1QH0A

Ferredoxin:nadp+ reductase mutant with leu 76 mutated by asp and leu 78 mutated by asp
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKDRDYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of a cluster of hydrophobic residues near the FAD cofactor in Anabaena PCC 7119 ferredoxin-NADP+ reductase for optimal complex formation and electron transfer to ferredoxin.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Oxidoreductase
molecule keywords PROTEIN (FERREDOXIN:NADP+ REDUCTASE)
total genus 89
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1999-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1qh0A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1qh0A02
4PC7A 1VQKB 3AVWA 1IJEA 4YAOA 2BPOA 1QFZA 4YAWA 3QE2A 1ZM9A 1W87A 2XNCA 4N3NA 1YJ9B 3MCAA 3CC7B 1E62A 1DDIA 2YWFA 1Q82D 1VQ8B 1U2RA 3OZUA 4BPRA 2B5OA 3FJOA 3CRZA 5KSWB 4R71A 1FNBA 1FRNA 2R6HA 3LVBA 1N8RD 4LC0A 3AVYA 5AN9A 1VQPB 1DG1G 2PLFA 4B47A 4M1KA 3PENA 1VQ4B 1N0VC 1EP2B 4DQLA 3OJXA 1S0UA 3W5UA 3SJZA 3QFRA 4Y9RA 1JB9A 4TMXA 1QG0A 4C43A 3CC2B 1EP3B 1EXMA 1G7TA 1NDHA 1D8TA 1QUFA 3JQRA 3QFSA 2QA4B 1J9ZA 2BN4A 4LBVA 1VQNB 2OK8A 2DY1A 3W2EA 1EWYA 3J81k 4TMWA 1SM4A 3JQPA 4PC2A 2J7KA 4ACBA 3W5HA 2BM1A 3E1YE 5THXA 4ZGNB 3CCQB 1GVHA 4AC9A 1F20A 3CCUB 1FRQA 3WBKA 4RD2A 4G1VA 2VZLA 4ZGQB 1R5BA 3CPWB 1BJKA 3AVXA 2PIAA 1OB2A 2HMAA 1JJ2B 2QN6A 4UAJA 2X3UA 1YITB 2QMUA 4RJLA 1IJFA 1VQMB 5TY0A 1D2EA 1VQLB 1OGIA 1VQOB 1H85A 3LYUA 3G6EB 1QGZA 4PGOA 3CCRB 2GPJA 2OK7A 3I1FA 1KQSB 3AVUA 3OJWA 1KJZA 4B43A 1KK0A 1GAWA 3ZZ0A 1NJID 3WY9A 5TV2A 2BSAA 1KK3A 2QTLA 4ZCMA 5GV8A 1QFYA 4M2LA 4TMTA 1G7RA 2RC5A 3ZBTA 4ACAA 1W2BB 3G71B 2B7CA 1KTVA 3B82A 1DDGA 1QH0A 1QVFB 1E64A 1TLLA 4TMZA 1TTTA 2BGIA 3MHPA 2YWEA 4P6VF 3CCJB 3I56B 2ZITA 2VYQA 1FDRA 2BF4A 4YAFA 3CCEB 2CRVA 1JA1A 4RD4A 3VNUA 1R5OA 1G7CA 2YWGA 3I55B 4F7DA 2BVNA 1EFTA 1E63A 4AF6A 1IB0A 4Y9UA 4YALA 1OB5A 4FWTA 1FNMA 2XEXA 3OW2B 1QVGB 3AGPA 4MYTA 3FPKA 1XB2A 3CCLB 4U9UA 3W2FA 1KC8D 4EH1A 4HE6A 3QFCA 1YI2B 2VNKA 4DQKA 1KK1A 5GV7A 1M1KD 3AVTA 1YJWB 4N3GA 5H59A 1Q86D 2PMDA 2QDXA 1WDTA 2VNIA 4YAUA 1ZUNB 1AMOA 3CD6B 3OZWA 2GQFA 2DETA 4PC1A 4PC3A 4Y7CA 2OTLB 3WYAA 4AF7A 4LBYA 4RD6A 3CB4A 4K1XA 4HE5A 3LO8A 3WNBA 5FA6A 3G4SB 4B48A 3CCVB 3ZZTA 1QUEA 4FN5A 3AGQA 1VQ9B 1EP1B 1KRHA 1K73D 2BMWA 1HA3A 3U6BA 2RC6A 3ZBUA 4QFMA 1N0UA 2BV3A 1B2RA 1H42A 2BM0A 4RCYA 3CMEB 1Q7YD 1CQXA 4YHBA 4J0QA 4IW3B 2FX3A 4Q7JB 4RD0A 4NBSA 1D1NA 1FNDA 1QFJA 4RD3A 3W2GA 1GJRA 1ZM2A 3W5VA 4PC6A 3U2QA 2DERA 3OZVA 1I7PA 2B7BA 3LRXA 1BQEA 1JA0A 3VO1A 1GR1A 4NCNA 2E1RA 4LBZA 4B44A 2YWHA 1SKQA 4RCZA 3VMFA 1ELOA 3W2IA 2DEUA 1OGJA 5JBQA 1DARA 2D74A 3AVVA 1B23P 2AHOA 1Q81D 3A1FA 1F60A 3JQQA 3CC4B 4M4SA 3MMPA 4QHYA 2EFGA 1AIPA 1S72B 4B4DA 5H5JA 3CMAB 5TR9A 3CW2A 1EFUA 5DSZA 3ES9A 3E20A 2BGJA 1KK2A 4MYUA 1XE1A 1YJNB 4C0SA 4FK8A 1KD1D 2C77A 2EIXA 3WXMA 3QSYA 1K8AD 1QGAA 4M0LA 1BX1A 1ZM3A 1G7SA 4ZV4A 4H9GA 1K9MD 4ZCLA 2OTJB 1UMKA 3QFTA 3B8HA 2QEXB 3VNVA 1YIJB 4M53A 1VQ6B 1A8PA 2QTZA 4TMVA 3P26A 2NPFA 1R5NA 5HXBA 1QGYA 2VNJA 4WQMA 3W2HA 2HCJB 1GAQA 2HDNB 1JNYA 3P27A 1TVCA 4B3XA 1M90D 3CCSB 1ZM4A 3V76A 3WBJA 1CNEA 2VNHA 3CXCB 1W34A 2XNJA 3CCMB 1VQ5B 1CNFA 1QX4A 3ZZUA 4G5GA 3ZC3A 1VQ7B 2C78A 1TUIA 4P3YA 5EMNA 1EFCA 3WNDA 1W35A 1YHQB 4RD1A 2CNDA 4G1BA 1BX0A 3WNCA 4LBWA 3B78A 2DCUA 3VO2A 1FNCA 4TN1A 1GO2A 3U6KA 4ZCIA
chains in the Genus database with same CATH superfamily
1NXVA 3L77A 2YV5A 4QXQA 3KRTA 1JKIA 1ADYA 4FLEA 3HVJA 4BY9E 1QQTA 4P8RA 5AJUA 3K6KA 5C3UA 4INOA 2RE8A 1PE0A 2ISCA 2NZUG 2ZQ5A 3A8IA 1FX1A 4BGUA 3QLUC 4MR8B 3N2KA 4Z4VA 3DL4A 5CVEA 3N75A 3UVEA 2BPOA 2H1FA 4Y6RA 4YAWA 2JGKA 4F2GA 3K9HA 3TH5A 3W1EA 5HX7A 2XA9A 3KSZO 1J9EA 1XC7A 2GXSA 2IZ6A 4TM7A 5G0SA 2VDMB 3HGTA 4KQIA 3U0VA 3R5SA 5E9AA 4F3KA 4N1AA 4MAMA 5I51A 3EXEA 5TXGA 2YWFA 1OA0A 3VYSB 4L76A 4O4JA 3AM4A 2A4MA 3GJXC 1Y8QA 5F5LA 2WYRA 1S89A 5E38A 2GCIA 2R2GA 1PJ8A 1B4DA 2JEOA 5P21A 3L4BC 4UUQA 2EIHA 4KQWA 5CVTA 1PTJC 1YRQA 1OXTA 3MD0A 2GT1A 2C03A 2XYGA 4IBOA 4P86A 2G9NA 5T5QA 1QHEA 1SR8A 5LC1A 5DNVA 3LVBA 2WJ6A 5JO9A 3SYTA 3SMVA 1XMOB 1Z37A 4QQNA 1D0IA 3TRFA 4KPGA 3ASPA 3E2IA 3WFIA 4JT8A 1Q14A 2J3MA 3Q12A 3AEKA 4ZZ2A 1XTPA 2F1MA 4C6TB 3KVRA 2IEDA 3LH5A 5HJ2A 4ATNA 2HQ1A 1C14A 1UL1X 2ZG6A 3PENA 2YY7A 2HU8A 4MPRA 5JADA 2H51A 2VBFA 5KJEA 4E4YA 3OJXA 2QP3A 4COKA 4GQNA 1O6FA 1GUZA 4UE6A 1ZJZA 3EDMA 3TBKA 4BP1A 4DDTA 5IVPA 1YOVA 1V95A 3R3UA 4TSFD 1PW7A 4LAFA 4QUBA 1I2BA 1EP3B 3CTMA 1KO4A 2H0QA 4C0WA 2PGXA 4PYQA 4KFRA 1HM5A 1KO8A 2PV0A 4H08A 5BYKA 2PM8A 3JS5A 3ELYA 1DCFA 1MQ8B 5DT2A 1Z88A 1PR6A 3S68A 4ZQIA 1DC3A 1EHYA 4PNZA 4YDQA 1KMCA 1TM4E 3N8DA 2VA8A 2XSZA 1CC1S 1JG7A 1YL7A 1MFZA 2W9XA 3J81k 1OXMA 2PGAA 2XAUA 4Y67A 2OZEA 1YVDA 1CJCA 3E2PA 4XIJA 5JSYA 1DX9A 3KWMA 3W5HA 4BVFA 1IG0A 3E1YE 1NFFA 3CNHA 3E58A 1DKLA 3GC6A 3UKJA 3KE8A 4KIFA 4H1UA 5C1DA 3G7NA 5ETJA 1P4JA 4X05A 3ONDA 1R6TA 3B9RA 3UMJA 2GCNA 2ONCA 2JGIA 5A02A 2R4QA 1MEJA 4HSEA 2ZZQA 3P1JA 2BW0A 1FLNA 2WIGA 4JEUA 4UNPA 3VXKA 5CHEA 4E5MA 4LXTA 2QQ0A 3NVDA 2P41A 3IUNA 4CMEC 3PKZA 2EF0A 3EEIA 4LWZA 4TKMA 5BXYA 4W1SA 1JHXA 1UZUA 1ECJA 1WQ3A 4TKUA 4LJRA 5BOSB 4WK6A 1QF9A 1HDIA 2IIVA 2YWXA 2FJ0A 4N3AA 4QO8A 4YUYA 4KNWA 2PS0A 1NMQA 3R7SA 2CCGA 4LXHA 4BU0A 4FPXA 1ISPA 1UBJS 3E9ZA 3FHCB 1YQEA 3HYCA 4J29A 4PPGA 1BGWA 4D4KA 5D84A 2PUFA 2P6MA 3WQRA 5J5CA 3C98A 2WDZA 5JJCA 1ZMOA 1L1EA 1NFQA 1V6AA 3L9WA 1VB3A 2QTVB 1L4UA 4CKCB 4KV9A 1R5JA 4EECA 3R3VA 1ZGGA 2PIDA 1QO7A 3HXKA 3TXYA 4F2PA 1HOTA 1WNFA 4EVIA 3A6ZA 3FZNA 4ZMBA 1K28D 1OYVA 1J0EA 2AOVA 1L4LA 2ZJ8A 1IY0A 3MCZA 1QGZA 3OPVA 3WIOA 1JAXA 2GA9A 3BORA 2ZKLA 4ZO4A 5J23A 5F98A 1MAUA 5IN5A 5B58C 3E3OA 3AF6A 1HF3A 1UD3A 1B8UA 4KN9S 2XVYA 4XPZA 1IC6A 3TQTA 1WDWB 4JENA 2ZAGA 3EIOA 1ZC4A 4Z2AA 3E5RA 3DKVA 2BGKA 3VHRA 3UAVA 1LC0A 3TECE 2CLKB 2KBFA 3ONFA 1JDBB 3CLVA 4DS3A 4DNFA 2R4UA 4P4TA 2C1XA 4HQRA 4P80A 3FBWA 4R81A 3TCNA 4RLZA 5IMBA 2IYSA 1E3TA 3DKKA 3OPMA 5GV8A 1Z08A 2YHBA 4Z7OB 1ZZEA 5K0CA 1ZCBA 4MQ6A 2TSYB 5B1DA 1F3LA 1W2BB 3F6RA 3S70A 1I3OA 4YRJA 5D7NA 1JFTA 1DAPA 2O4CA 2ZRNA 1Z28A 2D2IA 1OIWA 2IV2X 5C1PA 3PG5A 2Y0DA 4OV6B 2IUUA 3WQSB 1LW6E 1VMKA 4J4TA 1JKJA 3UHAA 2VVTA 4HXEB 2FMFA 5JZVA 3RYFB 4TLAA 5A05A 4LDAA 4LDJA 4V0QA 5FBWB 2JLSA 2WWWA 2NACA 5GAJA 4US0R 4R2JA 1P74A 2HOQA 1DCMA 1PK8A 1Y98A 4M8KA 5C4MA 1FMLA 2GPTA 3N05A 1L7OA 3HQ4O 4MV9A 2LR0A 1UEXC 2H17A 2A1TS 2H8KA 3W6PA 4YMUA 3QE4A 4QJ3A 3VNUA 5CT8A 1AB6A 5MGNA 1GZDA 1MOPA 3HM2A 1G7CA 1CUYA 2PGJA 2R00C 3DT6A 1BDBA 3IKVA 2C5BA 1GL7A 1MJHA 1TAGA 1U5BB 1P1BA 1U0JA 2FCRA 2WC1A 4MUMA 5IMSA 1KI6B 3A8JA 3K9FC 4GOOD 3KSMA 1R6AA 1DC7A 4EUNA 4DJFC 4NG4A 1YXMA 3DMFA 3QUAA 4ZJPA 5DRTA 4S2UA 3N9IA 4LDNA 2GK4A 3HCEA 4LJ8A 3RS2A 3WNQA 4QOJA 5D3ZA 3AUUA 4XTCS 2X77A 2DAPA 2QGGA 1EE9A 2JFYA 4EY6A 3RVRA 2WTMA 1GSAA 2ZWAA 3ANTA 2P3QA 2ZRQA 4XD7D 4AYWA 4CG0A 1Y1KE 4L8YA 2ZTLA 4CKXA 3FH0A 3TEJA 2GM9A 3IEPA 1KAOA 3MS7A 5E4TA 3ETCA 3O95A 5AKHA 2OYNA 2O3JA 5H59A 2FUCA 1YDGA 4G89A 4BDTA 1H93A 1H2AS 3CNEA 4K6FA 3OTOB 4PBSA 5B7GA 5M29A 4HNGA 2ZKIA 5B6JA 2C0QA 2WSSD 1T4CB 3P4XA 5IULC 4DR3B 1L1RA 4UXHA 3M4JA 1PWZA 1HNZB 5JAMA 1M1XB 2FPWA 3LWBA 3EHDA 4BFLA 2JL1A 4FMBB 1KMIY 1TZ2A 3NEYA 4Q24A 2J0SA 4MP3A 1AGXA 3WYAA 2DSTA 3UHFA 4UEJA 3HUEA 1L1FA 2R8YA 3F9CA 4AB1A 3OE7A 3FNIA 1U9IC 1TT5A 1QRRA 2V6FA 4G81A 4J75A 4L8GA 3CB4A 3UNXA 4B7ZA 5JZ9A 4H7JA 4PZ9A 4CKBA 1QLHA 1KYIA 3TXXA 4HF7A 4HFNA 4D0SA 1PIWA 1Z74A 1ZK2A 1QGDA 2OFPA 4MV5A 2CKMA 2PRKA 5T6MA 2PH5A 4JNKA 4KX5A 1K7YA 4ND3A 1VJRA 1G8AA 1QUEA 1HLFA 1IXKA 1MTOA 2FP4B 2H1VA 4A6XA 1JAYA 3ZHSA 4B0OA 1FC0A 5DM60 1USVA 2VZEA 1EP1B 2HHCA 2VP4A 2YJGA 4MRRA 2P2ZA 1K73D 1SVUA 2PFSA 2ZYVX 5A7HA 2ZWMA 1JLLA 3SCZA 3IL2A 1N5KA 1PGQA 4O02B 1ZNQO 4KGZA 4EFKA 4BO9A 4OLBA 1L3IA 4RV4A 1FS4A 3JQ9C 3LLVA 4V2IA 5EMLA 3BK2A 3Q10A 5F7OA 2I54A 3OAAD 3OWOA 4YRLA 4C7MA 3BMCA 1AZTA 2HDOA 1R0WA 4EKDA 1QH1B 3JYQA 8AT1A 2C7QA 4JL6A 1KJ8A 3C6ZA 3CR3C 2X76A 4IG9A 2H16A 1INLA 3KIPA 4O59O 4Z4ZA 3P0HA 4KYVA 5ALWA 2I8LA 2QMYA 4KO1S 3CLRD 4HNTA 2I6SA 4D0RA 1VRWA 3IH5A 4ZYLA 3K0SA 3X1JA 4LKRA 4A4DA 1JAIA 1OYOA 1PU2A 3PLRA 4L51A 1JSXA 2BRUC 3PC7A 4EJFA 2R79A 1VJSA 2ZSBA 3HYNA 2GCEA 4BLUA 3THXA 3EXIA 4DC0A 5KYUA 4G0ZA 1RJDA 3TZQA 3REQB 3WGUA 4U7GA 3O9VA 2R62A 3I73A 2FP4A 2PKQO 1RHQA 2NV4A 1OX4A 3OCJA 4UE2A 4DV6B 2BDTA 5TF0A 3JQ8B 1VXRA 4RESA 3WB9A 1J5EB 1AK2A 2WRZA 3BMNB 1ODFA 1ZI8A 1S01A 3V2IA 1I2ZA 3W77A 3WRXA 3MRTA 4BN0A 2ZTVA 5IJ9B 1KFJB 5EXTA 4DLRA 5BN3B 3X1YA 3PXUA 4RK1A 4JNCA 1ICEA 1LNSA 5FI1B 3HZOA 3K0AA 4KO3S 1WXFA 3I39X 3ZNOA 1COWA 3BRWD 3UMCA 4AJOA 3K09C 1TK9A 4CCAA 1N7GA 3AHCA 3QOXA 4ND6A 2EWMA 4ZCPA 3FPLA 5CA1B 3UK7A 3K5WA 2A88A 1VBKA 4R8MA 4I5FA 3R7BA 4DRXA 2XXAB 2WT4A 5JC8A 3P0FA 3E2MA 2Y0CA 5KTTA 1D6SA 3I9V1 3RNLA 1E3EA 4ZIRA 2GD0A 3LQEA 4B4DA 3KTOA 4L7QA 1A97A 2BYTA 3ELUA 1OASA 1CNMA 4XB6B 5G1OA 5GMOA 1YSCA 2AFIE 3GLHA 1MC8A 3NEAA 2HEGA 5KTRA 1BWRA 1KI4A 1FP7A 2YV3A 3WDKA 3FOBA 1C81A 2WTUA 3V46A 4HDCA 1XP8A 2EGHA 4KYIB 1U2DC 1N06A 1IFXA 2EZ8A 3G2KA 3JVUA 3V1YA 4WA8A 1GNQA 4U6QA 4GVXA 1O6GA 4G4GA 4WUVA 3ZX5A 1B0PA 4Z4UA 1JG2A 1N2BA 2HNAA 3E3MA 4F71A 3EBLA 5DN6A 2YZGA 4OHXA 2SECE 4ABTA 2LD4A 1NE7A 3L3BA 4FONA 2C9OA 1WKCA 1Z83A 2JRLA 3PXXA 2F1JA 4OXXA 5K6AC 5FUYA 4FGLA 2WD9A 3Q2KA 3FWZA 3FI0A 3QHQA 4OOFA 3CJTA 1YBAA 3B6EA 3LI2A 2HJWA 3B5JA 4RPJA 2IQIA 1PJ3A 3K0AB 2A86A 4YUAA 4LY0A 1WVIA 1GQOA 3BCHA 2O8CA 1R0KA 2V59A 1IE3A 3W7VA 3H4IA 4KMSA 4N0EA 4BZXA 1YDMA 5FOUA 1V7QA 3TLGA 3U1BA 1NM5C 1B6RA 5BN1A 2OAGA 3LZ6A 4AS2A 4CLRB 3S2SA 2OXFA 5K8CA 3DTTA 1VQ6B 2HQOA 4DK1A 1GPMA 1H05A 2X1VA 4XX1A 4E2FA 2P6OA 2W6IA 1REQB 1AA6A 2GCOA 4AWAA 1UP7A 1N6KA 3RHZA 1VJGA 3FYUC 5KOYA 2QTZA 1DX4A 1MJGA 1WUKS 3A25A 3HDTA 5I8PA 3GPCA 2JK0A 4GO1A 5J4LA 2JHGA 4KDCA 4PO9A 3UUFA 1G20E 5AI8A 1PFVA 3B38A 4O4HB 2DIEA 3BA1A 5J5AA 4PR3A 1SGWA 1XRNA 4LTNA 1YB6A 5AW5A 1X7XA 3DOUA 2GESA 2RKOA 3HP4A 5E1OA 1A9YA 2HXGA 4XWTA 2X0DA 3I9KA 3L06A 5CFMA 3KZOA 1ETHA 4LZJA 3QVUA 4F04A 3ONYA 4JLPA 3B1ZA 5EMKA 2F17A 2W2MA 3UB2A 3PWTA 4BZZA 4PGHA 1FU8A 1RQPA 2JVKA 1N7HA 5EZYF 1V9SA 2OYCA 2RBGA 5F1PA 1ZH0A 2C9BA 2CVHA 2RHCA 4PSAA 3SX4A 4ESEA 1VSBA 3MOSA 2XVXA 3Q3JB 1E3SA 4K3VA 1WTCA 2QW1A 4MO9A 2X8AA 2R6R1 2IDJA 4L3OA 5CVVA 5AM4A 4JVOA 4HGZA 5KYVA 2OR3A 5HG0A 5KOJA 3RS0A 4H0NA 2GVZC 2QQFA 1VF7A 4YA6A 4UHEA 3LP5A 1JFRA 1F2DA 2ZRIA 5AHRA 3G6KA 3WBBA 4D4IA 4BGDA 2C2KA 1M8GA 2QK4A 1PL6A 1C3OA 1SHTX 1WOMA 1TJ4A 4PG4A 4BO2A 5F64A 2AJ8A 2BHLA 3UJPA 2Z2KA 2OKCA 3L05A 2PXAA 2O05A 4HGNA 1PP4A 2J5RA 3DGEC 4CU2A 5FJIA 4X20B 1ZAYA 2HL6A 1E3WA 1D6MA 3LC7O 3IT2A 1QIEA 4CR7A 4YJFA 1W8DA 3H17A 4GKVA 1FPMA 3BULA 4DSZA 3ET4A 3DFZA 3TFQA 2IH5A 5SY4A 1QX3A 1BKSB 3FG9A 4UTRA 2A30A 2GM5A 1WRBA 4XRRA 3FPCA 1GAEO 4FR0A 1G9XA 1DIAA 2OP0A 3CX6A 3TZ6A 3AVWA 3ZCRA 2PR2A 2GZMA 2ZOSA 2C2YA 2BE9A 5A88A 3MJHA 3PFHA 4D9FA 4CM8B 1KMHA 1VGRA 3C15C 4MLZA 1JG4A 4EA9A 1GZUA 5L4SA 1X1SA 1ZVVA 5J58A 1GCOA 5J2TB 3ZDBA 5F1YA 1XMSA 1BVUA 4G37A 4RJ2A 5M04A 1XCLA 1AHHA 3CXUA 1OIVA 3DCYA 3OTHA 1PNRA 4GF5A 5CJ2A 1TRKA 1YMVA 1JXOA 5IM5A 5LYJF 4DMFA 2FYTA 4R83A 5REQA 2OBTA 1J90A 2ZRBA 2FWMX 1JQ5A 3SYMA 4AMGA 3CE9A 4NICA 1CXZA 3AF4A 1E62A 3T5BA 1E79A 3OT5A 1OR8A 1VQ8B 4I9GA 2CNNA 3HI4A 1I7NA 1NONA 2EJUA 3FROA 3FJOA 1KI6A 3GBSA 1F17A 3DP9A 3EEOA 2D5LA 5L7TA 1BEZA 2PMKA 4EZEA 2D5IA 2H2FA 3GJTA 4D4JA 4R71A 5BSTA 3WRXC 1PJ6A 4MW6A 3VKFA 1Y6RA 1DRVA 3R4CA 1V5VA 4E11A 1A72A 1FXSA 1YI0A 2CHEA 3HWRA 5FQNA 3TMKA 3SOPA 3VYRB 4J07A 4P3NA 3LY7A 3DV0A 3RAGA 4ITRC 2LP4Y 4GE0A 3KHKA 1E0KA 2CMGA 4KVAA 3CUKA 1TXGA 3DWEX 3TW8B 1N75A 3BIOA 3EMVA 4MS3A 1IZYA 1X87A 3E81A 3RHSA 3VNAA 4FHCA 2CC2A 4A5OA 5LKRA 2IEIA 1AC5A 3TTWA 2E7ZA 5H3LA 2CLHB 3PR1A 5SY6A 3ZXYA 4E12A 1HORA 3W5UA 3DDZX 1HI9A 4FHGA 4HJXA 2FSVA 1JHYA 2JVIA 5FWNA 1SVWA 4CMIB 2EKQA 3OE1A 1GAXA 1QG0A 5C34B 4RTLA 2OHHA 1GCIA 3FW1A 4GI1A 2IYAA 5T6BA 1BJRE 3QY9A 4XIYA 4PSVA 3JRXA 1EFVB 1IMJA 1NZJA 3Q3EA 1BRMA 3A4IA 3PSAA 2VXOA 5IUNC 2UYCA 1GHTA 1N1GA 1QOQB 5TARA 4RM3A 4UTZA 4JOCA 4ARZB 4V0ME 3GNQA 1J9ZA 4NBWA 4E2ZA 5A9SB 1FBTA 1XTJA 4IXWA 3TEFA 3TFWA 3QVGA 4DY4A 4ZHQA 2UZ3A 1BX3A 2XXJA 3RVSA 5FRDA 3PFNA 3F7NA 2GARA 2Z1NA 3EXEB 3IBCA 3IPXA 4UHHA 1T9GR 4P25A 5F4OA 1Z13A 2ZI3A 3BE4A 4IHJB 3WLJA 5EKUA 1T9DA 3I5YA 3AF5A 1FTSA 3VU9B 2ZR8A 3FPPA 4BLOA 2OBMA 1FSPA 5EUBA 3CNLA 4CBVA 3QXGA 4HQ0A 4YJ2F 2GXQA 2V3WA 3GBPA 3OQMA 1W0JD 3W78A 1WOSA 3CCQB 3FJ1A 1G63A 3OOCA 1W73A 2E49A 4YP1A 4H7PA 2VO1A 1U1IA 1Y9ZA 4A9AA 4LOHA 5CTJA 1M2OB 1TPYA 1PJRA 1N8TA 3C8UA 5IU6A 2OESA 1KQFA 3OT4A 1J56A 2EFJA 3T6KA 3RVDA 4YRNA 2D1RA 3O4FA 3BS4A 3OE7D 3QUQA 4QJIA 3KKNA 3NDBB 5KWIA 1NLUA 3R74A 2ZL7A 1NI3A 1OPXA 4Z0TA 1R00A 4CKWB 3OG9A 1P1CA 5CX1A 5AW0A 4IPTA 4R31A 4DCSA 2I87A 4C1NA 3RCBA 3PXCX 4MVJH 1KH3A 3D26A 2CLDX 3A7EA 4BNNA 2ZBPA 2AOTB 2CFIA 1W49A 4G9BA 3VOSA 2XWQA 3I53A 1JQDA 2ZBGA 3K1YA 4BO0A 3ACCA 5B6IA 3EVBA 2YFYA 3DBIA 1JTVA 1NXWA 4P6YA 2EFYA 2PCJA 1WKVA 1B0UA 1XJ5A 2WJ4A 3C2QA 1TYCA 3NYQA 4R84A 5DT9A 3GUUA 1WP6A 1RADA 2B1GA 3QHAA 3WE7A 1XQYA 3O8QA 3SS9X 1BGXT 3CCRB 1XYYA 1JIUA 4GVPA 4WCFC 5HE9A 4A23A 3ZYZA 2IZOA 5D85A 1GUBA 4GGPA 4LXQA 4EFDA 2C7PA 1GA4A 2I2BA 2XECA 4IRXA 2IXEA 3PICA 3FUXA 3H2BA 2WIJA 3IERA 3Q40A 4G0YA 1U81A 4K6GA 1CUFA 3IP9A 4L2IA 4Q66C 1LTKA 1NVUQ 1RBQA 4PRLA 4XVRA 4AW9A 4CJXA 4EY3A 4XAQA 3GB9A 1L4MA 2VSXA 3H65A 4GBJA 5DOZA 5JWHA 5J2UB 4RWEA 5THKA 1GUYA 4GYJA 2PMBA 5COQA 4JMLA 4N5HX 4YXFA 3E9QA 3N0RA 3PHIA 4J49A 2WD7B 2W4QA 3U17A 2IBTA 3B51X 4KP7A 4BLTA 2EP5A 2FUG6 3LBYA 3WDMA 4ERNA 3OI7A 4HR7A 1CF4A 2FR8C 2QRGA 2OT3B 4XM2A 3O75A 5EJ2A 2NADA 2BI4A 3ZWPA 4NXMB 4AP5A 2NAPA 4XNFA 2PG3A 5CCDA 1U0FA 4IVNA 2GHQA 4NONA 2ZE6A 2V6GA 2EYUA 1W5BA 3LY8A 4TTJA 4ZTBA 4C9BA 6NULA 1MCZA 1FDUA 3A0UA 3M4ZA 2JGMA 1WO8A 1N0HA 1JHAA 1RDFA 4J9VA 4TVKA 3J7AC 1OJ7A 4B3BA 1ODTC 3LSYA 2QMHA 3HCAA 2UU9B 3BFVA 3GRKA 3O6VA 1COWD 3BRWA 4B8YA 1UADA 2GQ0A 3KZMA 3F5QA 5A2QA 5BW5A 1XVIA 4RD4A 2XNDA 4ICIA 3PVCA 4D92A 3LQYA 1RZRD 2C9ZA 3FWYA 3FYDA 3ZQ4A 3QH4A 4N5DA 2P5YA 4KHZA 5FL7D 3PS9A 4ALNA 2A0WA 4DOMA 2O8FB 2MR6A 4WESB 1QONA 3OX2A 2BHNA 1N77A 4ZDKA 4AKHA 4YCAA 1H4TA 3U3OA 2P40A 4YALA 1V39A 1VIAA 2HV8A 3DG9A 3OCZA 2NTNA 4M8SA 3HYLA 5TPWB 4DG8A 4UQLA 2RHDA 3PCRB 1HYEA 3CJRA 4Q82A 5B3AA 1ULZA 4L6CA 3F9RA 3SIPA 4FSDA 1Z6TA 4H7HA 1I10A 2ZDGA 1QVGB 1OLSB 3AGPA 1QIDA 3AY0A 3EQ9A 4IIYA 1ZD8A 3EVAA 4UHCA 4OYLA 1EFHA 2ZQZA 4LCBA 4Q02A 1UKZA 3T7EA 3WMGA 1VI6A 2JFUA 3QFCA 1ZICA 4OKSA 1QV7A 1Q7BA 5A4KA 4RSMA 3B52X 4X95A 5PGMA 4YR7A 1D7OA 1E2JA 5CAEB 2YS6A 1FFBA 3QENA 2UZ1B 4A8JB 2ATXA 4LS3A 2MR5A 4O25A 5IZCA 5K0JA 1QIHA 3RVMA 1PR1A 5C8VA 2PYDA 1IIBA 4FNAA 5T57A 4NS4A 3R7WA 3EK2A 3P94A 1X7GA 3P52A 4IIBA 3A10A 5TC4A 3VNQA 3QVSA 1KSHA 1MO3A 2V7XA 3BFXA 1HTTA 5ER9A 5IBRA 2Q7XA 4Z4HA 3TVTA 2VT7A 4OI1A 2IPNA 1QYIA 1U6IA 1YKGA 2YYSA 2WU0A 1GGKA 1X8LA 4A73A 1NRIA 1AGYA 1M8FA 3A1DA 2A1TR 4Z5XA 9ABPA 1EEXB 4QYIB 2P9HA 3A4LA 4IZ6A 3OEYA 4N9WA 4BFWA 3UWSA 1ID8A 1HGXA 3JX9A 3GRPA 1SY7A 3N2NA 5FA6A 4LZAA 1VE3A 3PRYA 2MDTA 3F3KA 1CJMA 1GCAA 3JXEA 4MRPA 4Q4CA 2O5EA 2AUNA 2G8LA 4TV8A 5LQSA 3RKUA 5EJ5A 2GAAA 4MPJA 3ASRA 2I3GA 4QL3A 4P32A 4D4LA 4WZLA 2ZL6A 4M9UA 3ZWVA 3V1TC 1A0OA 4YCNA 1GTSA 2FZGA 3NORA 4ND2A 3L92A 3KJFA 5SZIA 4J0GA 2Q6IA 1A9SA 1R0XA 1GLNA 3C7KA 3T53B 3SIWA 1SULA 5JTTA 4P3KA 2IW3A 1HYBA 4QXMA 5CIWA 3P0RA 3PI7A 1MOZA 1XTRA 4BMSA 6Q21A 4AJEA 3A9TA 1R6VA 3DMRA 3QPBA 3PTAA 3M83A 4TYWA 2KLHA 3CH4B 1UPXA 1X15A 2XNDD 3RKRA 5HQJA 4ZKDA 4O4LA 3G9ZA 5HJEA 2PRYA 1VE6A 3OIWA 4E5VA 3OU7A 3OOYA 5L3QA 3JAMA 1CR0A 1SKBA 4ZJYA 1J2TA 4Q16A 1P5HA 4EHKA 1VDMA 4U2DA 4Q7JB 2DCMA 4DNXA 1G5PA 3DDYA 3OEHD 1FX0B 3WLSA 4P5DA 1B1AA 1UFVA 2EKPA 3P2MA 3STXA 3T3HA 3ODGA 3EC7A 4QOEA 3SZGA 3NDIA 1XHEA 2C2MA 2I2XB 4YQZA 3SWWA 4KB5A 5CB4A 5B1IA 1K63A 4OXRA 4BU1A 4D3DA 3QKRA 3W2GA 5DGCA 2W6ID 1B15A 1DKRA 2AUTA 1NJ8A 3DO5A 3M9LA 3TRIA 4UCXA 2QYTA 4Z7NB 4GLLA 3V4SA 4F5WA 1JLRA 1JXQA 2C1EA 1P62B 2WFAA 1FZTA 2GI4A 1JA0A 1O5TA 1H22A 3OPYI 3UAYA 1Z4LA 4ENTA 2BEWA 2ID8A 3AI2A 4LFAB 4CI0B 1X0XA 4IIEA 1H3FA 4AJ1A 4Q01A 2BM9A 1IAVA 1VB5A 2B7LA 1ZL2A 4J0CA 4LDRA 5GZ3A 4CKEB 4NI5A 4MRMB 2QJTA 3FCCA 3Q3IA 5A7GA 3W1WA 1FLVA 5HCUA 4TYQA 4ZC8A 3D8RA 5DASA 2O8EB 3FUCA 1ZD4A 4X7EA 4LOLA 4EI8A 1DT5A 1N2ZA 2WM2A 4PCLA 3I72A 2FPKA 3T99A 1DARA 2BJHA 2OILA 4I1RA 4TXHA 4YXWD 3ZZMA 3FI9A 1YQTA 2I33A 3C41J 1SCKA 3Q2OA 1QU3A 5EZSA 4BVBA 1U7XA 1IN6A 4OJMX 1FDSA 3KJEA 1J09A 3SJAA 5AI6A 2QX9A 5B1HA 4AO8A 1GGMA 5JXIA 2EFGA 1LLCA 4GWGA 4HEHA 1JLKA 3BMOA 4N18A 4M0UA 5BR8B 2FPIA 5H5JA 4BQNA 3FSJX 4XZ3A 3ZIUA 3B3GA 4ER7A 5ES3A 2GILA 3AR8A 4BEJA 4WN3A 3A7DA 1QHYA 2I4MA 1EVJA 5G0UA 2D0DA 1BZYA 2VHWA 1K5GA 5JI3E 1DEKA 1D04A 1U8EA 3R3JA 4GLBA 4EIWA 1O94A 3EFOB 4EYKA 2XDQB 5G4KB 1ISRA 3PNBA 2EIXA 2GK7A 2C1ZA 3G8CA 2HK9A 3HP1A 3ONVA 1GZ3A 1PLKA 3LQ2A 1OHHD 2H1LA 3EDQA 4P38A 5D6NA 5DTJA 2AEEA 1I9CA 5FEMA 3W8RA 3UMMA 1H1LB 5G3ZA 5JSHA 3U5ZB 1W59A 3JSAA 1G7SA 1M0TA 2X14A 3DC2A 2X4GA 4N7BA 5AUPB 1UWVA 4UCFA 4HB2A 4Q48A 2H1HA 9LDTA 2AFHA 5E7IA 2Z2XA 3OKCA 1UOEA 4MMXB 3MGAA 4GNKA 5KVAA 4ZI7F 5IAKA 1E18A 1HZEA 1BXGB 2SHKA 3H9EO 4RZXA 3H0CA 4XLZA 1ZCZA 1UMKA 4J1SA 2QEXB 3B7WA 2YVQA 4PYRA 2ST1A 1DMSA 4YLGA 1XJWA 1UP6A 5ALGA 1FP6A 4E03A 1CYEA 2BIFA 5HBRA 1RVDA 5CLQA 2OCKA 3VDRA 2WV9A 1MAWA 3L93A 2ZRGA 3R20A 4H4DA 4QBKA 2DPHA 2TMKA 2OEPA 3PWSA 2H11A 3D59A 3RVOA 4WECA 1FA9A 3OQIA 1FSGA 4LXIA 5GOZA 4B6FA 3U7GA 5BY2A 3T1OA 1W1IA 2HPHA 4HAIA 4MINA 2CSUA 4GQIA 4LCEA 3WLKX 5FUMA 4KH1A 2O6LA 5JZOA 3D1VA 2DJ5A 1G41A 4WZBB 2X0JA 2WWYA 2D3WA 1U0HC 2ZSAA 3AKCA 3CLSC 3MUFA 1WMDA 4R8KA 5BPHA 5I7HA 1Y9JA 3AF3A 3BK7A 4JI8B 2RHRA 2CUTA 2QPAA 2QSJA 1ZIDA 1KVTA 1SVMA 2H5EA 1KETA 1Y6ZA 2VNAA 1JJBA 4CG3A 3NAGA 5AW3A 1IHMA 3I83A 3TS1A 1OTHA 4PAGA 5LR6A 1OH7A 2WT9A 3GFGA 3QA3E 3OZ7A 2HWWA 1JHQA 2G0AA 4RA6B 2C4UA 3USES 2W4IA 1BYIA 1AXRA 1MO4A 2GJSA 2NYAA 4H2DA 5KPDA 3K6SB 2P35A 4JUCA 4G0XA 2LKCA 1OXBB 1OKKD 3V42A 1BQ3A 3O8CA 2VNHA 1ITZA 3WQQA 5ALNA 1D03A 3W1VA 4YJ3A 3QEKA 4RY9A 3WO0A 2EBWA 4TTSA 1PT5A 2G36A 4DILA 1BFUA 4LOAA 4UVEA 4BKRA 3HPQA 3RI3A 5EYPB 2C4KA 2ZVDA 5CA1A 3T7JA 1X1TA 3RUEA 3BH4A 2C78A 3GN1A 1E9RA 1XTUA 1IH8A 3HYSA 2NYRA 4R3WA 5EMNA 3UM9A 4J1QA 3AYZB 4B6SA 5GONB 2JJ1D 4MQEA 1P77A 4BO3A 1F4LA 3LT4A 1QYCA 3OEEA 5HUQA 3ESRA 2CJYA 1WSWA 3WQBA 1D1TA 4FFWA 2XQGA 4EBBA 4HBGA 1O97C 1OH8A 4R01A 3ML1A 5HS6A 3K5PA 1E7RA 2QQEA 3RLFA 2YZNA 5ELLA 1YCGA 3Q5DA 2ZZNA 2HLDD 1JAZA 1SCQA 2Q4BA 4Y2UA 3WKAA 1M6VB 4K88A 2FB9A 2GHRA 4GLOA 4YDSA 4CMKA 4BXOB 2XITA 1M2EA 4GT1A 5KQPA 4LYHA 5LNK6 3A3PA 3L0ZA 3MAAC 4UBLA 1SWVA 2PX2A 1P91A 3ZVLA 5ADWA 4BMNA 3A2LA 3ILSA 1GPYA 3L1JA 2BGLA 5AKGA 1MHTA 1L7VC 3EIUA 2GYUA 4ZMSA 4A2PA 5BSMA 2CV2A 4NFHA 4TWJA 4Z0PA 2JLUA 1FLAA 4N49A 4XKJA 1DBRA 1JHMA 1IHXA 4XYMA 4B46A 2ZYRA 4I1IA 2IITA 3SF8A 4JMPA 1E6WA 3T0FA 3UXMA 5ADUS 2XTMA 3E3NA 1HH4A 3TIXB 5JSFA 5I9TA 4ENPA 4KNYA 3NOVA 1SZDA 3A9SA 1KAGA 3H5RA 3GPLA 3IVGA 4W8HA 1PWEA 1Z0KA 1NNUA 4GXQA 3ISTA 3QV1A 3KD3A 2WA2A 3JU3A 5DFAA 1HNXB 1OX6A 1B8PA 4OTZA 1IOZA 3RS3A 1RPAA 1WX1A 2X0RA 3ICCA 3ZCXA 2IGBA 4D44A 4CE6A 1FJXA 2HPAA 1JW9B 3RYHB 1Y9AA 3NHBA 4YV0A 5EUMA 2OBFA 1F8XA 2A14A 3E5NA 3GHYA 5KNDA 1S3FA 2AG5A 1WABA 3EPKA 4HDAA 4ZI2A 1I30A 2B30A 4MB2A 1V71A 2HCTA 2Z5VA 5IYNA 1JBKA 5DX8A 2XZDA 3TZEA 3IO5A 1VQPB 1PWHA 2VDNB 3UWPA 4QDZA 1ZKMA 4TT8A 1P8JA 3H04A 4MDHA 1EP2B 3HA2A 4MOWA 3BHIA 4JJGA 1NNLA 1TYAE 2X6XA 5B7PA 4F46A 2ZT6A 3Q9SA 2MSKA 2XUIA 5DB4A 2AZ4A 2W5UA 3CZ4A 2XVAA 3SM9A 4EO9A 2WINI 4PFSA 1FU7A 1Q20A 4UUPA 1BCRA 1UMDA 3D7KA 4EX7A 1RXWA 2IEYA 3RK4A 1G55A 2JIBA 1U94A 1M34B 2W42A 4O4IF 1Q5PA 2K4MA 2GVDC 1TF7A 2OMEA 1P4SA 4Y2JA 2GEDA 2VYFA 1Y1PA 1QOZA 4EI7A 4D9GA 2Y2UA 1TVKB 1UKCA 4I3GA 2VJNA 4Q3AA 4Q19A 5EHIA 4DNQA 3BAZA 1F6DA 3W2EA 3VDMA 2W90A 4JQYA 2H52A 3SR4A 2R1VB 3ANLA 4DLZA 3M6FA 3RVKA 3MT9A 1NMEA 1XAHA 3PITA 3NC0C 3QVVA 4HAYA 2ECFA 2XMQA 3MTEA 2HYIC 1T1IA 4EQZA 3NHPA 4IQ4A 2RFLA 3VNSA 4XL9A 3PC3A 1Y7PA 4D0GA 1P4HA 1WPRA 4B7AA 1P0CA 2R0QC 5ICMA 4KTVE 4HO1X 3GZTB 1PVOA 4RABA 1WWKA 3ZTWA 5BV8A 4ZGNB 1CQJB 5HKOA 1KZ7B 2KYRA 3QTTA 1F20A 1AGNA 3R7LA 3OOSA 2YVUA 1YIOA 4PS1A 4QBFA 1L8OA 2J9ZB 3ZDZB 2BDUA 4KRXA 5AM2A 4ZGQB 1KVUA 3UMGA 1T0PA 2NX2A 1N4DA 1GV0A 3AVXA 5IYZB 4OP1A 3UMYA 5DSTA 3DJYA 5DCWA 4OJKA 2PIAA 3U1VA 4Q39A 1XEFA 1ZOIA 2PJZA 2H92A 4UJ5A 3U44B 3IHKA 4EW3A 1APBA 3DMHA 3F0TA 1A71A 4KR0A 1T6BY 1DAIA 2X40A 3T95A 3UH1A 3LC0A 3K2BA 3NV7A 5ALQA 1U2PA 3IULA 4W5NA 1I1HA 4X3CA 4I99A 4UTVA 3EX7C 2AK3A 4CRWB 5LQKA 1GLVA 2CFOA 3NWBA 4UBNA 4XWAA 2PKYX 1YMQA 1UF9A 2GRUA 1VQOB 2IT1A 1SXJA 5C80A 1ZD9A 5LDGA 3LT5A 1PFUA 3R3SA 2WKRA 2PX0A 4Y1GA 3VU8A 3NASA 1GPBA 2QTTA 3WYGA 3SC2A 2ACKA 1VHQA 4MW0A 3F8SA 1R50A 2BI8A 5HZKA 2ONKA 3VZRA 4PAOA 2YVKA 3HL0A 3NT2A 4YFYA 3AVUA 3LY9A 4RM2A 3RW9A 4BWYA 5KNCH 3P45A 2PZAA 1JQLB 2PBFA 3AHIA 5HQ3A 2QZJA 2ZP1A 4OGFA 3U3MA 2ZBUA 4NMHA 1H4QA 2L19A 3IKJA 4YP5A 3SP1A 1MXFA 2FLWA 4LSMA 3F5MA 5BUSA 4CLDA 4NBKA 2W2PA 3HVRA 3VH2A 3UT5B 5CDFE 4X7MA 5LD2B 4QDOA 2VHUA 5E9QA 3E9RA 4I66A 5JZSA 4H16A 2OV4A 4IV0A 3H1PA 4ODIA 4Y6OA 3T9DA 4WESA 4D3ZA 1RAAA 3KPYA 1JIJA 3IJRA 4X1YB 1WSVA 1RKBA 2C8KA 3LL7A 3QKSB 1XRPA 2CN1A 3HDVA 1JJVA 1Q3HA 1U7UA 3OQBA 4I4TF 1G9TA 1NQTA 2I3BA 3HHEA 4TMTA 4Q47A 4XOIA 4BE9A 1CZRA 3VKVA 4M8LA 1E2IA 2IK8A 1A9TA 5FNVA 5KIAA 5I5GA 4DKJA 1XPOA 1G16A 4DN6A 4UEWA 5K2MA 1OCEA 1VLQA 2Q9AA 3N87A 2YHUA 2O3SA 3LXXA 2VKQA 4X3OA 3QPDA 5E6RB 2F3UA 2HXSA 1IPEA 4IEEA 4NNOA 4S1OA 4BNHA 5CGQB 4Z4FA 2EZUA 2FCAA 2CXXA 2VS1A 4H0CA 4QG7A 3VJKA 1WY7A 5L6MB 4YAFA 2Q4TA 4Y6GB 1EGQA 3CF4A 4K6KA 3KHUA 1DC4A 1HUQA 4FUQA 1VFPA 4YJGB 5E6SB 3ZHOA 3NWEA 2NVBA 4I1OA 3OUTA 3EC1A 3GY0A 3QMPA 3RV3A 1R5OA 3CTAA 3NQ41 3PIRA 2JHAA 1AUPA 2YWGA 1BD3A 1CUHA 2JJYA 4JB8A 2GEJA 4FZVA 4AVYA 3NAMA 1QQ6A 2I3AA 1LRLA 4JLBA 4GC5A 3OCWA 2N3ZA 4PZYA 1G8MA 4AF6A 5CYGA 2OGWA 4ZZIA 4R8SA 4FC6A 2PGOA 2FY8A 2R84A 1WMEA 1CS4C 2BJWA 1XCJA 2PLWA 3G85A 3PC2A 5KBYA 2FPLA 4FFSA 4U3JA 3PA1A 4LQLA 3UK1A 3WDLA 1QC5A 3MRVA 4GSYA 4TLDA 3ZU3A 2SBTA 3WGZA 2QD5A 2IDMA 1OTYA 3VPFA 4B7UA 1VYUA 1UPUA 3JV7A 4PTLA 1YRWA 3D31A 2PFGA 2VHCA 4K9LA 1YU6A 1AS0A 2HSEA 3F4BA 3G8AA 3LPMA 2GGSA 1P3JA 4AZ0A 2AG8A 5LIPA 2EFEB 4R1TA 5K3EA 4N3GA 4DM3A 5E9JA 4KJZA 1BTOA 1NQAO 4LWPA 1U2QA 4IY1A 2YZ7A 4H3VA 1K6IA 1VMDA 2VNIA 2ORED 3AEZA 3DWFA 3H9JA 4KO2S 4M49A 5FCDA 2PE5A 3OZWA 3GQBB 4L4XA 5DLQC 5K4AA 1AS2A 4I50B 4GRIA 4PQFA 5JATA 1RZ3A 3WJ2A 1RIFA 4F4JA 3U4MA 2WHRA 4NVRA 4JVSB 1GNPA 1IEXA 1TO6A 2FA9A 2FEXA 4RZIA 2X8JA 4KQ6A 5EESA 3TTYA 1GSIA 4NZPA 2FH5B 4FYHA 3O3NB 3DMTC 4PLHA 3H9BA 5HUHA 4IOMA 5AKIA 3VTAA 3NJRA 1E7MA 1EVQA 2QMZA 1BPLA 2A9FA 4YJGA 5TGTA 3QG1A 1P5FA 1GGNA 1F38A 2R66A 2G1AA 2QYSA 4MJXA 1Y81A 5A3VA 1E2KA 1I80A 3BDAA 3WWDA 2Q1UA 3FUTA 2RIPA 2V6IA 5FA8A 4AKEA 5AKEA 3GNSA 4LKOA 2XB8A 4V3BA 3HUFA 5J4VA 1XYGA 1CIVA 1PFKA 2XYRA 3HGQA 4DA4A 2Z1MA 4C4SA 3U56A 1WHSA 1WW2A 3KKLA 1C7RA 4BVKA 4MWCA 3AB8A 2RC6A 3LNNA 4FWBA 5IYQA 1KARA 1G3RA 1THTA 2C94A 3UT5A 4DMKA 1FVXA 3COVA 5DK6A 1H42A 3SN6A 1UPCA 5KDLA 3TTSA 3N28A 3HCRA 1QMGA 3KZCA 4HXYA 4J0QA 4RH0A 3VPBA 4BTEA 3U7HB 1G66A 5CHYA 1UJBA 1ISSA 1XVUA 4XJSA 5EXDA 4MVJF 2QV7A 2HUPA 1UWLA 2Z3VA 3B7GA 2BEUB 2HDWA 4YPOA 2O2IA 1TLTA 2C4NA 4NBSA 4M88A 1XX6A 2JIDA 3C16C 3EDOA 4NPCA 1L5VA 1IEVA 4GR9A 1S2IA 1GJRA 2DBRA 3GQVA 1DI0A 1Z2PX 2AMYA 3IEXA 4F5EA 3Q6QA 2OHFA 2ZATA 1U6KA 2QRQA 3RYCA 3ENWA 5LMZA 1ZKDA 1KU0A 1ULUA 3LWDA 1AOXA 3ND6A 4M0CA 3V7NA 5C37A 1PLJA 3AHDA 3NIFB 4EPWA 4QXAA 5I8WA 2O0HA 1ZUD1 2X1LA 1A50B 2C4MA 3V8BA 1FOEB 1UOPA 3R7DA 4YQYA 1GILA 1NR5A 2DE0X 2NSYA 2ZJYA 1WBBA 2EHDA 2HTEA 4OO3A 5BWLA 4RCZA 3BL6A 1YB5A 3EBPA 2I6TA 3KLMX 1MC1A 4AXXA 1R9MA 3VC7A 4YP9A 5DTEA 3GYBA 4D8YA 2BH9A 4E5PA 1Y9DA 1ZH2A 5HZBA 3C3WA 4KQ2A 5DGTA 1SAYA 3HVHA 5CDFA 2DPYA 5EOVA 4Q9LA 5FBQB 3LIPA 5BMOA 4K8OA 1KI8A 4J9UE 4N6NA 4ALIA 4XSGA 3N0XA 3MNFA 1KNQA 2J46A 3IELA 5FAXA 1X8KA 1NVVR 2JZNA 5DM1A 3SY8A 1YLOA 1EKXA 2I1LA 3OMLA 2CLIB 1J6UA 1IZ7A 2G0TA 1MPTA 3DM5A 1R16A 3D6UA 1G8HA 2PBLA 2ES4A 2R68A 3LT2A 1ZBDA 1RWMA 4YGXB 1TD1A 4BOYA 1Y9EA 2CXOA 4JJZA 3CW2A 3OC0A 5T67A 4BFYA 2PUWA 2AFVA 5AI0A 2RGEA 3URKA 3EFEA 1KF0A 3GRCA 4D5GA 1S4MA 4QT4A 5JS7A 2O48X 1X7XB 2AVNA 2DHRA 2EKDA 4JL8A 1UKYA 5EMHA 2UXBB 1V8FA 2WNSA 4OJNA 4ZQGA 4NQRA 1V26A 3T34A 3EZ6A 2AR7A 4YROA 2IIQA 1GU0A 3PEYA 1QGAA 1K92A 2WJPA 5KDDA 3AI7A 4IHJA 1EFKA 2WG0A 3DHVA 4WXHA 4Y6LA 1RAIA 4EEXA 5F4JA 2O0JA 2JD0A 1NVEA 1Y5IA 4D4HA 3QE0A 1M6YA 1NRWA 4X7RA 4NTZA 5CK5A 2YMMA 3LFTA 2M1XA 1RFGE 4BMDA 3K70C 3ZVMA 5DYTA 5K0LA 1HLGA 1PYDA 5BURA 3PV0A 1FQKA 3WLIA 5JOQA 1PJ5A 3N2IA 3AB7A 1LI7A 2XNKA 4Q05A 3G9UA 3L84A 5L3RA 4HOYA 2XZLA 2QAJA 4WD3A 4B3RB 3WLMA 5JW6A 3OZEA 4HP8A 3GVJA 3X1KA 4NYJR 3ZWBA 1XMJA 3FTPA 4D9BA 2O7QA 1N5MA 3ZY5A 2G67A 1MO2A 4DR1B 4BFVA 3UA4A 4UFPA 4XYLA 2D3LA 1Z5GA 2GEKA 3JATB 3D1LA 1EAMA 1Y8ZA 1JALA 4PXYA 3IOYA 3V7AA 4BL5A 3GEEA 5E4FA 4S24A 3RWMB 5DI3A 3SBXA 4JI0B 1PW5A 2X5XA 4BEVA 4CIXA 1U2ZA 4TMVA 1X39A 4JLNA 3KR9A 4DT1B 2HPZA 5L3SA 5I9BA 5G2OA 1GZ7A 5EINA 5C8XA 4XM1A 1G38A 1FUKA 4NBLA 3KUDA 3TKLA 3IBGA 1RM4A 4BP9A 3H9NA 3HU2A 4XONA 4GMFA 1X7ZB 4BWFB 1J7JA 3JZFA 2B83A 1JT2A 3HB4X 1Y6QA 5IDYA 4QNNA 2B1IA 2R1TA 5CITA 1CJTC 3SYNA 1W5TA 4JBLA 3R6JA 5JASA 5E1DA 5KKNB 3U4QB 5KOJB 1PBTA 2NTJA 4GP6A 4KACA 4UJ3A 1E32A 1T0HB 2IY9A 1N8KA 4O33A 3E3LA 3OQOA 1L5RA 4C5BA 1RW4A 3SSAA 5LD2C 5JYEA 4QX6A 5EFZA 1NW4A 4HGYA 2I91A 2C5HA 3BRSA 4K87A 4MYRA 1Q6YA 8ABPA 1RI4A 1U4OA 2VDKB 1JLHA 2RHJA 2HF7A 3OT1B 3SNKA 2UVPA 3GMTA 5TIIA 2OQ2A 3LK6A 5JJ5A 3SFTA 3FTDA 3ER8A 3ZC3A 2QV0A 1KBQA 1VG0B 2YL2A 1TZMA 4ZDWA 5NULA 4CNQA 3G0GA 1S2MA 4R2MA 5ESRA 4EATA 3AHFA 4HNVA 2GUWA 5HBGA 2F3TA 2ZI5A 4OI2A 3NT5A 4GPIB 4QUKA 1ZONA 1NZFA 3WYBA 4WBNA 2J7PA 5T3YA 4KXFB 2HA2A 4MWSA 2C3MA 4WBNB 2Z2YA 3A1SA 1ES9A 3PNYA 3DL0A 5BN5A 2QU8A 3BHJA 4DIDA 4OB6A 4LNUB 5H7XA 5EXSA 2GPSA 5INTA 3U3DA 4RTNA 4F0JA 4OX9Y 1Z4OA 2CJXA 3E1SA 2X6TA 3TUJC 4O4JF 4BBPA 3B78A 1U3GA 3IEVA 3PFIA 4OFBA 4WAUA 5DNYB 3RC3A 1VL1A 4KWCA 1D6NA 4II3A 2QTCA 3ILXA 4BJ5A 4IUBS 2QU7A 2VP3A 4PQEA 2FDXA 3U6KA 1H6BA 3QVWA 5DM0A 3VMMA 1YR2A 1T3LA 3OJCA 3A9VA 4NYIQ 4UHKA 3T3DA 1UKBA 4Z6KA 1CPYA 1EFPA 2JANA 3KSAC 4DXAA 2O7VA 1XEXA 3EVGA 3QLUA 3HCNA 1FMCA 4KYUA 2V4DA 4MZDA 5FOTA 1ZJYA 2XF2A 4ESVA 1X38A 2WKSA 3RKSA 2W43A 3M6VA 2H3HA 1HDCA 4OJQA 2G5GX 1E6KA 5HFJA 2XNCA 4WK4B 3F3MA 3WP0A 4BKOA 1BVYF 3LX5A 4KGXA 1U0OC 1PEYA 2GD6A 4E09A 4G2NA 3TLBA 2YXPX 3BWBA 4LNAA 5EKTA 3LNTA 4FYWA 3SC3A 3I2FA 2IBSA 2JGNA 3E15A 3UAWA 3VHXA 5I9LA 1W36D 3FVVA 4I55F 3PXAA 5BSHA 3DLPX 1SBIA 2IS1A 3NIBA 2ZUUA 4RVSA 3PQEA 3S5UA 3IEKA 1EDOA 2FHSA 3AUKA 4LCJA 5TPZA 3VU1A 4DMRA 2Y67A 3DYVA 2DHCA 3FZEA 3GRAA 2BGRA 3NHSA 2WKPA 3RIEA 1SVKA 2R6HA 1Q1ZA 4QLBA 5JZMA 1P0FA 3H1BA 5ALYA 2PSSA 5AKXA 3B8EA 3BCRA 3FMIA 2C4WA 5BO5A 3DDUA 1SN7A 3OO1A 1EFPB 1TCVA 5FB3A 1DG1G 1G4HA 5IKEA 2ZTNA 4B1FA 1C1XB 2ABWA 4LXXA 5FUWA 2PUTA 2Q6LA 1LF0A 3VR5D 4CHTA 4IO0A 3QI7A 4RTOA 2E82A 2P62A 2PEZA 3GK3A 4O29A 1Z7YA 4EZBA 1LBTA 2QBYA 4KR7A 4FYPA 2YUTA 5DBHX 3LYHA 2NU8A 1EK1A 3T38A 2BJVA 2PQMA 1UC8A 4PLYA 4FYMA 3DCIA 3IQGX 4XOTA 5KVCA 5LN1A 1V4VA 3ZCSA 3IURA 1A69A 1NI4B 1XNGA 3N8IA 3L6RA 4I46A 2ZB8A 1RZVA 2J3LA 1Q0UA 2W58A 1NDHA 3E0XA 3X2FA 4HGPA 4NU0A 3S2UA 2R6DA 3K9LA 1Q2UA 2AGVA 3I01A 1B3BA 1QF7A 4PLGA 2WE7A 5J2TA 4URXR 2C54A 1A2OA 3GJ7A 4YRZA 2QR2A 1PWXA 3K31A 2GPWA 3QI2A 2DY1A 1I24A 1K5HA 4BGIA 4OSPA 1ESZA 2YY6A 1ISJA 1QR6A 1QS0B 3JQPA 3DDHA 1VLLA 4KPYA 3UXEA 3E53A 1IM2A 2P78A 1JL3A 2D1SA 2DPMA 2O1WA 1U4NA 1P29A 3ZWMA 3SVTA 3S2FA 1JX6A 3L7AA 3O4VA 3ICQB 4FS3A 2VAPA 2QPLA 5CG2A 1ULBA 4GX5A 1LK5A 2I3DA 4X45A 2XZPA 3U7JA 1EJBA 3BGIA 3PJEA 2L69A 3PHJA 5EGSA 2YTZA 4BV8A 5IH3A 1YS9A 1NYQA 4I19A 1BJKA 4QD3A 3AETA 4AECA 1SVOA 2O8NA 5CLIA 3QU9A 4R7ZA 2AC4A 5EJ4A 2YKGA 4C30A 2N42A 2JIZD 3GEPA 3NNDA 4OPOA 4A36A 1F8FA 4TXJA 4Y2PA 4TKVA 3ZNNA 4LJ7A 2EATA 3CLRC 1QLWA 3RABA 4AJKA 2GBIA 2QMUA 2O2XA 4WVFA 2PKEA 1FL9A 3C3EA 1BE6A 1QAOA 3ZV6A 3KSUA 3RFVA 5CDUA 4PANA 1RMTA 4QRIA 1O6CA 1VQLB 4YV1A 5M34A 2INGX 2V96A 2VDWA 4DLBA 2L0XA 2G40A 3K94A 3S4YA 3PC8A 1AKWA 1E60A 1J8MF 3VUFA 3HLTA 2P9BA 4FKMA 5K0GA 4IH9A 1U8XX 3MFYA 1YQQA 1XE3A 3BDVA 4IYJA 4MRMA 5KTOA 3DO8A 4B80A 3NLLA 3PYMA 4HHEA 1N2JA 1RCTE 3CIOA 4PGOA 4MRNA 4QARA 3UIEA 4AG5A 4F4IA 1VA5A 3I1FA 4OF4A 2HH9A 3M3HA 5WRFA 3QQ5A 1NN5A 1GKUB 3GIRA 4MO2A 4ETIA 1BXGA 2J5BA 1NC1A 3VPDA 4ND4A 3SEQA 3ZGZA 4JJIA 1YE5A 4XW2A 3UV3A 3OLYA 2ZIGA 3SQWA 2ZI9A 3BBPA 4Q9AA 3MIZA 1J23A 2VBCA 5FUQA 5CCEA 5K05A 3O7WA 3WY9A 2JI9A 4AJPA 2CFCA 2QTWB 2AVDA 5HEKA 5TGDA 2D13A 3W9UA 1KK3A 5JAPA 1N6NA 4G65A 4JT2A 3PYXA 1WHSB 3OU6A 1NT4A 4XIGS 5GVRA 1QSGA 4POAA 2R8ZA 5F2OA 4MUAA 5HF8A 1BKYA 1MG0A 1J4AA 4ROSA 2ODAA 1GNLA 3TR6A 1TYZA 4MUYA 3FOZA 4EGFA 2W6ZA 4QOIA 4H31A 1XTKA 4YEJA 1UDAA 4MVJI 3W0LB 2O2CA 4HEA6 1S7CA 2GX6A 2OM6A 5I7SA 4RIHA 2CL7X 2JN9A 4EYEA 3B82A 3LW8A 4RK0A 4W9NA 4KQ9A 2V4MA 1ODLA 4TRJA 3O82A 3BMOB 1KVRA 3UB4A 5I7EA 4FD3A 3SD7A 1TQHA 4KAXA 4XWGA 1EFLA 1OILA 3F6SA 3CCJB 3B5EA 4F2HA 5JJBA 3ADDA 2JLZA 2NU6B 4S1TA 5CU7A 2C9YA 4YRMA 2BF4A 2QEQA 1MRZA 4WLFA 2QN1A 3KKKA 3CCBA 5LFAA 1TIPA 1Y7IA 4PLWA 2P6RA 3E5HA 2Y0PA 1ECCA 2CFTA 3IQXA 4HGRA 3WLAA 2MU1A 5K51A 3PPVA 4J3FA 3A1WA 3Q3VA 4JQZA 2HRQA 4QTTB 2WTXA 1DMRA 3DTYA 4AT1A 2VSQA 3X0DA 1U3WA 2VQSA 2ILVA 3I92A 4GZ6A 1HT0A 4JAVC 2VDJA 1TK2A 3B1XA 1JR6A 5LLSA 1N07A 5CT5A 5DOVA 5A4MS 3L6EA 4BC1A 2ZQYA 3QEJA 4Q1DA 2HR1A 1SC4A 1A2BA 1N6PA 5J2UA 2NSJA 1ZOSA 1YA8A 3A04A 3AM3A 2ZTMA 4DEVA 5BRAA 3ENKA 1LNQA 3MILA 3F49S 2BISA 4Q1VA 1XD8A 3WLEA 2HCRA 2EYQA 4GLJA 1LI4A 3CCLB 1HQKA 3PUWA 4BQSA 3MQ2A 3T35A 1CTQA 2WJJA 3NDRA 4KXQA 4X90A 1KY4A 1VIVA 3HKDA 4UTOA 1RYMA 2H1SA 5D5QA 2VOJA 5JD3A 2P0EA 5F78A 4X8MA 3AUFA 3G3EA 1CQIA 2FQQA 1GTG1 1W5FA 2NPOA 3HY4A 3H2JA 1UT5A 4O6VA 2ISSD 1JHUA 1E1NA 1ORHA 3LWZA 3M6UA 2EDCA 2WD8A 1LLFA 1CUBA 3DW3X 4HG2A 2HBZA 3RUAA 5BRJA 4DJEC 5CPBA 4BX3A 1NIJA 3AERB 4JLOA 2NO9A 3B7PA 4QDTA 2OV8A 1JHZA 3GFOA 3DNMA 1N5DA 5BQOA 4MAFA 1F9EA 4RMJA 4MI3A 1QNLA 1NM5A 3LZDA 5FOSA 3W4KA 2VRCD 3M7IA 1SZJG 3ZIDA 1XK6A 3VZBA 5A06A 2E6UX 4HH1A 4CIYA 3EVCA 2JAQA 2DQYA 3IHTA 2AR9A 3C6MA 1XD9A 4QOGA 2JASA 4IH4A 1NT2A 2C00A 3D43A 2QUKA 2OCIA 2V65A 1O1YA 3ZUGA 2CYCA 1XQBA 1E69A 1E9DA 1NQVA 2ZRFA 4V0MA 3R7FA 3SSNA 2P2LA 3VTKA 5IP5A 4ES6A 5F35A 5KMGB 1USWA 2R25B 3ZVRA 4FN5A 1JRLA 1KZYC 1Y1LA 1GPKA 2DH5A 4XWYA 2ODBA 2ZGVA 2QTRA 3GVPA 4MITA 2ZIXB 2A94A 3L0PA 3ZY2A 3BGOS 5CTAA 3VDQA 5C7YA 5BWMA 4ZKEA 5IN4A 2LWIA 3PJDA 2MYUA 1U3UA 3S1AA 1C9NA 3B9BA 3CZAA 2JAXA 3JVDA 4HX9A 4O8CA 4F38A 3QKWA 5KNDD 1QIIA 2EVWX 3U9LA 2JS7A 4HDOB 4QULA 4URUR 1PFYA 1V11A 2AMFA 3KSBC 5GJBA 4JYAB 2XGGA 2GTIA 1CF9A 2CDBA 2IYQA 2NZJA 4ZODA 5FBZA 3UAGA 4B3MB 1IN1A 1HE8B 1YS1X 1R8SA 1AG9A 1NOKA 1U8UA 4NCAA 3NBYC 1P7PA 4FHDA 4IJQA 1OWPA 1TTQB 1FFHA 1IZ8A 1XG5A 3GFBA 1QQ5A 3LU1A 3N39C 4QQ8A 4RGBA 5D87A 3NBZC 3HSYA 3TQCA 4B8ZA 1ID1A 3LOQA 4MIEA 3WFJA 4YCJA 4O5OA 5DYNA 4NE7A 1RCUA 1AA9A 3C87A 4GOND 1P2GA 3CPHA 5ICFA 3FCYA 1ZH6A 2VQ6A 4XASA 4BO8A 2ZSHA 4PZZA 1VSQA 1NDQA 5JCZA 1NLMA 3OEED 4W1PA 1T5DX 1EWVA 4YRQA 3ICWA 5DDIP 4C04A 3ETJA 1GKKA 2RMKA 3NJ8A 2QHXA 1NW3A 2X1MA 2YXEA 3CR7A 4Y2TA 2FMTA 1U28C 2YIVX 3BEOA 4BFSA 4TTIA 3W5CA 1SA0A 3O93A 2ZYUX 5HF6A 1W4ZA 3AU9A 2FN8A 2BAGA 1JIXA 3TAXA 4FQ7A 2C31A 3TKAA 3ENNA 4WKNA 1BS2A 1ORIA 1W6RA 3NBXX 3IIEA 2FN9A 2FW8A 4IIDA 3SX0A 1MNQA 4CVNA 3AVVA 1EWRA 3LM8A 1G5QA 3G0CA 4KXLA 4MW2A 2IS6A 1JHOA 3CUWA 3RHFA 2OBSA 2ZPAA 1AQNA 2BGNA 4CQNA 2BE7A 4WJLA 3JQQA 4BQPA 1YK1A 3HFRA 3HWWA 4FHFA 4UDNA 3BFJA 4DDWA 2HWKA 4IJ5A 1X13A 4HS4A 3V2HA 4QHYA 2AFHE 3TINA 2TRSB 4KHPB 1BC5A 1QG6A 2E4ZA 2Q3DA 5ALTA 4Z4RA 2WYOA 3W06A 2KI5A 5IANA 5JQGF 2HCBA 4B3FX 3KQSA 3RIHA 4GR4A 3DTVB 1EYZA 2IFTA 5F76A 5KQLA 4IIHA 1ECFA 2GD2A 4TZKA 5DSZA 2JJMA 5TB5A 4DXDA 1ZVKA 2R2AA 4YCDA 4YX9A 5DK4A 5LUAA 2QVZX 4AF8A 2NG1A 1QXSA 4US2R 1OV6A 1TU4A 5GIPE 4IGIA 3MCVA 3OQJA 4KDRA 2O1XA 2FSGA 2GSWA 3TOVA 1SKYB 1MC4A 2IV7A 3HBMA 3MT7A 3OJOA 4LRWA 5JJLA 2J5XA 5ILOA 2OXRA 3IKTA 5LB2A 2W2TA 2XV1A 1T1SA 1NFRA 1H0SA 3AEYA 2J6IA 1Q2XA 4J0JA 4WNIA 3GROA 2AE2A 3H75A 2CL0X 4QBHA 5LVAA 4M1MA 4W7SA 1CRZA 4DUZB 4MUKA 2RJNA 1Z07A 3I6IA 3AOEC 3SQDA 1N05A 1TM3E 2Y6UA 1DKUA 1YASA 1E8MA 2VEOA 3AIKA 4RQBA 5ITZA 3ZQJA 4AY2A 4GMKA 4EITA 4S04A 4KUHA 2WQ6A 3EZ2A 2OHOA 4DNPA 3OM8A 1P2BA 2A5JA 4BQRA 3H2GA 1ADCA 3QITA 4P33A 1JV2B 2VF8A 3CLUD 1E0DA 2G76A 3AG5A 3KU4A 4K6HA 5ALKA 1C2YA 1LV8A 2FSVC 1TQ6A 3PGMA 2PVSA 3E3AA 2QNRA 3KDAA 5KQGA 3LIIA 4H3KB 2XUAA 1N6RA 4CKYA 3RRYA 2AI1A 5DYYA 3D6JA 3JWIA 2RAFA 2IYOA 3F6PA 4Q1BA 4DZZA 1GA6A 3C14C 3E4DA 1HOXA 4IDEA 3IR7A 3BMQA 2ZCVA 3L6BA 3MBOA 2ZBQA 2XSZD 3IBSA 4NKRA 2XADA 4EO4A 4KDFA 4CKWA 8GPBA 3PWZA 1OPRA 2Z6VA 1EM6A 4UBOA 2FAXA 1R8JA 3H5OA 4AZ3A 4JP5A 5EAIA 1Z3IX 2FMUA 1Z47A 3L8EA 3NAQA 5EE9A 4QHTA 5D3MA 4CL0A 1GZ5A 2DWQA 4QRHA 4R8RA 4XMYA 2O2EA 2WYIA 2HMYB 2RGXA 2GWRA 3EHEA 4OD0A 4UBMA 1S8AA 4D6XA 3AC0A 3G9QA 4V24A 1D3AA 2DUJA 4FGWA 1NF9A 3GVXA 1M73E 5I5EA 4OREX 4B3XA 1M90D 1TPZA 5AMXA 4RANA 3U7RA 4RPHA 3I4LA 2OO5C 3FVRA 3EYWA 4M1ZA 3WBJA 2B2XA 2DFVA 1A9OA 2K2QB 2VAMA 3BIXA 1WQ1R 3L8DA 4RO0A 3BWCA 5CURA 4BX9A 5IABA 5JYCA 4JUDX 2IYTA 3AFNA 5EIOA 4XUCA 4I4TB 4J90A 3CIFA 4EHJA 1NVXQ 4RA6A 2VSOA 5E9WA 3H6GA 1RM5A 3G13A 3DKIA 2XT6A 2QX8A 1RI3A 2YQ5A 4Y3UA 4U2EA 4ZHQB 1Y4AE 1ZGAA 4H1TA 3WL7A 3H5TA 1W0KA 4TL8A 2ZU6A 3I2HA 4HNQA 4LJSA 3E7PA 1A8QA 4LGCA 1N2HA 1Q7CA 3G2IA 4CQLA 1GPLA 3OZFA 3PD7A 1OD6A 3TW0A 1CERA 4ALJA 1Y0YA 1Z0AA 1YAJA 1YDWA 4PU0A 2A1UB 3OMWA 1GZ6A 2HN9A 4PQYA 2VJMB 1KDPA 4FN4A 4LC9A 1W2WB 4E5SA 4A10A 4LPKA 1YRAA 4I9UA 4RY2A 3RWBA 2DTEA 3QNWA 4WCFA 4BASA 2QMEA 2O06A 4YJFB 3PPIA 3GLFB 3A70A 1ZJ6A 3LPNA 5FL3A 1NMSA 1L5LA 1W1WA 4X6UA 3KXDA 3ZV3A 7GPBA 3BX1A 3I64A 1H0HA 4N65A 3IOMA 3CHYA 2R6FA 4OYRA 4RDJA 3OLCX 5A3QA 3GLRA 3QA9A 3HSKA 4L5IA 5EIWA 2E2WA 3UO8B 4XR4A 3OTIA 3ANYB 3LUHA 3HFSA 3REQA 3KUUA 1TCCA 4BVEA 3RU9A 4CT5A 3AF0A 1Z2EA 5AKLA 3JQAA 2JW5A 3GX1A 5EE3A 4LZLA 2NU9B 3CC7B 3W3ZB 3GLFE 3NGMA 3Q7TA 1E1MA 4I3FA 2ZRCA 4KIUA 4AFNA 2Q3EA 1BVHA 2X7JA 2EL9A 5HRAA 5IM4A 1AGPA 1XCPA 4MGYR 4ZJUA 3AMVA 5LXTF 1TADA 2H9AA 4HQNA 1FP1D 5REQB 1Z2DA 1PHRA 5CLGA 2V54A 4JBYA 5ALIA 1QIKA 1XL1A 3CNNA 4UM5A 3BMCB 5FBVB 4YXWA 3T41A 4OAPA 1A1VA 2FPXA 4JLAA 4S35A 5ELMA 1FRNA 4WACA 4Q7KA 2QXUA 4OMFG 1ULHA 4HLNA 4DUGA 5AN9A 1EE1A 2ZRPA 2X15A 2JLCA 4LJ4A 3A9CA 3LBAA 2KS6A 4HS9A 2O5RA 3DM9B 3OA0A 1QKJA 1MW9X 1R4NB 4JK3A 5HIIA 3ULKA 2FFJA 1N0VC 1OKKA 4OATA 3T5DA 4M1OA 3FCOA 2NNLD 4DHWA 5C8DA 3R9XB 3UQYS 2PQ6A 3A6FA 1YUMA 4EOGA 3OKFA 1YZFA 2HYDA 5HUJA 4MK4A 2P1RA 1TYEB 3HXPA 4KX3A 1R3DA 2WUWE 1W0JA 2XB4A 3ZNPA 1QRAA 4ML3A 3H2YA 5BQ5A 1O0BA 3EDRA 2FMXA 4F4UA 1HQDA 4E13A 4YIHA 3MWYW 1N32B 4OGKA 3ECSA 4PG5A 4RK7A 1CW2B 3I0ZA 3EVFA 5JECA 5DNDA 2W2LA 1S2NA 3ZWOA 1R4ZA 4DANA 2QRJA 3JQRA 3IAFA 1E9BA 5B1YA 5TLSA 2GWHA 1Q19A 2GBLA 4JDPA 3TEMA 2VAVA 3LLSA 4BNDA 6ABPA 1D4AA 1O2DA 2OO3A 1FSFA 1SRRA 4ABYA 2YHSA 2V0GA 4WEQA 4OP7A 2ZT5A 1E2GA 2E4AA 2QZ9A 3L1UA 3I6YA 2E89A 2WHPB 3O8NA 4LWQA 2AZDA 4V39A 5EYPA 5DGHA 3FYSA 2PL9A 5C7OO 1LVHA 4ZEWA 1ZGHA 3UATA 1ZAKA 2Q7DA 2PU7A 2VPIA 1K3TA 1SUFA 3JQAB 4PYKA 2YXDA 3W34A 3OLVA 4EB3A 3SQXA 1EFRA 1W6UA 2KPOA 2XCLA 3DE5X 3BQMB 1DKMA 3FDFA 3NYRA 3ZG6A 1KRWA 3WBKA 4YHHB 3DDSA 5KAPA 5JO0A 2A5YB 2QOEA 5A5VA 1TMGE 5JVDF 5CLHA 3AO0B 4J6FA 1M7BA 3JALA 3OHSX 3ZK7A 3A6DA 3V7WA 4DA8A 4AL4A 2F55A 5FXMA 5HF5A 3MOIA 1SU6A 4WKCA 4G0WA 3PVDA 2YINC 3TNFA 1DU4A 1NWCA 1P0PA 1J5PA 1W29A 4YT8A 1QDUA 1GSOA 3W5IA 2CUZA 3EGWA 4KFTA 1DBVO 4KLRA 2EOAA 1E5TA 1LGYA 4LNUA 4Z2YA 4MKXA 4NDAA 4FKZA 4FYIA 2RB5A 3SK0A 5CA0B 4N3BA 1V2GA 1Z2NX 1ZU5A 1FSSA 3ROMA 2PWPA 1JEQB 2I34A 2MYNA 1I4DD 2G28A 2I7CA 4LRSB 4WLUA 4EUEA 1O96A 4F3TA 2V58A 4YT4A 4EEKA 2QYOA 1XF1A 2P1ZA 1I0ZA 2D4AA 2NT4A 4PV7A 4XSVA 1E1LA 1MIOB 4NF2A 4PYLA 1VKHA 3PX7A 3CZMA 3G6EB 2E21A 3KYIB 1KE1A 4CGZA 1UQRA 3SIXA 2I6UA 1D07A 1CF2O 2X6WA 1KR2A 4KFCA 4Q34A 3KKZA 2JKZA 4I55A 3AYXB 3MYYA 1GTL1 4IJWA 1QFXA 1SCNE 4TWBA 5JWOA 1MVLA 2NU7A 4EFLA 1TD9A 1E9FA 4R0VA 3URMA 4Z53A 3KEFA 2VPPA 5AOCA 3S27A 1PUIA 4IF6A 2OCGA 3K0HA 1E61A 4HLCA 3MCWA 2XHEA 3GSIA 2B3DA 3DOHA 3OFSA 4YAIA 2AXPA 1NBAA 3A6HA 1ZA1A 4PYIA 3KQKA 1SFRA 3EJ6A 2O23A 2YIJA 2JZCA 4JOSA 1RJEA 4Q9DA 1VE1A 1IPFA 1ZD1A 1DFHA 2FW1A 1FFSA 2AYZA 3G82C 4HN9A 4ZALA 1RFLA 1VI5A 2CUKA 5C8YB 1O0SA 1JYSA 2W6JD 2QE6A 3JAWA 2HCFA 2IXTA 3HJNA 5FL7A 4MUFA 3GFQA 4DDHA 2NOAA 4EBFA 1RRCA 1N36B 4N03A 3ANNA 2B7CA 1X1QA 2Q8PA 1B1CA 4NDZA 4R2LA 1YVRA 1PWYE 3V4ZA 4KH0A 3B1VA 1KJ9A 2VKTA 2GVNA 3FTQA 4ZU6X 3QJYA 5SV2A 2BGIA 3MHPA 1IONA 1WZIA 4NJEA 2BY4A 3CE6A 2I67A 4GM4A 4CNBA 2P7HA 3JPWA 4L95C 3DEYX 1GLGA 1ICIA 3PFBA 4JGIA 1PG0A 2QX4A 2WWFA 1H6DA 4NZYA 3NT4A 4DLYA 4KLZA 1N25A 1XCMA 5A5DA 4ITUA 3V4VB 2WOOA 2BFOA 2IPXA 3BXFA 2B4RO 4Y18A 5EVJA 5BWBA 3FNBA 2DFKB 3WWZA 2WV7A 3Q38A 1QGOA 4EUHA 3T5GA 1F0YA 4CKCA 1H6CA 5CXSA 1P0QA 3EAGA 4BNKA 3TLMA 1COZA 2PH3A 1Q0LA 3LFHA 4QNMA 1TW3A 5FTWA 1MEOA 2ZSIA 1FB5A 1HT3A 4ZAGA 1F0NA 4LGMA 1E63A 4R05A 2IYLD 2JVJA 1N2EA 4A0GA 4HDMB 3RS5A 3WGTA 2F4VB 3EFHA 1OX4B 4EGQA 1P9NA 1E7WA 1SKMA 3ZWDA 1M7GA 4CIDA 3O3OB 1XLWA 1BWPA 2XCUA 3CF6R 4LSZA 3EMBA 4P2GA 2WFLA 4WY8A 4ZT4A 4QTXA 4Q21A 1G1MA 3CNQS 1J1UA 4IIJF 1GFZA 1HL3A 1U5CA 1PSZA 1J5XA 2Z6BD 1D4FA 2VUHB 3MZ0A 4HEJA 1KC8D 4I7EA 3C7CB 3W3AD 5FTKA 5TX7A 4O4LB 1GRNA 4B35A 1D2CA 2EWWA 1NG9A 2J6CA 5F33A 4BMCA 3HJHA 4QREA 4W1QA 2DOGA 1UD4A 1GFSA 3I2KA 1EX7A 3LHDA 421PA 1X80A 3IIKA 2Q21A 2OPHA 4QLOA 4DEXA 1JZSA 2XMPA 4M22A 5JFGA 1XO1A 3QSGA 1Z5PA 4HB3A 2IIPA 4NBRA 4WEOA 3EEFA 1E6LA 3U62A 5H9VA 1T6YA 1E5VA 1O9GA 1CV2A 2XTAA 3A05A 1F6WA 1X77A 2YYZA 1SEPA 1YC5A 2EGUA 1O97D 2F9FA 4RVOA 4L07A 2CLEB 5TPZD 4ETWA 3Q1LA 1XLTC 3ITKA 5AR1A 1R4MB 4BNTA 5BVGA 1VZ3A 3II6X 4PINA 3LGAA 3PQDA 3W4JA 4DIKA 3Q11A 4E5UA 5A4DA 4C01A 3DAYA 2WJVA 1OFUA 1VPLA 1F12A 3UW1A 1U7OA 1JQAA 2WG2A 3FTFA 3KXKA 3KFVA 4YC7A 3VVBA 4AF7A 1CUGA 5FR2A 1U5BA 1VKOA 4TZ6A 3I9NA 3UWOA 1V4BA 1Q0ZA 2FSFA 3VYWA 3VNBA 1QFSA 4FGKA 5CLJA 1HX7A 1AQ6A 2ECKA 2Y1KA 4HE5A 3H4TA 2BEKA 4DY6A 2PD3A 4NENA 3A11A 3M89A 2P68A 4JBXA 4NU6A 3S8EA 1PEDA 2QRPA 3BKWA 2R60A 4F6LA 2SKCA 3HXMA 1QPBA 2I3ZA 3EGDA 2OGSA 2OCAA 5H9WA 1O58A 5DHTA 1VCOA 5AOVA 2VBVA 3N0TA 3W8FA 3KSDO 5D5PA 1M6EX 4GXNA 2UVPB 5DTQA 5EP4A 3RFXA 2FK8A 2VJDA 2BMWA 2B82A 2QD4A 4M76B 3SDZA 4OYYA 4N76A 4OHPA 3HVKA 3ZY4A 3ZLUA 1X74A 5GTDA 4BX0A 4G2TA 3ZTYA 2OSVA 3ZBUA 2ZRHA 2C5AA 4QFMA 2AEJA 3KR2A 2BEUA 4KR6A 4U0KA 2GFQA 3T5CA 3ZYCA 4RAOA 5JWRA 1JMVA 3CEJA 3OKXA 1JILA 1GU7A 2QRMA 1NQ5A 4QUDA 3GUHA 4IW3B 2JDID 3STVA 3VAAA 3LQ4A 4V38A 1VP3A 3A9RA 1HURA 2OHIA 1HQYE 2Z1DA 2QZ4A 1QFJA 2XE4A 3KEOA 4JJ6A 4WJKB 2DQ4A 2KBEA 1P0IA 5KKCA 2HZBA 2IX3A 2XBMA 3GRVA 2WWGA 2WUVA 5I7WA 3CV3A 1Z73A 2NTVA 2REXB 4QUAA 4D4GA 1U7PA 5A6SA 2JNWA 5AVWA 2YS7A 1E43A 5JJIA 1SCJA 2MYTA 2REQA 4NK4A 1EVYA 4G1MB 3I30X 4FFRA 1YZNA 4M1YA 1L7XA 3HP7A 2RHHA 3O4GA 1C8LA 5BNWA 4KPEC 1H9AA 1U7DA 3DDNA 1XN1A 4ZO9A 3VMFA 3A14A 2JLYA 5HZAA 4I8XA 2ATVA 2YFKA 3OIDA 4JOBA 5KJ6A 1P3DA 1DINA 3LCRA 4R8VA 4RV9A 1W85A 2QORA 4Z54A 1IAQA 3MOGA 4KBFA 3RPEA 3KOWA 1W85B 4MWZA 4PICA 5DNAA 1NBHA 4YUWA 4B76A 1TL7C 3RQSA 2PUVA 4K9DA 4ZRMA 3HBJA 1MT3A 4ZQBA 4F2WA 1S5PA 3CC4B 1ZI6A 2VJBA 1Y3HA 4GX0A 4Q6BA 4R6XA 4BNMA 1JEOA 3VFDA 2HIHA 2H2IA 2O8DB 1YHNA 2B4KA 2QRUA 3HG7A 4P36A 4FXUA 5T4BA 1JEAA 1WUYA 4XCXA 1EX9A 4MS3B 3HK2A 3PEFA 2V9CA 1AHIA 3I32A 4OOVA 3F74A 1T9KA 4EL5A 4CG1A 5E6TA 3P2IA 5IUKC 4B2PA 2OP1A 3GH3A 2Q07A 5GJCA 1N5JA 4DQUA 5JU6A 1ZW1A 2K5UA 2J85A 4GGOA 1C5KA 2I4TA 3EZLA 4AZSA 4MUJA 4O1MA 2Y1DA 3A4NA 1I0LA 3BWMA 2FPPB 4XVQA 4XUDA 4BIIA 2JCXA 1K1EA 4QDKA 4F4HA 2DKNA 2C5GA 4FIDA 2J9YB 4LJLA 5CT6A 1VP9A 2NGRA 2Q3MA 3V1MA 1FVHA 1H8ED 1EBFA 1WJGA 1UZLA 2GJAA 1CJBA 3PB3A 3JCZA 3A0RB 1ESEA 2ZDHA 3C6QA 4PS0A 1ECLA 1LDNA 1SBCA 2B8WA 1H2RS 2PX5A 2ZB4A 4KNVA 5FI5A 1H2BA 2FR1A 5HDBB 3MF4A 2I6FA 1HT2E 1XQ1A 1HE2A 3DP7A 4R40A 2DY0A 3FB4A 4H6PA 1TCAA 1VL6A 3ST7A 2SKDA 3N2YA 5JR3A 4RAQA 2A67A 2AD1A 1UBCA 2J0QA 3NIDB 3TW8A 2I2FA 2WB4A 4WZAA 2ZVJA 1EUCB 1VL8A 3MSXA 1UZAA 3DBHA 1THGA 1W2HA 2PXXA 5FI3A 2VJJA 1LVGA 5L45A 1W94A 2DJIA 4L5JA 3E6AA 4LVNA 1G6OA 1RQXA 4FQ8A 4W5HA 1HSOA 2BBTA 3DTVD 4Z9XA 4NFLA 3T54A 3OOJA 2OC4A 3SDBA 4YCCA 4B32A 1DOHA 4UBJA 4NEQA 3SX2A 3OPNA 2WB2A 3LP6A 2CB9A 3A06A 3M33A 3VR4D 5HKBA 3AKDA 2YN0A 4YV2A 5K03A 1R5NA 1V1MA 3I8SA 2VTDA 3JD0A 4MI1A 1RT9A 3TZCA 3QIVA 4J2HA 3I6MA 4QBGB 4BZWA 4DREA 1QGYA 1R4MA 1VPWA 1E96A 3X2SA 3GCXA 3M0EA 1TGVA 2Y1GA 1LPPA 2YJZA 4LMAA 3S28A 3ZDAA 2BFPA 4PABA 5K4GA 4MVXA 2NXNA 4KXYA 2GPYA 3DR3A 2PXCA 4OKNA 4YB8A 3VDNB 1TQ4A 4B3JA 2RGCA 5CK4A 3G2HA 5BYJA 1BMQA 4G0UA 3VBCA 1TYBE 3RFTA 3WISA 4R1SA 1K4KA 1WMSA 3U37A 2O2ZA 1M34E 4FOLA 5DGDA 2XCQA 5C32A 1Z33A 4QGGA 1AN0A 2J32A 3LHSA 1Z7GA 4WKBA 3Q39A 4RULA 4RNCA 2OCPA 1DBPA 4O1HA 2DFNA 4J7XA 4O4IA 1MFPA 5C7LO 3CXCB