A 1LZJA 1VZUA 1E5KA 1H5TB 1OMZA 4Y6UA 4FIXA 3FOQA 1QWJA 4HG6A 4R7PA 1H5SB 2PGVA 3BRKX 4Y7TA 3Q4SA 4HO6A 5CMFX 4G3SA 5IFYA 1ZJOA 5C1LA 1FXOA 1NF5B 2V0IA 2VFZA 5C47A 1G93A 3HL3A 3I0LA 2Y4KA 1VICA 3OH0A 1VH3A 5FU0A 3D5NA 4NAIA 4M4KA 4AYLA 2AM3A 1FXJA 1V82A 1FOAA 3QVBA 1G97A 3U0YA 2FYAA 4MNDA 3V0NA 3D8VA 2O1HA 3I0DA 3CGXA 1QG8A 4Y6NA 5FYEA 2XWLA 1LL3A 4Y7VA 3V91A 1H7LA 2RIYA 5L6VA 5C49A 3U0XA 3ST8A 2APCA 2GGOA 1GA8A 3Q7UA 4G3PA 4G3QA 4JD0A 5C4BA 4HO4A 1XZ6A 1R7VA 1ZI5A 4FRAA 4HO2A 4MIXA 2V0HA 1ON8A 4O6NA 4NALA 1VGTA 4HOCA 5C8RA 1LZIA 2E3DA 5HS2A 1Z90A 1JYLA 2Y4MA 1GWVA 3CU0A 3K8DA 2VS5A 1VGZA 4EE3A 4FCUA 1TZFA 1YP3A 2VS3A 1TW5A 1ZJ1A 1MP5A 3FWWA 3OH2A 3CKJA 1MP3A 2WE9A 2C0NA 4LW6A 3IOIA 4IRQA 5D92A 2NXVA 3SXGA 2OI5A 2WVMA 3IOJA 1H5SC 5CQPA 1OQMB 1H5SD 3K8EA 1FG5N 2PGYA 2ZU7A 4KQLA 2Q4JA 2RJ9A 3PKQA 1GQCA 2VXMA 1JYKA 4D0ZA 3I0KA 2X60A 4ASJA 3SXBA 4B42A 2D7IA 2P6WA 2OEFA 3TZTA 4KPZA 3I0JA 1FZWA 3T7NA 1H7QA 2YQHA 3LW6A 4M2BA 1WSZA 4D0TA 2D7RA 2YQCA 3Q80A 1G3LA 1LL2A 1VZXA 4E1KA 3DJ4A 5C36A 2J0BA 4CVHA 3SX7A 2RIZA 1R7XA 4FROA 2WEEA 4FRMA 2J0AA 2Z86A 3RSBA 3T7OA 1ZDFA 5C4FA 4Y7UA 2VK9A 4EEOA 3NGWA 1EYRA 5C4CA 1GQ9A 2AGDA 4HO3A 2QH5A 2I5KA 2ICXA 1O0RA 3U2VA 1G0RA 3GUEA 3OH1A 4C2SA 5C3DA 4B4BA 4Y9XA 1S4NA 2O1FA 1H4DA 2QKXA 4EEAA 1FR9A 2V0LA 3CKVA 3PNNA 4LW3A 1O23B 1VH1A 5FUHA 2FYCB 1R7UA 1I52A 1ZI1A 1WT3A 5IDTA 1G1LA 4FREA 1R80A 3SXDA 5C38A 1V83A 2BO8A 1TVYA 2WVLA 4D11A 2FYDB 3EE5A 3OH4A 2V0KA 4HCQA 1V84A 4BQHA 3R3IA 5C3AA 2XWNA 2FFVA 1QGQA 3BCVA 1G2VA 1HM0A 3DUVA 2RJ5A 5CQLX 3JUKA 1MP4A 1LZ0A 4KPXA 2FY7A 1GWWA 1JVDA 1NHEB 5AJOA 4ZDQA 2WAWA 1H7HA 2VD4A 3N9WA 1LVWA 4B2WA 2RJ0A 3SXCA 4FRHA 2Z87A
chains in the Genus database with same CATH topology
1SS9A 2A8WA 1ZCTA 2Y4LA 2YCMA 4KC4A 5C4EA 3U2XA 1WVCA 3V8ZA 2X5SA 2A8UA 2I5EA 1HJJA 1WT2A 1ON6A 4EEMA 5AJPA 4O6MA 5C4DA 3OC9A 2AECA 4FRDA 4IRPA 4FRBA 4L41C 4Y7FA 1ZIZA 1EZIA 2X5ZA 3DK5A 1FO9A 2ICYA 5CMGX 3SXEA 5D91A 4Y7GA 2Y6PA 3SPTA 2AH9A 3V90A 4CJCA 4DE7A 2FFUA 2PA4A 2FYBA 1ZJ0A 1YP2A 2BO6A 3SX8A 3SX5A 4EE4A 4KT7A 2E8BA 5DDTA 2P73A 1H4CA 4GBPA 5C3BA 4FQWA 1VPAA 1ZCYA 1ZJ2A 1W55A 1H5RB 1O7QA 1R7TA 3TQDA 4FRQA 2X65A 3USRA 5IDSA 2JCOA 3OAMA 1XHBA 4KC2A 4J18A 1ZCUA 1H4EA 1ZI3A 1IINA 2VSHA 2W0WA 3ZLLA 1R7YA 3V0PA 5C1HA 2PX7A 1G95A 2BO4A 1VGUA 3ZGGA 5C48A 1W77A 2Y4JA 1S4PA 3I0GA 2VSIA 2WGZA 5EIYA 5JQQA 1H5TA 2MZBA 1G23A 3V0LA 2YESA 1JVGA 5DDVA 1H5SA 1FGGA 1PZYB 1FR8A 2WVKA 1QGSA 1HV9A 2P72A 4KXOA 4HO8A 1NQIB 4HO5A 3T7MA 4B4GA 1KWSA 2QGIA 2YC3A 4D48A 1FWYA 1YROB 3E25A 1WT1A 5AJNA 4P00A 1G9RA 2RJ1A 1IIMA 3JUJA 1G8OA 1INIA 4K6RA 1LZ7A 4NANA 3CKOA 2XMEA 2YC5A 1H3MA 2RITA 2VXLA 4G87A 1YP4A 4Q7CA 1VZTA 3V0MA 4MYBA 4AYJA 4CJBA 2JCLA 4KC1A 2I7BA 1R81A 1JV3A 2OEGA 4KNXA 4FRPA 2O1GA 2JCKA 2XWMA 2YQSA 4EVWA 4ASYA 3KIAA 3O3PA 3V0OA 3OKRA 5FV9A 2RJ4A 4ARWA 3V8YA 3V0QA 4NAKA 3I0HA 4DDZA 4B5BA 3F1CA 3I0CA 1ZCVA 1FO8A 3U2UA 2BO7A 3CKQA 1W57A 2CU2A 2RJ6A 1ZHJA 2RJ7A 5CQNX 1INJA 1H7EA 1S4OA 5CMIA 2OI7A 3D98A 5FTVA 4FIYA 1H7GA 2D0JA 2GGQA 3PKPA 3ZLKA 1ZI4A 2Y7AA 4KRVA 2OI6A 4Y62A 1HJLA 1H7TA 1ZJPA 2AESA 1K4VA 1LL0A 4FCEA 3RMVA 2V0JA 3JTJA 2DPWA 1VM8A 2W0VA 4P02A 3F1YA 4HO0A 3U2WA 5J49A 4HO9A 4XWIA 2XMHA 3CKNA 3U2TA 3I0EA 4Y64A 3OH3A 3POLA 3E26A 1R82A 4JISA 2VS4A 2UX8A 3ZF8A 1ZJ3A 3I0IX 1GX0A 4EEGA 1HM8A 2YQJA 5CQMX 1JV1A 1GX4A 1H5RA 3USQA 2ZU8A 4KNRA 3SX3A 5EJ1A 4CJ8A 4DECA 5C1GA 4BMAA 4EE5A 3IOHA 4FRLA 5FTSA 2JCJA 5CQOA 2RIXA 3R2WA 4B3UA 1PZTA 4M2AA 2AM5A 1TW1A 2RJ8A 4AAWA 4YS8A 4AC3A 4D11C 3OGZA 1OMXA 4B4MA 1MC3A 3I0FA 4UEGA 5FU8A 4ECMA 2AM4A 1O7OA 3SXAA 1FRWA 1NKHB 3RMWA 2ZU9A 5CMJA 4M28A 1VGWA 1FGXA 1ZDGA 5CMHA 5I1FA 1H7FA 5BXCA 1WT0A 2AE7A 5L6SA 3ZGFA 1NWGB 1NMMB 5EJZA 1HM9A 4B2XA 4Y63A 1LZJA 1VZUA 1E5KA 1H5TB 1OMZA 4Y6UA 4FIXA 3FOQA 1QWJA 4HG6A 4R7PA 1H5SB 2PGVA 3BRKX 4Y7TA 3Q4SA 4HO6A 5CMFX 4G3SA 5IFYA 1ZJOA 5C1LA 1FXOA 1NF5B 2V0IA 2VFZA 5C47A 1G93A 3HL3A 3I0LA 2Y4KA 1VICA 3OH0A 1VH3A 5FU0A 3D5NA 4NAIA 4M4KA 4AYLA 2AM3A 1FXJA 1V82A 1FOAA 3QVBA 1G97A 3U0YA 2FYAA 4MNDA 3V0NA 3D8VA 2O1HA 3I0DA 3CGXA 1QG8A 4Y6NA 5FYEA 2XWLA 1LL3A 4Y7VA 3V91A 1H7LA 2RIYA 5L6VA 5C49A 3U0XA 3ST8A 2APCA 2GGOA 1GA8A 3Q7UA 4G3PA 4G3QA 4JD0A 5C4BA 4HO4A 1XZ6A 1R7VA 1ZI5A 4FRAA 4HO2A 4MIXA 2V0HA 1ON8A 4O6NA 4NALA 1VGTA 4HOCA 5C8RA 1LZIA 2E3DA 5HS2A 1Z90A 1JYLA 2Y4MA 1GWVA 3CU0A 3K8DA 2VS5A 1VGZA 4EE3A 4FCUA 1TZFA 1YP3A 2VS3A 1TW5A 1ZJ1A 1MP5A 3FWWA 3OH2A 3CKJA 1MP3A 2WE9A 2C0NA 4LW6A 3IOIA 4IRQA 5D92A 2NXVA 3SXGA 2OI5A 2WVMA 3IOJA 1H5SC 5CQPA 1OQMB 1H5SD 3K8EA 1FG5N 2PGYA 2ZU7A 4KQLA 2Q4JA 2RJ9A 3PKQA 1GQCA 2VXMA 1JYKA 4D0ZA 3I0KA 2X60A 4ASJA 3SXBA 4B42A 2D7IA 2P6WA 2OEFA 3TZTA 4KPZA 3I0JA 1FZWA 3T7NA 1H7QA 2YQHA 3LW6A 4M2BA 1WSZA 4D0TA 2D7RA 2YQCA 3Q80A 1G3LA 1LL2A 1VZXA 4E1KA 3DJ4A 5C36A 2J0BA 4CVHA 3SX7A 2RIZA 1R7XA 4FROA 2WEEA 4FRMA 2J0AA 2Z86A 3RSBA 3T7OA 1ZDFA 5C4FA 4Y7UA 2VK9A 4EEOA 3NGWA 1EYRA 5C4CA 1GQ9A 2AGDA 4HO3A 2QH5A 2I5KA 2ICXA 1O0RA 3U2VA 1G0RA 3GUEA 3OH1A 4C2SA 5C3DA 4B4BA 4Y9XA 1S4NA 2O1FA 1H4DA 2QKXA 4EEAA 1FR9A 2V0LA 3CKVA 3PNNA 4LW3A 1O23B 1VH1A 5FUHA 2FYCB 1R7UA 1I52A 1ZI1A 1WT3A 5IDTA 1G1LA 4FREA 1R80A 3SXDA 5C38A 1V83A 2BO8A 1TVYA 2WVLA 4D11A 2FYDB 3EE5A 3OH4A 2V0KA 4HCQA 1V84A 4BQHA 3R3IA 5C3AA 2XWNA 2FFVA 1QGQA 3BCVA 1G2VA 1HM0A 3DUVA 2RJ5A 5CQLX 3JUKA 1MP4A 1LZ0A 4KPXA 2FY7A 1GWWA 1JVDA 1NHEB 5AJOA 4ZDQA 2WAWA 1H7HA 2VD4A 3N9WA 1LVWA 4B2WA 2RJ0A 3SXCA 4FRHA 2Z87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SS9 A;  2A8W A;  1ZCT A;  2Y4L A;  2YCM A;  4KC4 A;  5C4E A;  3U2X A;  1WVC A;  3V8Z A;  2X5S A;  2A8U A;  2I5E A;  1HJJ A;  1WT2 A;  1ON6 A;  4EEM A;  5AJP A;  5C4D A;  3OC9 A;  2AEC A;  4FRD A;  4IRP A;  4FRB A;  4L41 C;  4Y7F A;  1ZIZ A;  1EZI A;  2X5Z A;  3DK5 A;  1FO9 A;  2ICY A;  5CMG X;  3SXE A;  4Y7G A;  2Y6P A;  3SPT A;  2AH9 A;  3V90 A;  4CJC A;  4DE7 A;  2FFU A;  2PA4 A;  2FYB A;  1ZJ0 A;  1YP2 A;  2BO6 A;  3SX8 A;  3SX5 A;  4EE4 A;  4KT7 A;  2E8B A;  5DDT A;  2P73 A;  1H4C A;  4GBP A;  5C3B A;  4FQW A;  1VPA A;  1ZCY A;  1ZJ2 A;  1W55 A;  1H5R B;  1O7Q A;  1R7T A;  3TQD A;  4FRQ A;  2X65 A;  3USR A;  5IDS A;  2JCO A;  3OAM A;  1XHB A;  4KC2 A;  4J18 A;  1ZCU A;  1H4E A;  1ZI3 A;  1IIN A;  2VSH A;  2W0W A;  3ZLL A;  1R7Y A;  3V0P A;  5C1H A;  2PX7 A;  1G95 A;  2BO4 A;  1VGU A;  3ZGG A;  5C48 A;  1W77 A;  2Y4J A;  1S4P A;  3I0G A;  2VSI A;  2WGZ A;  5EIY A;  5JQQ A;  1H5T A;  2MZB A;  1G23 A;  3V0L A;  2YES A;  1JVG A;  5DDV A;  1H5S A;  1FGG A;  1PZY B;  1FR8 A;  2WVK A;  1QGS A;  1HV9 A;  2P72 A;  4KXO A;  4HO8 A;  1NQI B;  4HO5 A;  3T7M A;  4B4G A;  1KWS A;  2QGI A;  2YC3 A;  4D48 A;  1FWY A;  1YRO B;  3E25 A;  1WT1 A;  5AJN A;  4P00 A;  1G9R A;  2RJ1 A;  1IIM A;  3JUJ A;  1G8O A;  1INI A;  4K6R A;  1LZ7 A;  4NAN A;  3CKO A;  2XME A;  2YC5 A;  1H3M A;  2RIT A;  2VXL A;  4G87 A;  1YP4 A;  3V0M A;  1VZT A;  4MYB A;  4AYJ A;  4CJB A;  2JCL A;  4KC1 A;  2I7B A;  1R81 A;  1JV3 A;  2OEG A;  4KNX A;  4FRP A;  2O1G A;  2JCK A;  2XWM A;  2YQS A;  4EVW A;  4ASY A;  3KIA A;  3O3P A;  3V0O A;  3OKR A;  5FV9 A;  2RJ4 A;  4ARW A;  3V8Y A;  3V0Q A;  4NAK A;  3I0H A;  4DDZ A;  4B5B A;  3F1C A;  3I0C A;  1ZCV A;  1FO8 A;  3U2U A;  2BO7 A;  3CKQ A;  1W57 A;  2CU2 A;  2RJ6 A;  1ZHJ A;  2RJ7 A;  5CQN X;  1INJ A;  1H7E A;  1S4O A;  5CMI A;  2OI7 A;  3D98 A;  5FTV A;  1H7G A;  2D0J A;  2GGQ A;  3PKP A;  3ZLK A;  1ZI4 A;  2Y7A A;  4KRV A;  2OI6 A;  4Y62 A;  1HJL A;  1H7T A;  1ZJP A;  2AES A;  1K4V A;  1LL0 A;  4FCE A;  3RMV A;  2V0J A;  3JTJ A;  2DPW A;  1VM8 A;  2W0V A;  4P02 A;  3F1Y A;  4HO0 A;  3U2W A;  5J49 A;  4HO9 A;  4XWI A;  2XMH A;  3CKN A;  3U2T A;  3I0E A;  4Y64 A;  3OH3 A;  3POL A;  3E26 A;  1R82 A;  4JIS A;  2VS4 A;  2UX8 A;  3ZF8 A;  1ZJ3 A;  3I0I X;  1GX0 A;  4EEG A;  1HM8 A;  2YQJ A;  5CQM X;  1JV1 A;  1GX4 A;  1H5R A;  3USQ A;  2ZU8 A;  4KNR A;  3SX3 A;  5EJ1 A;  4CJ8 A;  4DEC A;  5C1G A;  4BMA A;  4EE5 A;  3IOH A;  4FRL A;  5FTS A;  2JCJ A;  5CQO A;  2RIX A;  3R2W A;  4B3U A;  1PZT A;  4M2A A;  2AM5 A;  1TW1 A;  2RJ8 A;  4AAW A;  4YS8 A;  4AC3 A;  4D11 C;  3OGZ A;  1OMX A;  4B4M A;  1MC3 A;  3I0F A;  4UEG A;  5FU8 A;  4ECM A;  2AM4 A;  1O7O A;  3SXA A;  1FRW A;  1NKH B;  3RMW A;  2ZU9 A;  5CMJ A;  4M28 A;  1VGW A;  1FGX A;  1ZDG A;  5CMH A;  5I1F A;  1H7F A;  5BXC A;  1WT0 A;  2AE7 A;  5L6S A;  3ZGF A;  1NWG B;  1NMM B;  5EJZ A;  1HM9 A;  4B2X A;  4Y63 A;  1LZJ A;  1VZU A;  1E5K A;  1H5T B;  1OMZ A;  4Y6U A;  4HG6 A;  3FOQ A;  1QWJ A;  4R7P A;  4Y7T A;  1H5S B;  2PGV A;  3BRK X;  3Q4S A;  4HO6 A;  5CMF X;  4G3S A;  5IFY A;  1ZJO A;  5C1L A;  1FXO A;  1NF5 B;  2V0I A;  2VFZ A;  5C47 A;  1G93 A;  3HL3 A;  3I0L A;  2Y4K A;  1VIC A;  3OH0 A;  1VH3 A;  5FU0 A;  3D5N A;  4NAI A;  4M4K A;  4AYL A;  2AM3 A;  1FXJ A;  1V82 A;  1FOA A;  3QVB A;  1G97 A;  3U0Y A;  2FYA A;  4MND A;  3V0N A;  3D8V A;  2O1H A;  3I0D A;  3CGX A;  1QG8 A;  4Y6N A;  5FYE A;  2XWL A;  1LL3 A;  4Y7V A;  3V91 A;  1H7L A;  2RIY A;  5L6V A;  5C49 A;  3U0X A;  3ST8 A;  2APC A;  2GGO A;  1GA8 A;  3Q7U A;  4G3P A;  4G3Q A;  4JD0 A;  5C4B A;  4HO4 A;  1XZ6 A;  1R7V A;  1ZI5 A;  4FRA A;  4HO2 A;  2V0H A;  1ON8 A;  4NAL A;  1VGT A;  4HOC A;  5C8R A;  1LZI A;  2E3D A;  5HS2 A;  1Z90 A;  1JYL A;  2Y4M A;  1GWV A;  3CU0 A;  3K8D A;  2VS5 A;  1VGZ A;  4EE3 A;  4FCU A;  1TZF A;  1YP3 A;  2VS3 A;  1TW5 A;  1ZJ1 A;  1MP5 A;  3FWW A;  3OH2 A;  3CKJ A;  1MP3 A;  2WE9 A;  4LW6 A;  3IOI A;  4IRQ A;  2NXV A;  3SXG A;  2OI5 A;  2WVM A;  3IOJ A;  1H5S C;  5CQP A;  1OQM B;  1H5S D;  3K8E A;  1FG5 N;  2PGY A;  2ZU7 A;  4KQL A;  2Q4J A;  2RJ9 A;  3PKQ A;  1GQC A;  2VXM A;  1JYK A;  4D0Z A;  3I0K A;  2X60 A;  4ASJ A;  3SXB A;  4B42 A;  2D7I A;  2P6W A;  2OEF A;  3TZT A;  4KPZ A;  3I0J A;  1FZW A;  3T7N A;  1H7Q A;  2YQH A;  3LW6 A;  4M2B A;  1WSZ A;  4D0T A;  2D7R A;  2YQC A;  3Q80 A;  1G3L A;  1LL2 A;  1VZX A;  4E1K A;  3DJ4 A;  5C36 A;  4CVH A;  3SX7 A;  2RIZ A;  1R7X A;  4FRO A;  2WEE A;  4FRM A;  2Z86 A;  3RSB A;  3T7O A;  1ZDF A;  5C4F A;  4Y7U A;  4EEO A;  3NGW A;  1EYR A;  5C4C A;  1GQ9 A;  2AGD A;  4HO3 A;  2QH5 A;  2I5K A;  2ICX A;  1O0R A;  3U2V A;  1G0R A;  3GUE A;  3OH1 A;  4C2S A;  5C3D A;  4B4B A;  4Y9X A;  1S4N A;  2O1F A;  1H4D A;  2QKX A;  4EEA A;  1FR9 A;  2V0L A;  3CKV A;  3PNN A;  4LW3 A;  1O23 B;  1VH1 A;  5FUH A;  2FYC B;  1R7U A;  1I52 A;  1ZI1 A;  1WT3 A;  5IDT A;  1G1L A;  4FRE A;  1R80 A;  3SXD A;  5C38 A;  1V83 A;  2BO8 A;  1TVY A;  2WVL A;  4D11 A;  2FYD B;  3EE5 A;  3OH4 A;  2V0K A;  4HCQ A;  1V84 A;  4BQH A;  3R3I A;  5C3A A;  2XWN A;  2FFV A;  1QGQ A;  3BCV A;  1G2V A;  1HM0 A;  3DUV A;  2RJ5 A;  5CQL X;  3JUK A;  1MP4 A;  1LZ0 A;  4KPX A;  2FY7 A;  1GWW A;  1JVD A;  1NHE B;  5AJO A;  4ZDQ A;  2WAW A;  1H7H A;  2VD4 A;  3N9W A;  1LVW A;  4B2W A;  2RJ0 A;  3SXC A;  4FRH A;  2Z87 A; 
#chains in the Genus database with same CATH topology
 1SS9 A;  2A8W A;  1ZCT A;  2Y4L A;  2YCM A;  4KC4 A;  5C4E A;  3U2X A;  1WVC A;  3V8Z A;  2X5S A;  2A8U A;  2I5E A;  1HJJ A;  1WT2 A;  1ON6 A;  4EEM A;  5AJP A;  4O6M A;  5C4D A;  3OC9 A;  2AEC A;  4FRD A;  4IRP A;  4FRB A;  4L41 C;  4Y7F A;  1ZIZ A;  1EZI A;  2X5Z A;  3DK5 A;  1FO9 A;  2ICY A;  5CMG X;  3SXE A;  5D91 A;  4Y7G A;  2Y6P A;  3SPT A;  2AH9 A;  3V90 A;  4CJC A;  4DE7 A;  2FFU A;  2PA4 A;  2FYB A;  1ZJ0 A;  1YP2 A;  2BO6 A;  3SX8 A;  3SX5 A;  4EE4 A;  4KT7 A;  2E8B A;  5DDT A;  2P73 A;  1H4C A;  4GBP A;  5C3B A;  4FQW A;  1VPA A;  1ZCY A;  1ZJ2 A;  1W55 A;  1H5R B;  1O7Q A;  1R7T A;  3TQD A;  4FRQ A;  2X65 A;  3USR A;  5IDS A;  2JCO A;  3OAM A;  1XHB A;  4KC2 A;  4J18 A;  1ZCU A;  1H4E A;  1ZI3 A;  1IIN A;  2VSH A;  2W0W A;  3ZLL A;  1R7Y A;  3V0P A;  5C1H A;  2PX7 A;  1G95 A;  2BO4 A;  1VGU A;  3ZGG A;  5C48 A;  1W77 A;  2Y4J A;  1S4P A;  3I0G A;  2VSI A;  2WGZ A;  5EIY A;  5JQQ A;  1H5T A;  2MZB A;  1G23 A;  3V0L A;  2YES A;  1JVG A;  5DDV A;  1H5S A;  1FGG A;  1PZY B;  1FR8 A;  2WVK A;  1QGS A;  1HV9 A;  2P72 A;  4KXO A;  4HO8 A;  1NQI B;  4HO5 A;  3T7M A;  4B4G A;  1KWS A;  2QGI A;  2YC3 A;  4D48 A;  1FWY A;  1YRO B;  3E25 A;  1WT1 A;  5AJN A;  4P00 A;  1G9R A;  2RJ1 A;  1IIM A;  3JUJ A;  1G8O A;  1INI A;  4K6R A;  1LZ7 A;  4NAN A;  3CKO A;  2XME A;  2YC5 A;  1H3M A;  2RIT A;  2VXL A;  4G87 A;  1YP4 A;  4Q7C A;  1VZT A;  3V0M A;  4MYB A;  4AYJ A;  4CJB A;  2JCL A;  4KC1 A;  2I7B A;  1R81 A;  1JV3 A;  2OEG A;  4KNX A;  4FRP A;  2O1G A;  2JCK A;  2XWM A;  2YQS A;  4EVW A;  4ASY A;  3KIA A;  3O3P A;  3V0O A;  3OKR A;  5FV9 A;  2RJ4 A;  4ARW A;  3V8Y A;  3V0Q A;  4NAK A;  3I0H A;  4DDZ A;  4B5B A;  3F1C A;  3I0C A;  1ZCV A;  1FO8 A;  3U2U A;  2BO7 A;  3CKQ A;  1W57 A;  2CU2 A;  2RJ6 A;  1ZHJ A;  2RJ7 A;  5CQN X;  1INJ A;  1H7E A;  1S4O A;  5CMI A;  2OI7 A;  3D98 A;  5FTV A;  4FIY A;  1H7G A;  2D0J A;  2GGQ A;  3PKP A;  3ZLK A;  1ZI4 A;  2Y7A A;  4KRV A;  2OI6 A;  4Y62 A;  1HJL A;  1H7T A;  1ZJP A;  2AES A;  1K4V A;  1LL0 A;  4FCE A;  3RMV A;  2V0J A;  3JTJ A;  2DPW A;  1VM8 A;  2W0V A;  4P02 A;  3F1Y A;  4HO0 A;  3U2W A;  5J49 A;  4HO9 A;  4XWI A;  2XMH A;  3CKN A;  3U2T A;  3I0E A;  4Y64 A;  3OH3 A;  3POL A;  3E26 A;  1R82 A;  4JIS A;  2VS4 A;  2UX8 A;  3ZF8 A;  1ZJ3 A;  3I0I X;  1GX0 A;  4EEG A;  1HM8 A;  2YQJ A;  5CQM X;  1JV1 A;  1GX4 A;  1H5R A;  3USQ A;  2ZU8 A;  4KNR A;  3SX3 A;  5EJ1 A;  4CJ8 A;  4DEC A;  5C1G A;  4BMA A;  4EE5 A;  3IOH A;  4FRL A;  5FTS A;  2JCJ A;  5CQO A;  2RIX A;  3R2W A;  4B3U A;  1PZT A;  4M2A A;  2AM5 A;  1TW1 A;  2RJ8 A;  4AAW A;  4YS8 A;  4AC3 A;  4D11 C;  3OGZ A;  1OMX A;  4B4M A;  1MC3 A;  3I0F A;  4UEG A;  5FU8 A;  4ECM A;  2AM4 A;  1O7O A;  3SXA A;  1FRW A;  1NKH B;  3RMW A;  2ZU9 A;  5CMJ A;  4M28 A;  1VGW A;  1FGX A;  1ZDG A;  5CMH A;  5I1F A;  1H7F A;  5BXC A;  1WT0 A;  2AE7 A;  5L6S A;  3ZGF A;  1NWG B;  1NMM B;  5EJZ A;  1HM9 A;  4B2X A;  4Y63 A;  1LZJ A;  1VZU A;  1E5K A;  1H5T B;  1OMZ A;  4Y6U A;  4FIX A;  3FOQ A;  1QWJ A;  4HG6 A;  4R7P A;  1H5S B;  2PGV A;  3BRK X;  4Y7T A;  3Q4S A;  4HO6 A;  5CMF X;  4G3S A;  5IFY A;  1ZJO A;  5C1L A;  1FXO A;  1NF5 B;  2V0I A;  2VFZ A;  5C47 A;  1G93 A;  3HL3 A;  3I0L A;  2Y4K A;  1VIC A;  3OH0 A;  1VH3 A;  5FU0 A;  3D5N A;  4NAI A;  4M4K A;  4AYL A;  2AM3 A;  1FXJ A;  1V82 A;  1FOA A;  3QVB A;  1G97 A;  3U0Y A;  2FYA A;  4MND A;  3V0N A;  3D8V A;  2O1H A;  3I0D A;  3CGX A;  1QG8 A;  4Y6N A;  5FYE A;  2XWL A;  1LL3 A;  4Y7V A;  3V91 A;  1H7L A;  2RIY A;  5L6V A;  5C49 A;  3U0X A;  3ST8 A;  2APC A;  2GGO A;  1GA8 A;  3Q7U A;  4G3P A;  4G3Q A;  4JD0 A;  5C4B A;  4HO4 A;  1XZ6 A;  1R7V A;  1ZI5 A;  4FRA A;  4HO2 A;  4MIX A;  2V0H A;  1ON8 A;  4O6N A;  4NAL A;  1VGT A;  4HOC A;  5C8R A;  1LZI A;  2E3D A;  5HS2 A;  1Z90 A;  1JYL A;  2Y4M A;  1GWV A;  3CU0 A;  3K8D A;  2VS5 A;  1VGZ A;  4EE3 A;  4FCU A;  1TZF A;  1YP3 A;  2VS3 A;  1TW5 A;  1ZJ1 A;  1MP5 A;  3FWW A;  3OH2 A;  3CKJ A;  1MP3 A;  2WE9 A;  2C0N A;  4LW6 A;  3IOI A;  4IRQ A;  5D92 A;  2NXV A;  3SXG A;  2OI5 A;  2WVM A;  3IOJ A;  1H5S C;  5CQP A;  1OQM B;  1H5S D;  3K8E A;  1FG5 N;  2PGY A;  2ZU7 A;  4KQL A;  2Q4J A;  2RJ9 A;  3PKQ A;  1GQC A;  2VXM A;  1JYK A;  4D0Z A;  3I0K A;  2X60 A;  4ASJ A;  3SXB A;  4B42 A;  2D7I A;  2P6W A;  2OEF A;  3TZT A;  4KPZ A;  3I0J A;  1FZW A;  3T7N A;  1H7Q A;  2YQH A;  3LW6 A;  4M2B A;  1WSZ A;  4D0T A;  2D7R A;  2YQC A;  3Q80 A;  1G3L A;  1LL2 A;  1VZX A;  4E1K A;  3DJ4 A;  5C36 A;  2J0B A;  4CVH A;  3SX7 A;  2RIZ A;  1R7X A;  4FRO A;  2WEE A;  4FRM A;  2J0A A;  2Z86 A;  3RSB A;  3T7O A;  1ZDF A;  5C4F A;  4Y7U A;  2VK9 A;  4EEO A;  3NGW A;  1EYR A;  5C4C A;  1GQ9 A;  2AGD A;  4HO3 A;  2QH5 A;  2I5K A;  2ICX A;  1O0R A;  3U2V A;  1G0R A;  3GUE A;  3OH1 A;  4C2S A;  5C3D A;  4B4B A;  4Y9X A;  1S4N A;  2O1F A;  1H4D A;  2QKX A;  4EEA A;  1FR9 A;  2V0L A;  3CKV A;  3PNN A;  4LW3 A;  1O23 B;  1VH1 A;  5FUH A;  2FYC B;  1R7U A;  1I52 A;  1ZI1 A;  1WT3 A;  5IDT A;  1G1L A;  4FRE A;  1R80 A;  3SXD A;  5C38 A;  1V83 A;  2BO8 A;  1TVY A;  2WVL A;  4D11 A;  2FYD B;  3EE5 A;  3OH4 A;  2V0K A;  4HCQ A;  1V84 A;  4BQH A;  3R3I A;  5C3A A;  2XWN A;  2FFV A;  1QGQ A;  3BCV A;  1G2V A;  1HM0 A;  3DUV A;  2RJ5 A;  5CQL X;  3JUK A;  1MP4 A;  1LZ0 A;  4KPX A;  2FY7 A;  1GWW A;  1JVD A;  1NHE B;  5AJO A;  4ZDQ A;  2WAW A;  1H7H A;  2VD4 A;  3N9W A;  1LVW A;  4B2W A;  2RJ0 A;  3SXC A;  4FRH A;  2Z87 A; 
#chains in the Genus database with same CATH homology
 1SS9 A;  2A8W A;  1ZCT A;  2Y4L A;  2YCM A;  4KC4 A;  5C4E A;  3U2X A;  1WVC A;  3V8Z A;  2X5S A;  2A8U A;  2I5E A;  1HJJ A;  1WT2 A;  1ON6 A;  4EEM A;  5AJP A;  4O6M A;  5C4D A;  3OC9 A;  2AEC A;  4FRD A;  4IRP A;  4FRB A;  4L41 C;  4Y7F A;  1ZIZ A;  1EZI A;  2X5Z A;  3DK5 A;  1FO9 A;  2ICY A;  5CMG X;  3SXE A;  5D91 A;  4Y7G A;  2Y6P A;  3SPT A;  2AH9 A;  3V90 A;  4CJC A;  4DE7 A;  2FFU A;  2PA4 A;  2FYB A;  1ZJ0 A;  1YP2 A;  2BO6 A;  3SX8 A;  3SX5 A;  4EE4 A;  4KT7 A;  2E8B A;  5DDT A;  2P73 A;  1H4C A;  4GBP A;  5C3B A;  4FQW A;  1VPA A;  1ZCY A;  1ZJ2 A;  1W55 A;  1H5R B;  1O7Q A;  1R7T A;  3TQD A;  4FRQ A;  2X65 A;  3USR A;  5IDS A;  2JCO A;  3OAM A;  1XHB A;  4KC2 A;  4J18 A;  1ZCU A;  1H4E A;  1ZI3 A;  1IIN A;  2VSH A;  2W0W A;  3ZLL A;  1R7Y A;  3V0P A;  5C1H A;  2PX7 A;  1G95 A;  2BO4 A;  1VGU A;  3ZGG A;  5C48 A;  1W77 A;  2Y4J A;  1S4P A;  3I0G A;  2VSI A;  2WGZ A;  5EIY A;  5JQQ A;  1H5T A;  2MZB A;  1G23 A;  3V0L A;  2YES A;  1JVG A;  5DDV A;  1H5S A;  1FGG A;  1PZY B;  1FR8 A;  2WVK A;  1QGS A;  1HV9 A;  2P72 A;  4KXO A;  4HO8 A;  1NQI B;  4HO5 A;  3T7M A;  4B4G A;  1KWS A;  2QGI A;  2YC3 A;  4D48 A;  1FWY A;  1YRO B;  3E25 A;  1WT1 A;  5AJN A;  4P00 A;  1G9R A;  2RJ1 A;  1IIM A;  3JUJ A;  1G8O A;  1INI A;  4K6R A;  1LZ7 A;  4NAN A;  3CKO A;  2XME A;  2YC5 A;  1H3M A;  2RIT A;  2VXL A;  4G87 A;  1YP4 A;  4Q7C A;  1VZT A;  3V0M A;  4MYB A;  4AYJ A;  4CJB A;  2JCL A;  4KC1 A;  2I7B A;  1R81 A;  1JV3 A;  2OEG A;  4KNX A;  4FRP A;  2O1G A;  2JCK A;  2XWM A;  2YQS A;  4EVW A;  4ASY A;  3KIA A;  3O3P A;  3V0O A;  3OKR A;  5FV9 A;  2RJ4 A;  4ARW A;  3V8Y A;  3V0Q A;  4NAK A;  3I0H A;  4DDZ A;  4B5B A;  3F1C A;  3I0C A;  1ZCV A;  1FO8 A;  3U2U A;  2BO7 A;  3CKQ A;  1W57 A;  2CU2 A;  2RJ6 A;  1ZHJ A;  2RJ7 A;  5CQN X;  1INJ A;  1H7E A;  1S4O A;  5CMI A;  2OI7 A;  3D98 A;  5FTV A;  4FIY A;  1H7G A;  2D0J A;  2GGQ A;  3PKP A;  3ZLK A;  1ZI4 A;  2Y7A A;  4KRV A;  2OI6 A;  4Y62 A;  1HJL A;  1H7T A;  1ZJP A;  2AES A;  1K4V A;  1LL0 A;  4FCE A;  3RMV A;  2V0J A;  3JTJ A;  2DPW A;  1VM8 A;  2W0V A;  4P02 A;  3F1Y A;  4HO0 A;  3U2W A;  5J49 A;  4HO9 A;  4XWI A;  2XMH A;  3CKN A;  3U2T A;  3I0E A;  4Y64 A;  3OH3 A;  3POL A;  3E26 A;  1R82 A;  4JIS A;  2VS4 A;  2UX8 A;  3ZF8 A;  1ZJ3 A;  3I0I X;  1GX0 A;  4EEG A;  1HM8 A;  2YQJ A;  5CQM X;  1JV1 A;  1GX4 A;  1H5R A;  3USQ A;  2ZU8 A;  4KNR A;  3SX3 A;  5EJ1 A;  4CJ8 A;  4DEC A;  5C1G A;  4BMA A;  4EE5 A;  3IOH A;  4FRL A;  5FTS A;  2JCJ A;  5CQO A;  2RIX A;  3R2W A;  4B3U A;  1PZT A;  4M2A A;  2AM5 A;  1TW1 A;  2RJ8 A;  4AAW A;  4YS8 A;  4AC3 A;  4D11 C;  3OGZ A;  1OMX A;  4B4M A;  1MC3 A;  3I0F A;  4UEG A;  5FU8 A;  4ECM A;  2AM4 A;  1O7O A;  3SXA A;  1FRW A;  1NKH B;  3RMW A;  2ZU9 A;  5CMJ A;  4M28 A;  1VGW A;  1FGX A;  1ZDG A;  5CMH A;  5I1F A;  1H7F A;  5BXC A;  1WT0 A;  2AE7 A;  5L6S A;  3ZGF A;  1NWG B;  1NMM B;  5EJZ A;  1HM9 A;  4B2X A;  4Y63 A;  1LZJ A;  1VZU A;  1E5K A;  1H5T B;  1OMZ A;  4Y6U A;  4FIX A;  3FOQ A;  1QWJ A;  4HG6 A;  4R7P A;  1H5S B;  2PGV A;  3BRK X;  4Y7T A;  3Q4S A;  4HO6 A;  5CMF X;  4G3S A;  5IFY A;  1ZJO A;  5C1L A;  1FXO A;  1NF5 B;  2V0I A;  2VFZ A;  5C47 A;  1G93 A;  3HL3 A;  3I0L A;  2Y4K A;  1VIC A;  3OH0 A;  1VH3 A;  5FU0 A;  3D5N A;  4NAI A;  4M4K A;  4AYL A;  2AM3 A;  1FXJ A;  1V82 A;  1FOA A;  3QVB A;  1G97 A;  3U0Y A;  2FYA A;  4MND A;  3V0N A;  3D8V A;  2O1H A;  3I0D A;  3CGX A;  1QG8 A;  4Y6N A;  5FYE A;  2XWL A;  1LL3 A;  4Y7V A;  3V91 A;  1H7L A;  2RIY A;  5L6V A;  5C49 A;  3U0X A;  3ST8 A;  2APC A;  2GGO A;  1GA8 A;  3Q7U A;  4G3P A;  4G3Q A;  4JD0 A;  5C4B A;  4HO4 A;  1XZ6 A;  1R7V A;  1ZI5 A;  4FRA A;  4HO2 A;  4MIX A;  2V0H A;  1ON8 A;  4O6N A;  4NAL A;  1VGT A;  4HOC A;  5C8R A;  1LZI A;  2E3D A;  5HS2 A;  1Z90 A;  1JYL A;  2Y4M A;  1GWV A;  3CU0 A;  3K8D A;  2VS5 A;  1VGZ A;  4EE3 A;  4FCU A;  1TZF A;  1YP3 A;  2VS3 A;  1TW5 A;  1ZJ1 A;  1MP5 A;  3FWW A;  3OH2 A;  3CKJ A;  1MP3 A;  2WE9 A;  2C0N A;  4LW6 A;  3IOI A;  4IRQ A;  5D92 A;  2NXV A;  3SXG A;  2OI5 A;  2WVM A;  3IOJ A;  1H5S C;  5CQP A;  1OQM B;  1H5S D;  3K8E A;  1FG5 N;  2PGY A;  2ZU7 A;  4KQL A;  2Q4J A;  2RJ9 A;  3PKQ A;  1GQC A;  2VXM A;  1JYK A;  4D0Z A;  3I0K A;  2X60 A;  4ASJ A;  3SXB A;  4B42 A;  2D7I A;  2P6W A;  2OEF A;  3TZT A;  4KPZ A;  3I0J A;  1FZW A;  3T7N A;  1H7Q A;  2YQH A;  3LW6 A;  4M2B A;  1WSZ A;  4D0T A;  2D7R A;  2YQC A;  3Q80 A;  1G3L A;  1LL2 A;  1VZX A;  4E1K A;  3DJ4 A;  5C36 A;  2J0B A;  4CVH A;  3SX7 A;  2RIZ A;  1R7X A;  4FRO A;  2WEE A;  4FRM A;  2J0A A;  2Z86 A;  3RSB A;  3T7O A;  1ZDF A;  5C4F A;  4Y7U A;  2VK9 A;  4EEO A;  3NGW A;  1EYR A;  5C4C A;  1GQ9 A;  2AGD A;  4HO3 A;  2QH5 A;  2I5K A;  2ICX A;  1O0R A;  3U2V A;  1G0R A;  3GUE A;  3OH1 A;  4C2S A;  5C3D A;  4B4B A;  4Y9X A;  1S4N A;  2O1F A;  1H4D A;  2QKX A;  4EEA A;  1FR9 A;  2V0L A;  3CKV A;  3PNN A;  4LW3 A;  1O23 B;  1VH1 A;  5FUH A;  2FYC B;  1R7U A;  1I52 A;  1ZI1 A;  1WT3 A;  5IDT A;  1G1L A;  4FRE A;  1R80 A;  3SXD A;  5C38 A;  1V83 A;  2BO8 A;  1TVY A;  2WVL A;  4D11 A;  2FYD B;  3EE5 A;  3OH4 A;  2V0K A;  4HCQ A;  1V84 A;  4BQH A;  3R3I A;  5C3A A;  2XWN A;  2FFV A;  1QGQ A;  3BCV A;  1G2V A;  1HM0 A;  3DUV A;  2RJ5 A;  5CQL X;  3JUK A;  1MP4 A;  1LZ0 A;  4KPX A;  2FY7 A;  1GWW A;  1JVD A;  1NHE B;  5AJO A;  4ZDQ A;  2WAW A;  1H7H A;  2VD4 A;  3N9W A;  1LVW A;  4B2W A;  2RJ0 A;  3SXC A;  4FRH A;  2Z87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...