1QH0A

Ferredoxin:nadp+ reductase mutant with leu 76 mutated by asp and leu 78 mutated by asp
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
295
structure length
295
Chain Sequence
b'DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKDRDYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FERREDOXIN:NADP+ REDUCTASE)
molecule tags Oxidoreductase
source organism Nostoc sp.
publication title Role of a cluster of hydrophobic residues near the FAD cofactor in Anabaena PCC 7119 ferredoxin-NADP+ reductase for optimal complex formation and electron transfer to ferredoxin.
pubmed doi rcsb
total genus 89
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1999-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1qh0A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1qh0A02
4YAUA 3CB4A 4ZCLA 1YJ9B 1VQ5B 3MCAA 3CCJB 1Q7YD 2BF4A 4M0LA 3PENA 1GAQA 1TUIA 3AVXA 1DARA 1FNDA 3FPKA 4YHBA 3QFRA 1GJRA 2BV3A 1OB5A 1FNCA 1GO2A 5H5JA 5TR9A 3B82A 1D2EA 3CCMB 1SM4A 1QFYA 1ZM4A 4IW3B 3WNDA 1QFJA 3CCUB 1HA3A 2HCJB 5FA6A 4NBSA 2J7KA 3ZBTA 4TMWA 1K8AD 1JA1A 3VO1A 1Q81D 3ZZTA 1FNBA 4ZGQB 2BN4A 4RCZA 1ZUNB 1M1KD 1BJKA 3QFCA 4YAFA 3LO8A 5HXBA 1F60A 4Q7JB 1JJ2B 2OTJB 1QGYA 1G7RA 3P27A 2VNKA 3U6BA 4BPRA 3ZZ0A 1XB2A 3VNUA 1I7PA 2DY1A 3I56B 1JA0A 4ZCMA 2QTLA 2D74A 1OGIA 3W2EA 4K1XA 4PC1A 1FRNA 1JNYA 3OZVA 4N3GA 4B4DA 1EXMA 1K73D 1F20A 2QEXB 2YWEA 4ZGNB 1H85A 4PC2A 3CCVB 4RJLA 4RD6A 1E64A 4PC6A 1OB2A 4QHYA 2GPJA 1WDTA 2EIXA 1W34A 1E62A 3A1FA 1GAWA 3CRZA 4RCYA 3VO2A 1DDGA 1R5NA 4ZV4A 4FWTA 1YJWB 4LBZA 2PIAA 1AMOA 3G4SB 1XE1A 3CMAB 4HE5A 3ES9A 3CCRB 4NCNA 2BMWA 2VZLA 4Y9RA 1W2BB 2AHOA 1KQSB 1VQ4B 1N8RD 3W2FA 1Q86D 1QGZA 4LC0A 1BX0A 1ZM9A 4G5GA 4B47A 1VQNB 2BVNA 4QFMA 5THXA 2VYQA 1AIPA 2C78A 1NJID 4N3NA 2RC6A 4ZCIA 1ZM2A 2R6HA 4Y7CA 1A8PA 1H42A 2DETA 1VQ6B 3AGQA 2QA4B 1QX4A 4LBVA 4MYTA 2XEXA 1B2RA 3CPWB 2RC5A 3W5UA 1KD1D 3U6KA 4RD1A 4DQKA 1IJEA 2XNCA 5JBQA 4TN1A 3WXMA 1W35A 3LYUA 5DSZA 1EP1B 3J81k 1FDRA 2OK8A 4LBWA 4G1VA 3OJWA 2DCUA 2DEUA 1J9ZA 4FK8A 1G7SA 4YALA 4AF7A 1VQ7B 1B23P 4ACAA 1JB9A 3JQQA 4M2LA 2BPOA 1TVCA 3WBKA 2VNJA 3OJXA 4C0SA 4M4SA 3FJOA 2OK7A 1TLLA 1G7CA 4YAWA 1EWYA 1QFZA 1YI2B 2QMUA 3E20A 1IJFA 3CCQB 3OZWA 4R71A 3CC4B 1DG1G 1GVHA 3AVTA 3CCEB 3CMEB 1CNEA 4FN5A 3QE2A 3B78A 4RD3A 2VNHA 3W2GA 3AVUA 4EH1A 5GV7A 1M90D 2VNIA 1SKQA 2HMAA 4PC3A 1FNMA 4YAOA 4F7DA 2BM0A 4Y9UA 1KC8D 1EP2B 2DERA 3I1FA 2PLFA 4B43A 1VQLB 2CRVA 3ZBUA 1VQ9B 1QGAA 3I55B 4G1BA 3AVWA 4C43A 1S72B 3AVVA 1YHQB 2BSAA 5KSWB 1UMKA 4B44A 1KJZA 1EFCA 1VQOB 3AVYA 2YWGA 1CQXA 4PGOA 4AF6A 3CCLB 1YIJB 3QFSA 3CC7B 4U9UA 2OTLB 3MHPA 3ZC3A 4AC9A 1QG0A 2PMDA 2X3UA 3WBJA 4DQLA 4P3YA 1EP3B 1BX1A 1N0UA 4TMVA 1QVGB 1N0VC 1QVFB 3LRXA 5TY0A 4ACBA 3WYAA 1G7TA 1VQMB 3WNBA 2QN6A 1KRHA 2E1RA 4TMTA 2XNJA 2EFGA 1EFTA 2FX3A 4P6VF 2B7CA 2ZITA 3SJZA 4MYUA 3W5HA 3ZZUA 4J0QA 4M1KA 3JQRA 1VQPB 4RD0A 2NPFA 2BGJA 4UAJA 3CCSB 1KK3A 3G6EB 3QSYA 1D1NA 4WQMA 1EFUA 1YJNB 2B7BA 3WNCA 1TTTA 4B48A 5GV8A 3CD6B 1GR1A 3VMFA 1BQEA 1S0UA 1QUFA 2C77A 3G71B 4M53A 3MMPA 2YWFA 1U2RA 3VNVA 1CNFA 3CC2B 1R5BA 3B8HA 1ELOA 1KK1A 1K9MD 4B3XA 1OGJA 4HE6A 4RD4A 3V76A 3U2QA 1E63A 2BM1A 3LVBA 5H59A 3W5VA 5EMNA 1YITB 3W2HA 5AN9A 1W87A 3QFTA 1R5OA 4PC7A 3CXCB 1IB0A 3WY9A 3W2IA 4LBYA 3E1YE 1VQ8B 1QH0A 3OZUA 5TV2A 1D8TA 2QDXA 3OW2B 1VQKB 2GQFA 2BGIA 4TMXA 1Q82D 1ZM3A 4RD2A 4TMZA 1KK2A 1QUEA 3JQPA 1NDHA 2QTZA 4H9GA 1KTVA 3P26A 3CW2A 1KK0A 1DDIA 2YWHA 1FRQA 2B5OA 2HDNB 3AGPA 2CNDA
chains in the Genus database with same CATH superfamily
3H84A 3SXUB 1BOOA 4MYRA 4YGYA 3RIEA 3V1TC 2WTNA 3QPAA 1G21A 2JANA 4ISCA 3AK4A 2NNLD 1P2DA 4GBGA 4FR0A 4OREX 4YRCA 2ZE7A 1U1IA 4MW4A 5AICA 2HLDA 4N0PA 2CNBA 1E3TA 1U98A 2HK6A 4UUMA 5GONA 3UOAB 5IN4A 3OURA 2FP4B 3EZYA 4J76A 2DOKA 4A8TA 1NRKA 2B35A 4YHBA 2X86A 4WJKB 4R1OA 4MQEB 2HTFA 3S5UA 1GJRA 4YRBA 5I7FA 5KJFA 4Z4EA 4HDAA 3H99A 4RHFA 5CVJA 1Q2XA 2WAAA 5DSXA 1PVDA 3L7JA 1I8DA 4CM6A 3CVYA 1SKYB 1AC5A 1HFKA 2QEQA 3R3UA 4PWZA 3RYHA 4E88A 3TXYA 3DQZA 3PRHA 5B2EA 2CXUA 1MBZA 2YMQA 4ZQCB 5KQMA 4FFSA 1PD0A 5HKLA 3W6NA 3O8CA 3KS9A 3Q1LA 4R5HA 1Q11A 4LRYA 4ZMRA 4GICA 3G0HA 2VJMB 1TCCA 1ZN7A 3W1WA 1QO0A 1WMEA 4YI3A 5I9IA 2HCJB 2VWQA 1ZN8A 1DV1A 3MJTA 5FI1B 4EYGA 5KNLA 2ZPAA 1BLIA 1EINA 3CX6A 1B6SA 2OB1A 2B36A 5C7YA 3W5IA 3RAEC 1GPWB 1SNYA 1TCUA 1II8A 1L6RA 1Z4LA 2B6HA 2OV4A 1G8PA 1D7AA 1EM8A 3V4FA 1EGMB 1U0RA 4UATA 4Q5IA 1UADA 1FNBA 4O0LA 3KJNA 1VDMA 2JCGA 4QU0A 2EKQA 4YA6A 5KSPA 5JY6A 3PEYA 3OJLA 1RABA 1ZX1A 2I4OA 1LFDB 4G41A 1ADGA 1F3OA 4XDZA 1UXHA 2Y1GA 3GCDA 5E6UA 4AXXA 5EIXA 1TRKA 3LQRA 2AGVA 1C7EA 1DO0A 3BH6A 1RQNA 3GX1A 2YIVX 4OK6A 3OD1A 4R8MA 1Q6ZA 5L9AA 5KC9A 1DKNA 4BMOB 4ILEA 3LZCA 3MJFA 5GAJA 3HKDB 3U26A 3NU1A 2ZIEA 1GPDG 1TJ3A 3HBMA 3MCZA 3PUYA 4FE4A 1DX4A 4CEHB 5TB5A 1K7CA 2IEZA 4QAJA 1LTHR 4CTMA 3H6GA 4HDKA 3U6BA 3MWGA 3J7TA 1E7RA 1FB5A 4GVPA 3ZLBA 1GDTA 3ZZ0A 1ADBA 1EGAA 4MRAA 4WBNA 4L6IA 3KZMA 3FE2A 4LMBA 2HJ9A 1VA5A 2P65A 4DV3B 3N2GB 5BWBA 1C30B 1UEJA 2IEGA 2PGJA 2DFKB 5FUYA 2G1UA 1NRXA 4KR9A 3SKYA 1QRSA 3H17A 2PS9A 3HZRA 4XR9A 4C7OB 1CB7A 2IZOA 2QW8A 1HDEA 3T9FA 5LJIA 1ITZA 2XMCA 2Y1WA 3IGFA 1I6MA 1XA3A 2N47A 5AHKA 3A4VA 2VDQB 1SBIA 3GAZA 4NG4A 4QTZA 4JCOA 1O6GA 4DWVA 3LKZA 3DR3A 4I66A 4X0CA 1EUDB 1EXMA 2FSGA 2IYZA 3OE1A 3CWQA 4QD3A 4BYMA 1RDFA 2C7GA 1KGDA 3CEPB 3GLFE 3KEMA 3OZEA 4NI5A 5LB4A 3TE6A 4BS9A 1H85A 1X42A 1EE9A 2RK3A 3QVKA 4W8HA 1JJVA 4TKVA 4RGQA 1E3JA 3MN1A 5CT9A 1LPSA 3G2KA 4L07A 5TJHA 3KSMA 3LHSA 3Q8WA 4MVJI 2WOJA 1WSRA 1CDDA 4XCXA 3PLAE 1GAEO 2O1EA 5IYNA 1X3SA 4NBKA 1T9ZA 3T5DA 3DBHA 3G2QA 1X0XA 1UWCA 1XZLA 2BWJA 5A1JA 2E3JA 4AKEA 1W581 4RENA 1OHHD 1R6VA 3G6WA 3L7KA 3RHZA 4E3ZA 5IHXA 1CJBA 1R8YA 1KO8A 1XK6A 2OO5A 3HB1A 4RDIA 4F1WA 2J5QA 5JYBA 4RDKA 2WM3A 2GX6A 1T5SA 1YFZA 2W8BB 4CT5A 1TPYA 2IYEA 2ZYDA 3BCHA 1RHUA 1XPUA 2PZ8A 3D3NA 4RA9B 2J7PD 2WILA 2H06A 3CSSA 5HS6A 1EESA 3D0OA 4HVLA 1HDRA 2WVJA 1MMFB 5B1DA 1YX2A 2VDPB 3NXSA 3IO3A 1HY3A 3O4FA 1SMKA 4G37A 1Q20A 5KNDH 3DOFA 1N5LA 5CAEB 3TSZA 3FGZA 3QPCA 1POXA 2J5XA 1AF4A 1SK8A 3C8ZA 4X63A 4JYAB 1VQ4B 4R05A 1U99A 4AWAA 2BMFA 1G5PA 1H66A 5DBHX 1QGZA 1Z7BA 3IDQA 4DLKA 2CZQA 4I2NA 4MGHA 4M8SA 3D6NB 5DEIA 4JI1B 4X90A 4E2XA 4MEAA 3ZI4A 4J6FA 3BFXA 4X07A 3OC0A 2GPAA 1F1JA 3R7AA 1EVYA 1UWVA 4A1FA 4A0GA 3ZWNA 4EJMA 3GIDA 3EPJA 1I7QB 2NO6A 2REQB 2C78A 2JFQA 2LXNA 4WADA 3TAUA 1JEQA 1ZICA 5AOBA 3VRHA 4RVGA 3EWAA 1J21A 1X7YA 4L8LA 4PTYA 4JGBA 2G9RA 3I0MA 3KQSA 1CY8A 1JBQA 1OXSC 1TCBA 3F3MA 2O8EA 2PXHA 4UULA 2YWJA 1B3BA 5WRFA 1R0WA 3NOVA 2PVSA 3FWHA 1H1TA 1PJ4A 3X2EA 4KL8S 5G41A 3IP3A 4NOJA 4GECA 1BWPA 2W6OA 3A7EA 5EKSA 4NNJA 3CPWB 1UIRA 4DYVA 3T51B 2GBGA 1CQWA 2DIEA 1XVUA 4X8HA 5FHQA 4OIFA 3A36A 2AFHB 3O93A 5TXGA 4CI9A 2HY7A 3RODA 4X05A 3ZIAA 1K66A 1G5QA 2W0MA 2DXIA 2AVNA 2HFJA 2ZI4A 4Q4HB 1NKSA 4I1PA 1FJHA 1EIWA 3ED5A 4FIDA 4RM0A 4IICA 2X1VA 4UNQA 5H4HA 1DQPA 3AKCA 1JU9A 3FDZA 5J5CA 3W4KA 5L7WA 2XIJA 1QPGA 3D4NA 2DFTA 2VRBA 3EG9A 3O2NA 2FE1A 3ENNA 3GRUA 4OXNA 5E7QA 1M73E 3PXGA 3I23A 1D03A 1EVZA 1U9JA 2R6CA 3S2IA 1O0CA 4XM1A 2RIPA 1FDRA 2REBA 3AUTA 4P3PA 1ZOLA 5IM4A 1JAHA 1OH7A 1Y8QB 2B4AA 2YV4A 1V0EA 2ZZFA 3T35A 3FPCA 3L1UA 3AEQA 2WBLC 1XQXA 4Z9XA 2IS4A 2ZG6A 3PIIA 1JAIA 2XRZA 3EYAA 3O95A 4TKZA 5TRDA 4D6YA 1B74A 2ZATA 3RHSA 2HT1A 5CIWA 1SXJE 4OOXA 4XLEA 1JBEA 3NBZC 2FH5B 4HSGA 2Y1XA 4HN4B 1G9SA 4JP2A 4AMBA 4IUBS 2FPLA 2AVDA 3PSHA 5JASA 5IMBA 2G71A 1BU8A 5E3IA 3I01M 5EPOA 3F78A 3RRMA 3TIFA 4MR9B 3RCBA 4DRZA 4F9FA 5KO2A 3WKEA 4HEA6 1AGRA 5J3OA 1FFHA 1O4VA 4WZEA 2BZ1A 2AN4A 1M75A 2H31A 3EWSA 3H42B 1VKZA 2QMUA 1CQIB 4KUHA 1ML3A 4XQCA 3WQRA 4D5EA 1K8ZB 5TF0A 4P4TA 1NVWQ 5DXJA 3CCQB 2OGZA 3BE8A 3DO6A 3WRWA 1ADCA 2FWBA 2HRDA 2C07A 2VTVA 3OEHA 1ZW6A 4JGIA 3TTUA 1PN3A 3K1JA 4YRPA 1KJ8A 3U3DA 3GZNA 2ERXA 4JLDA 4R54A 5DGHA 4HBZA 3SG0A 1UD6A 4I1IA 5C1BA 1WMFA 4IOMA 1CNEA 3A35A 3KE9A 4LW8A 4Q21A 4UPEA 4FYWA 3D1JA 4BFXA 4OBBA 1G5IA 3TJRA 1Z62A 2J3DA 4RD3A 3HUEA 4OEHA 4RY2A 4Y30A 3S2EA 4Z4CA 3V42A 1AS3A 3FGPA 4RIHA 3TLEA 1E79D 2PAAA 1K5GA 1QLHA 2GR9A 4GOLD 3BIWA 1YQXA 2FW6A 1HL3A 1I4TD 3ROEA 4EKGA 2YICA 3FJ1A 4RK1A 4KNWA 3VDXA 1QCDA 3IT1A 1JHPA 1QIGA 1XRLA 1BDMA 2X8JB 4F06A 2YBEA 2Y92A 4IIVA 2FW7A 1HZJA 1Q7CA 5EHZA 3KXKA 3Q2KA 7YASA 5HQTA 1U0FA 1I1HA 2JH8A 4BAGA 4KBFA 2B83A 1T9AA 3KUCA 3IP5A 4FILA 3SJAA 1P1IA 1BYIA 4LZNA 1NQUA 2A58A 4PABA 1AZWA 1ONPA 2V0NA 4K6FA 4ME6A 1CEXA 1GFSA 1USKA 3TLGB 1QU3A 2OYSA 1UP4A 5LM3A 4P26A 4CEJA 1ST3A 3F47A 3SDZA 2NV6A 3D3WB 4IQGA 1LPAB 1Q0QA 2ETVA 4ZALA 3V7AA 3SSAA 3TR6A 3DF7A 1NLFA 2GESA 1ZJWA 4WK0B 3O9ZA 3ZG6A 1I80A 1VLOA 3IQHX 4N0EA 4D44A 2MR5A 4YLYA 3U09A 4QC2A 1QB8A 1JVNA 3AVPA 4I0WB 3OJOA 4RMJA 1JPUA 5TEVA 3ENZA 2OCPA 3G2HA 1HH4A 5CLFA 3FM9A 5SY4A 5F4JA 1H2YA 5D1NA 4R7TA 1EFCA 3T0FA 4Z3OA 3CPJB 1W7AA 3Q3IA 1TA9A 1HDXA 2MIIA 4JHXA 2YWGA 5KNCA 3MEQA 5CDGA 1CJMA 3Q87B 4O4LB 3RFXA 3T15A 2QUZA 4WXPA 5K3OA 3RVPA 3I3SR 1RXWA 4AF6A 4OMDA 3VPHA 4KKTA 4A0HA 2BGWA 1X74A 4QGBA 1D2HA 4BRZA 3V8NA 3FTFA 5C1DA 3A11A 3GUVA 4M60A 4TX1A 2VO1A 4MVXA 3TXAA 2R1ZA 2P2SA 1HYEA 4CG1A 3NHUA 4MWZA 3A1CA 4N47A 1JXMA 2WUEA 5DDIP 1MC1A 4NMXB 3RUPA 3M9WA 3HJGA 3KXDA 1UD5A 2HH9A 4FYVA 1UBMS 2BF7A 1A7AA 1GSIA 2XMPA 3PUHA 1QVGB 1P33A 4BCCA 4H1VA 2OO5C 3PFFA 3H5LA 3UBMA 5GTDA 1A76A 1AY0A 1Q0PA 3TMYA 3U4CA 2WM9B 4JL8A 7AT1A 1QNFA 2CDRA 3GLHA 5J4KA 3ZVNA 3NPAA 3I2YX 4KIFA 1SQSA 1RMTA 1SXPA 5DTEA 4LISA 3T5PA 4FINA 4NRDA 2CNWA 1AGNA 1N7JA 4J0HA 4ZANA 4LE0A 5EXEA 3TB4A 1PJCA 2FPGB 5DBGA 4BBJA 3UT5B 1UBOS 3N0TA 3LCRA 5HUQA 2J0UA 1YJBA 3N2KB 4YC7A 3TAHA 1K08A 1ZN9A 1WO8A 4FNOA 4J6EA 3GH1A 4Z5XA 2CY0A 4BOYA 2PE5A 2EX4A 3TVTA 4IO0A 1B8UA 1XG5A 3N59A 5CJPA 2M9MA 4ERXA 3KYCA 4EUKA 2OZVA 3VH4A 4BO7A 4EW6A 1UM9A 4AECA 4E5NA 2D06A 4MV3A 3WRVA 3ZNPA 2Q3HA 4WKBA 3W5HA 2O52A 3LV8A 1MAAA 3FYDA 3QRWA 5B7QA 3GLGB 3C7TA 2PWBA 5DTJA 1ACLA 1TIBA 4JI5B 3ADKA 3HGMA 5B5SA 3GQBB 3MJHA 4AY2A 2NPFA 3GUCA 4ED9A 2D3LA 3FOWA 3KG2A 5KTNA 1C29B 4I4TA 4INPA 4IWNA 1PR6A 2ZRJA 4EA9A 3ZYCA 1XZEA 2R6GA 2CXXA 5HJ7A 3A04A 3AFGA 4I4CA 4Q9JA 1N0IA 4W6QA 3FYTA 3GMDA 2HK7A 3EZGA 1UZAA 3D7NA 3FF4A 2NZXA 3R0XA 4WUVA 3L0SA 3DFIA 3OWXA 3Q0TA 4X3PA 4N3CA 1GNPA 3CD6B 2IPLA 1VMDA 3SFVA 4WZTA 3SJUA 3AHFA 4MDYA 3BTOA 4YROA 3R5TA 3BF7A 1O94C 3K94A 4HYQA 4KXWA 4Z8YA 5JSKA 4FGLA 1JQBA 4X91A 3UJAA 3UTCA 1KYWA 4R98A 5E3HA 3GJ0A 5CX1A 3ZBPA 2NP7A 4GH5A 5FBVB 2JA2A 2PUVA 3BB4A 4P84A 2O5VA 4RZHA 1YBAA 5BT9A 2AZDA 3VR2A 5BR8B 2C0QA 5M5BA 1TZCA 2A9PA 1NURA 1PV1A 2BGMA 4S24A 1M72A 2AUMA 1OSNA 2FEWB 2P6NA 1RAEA 4QOIA 3G0CA 2XZTA 2O19A 2PSEA 3U4QA 3NDJA 1K2VN 2H85A 3K96A 3DB2A 3HNPA 2GCNA 3O3NB 3I1JA 4LGVA 5ALFA 1F8UA 3PDIB 2DWUA 1NT2A 1WOMA 1RBMA 2KYRA 4PM4A 1QZXA 2QKYA 4WX2B 3ENWA 3C98A 3JWPA 4X71A 4MGIR 5HF9A 3L43A 3TM4A 5A9SA 2CCKA 1H2XA 3CRMA 3GP3A 3KDPA 1RYYA 2D2XA 3W2IA 2GM9A 3PUWA 4MWOA 3KQKA 5JPIA 2JK1A 2HHAA 2QN2A 4JBNA 4BMYA 5BOSB 3NJ4A 1VQ8B 4IRMA 2XE8A 4PVCA 1U0OC 5F1PA 4KXXA 1L5GB 3CF6R 4BNMA 4GZLA 4KBGA 5AM1A 4XYMA 5TT1A 4B84A 2B1JA 2Q07A 2BDEA 3L8DA 3CKLA 1DP4A 1V6AA 4NESA 2A9JA 1RBQA 3ZE2B 3LTNC 2OD2A 3QMPA 1FS6A 4C0WA 5F7OA 3E2PA 3LAWA 4RE5A 4B3CA 1WJGA 4D43A 3ILHA 3W1VA 1Q74A 2AN3A 4TT3A 1GGNA 3QU5A 4D3FA 1KBZA 4Z51A 1C8LA 1N8TA 4RHTA 3HN7A 2QD3A 3FY4A 1HGXA 3ISTA 5TEWA 2A5JA 4BV9A 5B2FA 2IPAB 1A77A 2PD3A 3CZPA 3GLIB 2MJLA 1XNQB 4C3OB 4BPBA 4QHTA 2B5OA 3VYVA 1IHUA 1XFAA 2WJWA 3NJRA 4I6EA 2WHXA 5K0JA 3EVAA 5KQSA 3JTMA 1B8PA 3KOOA 1UFOA 3FLEA 2Z5GA 3GN2A 4EHFA 5HUHA 4QXPA 3IOBA 3V8VA 1ORWA 1HSZA 4ZCLA 1EK0A 5HFNA 1UANA 4J1NA 2O3QA 2XA2A 3D3QA 1DINA 1W47A 5G4LA 5IAKA 1KZ7B 1T9GR 2K2WA 3EFBA 3R1IA 4HEJA 4QIHA 4REMA 3V3TA 4CGYA 4CT0A 2P4EA 5JYEA 3EH1A 3L2OB 2X41A 3H5RA 1T36A 1X8KA 3FDXA 4H77A 5FA5A 4HLNA 1L1FA 1YJAA 3AERA 4YXWA 3G9UA 4QQKA 3KHSA 2XT6A 4OLAA 1KNXA 1UDAA 5AW9A 4DBZA 3KEQA 4OP1A 2A7XA 3VC2A 2BGRA 1XZIA 4Y2XA 1QF6A 3NDIA 2ZL5A 1A8HA 3H7IA 5DNCA 3SQDA 5JWOA 3KJXA 1U3CA 4OGWA 4CQLB 4EVIA 3R40A 1OFIA 5JDIC 4HGQA 1EFHA 3ZGYA 3HSSA 1WZUA 4UVDA 4XJSA 3WLRA 1JVSA 1KP9A 5AM4A 2AUTA 5E6UB 3TWOA 1KY5A 1PW5A 1Z5VA 2VDVE 5LYJB 3GPDG 3S81A 2WU3A 2PH3A 1WCV1 3O75A 1VC2A 4YAEA 4MROA 1BWQA 1OQAA 3LNTA 4QYIA 5CX1B 3L6OO 4HSEA 3RBVA 5IAOA 3VR5A 2FWNA 4BRWA 1OT3A 3CIOA 3PA8A 2BBTA 4V2IA 7GPBA 3KR9A 3OI7A 1P60A 1K8AD 3THYA 1OPRA 3L07A 4MZXA 2IYUA 3IQGX 3OU7A 1E3IA 4LXIA 1TFUA 5TE9A 4CIWA 1O2DA 3QNMA 3QEBZ 1O54A 4YCBA 1KO4A 4CKBB 5LC1A 4B6EA 2WTAA 3OE7A 3V8RA 5ICEA 1LSSA 1NNI1 4PQFA 1T4DA 2C84A 2X76A 3C5VA 4FOPA 5T5QA 2MCFA 4AUKA 4HT3B 4IX9A 1IBKB 1TM4E 1ECBA 3HWSA 1EJ2A 4YP6A 2J0UB 2XCLA 4OGKA 2OZLB 4IFIA 1E2MA 1N8SA 5COBA 1QC5A 3GJ7A 4UU8A 4OHXA 1DXQA 2B21A 1YRYE 2PUHA 3EC2A 3Q6IA 1BJRE 4HXEB 1H5UA 5JCOC 3TGLA 2V6FA 3MWDB 3EJWA 2NO5A 2V54A 3PQ8A 3HVKA 5DK6A 4DLNA 4Z9AA 5A4DA 1SKUA 1JJFA 3PF8A 4OQYA 2BEWA 2ZJ7A 4CM7A 4A10A 4ENWA 2C2OA 4YMGA 4DFDA 3R77A 3HR7A 5CVTA 3U7JA 2Z2KA 3KSUA 2E9SA 3FNGA 1E3QA 2QRKA 2HLDD 4K6OA 5GVRA 2WIDA 1C8KA 1IE3A 1K68A 4JUAA 4MS1A 4OB7A 2IZ5A 5IDYA 1ZSYA 2YN2A 1RACA 4D45A 2C92A 3IBFA 1S3SA 2ONZA 2RH9B 5FWXB 1NZDA 2Y93A 1GNTA 1WX1A 3GT7A 4PG7A 4Q19A 2WV7A 2PRZA 3F6BX 1FTSA 4N9QA 4IDOA 4PYRA 4HOYA 4QOFA 4JI0B 3Q6QA 3L8CA 4L4UA 1S7CA 3G8YA 3WYGA 1CP2A 3W2EA 3GVXA 4BGDA 3VKUA 2W90A 3QKWA 5IYPA 1CUIA 1U7DA 1CJCA 1GL6A 1PWYE 2DLDA 2HL6A 5JYDA 2O2YA 1KWGA 1L8XA 3CUEF 2C96A 1Q7GA 4IIXA 3T9BA 3ZXXA 3PP8A 1BMFD 1X92A 3ZOZA 3DHNA 3C74A 1O5TA 3RC2A 3VZQA 4BX2A 3RS2A 5BV2P 2QVBA 3NH6A 3RFCA 4EHBA 3V48A 2BKAA 2YHSA 2QI9F 1LV7A 1O77A 3KELA 1AK9A 1UBGA 3ODPA 5IFKA 1O8CA 2C1XA 1CJKC 2JJ1D 3LDHA 2O8BB 4ZAGA 3HKCB 4I1VA 1C9KA 3NNSA 3NWEA 4RNCA 2BTEA 3FUCA 3FCEA 1OHHA 4HWPA 3TDMA 4DG5A 2VNSA 4UEKA 2AD5A 2PYDA 1DFIA 3AQIA 2HWUA 3OX4A 4GLFA 4FC7A 1EDZA 2V7WA 1JHZA 2V1UA 4L7QA 5ALXA 3OA0A 4RCYA 4N18A 3AR2A 1WCIB 3AR9A 1EDDA 3HQ4O 4JSRA 1A88A 1VLVA 3UUWA 5CLHA 5LOVF 4ZV4A 1DT5A 4UQLA 3BDIA 4OOEA 5I51A 2IV3A 1GZVA 1NW6A 1UDCA 3FTEA 4PLGA 3G4SB 1GIAA 1M8KA 2O2DA 2RGNC 4G1UC 2B2XA 5IT9A 1DKRA 3GK3A 3LDGA 4TYMA 2NX2A 5U1PA 1IQ0A 3DXXA 3PUVA 1LDBA 1CKEA 1YZTA 5JG7A 1F12A 4CW7A 4MTCA 4LY0A 1Y7HA 4IXMA 1I18A 1MENA 3FPLA 1XA4A 5EJMA 5JSFA 1TC2A 2VBSA 5L4SA 3K9QO 5LCXA 4AJPA 5CXUA 2V7GA 4YI5A 3RG8A 4EVSA 4YMUA 3GIRA 1P3Y1 1W9MA 1CUZA 2Z56A 4QBFA 2VCYA 1EA7A 1VHJA 1T5OA 2H63A 4PYQA 4OGGA 3ZV3A 2JRCA 4GO1A 4B47A 1QZUA 1QMGA 2I3BA 1HMPA 4LVNA 4TLDA 1PFUA 3V8PA 1DCTA 4BEWA 3HXPA 5EIHA 1E1RD 3R8CA 4FXPA 3RC7A 4B3TB 1IUKA 2ZI7A 4F86A 2KI5A 4DA4A 3ABIA 3G5MA 3UHOA 5JU6A 1VCNA 3C3JA 2VHZA 1WXEA 1AE1A 1Y3CE 2JDID 2A8YA 3KE8A 3EPKA 2Z6AA 4NJMA 5CXQA 1C14A 1XD2B 4LPSA 3CJQA 1YS6A 1OU4A 2PMWB 3G8AA 2QX4A 1UAYA 3GMIA 4UMDA 1W0JA 4Y8VA 3U5TA 4JZKA 4HQLA 1BYUA 4K3VA 4LOLA 5GZ6A 2XD4A 3LT0A 3TOZA 1QH1A 3ZCTA 3MXTA 1ZDMA 4MZDA 4V03A 4FJ2A 1L3CA 1VPWA 3GRRA 5FOXA 3I42A 3NT5A 4MIYA 1KD1D 1X7XA 2HA4A 3I37X 3QP9A 4PICA 3LKVA 4DXHA 1GGEA 4YJGB 5BR7A 4X7DA 4KQWA 2IHVA 2ZRBA 3BL8A 4W7HA 1NG9A 1YR6A 3UJBA 1YE3A 4XPZA 3CH7A 1DC7A 3PITA 1ISRA 3UXHA 3RVOA 3QI7A 2R62A 4RJKA 1P3JA 2R5NA 1KEPA 4LY9A 1VP3A 1X86B 4PRLA 4Y2UA 3KJFA 1VL5A 1OPXA 2CVZA 2FUKA 3NGLA 4BVGA 4ZDIA 3SR3A 2X14A 2QN9A 1DHTA 2X4LA 4AZVA 4Q1FA 1JHUA 3CZAA 1DXOA 2GRJA 2FW0A 2VEDA 2XYHA 2Z2IA 3K5WA 4FSXA 5ITZB 4ZAFA 3SDBA 3SZRA 5J4VA 1CLEA 5EKTA 4P2NA 2E4VA 1RWOA 4ACAA 3OMLA 3GG9A 3H4MA 4CMKA 2H48A 3KZKA 3ON5A 5GJBA 4JJ7A 4RPHA 3S3TA 1OX4A 4J29A 2KBEA 2YTZA 3OBIA 5D6NA 3RTEA 3PXDA 1N08A 1WW2A 1OFUA 3EVZA 4V0KA 4YCAA 1G1AA 1NY6A 2G80A 5CW1A 5DV9A 1KAMA 1N25A 1NI4A 4G23A 5M2QA 1TMKA 3E05A 1OAAA 2R6FA 5EWJB 2EZ4A 1ZGJA 3RS3A 4DCPA 1GP2A 1QTRA 3HPQA 3JWGA 4YUAA 4L5CA 3AUFA 1R3UA 1S1MA 1ZFNA 1OY1A 2FAXA 3ESZA 4RKQA 3ZLUA 4MJXA 1SD2A 3ZDRA 4EITA 3MWDA 3B1KA 4MLZA 3QXSA 3AUAA 5JD4A 1H2AS 5C3MA 1OFVA 3VDNB 1QOPB 2A1UB 4KUGA 2UZ4A 5BRNA 1N2HA 4G86A 4QTYA 4FN5A 2ODEA 3BK7A 2M32A 1YS7A 3QE2A 5DYNA 1A69A 4EY3A 1DCMA 3IL2A 1YMQA 3OE7D 3UAXA 2YR0A 2HDHA 4BX9A 2B8EA 5BORA 2QX8A 4XD2A 1JW9B 5J23A 3NVMB 3KNZA 4IOJA 1PR2A 5AVOA 3FNQA 1AVTA 2AOWA 2QVYX 5I3CA 5DU2A 3E5RA 1V3VA 4HDRB 1WD7A 4ZXPA 2PUBA 3EGDA 3QEJA 4RLFA 2OFWA 2EBWA 1T8WA 2HT6A 3GJ5A 1T6YA 2ZLBA 3JQ7A 5FR1A 5JC8A 4ZVMA 5A7GA 2ZXEA 4HK4A 1Y80A 1Z6XA 1SGWA 4BMZA 4IHJB 4PO8A 3CNNA 3EGCA 1DZIA 3PU6A 3W8EA 1EUDA 4JT4A 3H9NA 1EBUA 2IK8A 4IDAA 1N5IA 1YRHA 2YNMD 3FHJA 1XZ8A 4M9CA 1CERA 4IZHA 1K3FA 3JPWA 4N65A 4U5XA 1QGAA 1JAYA 1L7EA 2FR8C 3T9EA 1VP9A 1H6BA 3LYLA 5HQJA 3S2UA 2ROQA 3SVZA 1N5RA 3A2LA 1UMCB 3DZIA 4W1RA 4DDMA 3STVA 5J40A 4AIRA 5L3QB 3HU3A 3WNVA 3ZTTA 4FOOA 2BSAA 3H2KA 1ZH2A 3DMYA 1KP3A 2AFRA 3FFWA 2HSJA 3GROA 1KJZA 1NJ8A 4Q39A 4TV9F 3WV4A 5JSHA 1VQOB 1R8SA 2VBCA 4AJHA 1XPOA 1Y8ZA 1E9EA 5HFAA 5I7HA 1A9XB 4J03A 4L27A 1YIJB 2EATA 3QFSA 4AD8A 2EX1A 3CC7B 4E51A 5BRAA 3ADBA 1VKJA 2GGSA 3Q41A 3HCCA 5CD9A 4PLZA 2XA9A 3AHEA 4Z0PA 1SJ9A 2O48X 1V5EA 3N0XA 5ALUA 3WKAA 1GGFA 2QRMA 4TVSA 3ESAA 3T56B 2NT3A 1KYVA 4IXDA 6CHYA 5I7UA 1LWNA 1X3LA 4KRXA 3TLJA 3PC2A 2ZAYA 4WH0A 3HJFA 1ZJ6A 3KOXA 2HMTA 4AG5A 1TCVA 3DEFA 5FJIA 4WFIA 4GFDA 2I33A 4D99A 1J90A 2Q5JA 1QVFB 1IZ0A 5CFPA 2AR7A 2WT9A 1E2EA 3LRXA 4FNAA 3SJBA 3JYOA 4R16A 5AKEA 3K70B 4EGFA 4FZJA 1Z3IX 3UC9A 4RHCA 3I0NA 1HZEA 4RDJA 1OOEA 1FMLA 1USVA 3EF1A 1UODA 4FIZA 1C0IA 4DLYA 2XJ9A 3VAZA 5HKKD 5ULLA 3EA0A 3NONA 4LDNA 1AUVA 1G20B 2O05A 5IASA 1V4NA 3BXGA 3P9RA 5HKAA 2X1MA 5JMOA 5C1OA 4FEGA 4QUHA 2I91A 4GGMX 3T7JA 2QRNA 3CB2A 2HAEA 4FXUA 1W5FA 1ZCBA 2AR9A 4XSVA 2FX3A 1T4MA 2FPIA 1V2GA 3VHRA 4BX3A 5IYZA 4AQYB 5LQRA 2R8ZA 4BJ5A 3QK7A 2A5FA 3AL3A 5BQFA 1MAUA 3MOGA 2CWWA 2NZYA 1ULBA 1A8UA 5BN4B 2BP7B 3JQGA 2Z6QA 1U3DA 4HQRA 1IMOA 1AQYA 2UXBB 1GVNB 3FTCA 3RARA 5HCUA 2ZYVX 2B61A 3IDOA 3T41A 4MYUA 1CYDA 3PNPA 3FHOA 5JD3A 1AO3A 5BMVB 1G4AE 1ZQ9A 2R1VB 5A4IS 1KPHA 2IH5A 5KVCA 3GJTA 2AYZA 4RD0A 3JYNA 2IYVA 5C8VA 5ICMA 3R5HA 4Q7QA 4JYMA 1B16A 3O1JC 4MAMA 1ZINA 5A6SB 2WV9A 1SC6A 3LOUA 1SXHA 3L4BC 4QDOA 2WSSA 3WGLA 5JD6A 3HUTA 1R0KA 1EVQA 4B3HA 2KVOA 1GT6A 2H2GA 1GLNA 1CRWG 1Y5MA 3ED1A 2FXIA 3FPBA 3P9IA 4LOKA 4MICA 2EWMA 1E2HA 2WU4A 3RI3A 3H4TA 5TMDA 3PYLA 3PDIA 2HDWA 4A6DA 4LF4B 1UMCA 3ABZA 2D2FA 2A59A 4YK7A 2JH9A 5FAXA 3IP1A 5L7YA 2XW6A 3V1YA 3AINA 3OEED 1FQKA 1H65A 1VJ0A 2ZRQA 4TM8A 5DLPA 2C61A 2YJNA 4TTIA 4ZU3A 4UM9B 5BMVF 3WYDA 3V4OA 3QKRA 3D2CA 4BFLA 4ZVTA 4YQEA 3NMUF 4Q3CA 3DTTA 1Z0AA 3HJCA 3C6BA 3IQXA 1E3SA 4ARZA 3V76A 2OXRA 3LP8A 3ROZA 1N34B 4NVRA 3D7SA 5K0FA 5A06A 1BOFA 1G66A 4RK7A 4BLRA 2ZRCA 5MGNA 1KTIA 1DTWB 3AH8A 3E03A 2NV4A 3CRW1 1SQ6A 2AD1A 4G5QA 1E0SA 3W2HA 5AOAA 3X1YA 2AQIA 1W87A 4EW1A 3ELUA 4QDXA 5C5IA 4WOBA 4ZGBA 3KZXA 5ALOA 3K8ZA 1M6VB 2QQ0A 3RKUA 1EUYA 5F2OA 1RTTA 1K7SN 3KQMA 2ZBUA 2HWWA 3T1TA 5H9VA 1DTSA 1UC9A 3VR4H 4AWXA 1JMVA 3UUGA 4AFNA 1SBCA 1NI4B 1Q21A 4B6JA 1SC3A 2JLVA 1NLZA 5KTKA 3CN7A 4IJMA 2XWJI 4ECEA 5I9BA 5E4FA 1T25A 3ONFA 4U6SA 2UUOA 1H9AA 3AO0B 3DMDA 3DMTA 1EFPA 1SBTA 1I3NA 2VTDA 2Z2JA 4GLJA 5CVDA 4X7MA 1EWVA 3VHQA 4RD2A 3WE7A 2NZUG 2RGDA 1OIXA 1FVHA 1YS2X 5EZQA 4Z7NB 3ADPA 1V3UA 1HZZA 1XF1A 1U2ZA 1SU4A 3WGHA 4EG5A 4AJEA 5ADHA 1Y3AA 4ML3A 3O3CA 2QJWA 5CYPA 1JG6A 1RVDA 2IHBA 2VQDA 3D81A 5FYDA 4D1YA 5IZ4A 3AG6A 3FNRA 3C7AA 3GDFA 2VHXA 4ZEXA 3RRXA 4GKJB 5E1BA 4TZ6A 1NQ5A 2P67A 4NYJR 1Q91A 4B4KA 4BNWA 5JS8A 3KTOA 2EJWA 1M9NA 1MAHA 3BRWD 3FROA 2RGWA 2H5IA 3CLSC 3IC5A 3QVOA 4HI0E 4G1MB 5FUBA 2OPHA 1WMBA 5A4MS 3IEMA 2IP1A 8LDHA 1KEUA 4MP3A 3CCJB 3VKHA 1BC5A 2OECA 2FHPA 2PKQO 3A0UA 4HD8A 3AVXA 4CEJB 4U7GA 2AN9A 1T8SA 5KZMB 1G20E 2FV8A 1SH7A 2FG6C 4QBIA 2B69A 2YZGA 3QF7A 4P31A 1V1MA 2C7PA 4KQ2A 4PHTA 2RMKA 2BV3A 3CINA 4GYKA 3H5NA 3WYNA 3ICVA 4BVBA 3HTXA 1YCFA 5IULC 3I61A 2O7QA 5K2OA 4HAUA 2XGJA 1SCQA 1T1SA 1F8YA 1S1CA 2H1HA 4HAYA 5CR9A 4B33A 3I9OA 2B4QA 1S6YA 1GNQA 3S2GA 1ZRMA 4J07A 4RO0A 1Y1TA 2MSNA 1Y7LA 1GADO 2NV2B 4KODA 4JLUA 4XASA 2EBUA 3VZCA 4G8BA 1KNQA 3LKDA 5A9RA 4YECA 1SZDA 1EJ6A 2GEFA 2IHTA 5DBIA 1DRVA 3DWEX 2GI4A 3ZZTA 3ECAA 1NF3A 3N70A 2C94A 2AMLA 2OTCA 5F9FA 4CN8A 4PPYA 3PGXA 3WWYA 2EYUA 1ZIYA 3FF1A 3KR2A 1E6WA 2J3HA 3JQ9C 1BROA 3HWX1 3NKLA 3OVMA 3M1YA 3P32A 4GNKA 5A8AA 4GMFA 1OE0A 4XKJA 3K0HA 4NZNA 1GGKA 1YKGA 5J4LA 2AMYA 3Q88A 2G4LA 4BX8A 1RFLA 1DBWA 3S2FA 3SU8A 3JWHA 4COOA 3A4TA 2BDUA 3KFLA 4KJXA 1X9IA 2Q1WA 3CE9A 4LRWA 4OHPA 5EYPB 2HC9A 3G1TA 4IDCA 1J7JA 3KAJA 3U0BA 1GKIA 2QENA 5KS2A 4Y1RA 5DNYB 3RR2A 1HDCA 4DSTA 1XVIA 1DMSA 2RE8A 1WQ3A 4LF7B 2ZTNA 4QOJA 3O6VA 4EFNA 4FX2A 3WZLA 1RQRA 1PZGA 1REQB 1PBNA 3DTVA 2QQFA 4MPRA 3NWJA 4N48A 3BWCA 1X7ZB 3ASUA 1JA0A 3OEWA 1JJAA 2BY4A 3JVIA 4KFSA 3EAQA 2AJCA 1XEAA 4XD7A 1JAXA 3JVUA 1DWUA 2H7YA 2XSZD 3GA7A 4N39A 3NIGB 4DR2B 2O8EB 1U4NA 3MMSA 2ST1A 1J42A 2GETA 3T61A 2C2ZA 3I53A 1FFCA 1Y8QA 1IOWA 1WORA 2JA1A 2RKWA 3DBOB 3DHYA 4JCCA 4OJQA 5SYNA 5KW9A 4C6TA 5ALIA 1WKCA 1Q0RA 3WDLA 4E2FA 1UCFA 1UZNA 1D0VA 3BCDA 1P1KA 2EARA 2Y76A 3EFEA 4J3JA 4RQTA 1PWEA 1QBGA 3JYHA 2E4ZA 2OE2A 2AFHA 4FYHA 2G7ZA 2AIRA 4YP7A 1T5TA 1K92A 2A4KA 1E64A 2FWPA 3H65A 4B3DA 3DM5A 2RBGA 4BATA 2I6TA 5BYAA 5J43A 3OBBA 2D0PB 1JR3D 1JDNA 4FKMA 3PFHA 5EJGA 4OM7A 4OM8A 2DH6A 1ENOA 2H4HA 1JKMA 4X7FA 4IUYA 2O4UX 2BT4A 1T8TA 1WUYA 1YU6A 4X8LA 3F6YA 2NU8A 2HQSA 1IIRA 3QF4B 4LJ6A 4OQFA 4AKSA 2Z0MA 3FMFA 1MIOB 5FLYA 1EZZA 3C41J 1TEHA 3MCVA 4NYIQ 4ZREA 1CLUA 1BX3A 1XZDA 2FWIA 2JCVA 5EZYA 3KUUA 1AMOA 2WVGA 1E2NA 4E6PA 4F2DA 4B3SB 2WC1A 4C2TA 1RLUA 1DAKA 5ED4A 2YV5A 5FL7D 2ZUFA 1RXVA 3NHSA 2QTRA 2I9KA 2O20A 4FYKA 4YJ2A 2E4UA 4TMYA 5A02A 4RADA 1DC5A 4L7VA 3TO5A 5BNTA 1N6RA 5LP6C 4P33A 2WFLB 4I9FA 3IV9A 4P7FA 1T2DA 1YR3A 3FNBA 4XVRA 2F43B 2PXXA 3T4EA 3EFHA 2D6FA 4BE7B 2XI4A 3D9QX 1NRJB 1EFRD 5BUQA 4I1SA 5DLEA 2HJHA 2AK3A 2ZWMA 2OENG 1Q86D 1TFRA 2QIPA 4NE9A 4DCMA 4NBRA 1XQ1A 2WWHA 1YQQA 5HE9A 1K3UB 4RTPA 1ST2A 2IUSA 3AONB 3AQ4A 4WOJA 1VQNB 1ULTA 1PFVA 2A5DA 3E35A 1Z68A 1P19A 1YV9A 1AKYA 3PR1A 3AM5A 4PR0A 4TS9A 1CHDA 4EKYA 4JXJA 3VNQA 3CE6A 5I5GA 3WRXA 5G4KA 4ENSA 3TLKA 3E9MA 3K5IA 4GQBA 4HDQB 5DH9A 1RZUA 2BR4A 1YJ8A 2HFKA 4N5HX 1X14A 2W83A 3DFUA 5LB2A 3H2GA 2HJRA 3RHFA 1CS0A 4JD5A 1H23A 4ZYYA 2ADOA 2BCEA 4EPYA 1XDBA 4E2YA 2QR5A 3OPOA 2GJRA 2VHCA 5A3VA 1O95A 2RI1A 1XMQB 2IZZA 1MQSA 4WHMA 3H8JA 4AT1A 3JAKB 1RCTE 4Q24A 1TU3A 3AIOA 4W5HA 3MJCA 3A3PA 5EIFA 3BH4A 1CEQA 3RWBA 1TO6A 3KB1A 3ABRB 3BMNB 3MSCA 4DDKA 1U8EA 5CNIA 1ODSA 4H08A 3T3DA 3CLSD 4EQ6B 1U8TA 2IFTA 5LR6A 2FZ5A 2XNCA 2HBYA 1KJYA 1Y1PA 4I6JA 4PSKA 4C4PA 4CDRA 4YX9A 4WWVA 4LDQA 2FX2A 1K27A 3Q6RA 5CDFA 1UK6A 2VBTA 5EE9A 2LDBA 2ONCA 4RPDA 4S0ZA 3PUMA 3FR8A 3LLCA 4N54A 3S7TA 1FMFA 4PZPA 1XRPA 3SQOA 3DTVD 1ORHA 1KEZA 3OJWA 3D2AA 2D0OB 2B0JA 4F3NA 3OY2A 4FDTA 3GD7A 2INGX 4C0KA 4C20A 3PPWA 3KQOA 2I3ZA 1GRCA 4WDQA 2BCGY 4I81A 2ENWA 1B23P 2XBLA 5HM6A 2VT6A 1DUSA 5JATA 4C4AA 3KQHA 5HM8A 3LT1A 1T2VA 4L95C 5CK5A 2W11A 3GRPA 3N2NA 3V2IA 1FYXA 4CEHA 3OJEA 1XCLA 3TW8A 4HWTA 1UJ5A 1PJ5A 5BT8A 1SWWA 1M2FA 1ZD8A 2F4NA 1L5HB 1H93A 3MMNA 1SELA 1F9AA 2ODNA 1SOMA 5HJ5A 5EPUA 1PX2A 1IAVA 4P08A 3ZNNA 2HCTA 3JALB 2OM2A 2VJDA 5JXIA 4YAWA 4BGEA 3F5SA 3FYHA 5LQAA 1Z6PA 3E9YA 3N8NA 2WKWA 1IJFA 1ESZA 4DNXA 4MHTA 4N5DA 2YQZA 4I9UA 1FF9A 1SUSA 2FSVC 4XGIA 5TVGA 3HDJA 4V0MA 3DZBA 5LZ4A 2HDOA 4ZVRA 4FKBA 3L92A 4MAAA 3HG7A 5EZYF 4EHHA 2D0IA 2EL7A 2X7XA 3UT0A 5D3ZA 1JQDA 1LK7A 3IUBA 3SYTA 3NTVA 3IT0A 3B3FA 5T3UA 2VYFA 3ZE7A 1Y48E 2CBXA 2OGSA 3CKMA 4RZIA 3V1UA 4AJLA 5LP1A 3GU3A 2H0RA 2GREA 3EMVA 3CG0A 4PYIA 5CD1A 2ZROA 1N6PA 2NOAA 1QJCA 1K88A 4FE3A 1FUYB 4AW9A 5AR1A 2QBYB 1HYBA 2AG0A 2H7VA 1ULUA 2QYHA 2CSUA 3F9IA 3SYRA 3WK5A 1UBHS 3TLBA 3QELB 1V0JA 1EK2A 1LBEA 2ECOA 1KOFA 2BLNA 4M9UA 2Y2UA 5HRCA 4S1NA 2FWAA 1JH9A 2IGTA 4YUYA 4E31A 4HLDA 4L5IA 4L51A 4XLAA 1IK6A 2TS1A 4MV8A 4LF9B 3CNLA 3DZKA 3RH0A 3EMBA 3F6EX 4ZYZA 1KPGA 4IDEA 4IKPA 4OK3A 4F5YA 1YF3A 4I8XA 1Z74A 2FZWA 2EBFX 2YH2A 3AW8A 3IILA 3N8KA 1GILA 3VJKA 2VJMA 3STHA 2BBWA 2CXQA 2PLFA 5IYWA 1D09A 4DXDA 1KJQA 3KOMA 4WZBB 5CFOA 2CRVA 3ZBUA 2EXXA 1E3XA 2RI0A 1Z35A 3PFBA 2DHDA 3ZUPA 4E03A 1VJGA 4GMHA 5JNSA 4NXNB 3AZQA 1P1CA 2GAOA 2BFFA 3NORA 5FO1A 3AVVA 2QGZA 3QU2A 2WYVA 1WBBA 2FSIA 4G97A 5KWSA 2FW9A 2G04A 3GLGA 4EJSA 3QX3A 4UW9A 5FULA 1TUBA 2C3YA 3ACBA 4UQOA 1RMYA 2GO7A 1C1YA 4GL4A 1G3RA 4BO2A 1DBQA 1R5JA 3OCVA 3BMOB 4MVWA 2FWMX 3R0JA 3OZBA 4GWLA 5ALHA 4QBHA 4G0WA 2F9MA 2JIOA 5FLEX 3F3SA 3NIWA 2DHCA 5EP4A 4DF3A 2NV0A 3LL4A 4XGQA 3FNFA 3X1MA 3VPGA 4ZZ0A 1F7UA 2Y3IA 2D1RA 1LTQA 2J9FB 1SA0B 2HEIA 3GOQA 4MRMB 1W4BA 1Z0KA 4P3YA 1ZWLA 2DPGA 1GZ5A 3G9ZA 4DVJA 5FTWA 3HXOA 3AMVA 4F21A 3M6LA 1IB6A 2PZJA 3MINB 4B3MB 4NFLA 3KU4A 3V46A 2DFPA 1O94A 1DMRA 3JVVA 1YE5A 4GBJA 4PPNA 4OQPA 1Z5WA 4PZYA 3FPHA 3THXA 1LCIA 2VSXA 2CXPA 3H1PA 4WINA 3ETNA 3OW7A 1E9RA 5DLDA 8ADHA 4HVAA 3E3LA 3W3AD 3GA0A 1M2NA 2QPLA 2C5HA 3AXSA 5LD2C 1KRHA 1W4ZA 1XLUA 1EWKA 2WJIA 5IF3A 1IVNA 5KTOA 1WLSA 2JGFA 4K87A 5EI5A 1ZITA 3EC1A 2BJVA 4DSUA 1IY2A 5TGDA 1XD8A 4G5OA 4GEKA 2IYRA 3KQYA 5K5EA 4NR0A 1DSSG 4BNGA 4W5RA 2B7CA 3SIRA 1G2OA 1BS2A 3OIYA 1VYVA 1C7FA 1GTG1 1P4AA 3W05A 1YFKA 4BNNA 4D4IA 4EPTA 3UANA 4WLEA 1UIMA 3GQVA 1MRZA 1PSDA 2N42A 4NULA 4RIGA 4ZOBA 4R2KA 1W9HA 3D31A 1JIUA 5C32A 2R44A 3HSKA 4GLBA 2ZYHA 3AUUA 3ACCA 4MJ3A 2EFDB 1M1NA 3B1VA 3JQRA 5JDIA 1N2CA 1X70A 1XFOA 1TVKA 4L16A 2BGJA 4G8JA 4RBNA 5HG0A 1UDXA 3NWBA 1KK3A 4MSUA 4H2DA 3W9YA 1PZNA 1Y3HA 5DP2A 4O4LA 1NVFA 1E1DA 2ENUA 2AOTA 3G5UA 1E1CB 1ZGAA 3WJ1A 2HA2A 2HBQA 3GN1A 1E9AA 4UHHA 3PL1A 1YB6A 2N3ZA 2X40A 4RUKA 1G2PA 4II3A 1NYRA 1FMJA 1IWBB 1PG2A 4UU7A 3LHFA 5KAPA 3SC2A 1PWHA 1W46A 5A3JA 1GR1A 3I72A 4RV9A 4DR1B 1FTWA 4DIDA 3INRA 2VT3A 2CMGA 3SP1A 2HA5A 1JHOA 2OAEA 2VBFA 4IGAA 4BKMA 1RXIA 3V32A 3R6DA 4EB0A 4E7OA 4GYYA 4PO1A 3RYCB 4KXUA 3K2QA 3RC3A 3R9IA 2ESRA 2F3QA 1K9MD 2OFOA 3CUTA 3FZEA 4UCWA 3JAMA 3JD1A 3ZHZA 1XTVA 3ZEIA 4B80A 4ZVVA 4M1MA 3FLBA 4O2BF 1EQUA 1Q50A 1CP3A 1C2YA 2FZLA 2P9HA 2QR2A 3JD2A 2C88A 3FDJA 1TKRA 1URPA 5FWDA 3REFA 3SS8A 3T7CA 2ZZEA 3BJIC 1A4RA 4G5HA 1QHHA 1UPXA 5LA6F 4DIOA 3L6BA 4QJ3A 4RSGA 4QFDA 1GV1A 4TKLA 1Z22A 3RK0A 1P5JA 4ZOCA 1CRQA 2V7PA 2O57A 2OLEA 2QXYA 3K6KA 4PLWA 1ZNYA 3ZGLA 1M1ZA 1SULA 1F3LA 4E09A 1GRNA 2R8PA 3BC1A 1Z2OX 3CPHA 4JVNA 4TXHA 2VXBA 4XDHA 4QTXA 1CF4A 4I9HA 2CC2A 1P7WA 4K9PA 3DLPX 4UM7A 1MW9X 2A94A 4WW0A 1KRXA 4CKXA 3QKTA 4DJDC 2I6GA 1L4NA 1RYMA 3O8BA 1S5PA 4AIIA 4ESOA 1E32A 3H8VA 1LPOA 2F3SA 3F98A 2JHCA 3QX8A 1VBKA 1ZZEA 3HCRA 1Q82D 3T4PA 3NCTA 1GL7A 2FPSA 3K0KA 1G17A 5B7GA 1CEYA 3G02A 2X7HA 3HNRA 4O33A 4EECA 3D5TA 3V1MA 3LOPA 1HDOA 2FSFA 4K86A 3EXG2 4OUDB 1J7KA 1GOTA 4MS1B 1ATIA 1SVOA 1C7RA 3CUVA 2ODAA 3VSCA 1Z5NA 2ICAA 1XGKA 4DCTA 5CU7A 3WIEA 3IQEA 4NV3A 1P18A 3JQ8A 1JHQA 2K4MA 2PAFA 4PHFA 3HVUA 2MYUA 5SV2A 5KWJA 2F17A 2YC4C 1XCPA 3KLOA 3L7DA 4K9KA 5AW1A 4BP9A 1LF5A 3K70C 2AFIB 1R66A 2NQ2C 4DCOA 4Y2YA 5FPTA 3FKSD 4LV6A 3CFYA 4MVYA 1S4MA 3L8GA 1CVIA 4WK6A 5A3RA 4NFHA 3V6MA 2ILVA 3OTHA 4JEIA 2QUJA 3IUNA 2WPNA 1QIMA 1ZESA 3EOBI 5IVDA 1EHYA 2ZS9A 1MX9A 1E2IA 2CK3D 2WIBA 1E4VA 1P0IA 3FMPB 3O7MA 3GBVA 3LLSA 3P9CA 3QKRB 1VE1A 1Z25A 4K81B 4V02A 4X1KB 4ZVNA 1HQCA 4M1TA 3IVCA 4MGZR 5LQUA 5DW3A 5CEFA 4MR7A 4H1HA 4O29A 2FN4A 4C0BA 3L4JA 1FNCA 1BN7A 1XVAA 2UYOA 1WUJS 3FAZA 3OT5A 4FMCF 4DDUA 4HKTA 3O38A 3M3PA 4O4JF 4YWJA 4G6IA 5SYMA 2JFUA 1J8MF 1JR3E 2AL7A 1XWFA 2JIRA 2D1QA 5G0VA 3JZAA 2EP8A 3R6TA 3SLDA 3UJHA 4EUNA 2OHJA 4U7HA 1U2GC 3UF0A 1RJWA 3PDHA 3USZA 5EMKA 1PYOA 2ZBVA 1XCGB 3CW8X 3GNLA 3HE3A 4UUOA 4UOQA 3R7DA 5JZBA 3LDAA 3Q0IA 1I5EA 3DVQX 1ODLA 2B30A 3P2IA 4Q9KA 2ZL7A 1U9IC 4KYVA 2EZ9A 5AW4A 3ASRA 2AZTA 2HWXA 2G88A 3C5EA 2P35A 4UNSA 5KYKA 1S2IA 2AWOA 3RVJA 4ZT4A 3G2IA 2NVWA 1PSZA 3ETDA 4TGLA 4KMRA 2Y6UA 3UCFA 2CK3A 5CFZA 1QGDA 4OQEA 3G7UA 3QY9A 4HDCA 1QPZA 1DJQA 4X24A 2ZQZA 3TD2A 2YHIA 5KYTA 5IYZB 3Q4GA 5KCZA 3FKQA 4PO9A 4BEJA 1C9NA 4KFTA 1O08A 2ADFA 1KH1A 1XEFA 4EGCB 5IK2A 2ZYWX 3ILYA 3BCUA 1HWYA 2XMQA 3S7ZA 1G291 4DCGA 4CMEC 1Y6JA 2PRKA 3QBEA 3CZRA 3F4BA 3M4XA 3G5AA 5FPHA 3SLRA 4BLTA 5JNVA 3MT0A 2P2YA 4LJSA 1NNSA 4NNPA 1NHGA 4OLHA 3S70A 2JK0A 1HLGA 3QENA 3UVEA 2MSLA 1VE3A 1N6KA 1E3WA 5C46F 1PLKA 3SM3A 4KN5A 1GZ7A 1RPAA 4J0IA 2YW9A 3DFKA 4MQ5A 4P5DA 4YP5A 1I7PA 3FI9A 4DSNA 2V65A 3BXHA 3FPAA 4K9MA 5AK6A 3ZWXA 1XDGA 4OQLA 1JMYA 3OCXA 2PX6A 2CVQA 4ALIA 4YT4A 2P4HX 3S2YA 4YQFA 3ANSA 2H1IA 5JCXA 1ZOOA 4P92A 4CT4B 3QLJA 3T7RA 1F4PA 1XQ9A 4GQAA 5AKIA 1T4CB 1NBIA 4MI6A 5KYYA 1GDDA 3SBEA 1FRNA 4LJAA 3V8BA 3IS3A 3OZVA 3AI3A 1VHEA 3D6HA 1KE1A 2ONJA 1R27A 5EVJA 2ODWA 5G1OA 1J0EA 521PA 3WGGA 4Z7QB 1O0BA 1D9XA 4H31A 4JT8A 4B3BA 1CFZA 4BB5A 4DA6A 1B15A 2ZULA 2HRRA 3AOEA 5FQOA 3WNZA 4A0QA 3CCVB 1R4NB 4OU4A 3RDPA 5CDTA 5A9SB 3W9SA 1W49A 2XAUA 4WEQA 5KVVA 2FUNB 1BFKA 1CY4A 1FX0B 1FC0A 2QRQA 3EIEA 3JD3A 3O8QB 4QHYA 1P44A 1EJBA 4GPTA 4B9AA 1Q2UA 1Q12A 3LO5A 2A92A 4AJIA 4H35A 1M1YA 5B4TA 1XEWY 5I7WA 5M3BA 1CIPA 1QIJA 4R2HA 4WKGA 2H18A 5NLLA 5BMOA 4DR7B 4DMLA 4P58A 3U7FB 5FPSA 5T57A 3RYIA 1LVGA 2YNMC 2I5PO 1VMKA 1C3VA 2JGJA 1SCNE 5FX2A 5AI6A 1J49A 2DUUA 1GUFA 2O8FB 4AB1A 4LBZA 5K0CA 2UAGA 1QK3A 1XO1A 5LLTA 3DG9A 2ACEA 1TQHA 3IQWA 1J39A 5L40A 2ODTX 4H60A 1WZCA 1EU1A 5LN1A 1MZVA 1EM8B 3G2OA 3U9TA 4HUQB 1VBFA 1XU7A 4BWVA 2BMWA 4QG3A 4DB4A 2PQ0A 2OWEA 4Y9RA 3PDWA 1BU5A 2JJ2D 5TPWB 1TTHA 4ZT5A 2H9AA 2WF9A 3OPMA 5IYRA 4X7CA 5DKFA 1NVUQ 5CB4A 3W2FA 5KOYA 2F8TA 1FFWA 4BVJA 3EUWA 4E2WA 2KM1A 3HV2A 5IU6A 2JLQA 2B1QA 4HDRA 1XN4A 1V16B 1WP9A 2CMHA 2OO7A 1GQYA 4G5GA 1UR5A 5T6BA 1ZR2A 1QCYA 4ER6A 5B7NA 4MI1A 1PV2A 1NXXA 3QVGB 2D7DA 4PX5A 3TTXA 3EAFA 1XZAA 4TKUB 3MD9A 5G0TA 4INAA 1Y5RA 1M34B 1RI3A 4N3NA 1UM8A 3QFHA 3PXCX 1QZ3A 4Y2TA 5DHRA 4C2UA 1HRKA 1R6UA 4ZV9A 4ID9A 1LI7A 5MDHA 2EZUA 2PTHA 3OETA 2PWAA 2ZUDA 4P7KA 3DUWA 1U0JA 3AGQA 1FSSA 4QUGA 3KKQA 3SN6A 1DE0A 1XI2A 4H1WA 4I1YA 5HSGA 4J94A 1QLWA 2FJUA 2O8DB 3S6JA 3TIIA 1PR5A 2FSHA 1LDYA 1Y89A 2P69A 3Q3EA 2XVXA 4WT7A 4Q0MA 4YNBA 4C7JA 2P62A 4QBGB 5D7NA 3RYFA 3I2KA 1VYUA 4ZT3A 5T3YA 1HNWB 3CO5A 1OT5A 1LFAA 3KKEA 1U8XX 4WKCA 3D43A 3RQIA 2FA9A 3P20A 3SZOA 2DFVA 3R0VA 5BYBA 1I94B 5JBQA 1GQFA 4A0SA 1OX4B 3ANXA 2CXNA 3H5OA 4E0BA 4XB2A 2H1SA 2ONYA 2R6ZA 4MYSA 1NXVA 2ANCA 4QXAA 2JAOA 2W6CX 1VLYA 3I3OA 1Z8HA 4QM7A 5A04A 4FVTA 1CR0A 1M67A 1MH1A 2I03A 4V0ME 4YDSA 1MGOA 1SIWA 3KAQA 3IVXA 3KYCB 4OK5A 1W9XA 1GNRA 2BD0A 2C29D 2OK8A 3EXFA 4QJIA 4REOA 1VXRA 2R7AA 3SIPA 3RVLA 2WAXA 4TRRA 2JAWA 3OQ6A 1NVTA 5CYFA 5GONB 5BW6B 2IV7A 2XB9A 4XVCA 2BEUA 1OH5A 2XXBA 1QIEA 1J9ZA 4XR6A 1ZSVA 4YALA 1G7SA 3PT9A 2ATXA 2NU8B 4D41A 3ZPNA 4XQ9A 2HF9A 4IHAA 1JFFB 1SVNA 4DV7B 4MAFA 1TEXA 1XUOA 3V9AA 3GUUA 1Z4IA 4JK3A 3UV6A 5FO0A 3WK6A 1NE7A 4XTRA 4DANA 5EXSA 4IAOA 1Y81A 3BREA 3TDKA 3C7DB 2CMFA 2CEKA 5CB4B 4Q4LA 4M4SA 4BNHA 3E9CA 1LK0A 1VJ1A 2CE7A 2OSVA 2ZETA 4JUDX 3TLZA 3VSDA 1NN1A 4PFSA 2WVHA 4ERNA 4BTLA 2X0KA 2VP5A 4J1SA 3ZKWB 3KOUA 4KFUA 4FB4A 4P9SA 2P78A 3TI7A 3OOJA 4PHHA 1XTZA 4IOLA 3WLTA 4RWZA 3ZCRA 1CZUA 4TYNA 3OZTA 3NBXX 4YJ2F 1O5OA 2YY7A 1KO1A 2HU8A 2ZRFA 1SC1A 1P3DA 3VPCA 1PJBA 2I0FA 3CC8A 3A8JA 3AF2A 4JEMA 4K9RA 5HHTA 3CCEB 2ZW9A 3MK31 4J3FA 5E1DA 5EZ6B 4Q05A 1PQPA 3DTVB 2RH8A 1Y42X 3BGSA 4YRQA 2CV2A 1VRCA 1HTTA 1NJ1A 1ZJ5A 2EV9A 2NUAA 3GYBA 4UE6A 5LXTB 1WG8A 1IXKA 1MEJA 4P2GA 1IJBA 2B8TA 4FBLA 3SY8A 4AK9A 4CFZA 3BBPA 4JR1A 4HQOA 1UC5B 1JEJA 1N2IA 1NBMD 1QK5A 4X44A 1BFDA 4ZA2A 4ZT7A 2HMAA 3WYFA 2RI6A 2P2NA 3CM0A 5CB8A 4CFYA 4Y1FA 1M2VA 4KOEC 5ABPA 2O8CB 4DR3B 1LF0A 4E5YA 4AULA 2QY9A 4JXKA 1K86A 2BM0A 2XTNA 4YHHB 2FF5A 4GG1A 5AHXA 5EIOA 3TXXA 5CIQA 3RVNA 1YNSA 2H54A 1PL7A 1T6XA 1YUNA 3O7WA 4JB3A 3V80A 1CNMA 4L08A 1MFZA 1Z8NA 3NS7A 3BS4A 3FR7A 4XGKA 4B43A 4ON9A 3H3FA 1OFUX 1E2UA 2X6QA 5AXDA 2X5OA 4B17A 5MFZA 4HATA 1C1DA 3CX8A 3G23A 2Z8YA 3ZPXA 1D6MA 1WXIA 3GLRA 3JWEA 1XZPA 1NAHA 3JZDA 3ROGA 2P8SA 1IOLA 1OV4A 2XUZA 3BA1A 3FOAA 3ITEA 3AVWA 2ZYUX 1KFEB 4MRRA 1SKBA 1WZNA 5AUPB 1JIQA 1PRYA 3VU3A 1DJLA 1M83A 1CDEA 3I9JA 3OSUA 3T0GA 4ZYWA 3I6BA 5AJVB 4DYDA 2AWNA 4DTCA 1JWLA 4UM8B 3HZOA 4JUCA 5IFLA 2G6TA 2XV1A 4K9SA 4NYJQ 3FB1A 4BNIA 1S3IA 1NYLA 1Z0IA 2IY7A 1GD1O 3JW8A 3PJFA 5GADl 4P32A 5J58A 3CVJA 1LBTA 1HXHA 3DZCA 4LRQA 5SZKB 3H9EO 2J5BA 1CJUC 3U7GA 4TLMB 4RQBA 3EJ6A 3KB6A 5DYYA 5EJ2A 2J9YB 3USCS 1P6UA 2VA8A 1RWKA 5C81A 5IJWA 5KNBH 1MAVA 1P6QA 1C9MA 2AMVA 3PD7A 3LYHA 2PMDA 3T7DA 4DV5B 1ILWA 3TFQA 3ZGXA 5IDXA 4P8RA 3M5DA 4A27A 3K31A 1IHDA 4Q12A 1RRPA 1OLUA 2K87A 1FSGA 4G5XA 2PMBA 3W4JA 4AQDA 2H16A 3HUUA 4PPGA 2VWPA 2B3TA 2ZJ4A 3JAWB 4TWAA 1TO2E 3OZ7A 4Y6PA 2DY0A 4DJJA 1VE5A 3OIUA 3IERA 3OPYI 4KE9A 4NQZA 2GAJA 3BFJA 4HNVA 5EESA 2ODQA 5D51S 5CXXA 1DAMA 2RHHA 4MQFA 2J4CA 4XPIA 3H0EA 2VWGA 3UJ6A 4GQNA 2EAUA 1YHZA 3MS2A 1T0BA 3E1GA 4BP3A 1TADA 2DTEA 2ZTUA 2B98A 4RMGA 4JI4B 4BAUA 3CW9A 1EFTA 5H16A 2ONKA 4R3NA 1N2OA 1PUIA 2FLKA 1SU8A 3F46A 1S89A 2RHOA 3HYSA 4GI5A 1QWOA 5DX0A 1RHMA 1KFCB 3GPCA 1ZKDA 3CTAA 1JTEA 3MFYA 4KN8A 2QRHA 4NL4H 3COYA 4RGYA 1EEHA 2HR1A 4MCHA 3BXOA 4RORA 2MTBA 4A91A 3L7IA 1Z0JA 3R5FA 4CKBA 1IHMA 1ZK2A 1ZN2A 4ZI5A 3RLIA 4ZV7A 2PJUA 2Z08A 4UU0A 4YJFA 2Z4SA 4UZUA 2HEGA 1WA5A 3BRWA 1P2FA 1QHNA 4UUBA 2O0LA 3RSZA 2NYRA 4MPDA 3H0CA 4W4TA 5JLAA 4JBXA 4MQ6A 3G8DA 2YOHA 1RP7A 3GGDA 3GBPA 3D7KA 4MRNA 3B12A 4R6WA 1WF6A 3OFKA 4QJ5A 2GNOA 4BNKA 5CA0F 5JQGA 2VTBB 4KPUB 1D1NA 2R1UA 3DB1A 4BO5A 1U6JA 3EFOA 4LCJA 4C4XA 4OQZA 2RHTA 2XSZA 4KPGA 4OLJA 4H6WA 1U7XA 3X2SA 4BO9A 4B48A 2Y0EA 5IH3A 5C7LO 3KFVA 2IYPA 3NP7A 2VAWA 1V26A 3C87A 1X0VA 1ICIA 2C77A 1UH5A 2J9GA 4XH9B 3VFDA 4IIEA 1C1XA 2N1BA 2OCXA 4YP1A 2TYSB 3EXEA 3OLCX 4HZIA 3MMPA 2YWFA 2DWQA 3PXAA 2QAIA 1OZFA 3NASA 4Z9BA 2MINA 1R5BA 1NBHA 1HQDA 2NUTB 3B3AA 4MWBA 4R31A 1FY2A 1T35A 2EFCB 2G9VA 2GPBA 4BC0A 4C22A 1Q7TA 1MQAA 2COUA 3Q5DA 4JOCA 3ZGNA 2VQSA 4G5SA 1KWKA 5DCWA 1TCAA 4E6EA 1Q22A 3AUYA 4WVFA 4AJOA 3FUUA 3MGKA 1BDBA 3ORQA 5E6TA 4XOPA 3C3EA 3MELA 3OX1A 4RAOA 3THOA 5KTSA 5ILQA 2ODPA 1JT2A 4NCXA 3HCNA 1I3MA 4EWLA 4G0YA 3H4VA 5IJXA 2REXB 3ISVA 1OAKA 4I9GA 4LSGA 3MSXA 1T0PA 1EFVB 2I8LA 1IZYA 3GMSA 3GDOA 4LHYA 2QLBA 3SHTA 3R9XB 4MKXA 3A14A 3IPCA 4DMHA 4NCAA 3T3OA 4H3HB 4DG9A 2XMBA 3TRDA 1Z36A 2E82A 3MGCA 4H1UA 3AF4A 1FDSA 1ODKA 3VZBA 3EWIA 3DLTA 3NOOA 4NP6A 2FMTA 4CQMD 1K5DA 1M1YE 1JN0A 2C9ZA 3M82A 4TRMA 4CTNA 1FPMA 5IEJA 3T3MB 4A9AA 2FSSA 2JBWA 3NVKI 4C0AC 2QLTA 4JB2A 2Q4DA 4D9KA 4PGMA 4LDAA 2IS6A 1WPCA 5AW7A 4G67A 1DEAA 2EFJA 1BEEA 1KI3A 2YJ5A 2PKQP 2ZRKA 3I9V1 4V0NA 5AW6A 4HDMB 1RAAA 3BRSA 4KQMA 1GA6A 1TJ5A 1YR8A 3GCZA 3GLHE 4OOSA 1ESMA 2ZRNA 3THRA 5LKRA 3KJQA 3AFIA 1KERA 2R48A 4CF4A 3P26A 4YRTA 3BNWA 1EIZA 4JNCA 1XXHE 3NALA 4ZYUA 5KX5A 2ZTVA 3WTBA 2JJ2A 4MV7A 2BM9A 4ARBA 4C03A 5C9ZA 3O8RA 4A36A 3DDOA 4Y6RA 1YGYA 4HDKB 1FJ2A 3W2TA 3K0SA 4J7UA 3K4QA 1P0FA 3NC4A 2VSNA 3D8UA 2FEPA 4EX6A 1NKVA 1CIVA 2GO1A 3LUJA 2QI9C 3KC2A 4DMRA 1QHIA 1R4NA 1OWNA 5CBKA 1TPZA 2CF6A 1KZLA 2PFKA 3N2GA 4KQGA 5DIFA 4DNFA 2QD5A 1EB8A 1PD1A 2PFSA 5FKJA 1YO6A 1LGYA 3IX7A 2DKOA 4NV1A 1T5IA 5M34A 1PQ4A 1B0UA 1ZCAA 3HJUA 1U0HC 3OM8A 1D2MA 1XDZA 2EC5A 2OZPA 4FDAA 4X6UA 5DBEX 2V6IA 3VOSA 5EQTA 3WLEA 3BD9A 3UYLA 3H3XA 3ZD9A 4J7AA 5HK9A 2WM2A 1FNDA 1RM3A 1XTRA 4NBVA 1E99A 1RLJA 4KMMA 5I7VA 1ZC4A 1CDZA 3QMWA 3LK7A 3MCUA 2J3LA 3KSRA 2IELA 2LKCA 4CZ2A 5BUSA 4CKCA 2B9EA 1UDBA 4GT1A 4GXTA 4HDNA 4KYUA 2P9BA 1ZUWA 5E0KB 1OB5A 3I0ZA 4DT1B 2O3JA 1US8B 4WBNF 4C7OA 5AVYA 4J2OA 1S2OA 1JS1X 3FFTA 4OHWA 3UPUA 5D1HA 5FNZA 4TLEA 3TTTA 1W5BA 2XCQA 5KX5F 1IDOA 2E5WA 5DASA 4XSHA 4ZVOA 3WNDA 3TNDA 3MJDA 3Q5GA 1IPFA 3BOSA 4P3OA 1XHEA 2BC9A 2P9QA 3AR5A 5BVHA 2ZTHA 4WVLA 1HE3A 4MVJA 1C3LA 1U1DA 3NNDA 3CUKA 3HDVA 4MGKR 4MVJG 3N87A 1JKFA 1JG7A 2F3UA 2PWPA 2B7LA 1W88A 3LHKA 3REGA 3ZVRA 4CF6A 1IEXA 1CUDA 1ZJYA 2UKDA 1KVTA 1SRRA 3DBRA 4BMSA 4A8JB 2B82A 1B1CA 5ALQA 3CUSA 3D7RA 4B4UA 1K0UA 1Y7IA 3FTQA 4QJ4A 4RIFA 4ZVPA 3AP2A 4DR4B 1SU7A 1Y3BE 1T1EA 1ZMOA 4AUNA 4K26A 3AZPA 2PM8A 3IEKA 2IZ1A 1TC1A 4DXAA 4A6XA 3ZWVA 1VSUA 1WPXA 5C7OO 1S9DA 3GQBA 1CRLA 1IG3A 1RBYA 1E9SA 2XCRB 2OVBA 2YVLA 3N2ZB 4OPMA 4ZKEA 3Q2OA 4LVOA 1YCDA 1SG0A 4S04A 2DGDA 4EP1A 4E5VA 1A5TA 1GLGA 4UVEA 1KKLA 1SCUB 5JO0A 3U9LA 3ANTA 5IH7A 3PIDA 4YJ3F 2FB9A 2Q99A 4GIBA 1WEKA 1M8FA 3RFFA 4DOMA 3CJRA 2FZ4A 2CLSA 1N9GB 4L8WB 1ZMTA 3K2IA 3AVQA 3JS5A 3OEEA 3LRTA 5LIPA 5KSZA 2M1XA 4B6OA 3LLUA 4LTMA 1QJ4A 3FBWA 2GJ9A 4B81A 3NM4A 5FCDA 1WTHD 1X1EA 4W63A 5EJ5A 3M89A 4A4DA 1NVXQ 1QVVA 1UMBA 1U3TA 5J2UB 4EB6A 4O4HB 4L02A 4KO3S 3I9NA 1TK9A 1J6UA 2DULA 3A9WA 4CM8A 4H4DA 1AF7A 1PP4A 1Y1LA 2B99A 1W1UA 3GFQA 4GOXA 5TC4A 1UT5A 2A1TR 2PEZA 2WIAA 3FPSA 4FW8A 4CDMA 2XVZA 1LBHA 5LA6B 1C4XA 3RVQA 4JLKA 1ZHHA 4OXKA 5K3BA 3QE4A 5EHGA 5GWXA 3QW2A 1UBTS 4DQVA 2XQIA 3GHYA 3NEJA 2TMKA 1YZ3A 3ZE8A 1OWOA 1RXCA 1WHTB 2BFOA 3KCQA 4RVUA 3WS7A 2QTVA 2ZBQA 4Y9DA 1RWVA 5I7EA 1XVTA 4XA8A 2VAVA 2QVXX 1YBMA 1RKBA 1T2FA 5E95A 2Z8ZA 5B4VA 3DWIA 2W6MA 4ZCSA 4IGIA 2D5AA 1ACMA 1FTGA 1LBIA 1I6WA 3D3WA 1FQOA 4QVKA 1E62A 3SIXA 4X64B 3AEZA 5LKAA 1U8FO 2OYCA 3BTVA 3ZLTA 3PX2A 1ZD5A 1H05A 2C42A 3T3IA 2AG5A 1L5MA 1NQWA 3NNNA 5J59A 4N3AA 3BFKA 1HTWA 3UH0A 4RVNA 1WXDA 3DAHA 5E7IA 5I8ZA 4JOQA 2XD9A 3LKBA 4F8JA 5AW8A 2WT4A 4QVAA 4MPPA 2BH2A 5D5QA 3ES9A 2EU8A 4UBNA 4WXYB 3CCRB 4AP6A 4BQRA 1T29A 4YELA 1JXAA 3A6LA 4CM9A 4R4JA 4ITRC 3JALA 2K2QB 2FLWA 4H59A 4ZU6X 3S4YA 4AG3A 4PRZA 1ODIA 7REQA 2D2IA 2A0UA 1A9QA 1W2WB 1I6KA 5KPDA 1WETA 1IIBA 1E2QA 4GP9A 4X06A 3C3XA 4XUCA 4KPFC 1T24A 5BY2A 2ZUEA 1Z0UA 2X6RA 4CMIA 1D4ZA 3S5JA 5IM4F 3BGWA 2HSWA 3SKBA 4MUIA 5D85A 1N32B 2Y1CA 2PL9A 3ZXIA 2X0RA 2QMQA 2WIGA 4MVJF 1YKFA 4U02A 2ZK7A 4AJ2A 1EXDA 1FUIA 1VSQA 1CQJB 1BRTA 3IMFA 1W93A 4PR3A 4ZN6A 2AFIE 2ZTGA 4HWRA 1H6DA 5FFMA 1PZXA 1Q5PA 4GDMA 5C35A 4B5LA 1AHPA 3IKJA 5EP2A 3BSWA 4GX2A 2YWXA 4HAZA 1MR3F 1U1FA 3CZ4A 3EQ8A 3HVRA 3CR3C 1USUA 2VUIB 3VR6A 1DAHA 1HEUA 4LBVA 4O2RA 4HPXB 3FCYA 2J32A 4OJMX 3WLOA 3VPAA 3DOJA 2PIDA 1LS1A 2G40A 1MNQA 3NHWA 2QTBA 4IDGA 5DYTA 5KOHB 3ZHSA 1HFWA 3OX3A 4PLCA 2YQ4A 1WCIA 3W34A 3T6KA 3O4VA 1DIBA 3HUDA 1YGPA 3FW1A 1K8YB 2BFCB 3LQKA 4JI3B 1KHTA 3OPYB 3QWHA 4DQKA 1X87A 2WZDA 1QRAA 5AIBA 2FVXA 1CR6A 2FF7A 1YC5A 4ZDWA 2F1IA 2Q4OA 5A3SA 2V6BA 3BIOA 1PR1A 2GASA 3G8CA 2NG1A 3K0BA 4A23A 3JQEA 2C2KA 4QPJC 2AR0A 5JS2A 2XNHA 3HM9A 3LCMA 3MTQA 1CUFA 4IIUA 2J3MA 5BSUA 2QTMA 2VHYA 3DBIA 4P82A 5IWCA 2I3DA 5FL3A 4R9NA 2IY9A 2VIIA 3U3JA 4X1YA 1JEDA 3QGMA 4ALMA 4CU5A 3U61B 2XY4A 2XMGA 3ZU5A 4JJIA 4P3NA 4Q03A 4M7RA 5BSXA 3EZFA 3T9CA 3HU5A 1IBMB 3J81A 1JZQA 3NDRA 4Z4ZA 1OBOA 4O1MA 5NULA 4GZ6A 1M2OB 2VBIA 1FA9A 5DOVA 3CZQA 5KAMA 2UZ0A 4TKOB 3LFHA 2VJJA 4GE3A 3RO7A 4AN1A 4YV1A 4P22A 4XUGB 4YCMA 2E7ZA 4ZZIA 4FTWA 2DKFA 2WJPA 1EFVA 3OECA 4OQQA 4KI7A 4ZHQF 4CJXA 3NHKA 3WP0A 5BSKA 5P8WA 4OXXA 3V55A 3BSYA 1DWQA 3A3YA 3DEHA 3MWYW 1OKKA 3OKAA 3BIFA 3MMXA 4GM0A 1OXKB 4IMRA 4HNUA 1F06A 2A5YB 4F3YA 3CNOA 3SNHA 3WQQA 5K3FA 1EK6A 4HV4A 3R6LA 2V8OA 1ORTA 4O2AA 4S1VA 1E58A 4GGOA 3H4IA 1NF8A 4NAVA 3ICQB 4XONA 1V4BA 4NU5A 3U7QA 3MRXA 1NATA 2R4TA 2MINB 2GJAA 2H00A 2ZAMA 3GJ6A 4QELA 5DIZA 3U56A 3LQQA 1KRWA 2QP9X 3E7DA 1AN0A 1P9RA 3PNQA 4ID3A 1JDPA 3VU1A 2GPNA 4TTAA 4DBLE 4MQMA 4ZD6A 5FF9A 2G0NA 3QG5A 5JZSA 4R9UC 1DAOA 2IVFA 3WG9A 1A8IA 3LTEA 4R0NA 3EG5A 3VXKA 4C4OA 3Q7QA 4D8XA 1QO0D 4HFMA 4KPUA 1SKQA 2A0FA 5I9SA 3R9WA 3HKEB 4HQKA 1ZD1A 4DUZB 1L7RA 1GWNA 1E4YA 1LY1A 1VE7A 1A2KC 2EFYA 2I7TA 2PJDA 1DWPA 2WKRA 4DCSA 4EY6A 3ZUGA 1M5TA 4LFAB 3H75A 5D3MB 2PUFA 2AG6A 2LCFA 1N2EA 5TPZD 3ZJYA 1XKTA 4UMEA 4Y9UA 1E18A 1KBQA 1HLPA 1EXNA 1MDFA 1U3FA 2J6IA 2ZM5A 4HX5A 4IJ5A 3ID6C 3S8YA 3KQVA 2VS1A 2H2FA 5ALGA 2C98A 1FP6A 5C8YB 2MSCB 4R2XA 4F4UA 3CEJA 3B9RA 3ETJA 3DAGA 3BFPA 2GZDA 3PLNA 4RK5A 5TT0A 1X1BA 3U9SA 4EIWA 5LZ9A 1VJDA 2GFIA 1WZIA 1BPLA 2J48A 4ZIRA 1GG2A 1POWA 4K9QA 1E1NA 2AC4A 3C0KA 3HB0A 3VBEA 3GLQA 2IWRA 3LBFA 2GERA 3M9XA 5BSYA 1EAYA 4IL5A 2JDIA 4X92A 1Z29A 2AUNA 4QEKA 4WK2B 1UMKA 3KKKA 4CFSA 3FNIA 3F3YA 1QVRA 3FYUC 3RBAA 1F6BA 3OTGA 5B3KA 1MHPA 2Q0XA 4UCQA 1I4WA 1E1RA 3A1VA 3CCLB 2QVGA 3OE5A 1R6BX 4YPFA 2I65A 2I4RA 3ELBA 3TKLA 4Y2RA 5EE0A 4ARVA 2OTLB 1XAIA 2QQEA 4FDUA 1JI0A 3B8EA 3DF9A 1QG0A 4CLEA 2O7SA 3L7BA 3P2JA 4MQFB 5FB3A 4IGFA 2IZ0A 1P4GA 3LY7A 3FHCB 2OB2A 2VATA 1FNSA 3DJFA 4QDJA 2ZSBA 2LGJA 3N74A 5FOSA 4B0PA 2GXAA 5AKJA 5ALPA 1VJSA 3L4EA 1G5TA 1UBCA 3JQDA 1JIIA 3D4BA 1PNQA 3NETA 2GBPA 2BE9A 3O4IA 1BHSA 3CR8A 4OKNA 2OBXA 4DLTA 2TMDA 3BWBA 4IIDA 3UT6A 4OHOA 2HSZA 3ZNOA 2SKDA 4Q6WA 4RKYA 2RCNA 1MC4A 1FMTA 1MG5A 1QDLB 2ZRPA 5GOZA 1BS9A 3H5IA 4R2MA 4WL0A 4PAOA 3LCJA 5C80A 3LFTA 4U2GA 2AQHA 4UEQA 5BSTA 1GPJA 4QWMA 2QGGA 2EFGA 3OMWA 4UCXA 2NN3C 4DDHA 4OHKA 2J85A 3VZRA 5C1PA 2OV6A 4IEFB 2GB4A 4MCIA 4C5BA 1QE0A 3EZLA 1IPEA 1HRDA 3P9KA 4P35A 3U62A 3BN3A 3FI0A 3X44A 3OFNA 4IWYA 1O95D 3KVYA 1FVOA 3LVFO 1TVKB 3LX5A 1GTSA 3K20A 1YMVA 1FZQA 2GZRA 1E1QA 1G6KA 3FRHA 3IA2A 4RPLA 1OU0A 3A6FA 3W3AA 2ZJYA 2IS2A 5IUJC 1ID8A 2EP7A 1VQPB 5H68A 4DS3A 2O8CA 1W4RA 1JEYB 2YY5A 2X3FA 1C30A 2OPBA 1P5HA 1E2LA 2VG8A 1N7IA 1P5ZB 4ZO4A 2WNHA 4BVAA 2OCIA 4FEYA 4BFZA 2AV6A 1GKYA 1M5UA 3N8IA 3EZXA 1ODTC 2EGGA 3UAYA 1VKNA 1YACA 3INGA 1PQYA 3JZMA 5CURA 2VJOA 4PIPA 2O6HA 1DBSA 3O4HA 4P80A 4F2PA 2VP0A 4WI1A 2WYUA 2WA2A 2ZWVA 3UWOA 3VTKA 3IP6A 4K0KB