1QHFA

Yeast phosphoglycerate mutase-3pg complex structure to 1.7 a
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
240
structure length
240
Chain Sequence
PKLVLVRHGQSEWNEKNLFTGWVDVKLSAKGQQEAARAGELLKEKKVYPDVLYTSKLSRAIQTANIALEKADRLWIPVNRSWRLNERHYGDLQGKDKAETLKKFGEEKFNTYRRSFDVPPPPIDASSPFSQKGDERYKYVDPNVLPETESLALVIDRLLPYWQDVIAKDLLSGKTVMIAAHGNSLRGLVKHLEGISDADIAKLNIPTGIPLVFELDENLKPSKPSYYLDPEAAAAGAAAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a phosphoglycerate mutase:3-phosphoglyceric acid complex at 1.7 A.
pubmed doi rcsb
molecule tags Transferase
molecule keywords PROTEIN (PHOSPHOGLYCERATE MUTASE)
total genus 81
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature ec 5.4.2.11: Phosphoglycerate mutase (2,3-diphosphoglycerate-dependent).
pdb deposition date 1999-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1qhfA00
4HBZA 2IKQA 3FJYA 5AJXA 4QIHA 3EOZA 4E3WA 2A9JA 4JOCA 2H0QA 3MXOA 1ND6A 1C7ZA 1QWOA 1FBTA 1CVIA 5AK0A 4IJ6A 1DKOA 3EZNA 2P2ZA 4MA4A 2GFIA 4FDTA 4PZAA 4D4KA 3IT2A 3E9EA 1BQ3A 3GP5A 3LL4A 3R7AA 2OWDA 3QPWA 5AJYA 4EMBA 4D4JA 2P75A 1C81A 2EKBA 5AJZA 2P78A 2AXNA 5HR5A 3IT1A 1T8PA 5HTKA 1RPAA 3F3KA 2WNIA 1TIPA 2YN0A 2PA0A 5CDHA 1SK8A 2HIAA 1QHFA 2BIFA 2H4XA 3IT3A 3DB1A 1DKNA 4GPZA 1DKLA 1XQ9A 4GPIB 2YN2A 4TSRA 4ODIA 5AJVB 3D6AA 3QPVA 4ARSA 2OWEA 3OI7A 2DWPA 3C7TA 4IJ5A 2ENWA 2HPAA 2H52A 3KKKA 1YJXA 5CU7A 2P9YA 3ZHCA 2ENUA 2H4ZA 2I1VB 3LNTA 1NT4A 3D4IA 4PZ9A 3IT0A 3PGMA 1V7QA 1V37A 1EBBA 4JOBA 2P79A 3HJGA 1DKMA 3GW8A 3FDZA 2A6PA 1E59A 2F90A 1FZTA 4AROA 2P2YA 5PGMA 3K4PA 3F2IA 2P30A 5AJWA 1K6MA 2P9FA 3K4QA 1H2EA 3DCYA 1UJBA 2WNHA 3E9CA 2P6MA 3LG2A 4JODA 3D8HA 4EO9A 2P9ZA 4ARUA 1BQ4A 1IHPA 1C80A 1RIIA 3BIFA 2EKZA 1SKBA 2HHJA 4PGMA 1ND5A 3GP3A 3MBKA 2P6OA 2EOAA 3QPUA 4D4MA 1H2FA 3O0TA 2DWOA 4D4LA 1SK9A 2RFLA 1YFKA 1RPTA 1DKQA 1DKPA 1E58A 3E9DA 1BIFA 1SKAA 3NTLA 2P77A 4ARVA 5CX4A 2QNIA 1UJCA 3NFYA 4FDUA 2WU0A 3FDZB 1QFXA
chains in the Genus database with same CATH superfamily
1V6AA 2H2HA 3TRHA 3ZKWB 4J90A 3GC6A 1QF6A 2VP6A 2CXRA 1ORRA 3UJ3X 3T4UA 3HY4A 3KBBA 1OXBB 3THSA 4GL2A 1A9XA 1B26A 2W5UA 1T8RA 3DV9A 1W6RA 3JR3A 1T0UA 2IXTA 3EMBA 4PZLA 5LP1A 1FTYA 2KLBA 5K6AC 3ICPA 4PCAA 1EFRD 5A3SA 3VKHA 3JQBA 1C29B 2O23A 3C4JA 3W5VA 2NQ2C 1N7JA 4KX3A 3GA0A 2ACWA 3UC5A 3EA0A 4W7IA 1MX5A 5A06A 4Z5XA 1MO5A 3CF0A 3EZ7A 3U4GA 1PFYA 1V5EA 5KCMA 4NEHB 5GP1A 2OCXA 4LCEA 5AW5A 1MO2A 3ZIUA 3C3CA 4XIYA 4ESHA 3FGOA 3H5IA 3MJTA 5ALNA 1BDHA 5KQPA 1U8ZA 4RM3A 3NBMA 1YD7A 3DAGA 1UKCA 4KJXA 2BFBB 4QEDA 3VPGA 1BU8A 1SY7A 3LYAA 3SU8A 1J06A 1MB9A 1QO7A 1DARA 1V3QE 1WABA 2DPMA 2OV3A 2P4SA 2PA0A 3KEQA 2VZ9A 3O21A 4UNQA 3WYCA 4DJDC 2HFKA 3BD7A 3I1YA 4IXMA 3DZFA 4CUZA 1PZHA 3UO8B 5DMHA 1OPXA 3IPXA 4KBGA 2XUHA 2P3LA 2BW0A 5A5DA 5F21A 2QM7A 3V42A 2A1TS 1P1HA 3NASA 4OHPA 3KVRA 5TGZA 1XLTC 4AYWA 1NVVQ 2JJYA 1R4MB 1Q14A 3D2LA 4HDSA 2C8KA 4FD3A 2AEMA 4QVKA 2DTEA 3MINB 4DCOA 1EVKA 1M33A 3HJBA 1C4XA 1UBLS 1KMQA 1A82A 1H2XA 1G41A 1U8YA 2QX8A 3U7GA 2MSDB 3L8FA 3QLJA 1IBCA 4HDRA 3QITA 4QUIA 1E2BA 3SXUB 4JYCA 1SEVA 3GA7A 4E4TA 3ANNA 4EJMA 1VMEA 1V25A 3GJ8A 3U4HA 2YVQA 3STXA 4CIWA 2RG7A 4H1WA 3BPSA 4ND4A 3I2GA 3O3CA 1ZK3A 3FYHA 4TRMA 3SQOA 3H8SA 3B1YA 3H9EO 3TR5A 3ZE7A 4RVNA 3PWSA 1DIAA 3GNLA 4A91A 3FCXA 2HYDA 3THWB 4B3DA 1XUOA 3E1GA 2AWNA 5DFAA 2V9PA 1O5IA 2MYPA 4GYKA 4DDMA 1F2VA 5FORA 3OHSX 4GI1A 5I9NA 4UCWA 3SF8B 2OUKA 2PVSA 2PPLA 2QVXX 3AF5A 2C1XA 4UXIA 1YJAA 2WWTA 2ZIUB 2G63A 1J49A 3ASUA 1H6AA 2ZJ2A 1RJDA 3QLUA 4MGIR 2AJLI 3S68A 2QENA 4Y6GB 1VGRA 4G8JA 2WQ7A 1RWPA 5BURA 2Z4TA 3DF9A 1H1DA 2TMGA 3OT5A 4AXXA 4XQ9A 2A5FA 1RSZA 4MIYA 2O1WA 5CYGA 1UEIA 1RE1A 5HZKA 3EZYA 2WSMA 3VH3A 2I7XA 3N70A 1QV6A 1YL7A 3FH0A 3MT0A 1G6Q1 1HNWB 4GI3A 1ZOOA 1DEHA 4O2RA 3KJIA 4F84A 2GHQA 2BP7A 3V6LA 3DO5A 4KN6A 3IAAA 1TZBA 1RC8A 3K6SB 1QP7A 4DBLC 5CYOA 1NF2A 3B20A 3MWGA 4IJQA 5K0JA 2XOKA 5EMMA 1N0IA 1TZCA 2Y1OA 4KWEA 4HI0E 4LE1A 1Y6ZA 4Y9UA 3AI3A 3IQWA 4RF4A 1ZLXA 2R6ZA 3CF6R 4DLPA 4HHEA 1QDUA 4NJEA 4RHTA 3ZDEA 3FKQA 4LBZA 4PBSA 3MJHA 4L7QA 1P2SA 1Z5UA 2JZOA 3QX3A 5GONB 2J3IA 4MARA 3X3HA 3ITDA 2H2GA 2O3UA 3SHFA 2X2FA 2CNBA 1Z74A 3G6WA 2OT3B 3T5PA 1N6KA 3I4LA 4IS2A 1Z0SA 1Z4IA 1K66A 4B4WA 1L9KA 5JECA 2VBIA 3NYRA 4OHKA 1X14A 3GOHA 5CA0B 2H7VA 4MICA 3G2IA 1WU7A 4ZOLF 5AOAA 1Z47A 4IPTA 4MI6A 3DE2X 5A4MS 4W9RA 4DQDA 1FU4A 4YK7A 5KTSA 2CL0X 1YVDA 2HTEA 3OC6A 2NNWB 3OOYA 5JQGA 3HXQA 3OI7A 4E70A 4TVSA 1TTTA 3CH7A 3PPXA 2FN4A 5M04A 1F0PA 1WY7A 3PQ6A 2GETA 4CM9D 3A2MA 3FY4A 1N2CA 5C7IO 2E85A 4HCJA 2FPLA 1PV4A 1T2AA 3F6SA 5D5QA 2OV1A 3WKCA 1Q7GA 1G8JA 3W5UA 3A28A 4KLCA 3IAUA 3ZI4A 3R5TA 4L72A 5HIIA 1G21B 3EOBI 2HRRA 4YJDA 5B2FA 4EA6A 4YJHB 4D9GA 4R2XA 4R8LA 3BIXA 3LF1A 3TIIA 3HP7A 2IU3A 4CKYA 2CKDA 2VHQA 4G24A 1EJ0A 4IBOA 3RD5A 2WICA 4DYVA 3K4QA 4EFMA 2C3OA 3GJ0A 4Y9TA 2FZ5A 1ZJ5A 4AZTA 1T5OA 1UJBA 3GMTA 5JI3E 5LIPA 1CB0A 2P90A 4LXTA 1GTVA 1TLTA 2C9YA 2GPAA 1EP9A 3BDIA 5FWXA 1LFAA 2FMFA 3IMEA 4MAAA 1PT5A 2H0AA 3D6VA 3O26A 4MAFA 4HH1A 5ALTA 1ISIA 5KYVA 1MOZA 3REQA 1SKBA 4EARA 4KEAA 3NYWA 2X4LA 4CCAA 7ADHA 3AKZA 5HIJA 2Q4TA 4OF4A 1MDFA 4XYMA 1L7AA 1V96A 2QRJA 4CKXA 4C6HA 1PZFA 1A8IA 3ZKWA 3NXSA 2GXQA 2RH8A 3PEWA 5CJJA 4LYAA 2PO5A 4RS4A 4X3CA 3D8SA 4Q66C 3I9NA 3KU1A 1LRKA 3NHRA 4HAZA 4HT3B 4YRKA 5BN3B 1AK2A 3K0CC 3Q7RA 2G5TA 1QB8A 2RI1A 2VSXA 4OYYA 4QHYA 4MTLA 2EQBA 3FFAA 4C0SA 4HQ0A 5L3ZA 2QT0A 1NZJA 3AV0B 3QQ5A 1C50A 1R4NB 1X1CA 4ZVQA 4YH1A 2MINB 5GJVC 3HH8A 16PKA 2POQX 3KJZA 3GR6A 1NYTA 3LPLA 5FUXA 3TLGA 1I2CA 2C2WA 5BW5A 1RAIA 2IC5A 3A36A 4HLNA 3IUNA 1EXMA 1QYVA 4DBZA 5D3ZA 2E6UX 2BJVA 2HFJA 1STOA 2XA2A 5IABA 2WU4A 4NMHA 4KBYA 1ULHA 2PZLA 2ILVA 2CLMB 2X0IA 3CRW1 5T5QA 5AW4A 1JEYA 3W5AA 1N5RA 3EXFB 1AVTA 5DEOA 3H8VA 4DCCA 1K63A 4CGZA 1JL3A 2XYPA 3IQGX 3RAEC 4QPNA 1FMTA 1GPJA 4DL9A 1ML4A 4MIOA 1MGOA 1S5PA 3E22B 1GTMA 5TQJA 3K2EA 2NU6A 2QN9A 3OQJA 4O2AB 1PJ8A 4PG6A 3VSCA 4CIVA 3JWEA 3OQPA 3V48A 4C5BA 1AHIA 4S1WA 3ZCQA 1XVAA 3NGXA 1EKXA 4J2OA 4MUIA 1U2RA 4LI0A 5J1TB 1AGXA 4CQLB 5KWIA 2W6CX 1I3CA 1RRMA 4MVJE 2FOXA 3N0TA 3QJ5A 2IE8A 2ZIXA 3GNTA 3IQFA 4MP8A 5U4XA 3BE8A 3T7KA 1PQUA 3ZY2A 4W4TA 1DAGA 5EPEA 3VKGA 4FUTA 1N25A 3N7UA 3SXUA 1R2QA 3BEOA 4ARSA 5JAPA 2FFAA 2QLFA 3HU1A 4REOA 2J30A 3D6HA 3W1EA 3W8RA 5J4LA 5L9AA 1Q0RA 3VHXA 3ZJVA 2YCLA 3FNGA 4ZDJA 4DR1B 3AY0A 3AHDA 3F5SA 4MPPA 4MRNA 4GP7A 3FTEA 2HN9A 3M9WA 5I7RA 2GBLA 3U56A 3X1XA 4BJ3A 3KQLA 2J0SA 4O4IA 3BE5A 4IGAA 3M89A 1NFQA 4LJ6A 1N9ZA 4MYTA 4QE3A 2QX4A 3ZWMA 4URXR 2D5AA 1AKRA 2CD9A 3R3XA 4FLFA 1E2EA 2HCTA 1Z28A 1IHYA 1H4QA 4LZZA 3NGMA 1UWLA 2G6BA 2Y76A 2V3VA 3KB2A 1JBEA 1OX6A 2WQZA 3SPXA 4D9MA 3K4PA 4DV5B 3AHEA 4B81A 2WM3A 1K6MA 3EQ2A 4M9QA 3AY3A 3BZUA 1RYYA 1O6ZA 1YZTA 2J45A 2PH3A 3FDFA 3NDRA 3NOOA 3H7IA 2HWUA 2QE6A 4GZ3A 4NV0A 4R2JA 2HOQA 3KYCA 4UW9A 2C3YA 3F5QA 4CIDA 2D54A 4CXMA 1NJ8A 5IKMA 5K0FA 4YO7A 2IHNA 1ZHHA 2GPTA 2O3RA 2CXSA 3MJSA 4KQJA 1JG2A 2AHOA 4PZEA 3RS9A 1VE5A 3PR2B 3K0AB 4IHQA 3EVCA 3FFBA 4QJ5A 2F1IA 4BBPA 4ZYZA 2WTAA 3D02A 3QXCA 2XVMA 2ZQZA 3TLKA 3VO8A 3NBYC 4JP3A 3O8BA 4QAJA 1PBNA 3HP1A 4BQRA 1JDVA 1P3DA 5IYZB 4L9WA 4EW3A 3KOOA 3H5WA 2Y0CA 4N7BA 3LBAA 4OBXA 4ZOCA 5B1DA 3ZWPA 4OQMA 2ET6A 2X42A 1P31A 4S1TA 2R97A 4AAYA 2EKQA 3K9BA 2VG8A 2E4WA 2CVQA 2YNMA 2GILA 1L5NA 2EFHB 2Q50A 3U1TA 4EF5A 4BFVA 1UJMA 4EHNA 1EB9A 3AEXA 1WOYA 4FX2A 4RJTA 1T36A 4Z2YA 3TW8A 4R5MA 3TJZA 2ZJ7A 4MV4A 3JRWA 3HEBA 1YMUA 1XRMA 1MAVA 2VJMB 2GLUA 4QBKA 4JT9A 2GNPA 3TOVA 4U7HA 5KHOC 1BVYF 1T8SA 5EJGA 5FV4A 1N7IA 1DDOA 4NP6A 2W2KA 3GVPA 2PS9A 4DHWA 1IPHA 5ALVA 1B8NA 3MRXA 2IWRA 3U26A 4IDBA 4R8KA 3FOAA 4EHFA 2OZLB 2AMFA 3U9SA 1DKOA 2R1ZA 2ZIZA 5JVDF 5FD8A 3HB1A 4ZANA 5KNLA 1C1DA 3AVPA 2Q3HA 2RI6A 1O94D 2FF5A 1W35A 1NI3A 2JPDA 4GLOA 2NUPB 3ORSA 2A9FA 2X0EA 4JR0A 4BQOA 2OFXA 3AB3A 4RAQA 4R8MA 3D7RA 1M2VB 4CLRB 2A9QA 5JJLA 2WHPB 2P75A 2JCVA 2DR0A 3AHIA 3MOGA 4AKEA 4FB4A 3IVXA 1XROA 3A27A 3RFUA 3GZNA 1A95A 1V16B 2JFWA 3AP1A 3R9WA 1N8TA 3U37A 1O7JA 3RUDA 2ZYDA 1N9GA 2KPOA 2DGDA 3LLSA 3OLVA 5IG2A 5FHQA 1X9IA 3GJQA 1XJWA 4AQYB 4NU0A 1HH4A 4LV5B 3CVJA 4A16A 1JIIA 1ZKDA 2FLVA 4MMYB 3UJ6A 3NBQA 1G21A 1SU6A 3V3KA 4A0GA 5M34A 5A0TA 1NV8A 3S99A 1ZKMA 2IODA 4HMQA 1OJ7A 3BJEA 1ORTA 1DOZA 4QPPA 4NV1A 3TTUA 2ZU0C 3D7NA 1G291 4F7WA 2QD5A 2JCSA 1CPYA 3WMFA 3C6MA 1QS0B 2YASA 2LE0A 4PWZA 2X2PA 2WYUA 1LSOA 4LTMA 4C76A 1OZHA 1A5SB 1C7FA 1K7EB 2PGJA 3DFUA 3VNSA 5CDYA 2F3QA 1H2HA 1VYTA 3G7NA 3MC1A 4IX9A 3VZRA 1II0A 4BNUA 1IBLB 2J4DA 3ZV7A 2IF0A 5KVSA 3BG5A 4CIBA 4K9QA 2BR4A 4AULA 1KU0A 2PUCA 2XUQA 1FDTA 3IESA 4EUKA 1U8XX 3CRNA 1G59A 2P9FA 3RFXA 4KMOA 1G16A 3TPFA 2L19A 1FSGA 2DFLA 1GNQA 2G72A 3BL6A 3LCMA 4GPEA 5TX7A 1C0PA 2BH9A 3ZDZB 4D0NA 5BP7A 2QG9A 1Z7GA 3GJTA 4LDQA 3CF2A 3CUYA 3GD7A 1RI1A 3BUSA 3GO4A 4MO9A 5JT1A 3HDGA 4CMCA 4Q00A 2MWMA 1XNHA 2OV6A 3N8HA 4LGVA 2GEJA 1WETA 3MJ4A 2ZT5A 3OIDA 1QV7A 4KSYA 5IJ0A 2X2EA 4LBWA 2EXXA 1XE3A 1AA9A 3SX0A 4WNAA 2TMDA 1YU9A 5LP6B 1AKYA 4OQPA 2XB4A 2HK8A 3A7EA 4OVKA 1I6KA 2C98A 2Z8YA 4HX2A 4KU4A 5CVTA 3PDIA 5C8DA 5KOHA 3R7WA 1J90A 1EGQA 4XFDA 1A4UA 3HKBB 3MT7A 1V7CA 4FFBB 4I46A 1OAOA 1JHUA 2RGEA 2ZYRA 3EULA 3KAQA 1DKPA 1JECA 1HZZC 4J0EA 4JJGA 4MV5A 4NZYA 2EFYA 4OSPA 4KHZA 3SCZA 3JXEA 1KEUA 3C41J 3J80A 1Y4DE 4GZLA 4YJ2A 2NACA 4IOJA 5HIAA 1S8OA 3DFMA 4P4GA 4XFKA 4WOCA 4DHEA 4TWZA 4UCQA 3WDKA 5KU7A 1M2NA 3T1HB 4D9FA 4DTCA 3PNKA 4GAEA 4MYHA 4YJHA 3VC1A 5A4AA 4H31A 4NBLA 5CXSA 2CEKA 5DNEA 1FPQA 2IZ7A 3ZDDA 2F9MA 1B8PA 1S2MA 1Y1QA 2GK7A 2Z6UA 3DBLB 3H11B 1N5LA 1IOWA 1PL7A 2W6PA 4JP2A 4K05A 2PZFA 3UK2A 1T3TA 3D6JA 4OB6A 4BBJA 1ESMA 3HKCB 4I1VA 4NF2A 5A4FS 5FTLA 3HKDB 3GJ7A 3U39A 5FWXB 4AY4A 4I9HA 1J99A 3U4DA 3FCSB 4M88A 1L0BA 3EH1A 1GTL1 2I87A 2Q8QA 4DZTA 3VUEA 1COZA 3TJRA 3E2PA 3WHKA 4WBNF 3I30X 4RK4A 3WGTA 4RY8A 3WKDA 3M83A 4TTQA 4B4VA 3S8YA 1PAUA 3UT0A 1MC1A 4IAOA 2VTVA 1NL3A 1P61B 3ANMA 4TMXA 1CUBA 3DAFA 1UPBA 2CSUA 1XZQA 3BZWA 1DV2A 3FGNA 4JQOA 4MVJH 3UN1A 3DOUA 4L73A 5DULA 4ZYTA 2HSDA 3PUKA 4J4HA 3QVLA 2K4MA 1TIPA 4BWFB 4G1FA 2B5WA 2O0KA 1L7VC 3NHPA 2Y4OA 2G67A 1C1XB 1E60A 3OURA 4NY1A 4WCFC 3WP1B 1CYEA 1KEKA 3GP8A 1CJUC 5LYJB 1ZNXA 1SVIA 4H7HA 2ZREA 2R85A 1Z75A 3PRHA 4ND5A 1JIJA 4ZQIA 1OXMA 4L0CA 3W78A 4IQ0A 1HKHA 2PZBA 3LP8A 3SX2A 1NW5A 1KARA 2F8MA 5KTTA 1ZK2A 3TI7A 3ZLJA 4XQGA 4PINA 3G5TA 3TLCA 1EFUA 1L5OA 4G5XA 3O03A 4B7XA 2IOHA 2VXOA 2OXEA 2HRDA 4TYPA 2R6AA 4F9EA 1DJMA 2QW8A 3UPUA 5FF9A 2ECKA 3RTGA 5FNVB 3EASA 5HUQA 1ZUNA 1LJUA 5E7MA 1EFKA 2F90A 3W7AA 5I51A 5JBIA 5IVIA 1KORA 2YHIA 3QI7A 3RIEA 3MLAA 4RULA 2N1BA 4ZQBA 3GARA 9ATCA 1TVMA 1DTWA 1KC3A 3M3PA 3TM4A 2XQVA 1WW2A 3W3AH 3SVLA 1BVHA 1UFKA 5C34B 3I4CA 3DMDA 3RTEA 4BUJA 1R6AA 5AI4A 5IBPA 1XTKA 3M81A 3I2KA 4X63A 5K20A 2Z9DA 4UEQA 4YJGB 5JZSA 4RJLA 1FY2A 5EG5A 3OJLA 1E6WA 1U98A 1QC5A 1XVIA 2AFIA 2ID9A 4NSNA 4Y2YA 5COBA 2OXCA 3VO1A 4B45A 3IL2A 2NLOA 1UIMA 1U3CA 5I01A 2PRZA 3OZTA 4ZJZA 3AZOA 1GJRA 3G0GA 1XTBA 2I99A 1KL7A 3PDWA 4WL0A 1A97A 1XELA 3SR0A 4DUPA 1EA5A 5FBWB 4GZMA 1UBGA 1ATIA 1T2EA 4WXEA 3V4SA 4WCVA 4CR8A 5A3RA 1Z3CA 1NLMA 5JD5A 4MB2A 2XQJA 3CCCA 1CQJB 1QVZA 4R84A 1G6HA 1HDRA 1L5SA 1D1TA 1VGVA 2P4HX 3HA3A 4L4XA 5CH8A 2YY5A 3K70D 3DM5A 1P29A 2G3YA 2JLBA 3B48A 3JD0A 3ZY6A 3L7MA 3AR4A 3JYLA 3PHGA 2CNDA 1T4CB 2BFAA 3V4ZA 4MVJA 1M5TA 1AQLA 1A9PA 4PRLA 3ZX5A 1Y8ZA 3H13A 2IKQA 3S1SA 3CZPA 2B8WA 1VG0B 4HNAA 1JPJA 1WMDA 4Y1RA 1T6ZA 3FJYA 3PJGA 3VDXA 1R7RA 3W1WA 3JPWA 5KTOA 4X62B 2Q0HA 1N32B 2ILTA 4EGFA 5ICSA 3GEPA 3PLRA 2O8FB 2G5GX 1JG6A 1GTZA 1QHIA 4OFBA 1CZRA 2JFUA 2RHBA 3ITNA 3M6UA 3VR0A 4DNPA 3X1MA 4HLCA 4ARBA 3MWYW 3H5LA 5JS8A 2ZDQA 1GCGA 1YQGA 4QULA 3SSMA 4D25A 3AFNA 2XUFA 1ILWA 1CVLA 1MPXA 4PC7A 1W4ZA 1YCFA 4TTPA 1ULZA 3WR5A 2J6HA 1G1AA 1OLXA 2Y6VA 1G17A 4RHCA 1SHLA 4K87A 1YASA 2PWBA 4PQFA 3SQDA 4EPXA 4F2PA 1GGJA 4W99A 1CUDA 1Q92A 1IRIA 2H63A 3L9XA 2BFEB 5EIEA 4ZKEA 5JH7B 4S2UA 1BGVA 4TLLB 1UT5A 2GAIA 1FCJA 1MA0A 3WZMA 5EKDA 1FX0A 3BSYA 4WN9A 3QFCA 3OJXA 3ONVA 4MP6A 5FIUA 4ER6A 2FN7A 3CZQA 3H2SA 4UBOA 4BVEA 4H6PA 5AVUA 2FFQA 2GDZA 3V4OA 1BSVA 3N2LA 2V65A 1MH1A 2HJVA 3ICQB 5JFTA 3KUXA 1P5RA 5KNDH 3D1JA 1TYBE 2HWYA 3R6TA 4FKBA 5DHQA 1AMNA 3NPMA 1KI7A 1MZVA 1FUIA 3RQSA 2VFAA 1M1NA 4QNMA 2UZ3A 1XF1A 4RU1A 4X66B 3S29A 3WDSA 1F17A 2X77A 5KTRA 3KD2A 3D3WB 3Q6MA 4AN4A 4XB2A 4WERA 3D4LA 2LDBA 4DSNA 1KOGA 1TKCA 4RHYA 3L8CA 1G8KA 1KQPA 2WVAA 3LXXA 3VX4A 4ABYA 3LY9A 4QEKA 8ATCA 2DLNA 2EIHA 3IQXA 3P26A 1U9JA 3GH3A 4QJ4A 1RE0A 4YEDA 3U7EB 2P79A 4X20A 2VDRB 4JQSA 5DPMA 2GR9A 1FJHA 4Z2AA 2IEGA 4QVIA 4CKBB 1IQRA 5G02A 3TAHA 2FU5C 1NHWA 4LYHA 2QYTA 1UK6A 5CT5A 2GPBA 1LLDA 3QUSA 2OCDA 1NW8A 4HMOA 4TGLA 4TLBA 3VKVA 5BMVF 4RL6A 5C1OA 4Q9KA 1U7WA 2J59A 1ONPA 1VPTA 2Q0SA 5I9MA 4IOKA 1Z06A 3HYSA 1FLAA 3STHA 5AVTA 4B6QA 4OG2A 1NPDA 3V1KA 1UZLA 2IHBA 2SICE 3FZEA 5CW2A 5G1OA 1IHPA 4JBGA 3UGTA 1BCSA 1QTIA 3BL5A 5FLEX 4G4GA 4YHBA 3DCIA 3IX7A 1TQ8A 1U3UA 5JJIA 1YQEA 2XWJI 3PFHA 3PX2A 4KYUA 2AG6A 2UXDB 1D8AA 1GUAA 1OZFA 2Z04A 4RK0A 4Z1OA 1P72A 1EUDA 4CKWA 3HMQA 1JIUA 3WRVA 4C2BA 4RSMA 2VSQA 4H4CA 3EZXA 4H3VA 2ZAGA 4CMIA 2PJRA 4PX9A 1DQYA 1I2BA 1F0YA 1Y0BA 4LQCA 5G0SA 2OD7A 4YCAA 2JBAA 5A4JA 4EL5A 2EF1A 1L1QA 1Q22A 2O3TA 2YRWA 1PSDA 5KEIA 1JQ5A 1JSXA 1KBZA 2QLLA 4YXFA 3N59A 4NXNB 4QYMA 2A3RA 3IR5A 5DI3A 3GT3A 4W9MC 2IZZA 2V97A 4UBJA 3RADC 1JR3A 4KDRA 1CUYA 2GD1O 3TOSA 2Q5JA 1ZCJA 1KETA 3JWGA 5HF9A 3SD7A 4DUZB 3BF8A 3L7KA 1SU8A 5EYPA 1JEQA 4CHTA 5AMXA 2QLBA 2E18A 4MI9A 5KJ6A 4RLFA 5FYQA 1AS3A 3OFKA 1CC1S 3IP5A 3P9IA 4XCQA 1LV7A 4BO3A 1PS0A 2ISCA 1KYVA 1GKKA 4YCJA 3QQPA 3T5AA 5H83A 1UQTA 1T5LA 4E2XA 1M9NA 1V1RA 2XEDA 4L4UA 4OGGA 5JCPA 1GNPA 4ARIA 1HLPA 2HBZA 3FKSA 3G2LA 4UBLA 1NX9A 4X85A 2DX7A 4RF5A 3RJZA 4EB3A 4I9UA 1GPNA 4AJLA 4B79A 3K09A 4L4YA 4GI2A 5LXTF 2XD4A 2FWIA 1K7YA 3E35A 3OA2A 1X77A 1XDDA 2Y1KA 2Q2NA 3GCWA 2O5RA 1QYWA 4PFSA 4UUQA 4X91A 1IL0A 2Y05A 1BWRA 4XLTA 1QG0A 3PGVA 3Q5GA 4JHLA 4KE8A 1GPDG 2FWAA 1NJSA 1K8ZB 2NUAA 3L1HA 5EE0A 1T9KA 3ZYZA 4BP3A 9MHTA 2QL7A 2CDAA 1TJ5A 4QQ8A 4ZVOA 2NSJA 2H92A 2AG0A 4C4SA 2WKQA 1NUUA 2B69A 5TT0A 3HO6A 4XWKA 4WZBE 4X5OA 1NASA 2QN3A 3DDSA 3S2EA 3T95A 2ANBA 1GNTA 3LX5A 4LXYA 5EJ7A 1N33B 1D5WA 3VDRA 5DT2A 5BORA 3BSWA 4MKZA 1Z6QA 2EL9A 2DUMA 1M54A 4U9IS 2FMTA 1X1RA 3P2YA 1UPCA 5LA6B 3ZJ4A 1F1JA 1VJGA 3PQ5A 3RU9A 3DJYA 1L4HA 4TUYF 5EXEA 5FPQA 4YB8A 3K73O 3RAJA 3F4LA 5KYUA 4H1TA 5EJ5A 2C82A 5GTDA 1HT2E 1FFXA 3FG9A 3KX2A 3NORA 3GY0A 1Y1RA 4UEKA 1ACLA 3OJ0A 3I1JA 3QOYA 3TM5A 3LUPA 5IJ9A 4GYJA 1SUFA 5E7JA 3LIPA 1D2GA 1SUWA 1X1DA 3LG2A 4DABA 4R6XA 2ECFA 5DCUA 3REOA 5A6SA 1LVHA 4HJXA 1DJQA 4LC9A 4EDFA 5LLDA 2E5FA 1G3QA 1U4OA 1ZH0A 2A0UA 1OXVA 1VE1A 2QVBA 2WEKA 3N5CA 3NIFB 4FKMA 4V3CA 3FVVA 4WACA 4ARUA 5LNK1 2IYAA 5K8IA 4FM9A 2VN8A 3RSHA 2Q5EA 3P45A 2QVCA 3DLTA 1BN7A 3OZSA 3CRZA 1IEXA 3TVDA 4B2YA 1E79A 3QOFA 2GLTA 2O57A 2ZEJA 2E1RA 1DIRA 2MMCA 4JJFA 4HUTA 2PYDA 3I6YA 1VKOA 2GASA 4JI5B 2F8TA 4FHGA 5ITWA 3GPDG 4PLYA 3MILA 1L4BA 3H8JA 3OT1B 4YUYA 4BFWA 3TKYA 1QCZA 3U4QA 1XGKA 1Y8QB 1XNJA 2PK3A 3QW4B 3KQYA 2OXIA 1UMCA 3BCHA 3LT0A 1IQUA 3OCCA 1DEKA 4BO5A 3O8QA 2IFTA 1F0NA 4PG8A 1OF1A 3WKEA 2ADMA 3VAYA 3GT7A 3QX8A 1NSTA 3D8BA 4Q9DA 5C8VA 1U65A 3IT2A 2E87A 4KITB 4DS3A 1OFGA 1H8ED 1WQ1R 3ILHA 3OOWA 1VLVA 4N12A 1DCKA 4ROSA 5KSPA 1N2JA 3DWGA 6GPBA 1ISJA 4CIAA 2JLYA 3EGEA 2GGSA 3U3OA 1WA5A 4L6AA 3T9AA 4CVNA 3H0CA 3TRJA 2CLEB 4B85A 3CF4A 3D2AA 1WUKS 3KEOA 3HO1A 5EINA 2XQFA 1EUZA 1U2PA 2AK3A 1B1CA 1OXSC 2BGKA 3F96A 3HCPA 3RT1A 3WXBA 4URWR 1H9AA 3ZYCA 1FTGA 1XEFA 3DPSA 5F12A 3D0OA 4D74A 2V3CC 4F86A 4MB0A 2H48A 4MRVA 1VCHA 4P7KA 4W6ZA 3DKVA 2FV8A 5TQ0A 4EJSA 5AKIA 4EABA 1H69A 1L5FA 3ISVA 3CRMA 1KK2A 3DUWA 2DKFA 1E61A 1OZAA 2ZE8A 1HNNA 1PQYA 1Z3IX 4EKGA 4XWWA 2P0YA 2GXUA 5AHXA 4OAPA 1QFJA 1WJGA 4GF5A 1U8EA 1QYDA 5JZBA 5CIYA 2V0NA 4YRDA 4OAQA 3P4XA 2KE5A 4UD6A 5F64A 5FNZA 2IWHA 2R87A 3GLGB 5E9JA 4E7OA 2FEWB 3JZFA 3PUIA 4NABA 4UE2A 4X94A 4YPVA 5G0VA 2EWVA 2JLXA 2GEKA 2KBFA 1P2UA 2H06A 4QPDA 3CY6A 3D6AA 5DX0A 2F43B 4CQMD 2Q2VA 5BPHA 3IBGA 4EYGA 5C3MA 2ZBFA 4LGYA 4P35A 4IG9A 1NFFA 3IB6A 2D1FA 3RUPA 4HADA 3TRKA 1V1MB 3CKKA 1ONBA 1FFEA 3OF2A 3RSGA 1DFIA 2OCGA 4I3FA 1N3LA 3WHLA 5FQOA 4HF7A 3R9IA 2LDXA 2AFHA 4AY6A 4K9NA 2R4QA 4M9RA 3M33A 3DSRA 3Q3VA 3PJRA 3OKFA 4ZP1A 1EBBA 2AOTB 3EVGA 5REQA 4E33A 1CWUA 3K35A 3ZDYB 3GW8A 2DTDA 4FHDA 4G1VA 3S1AA 4FHFA 4C29A 2Q2OA 4P6VF 2NQTA 2VRCD 1JA1A 1MV5A 1PYDA 2X14A 5KYYB 3LS2A 4AMVA 2ORWA 1OOEA 1J8VA 1NATA 2D2FA 3A6DA 3BGOS 3ETEA 4R98A 4TMKA 5BN4A 1WZCA 5F2OA 3QKWA 1BE0A 2MT9A 2ZM6B 1D04A 4NWIA 3IVGA 5TY0A 3V55A 4D8XA 2NT4A 5JH7A 1OGIA 3QMWA 5LNK6 1KMIY 2XCUA 3DL0A 1MB3A 2X8JA 4QXQA 4KAFA 2ZSUA 4I50B 3NX4A 1E2GA 3DDWA 3W3ZB 3WNVA 3OKPA 1LBIA 1QXSA 3E5HA 4L0MA 3L4BC 1XQ1A 2XWSA 3BB1A 3NVMB 4BLPA 1SIOA 1BJTA 4DV4B 5KJCA 5E9QA 1HEIA 5G3YA 1KQOA 1WKBA 1Y7IA 2CYCA 2R7LA 3COSA 3OPYI 4DV2B 4D98A 4YT5A 2C9MA 1GQRA 1XXHA 2WFLA 3A2LA 3OPYB 3DDNA 4TQAA 5AKKA 3PFBA 1A4RA 1XCMA 1VMAA 5MHTA 2R6JA 1BS9A 1NR5A 2WZQA 2YHUA 3R7SA 4I4NA 5CXXA 2A88A 3KQVA 2YJ6A 4MLZA 1TM7E 1ZGAA 3D3WA 3W04A 4UU8A 3NH6A 5E0OA 3TTYA 3NTXA 4BO0A 5DHUA 3W05A 3MW8A 1KS2A 3OESA 1EG2A 1SGWA 4RS3A 5SZHB 2ASVA 4MPJA 4UFNA 4QUEA 4YASA 4HYTA 2H8KA 1J0AA 3IP8A 5JARA 2DOKA 1VTKA 2EZTA 2GUGA 3OX1A 2HCBA 4LYJA 1T1SA 4QQFA 4N7JA 2PXCA 3QGMA 3W6UA 4LSWA 1FDRA 3VR5D 4P80A 4HJRA 1MHPA 2OHHA 1KK3A 1VXOA 4E6PA 2E2WA 1KC1A 5AKLA 4YJ3A 2V7BA 4IQ8A 4MVXA 1IAQA 4I55F 1WX1A 2WUWE 2X3UA 2BRUC 4HEHA 1VYVA 2XX3A 3MAAC 4AQ7A 2NADA 3HP4A 3THYA 1ADCA 1KY4A 2PS1A 1I01A 4EQ6A 3LZCA 1I7NA 5CT4A 3B2NA 3BWXA 2H1VA 3IAFA 3OEED 1GZUA 4P3YA 2W83A 4DZRA 5EZSA 1EK0A 2PU5A 3M34A 4F72A 2YYAA 1Y7PA 3RIGA 1TM4E 5ECYA 4BGVA 2GF2A 1T5DX 4M0UA 3V9PA 3H5AA 4GMFA 1L7OA 1SZCA 2JIDA 3ZWVA 3IE1A 2AJBA 3WL4A 3OTOB 3ZVKA 4P0TA 4BMNA 3T06B 2JI6A 2YJ5A 3F98A 2Z5VA 1J23A 3FYUA 1ABFA 3ND9A 2P4UA 4C4ZA 4MW1A 5EWLA 3SHVA 1DGQA 3LV8A 2AIRA 4D9KA 3FPAA 2QQGA 2FEXA 2WNIA 4O4HA 1CTQA 4NBNA 1V8PA 5DXFA 1WXHA 2O8VA 2YWJA 2V0CA 3SBOA 2R7NA 4TXHA 5B1IA 4ESEA 2Q4OA 1NN5A 3GFRA 4DEVA 3LVRE 1HUQA 4QUKA 3ZGZA 4ALJA 5KTKA 3RLIA 4BFZA 5YASA 1NYRA 4WLVA 4EKNB 3PI6A 3D4BA 4G0OA 4ENUA 1I4LD 1N5IA 3LOUA 4KUGA 1E1RD 3KKQA 3A1UA 1YRLA 1OTXA 4MUEA 1NY6A 4K46A 4O4LA 2BR5A 3RDPA 1ZN8A 2ODNA 1T6YA 2JHGA 2ZANA 3EGDA 4WA7A 1B93A 3Q11A 1EVJA 4Y0VA 5JSYA 3SBXA 4AP5A 5CNMA 3BMOB 5AWFC 2VF2A 3FMGA 2XUIA 1IRXA 1J09A 3TNYA 5AW1A 2CT8A 1X39A 3COYA 1FSSA 3DLCA 1E3DA 1E3EA 1Q95A 2IUTA 2Y92A 1SUDA 4E94A 3BWDD 3HCOA 4MUBA 3MCWA 4ZIRA 3H1TA 1W52X 4MUGA 7MHTA 1E2FA 3PR1A 1WM1A 5EOVA 1F2TA 1UBSB 2GHRA 4E0BA 1E2LA 4J1TC 3C39A 5AXBA 3ZGXA 4PXSA 4CODB 3FSJX 1I4EB 1NDUA 1QQ6A 2IEAA 2RGYA 4RE6A 1J5EB 4L8WB 1ISMA 1WZEA 3BIJA 3SF8A 4EFKA 1KYXA 4OU4A 4AX8A 1ZC4A 3HGTA 5L40A 5DM2A 3QLVC 3LO8A 4HNHA 4MVJP 1HLDA 1U8TA 1H2FA 2BI7A 2HT6A 4Q3OA 4TKUB 5E3IA 3ZJUA 1NVKA 1UJ5A 5BVHB 5KREA 4MP3A 4YLGA 2XQIA 3TXAA 5B7NA 4AFNA 1N4DA 1FMLA 3IVMA 2VJLA 5IWAB 2CLHB 2R751 3OLCX 1IN7A 1V3UA 4JMPA 4LY6A 3CSUA 5ESDA 3EMKA 4AMYA 1KO5A 1DAHA 4FFVA 1PZMA 4QWMA 3C5EA 4DN6A 1Y8RB 3LDGA 3VFDA 5ALKA 5K0EA 1U3VA 2FZ4A 2YZNA 2WZBA 1YHNA 1ZVJA 3CKLA 3K1AA 4OSEA 3ROPA 3KUUA 3AKDA 2JCBA 4LSGA 3O82A 2CVOA 1Y81A 4FNGA 2MDTA 4I1IA 4KN9S 4X9XA 5J47A 5G4KB 3VM6A 1KF0A 2AQIA 3EOZA 4IX1A 4ZU3A 4BV8A 3WFZA 2PBRA 1ND6A 3PXUA 4HFNA 3UUGA 5IUJC 1V6SA 1YNOA 3CZRA 4F0JA 2ZYUX 3JX9A 1TYZA 2IOQA 2VPPA 3N3AC 1QHXA 4O2BA 2XCTB 4XM0A 3WBBA 3D2BA 1MRZA 3LGXA 3REQB 4A4DA 4BQQA 4D82A 3VOTA 2QPLA 2F8SA 1GNSA 5P8WA 3GVXA 5F23A 1W5SA 3M6MD 4OJYA 1GG2A 1FJ2A 3BBLA 3AUFA 3JATB 4BASA 2XZLA 3BKWA 1BKDR 4KXMA 2P5SA 2DVMA 4L5YA 4MUMA 1L5ZA 4ZI3A 1QP8A 5DISB 3WL5A 2OYSA 1Z4NA 4RIHA 4KOEC 3ESZA 5CLIA 3M6FA 4XSGA 4JFRA 4ARAA 2GTIA 2ZUVA 3PTAA 4LTDA 1Z15A 5B7PA 3CLRD 3F74A 3Q3EA 3X1KA 2BHNA 4QRHA 5JQWA 4CJXA 3AUKA 1T4DA 2QJWA 1TF2A 4XH9B 3EARA 3F1KA 1WEKA 1GPBA 4C0LA 5EEGA 4LKOA 2BMAA 1XMOB 5JSQA 3IT3A 4N5DA 4O4JA 2MINA 2AOTA 2OVFA 4FMPA 4PR3A 1EFRA 5REQB 3ZXUB 1L5KA 3H86A 2YQ5A 3VNRA 1WV0A 2WP8J 4EW2A 3UGKA 3OZCA 2XVZA 2H52A 1WXFA 3N53A 5EJFA 1IZ8A 4AT1A 4BGIA 5IT9A 4B46A 2NZUG 1FP4B 2J1LA 4QD3A 5CVVA 1T5IA 1KEWA 3QFHA 4DJFC 2LBPA 3OCYA 2QPTA 3TEJA 4FCCA 1T13A 3FGZA 2ZETA 3LPCA 3O93A 1XK6A 3UXEA 2G07A 2J4FA 3GLVA 2GUWA 2YJTD 2VZ0A 3DNMA 4A6PA 4CMKA 3PEEA 1RRFA 1PNOA 4MYSA 1I6MA 1N6OA 1VXRA 1ECBA 3A3KA 1G55A 3EDRA 1N77A 3TVYA 3ZZ0A 4LDPA 4V0OA 5AW9A 3VYUB 4B8WA 1RXWA 1G2IA 1E0DA 2WM2A 4ON9A 3ZCTA 3O6VA 5LQDA 4LVCA 1I9GA 1W1UA 3JYQA 4XYGA 2I2CA 2FPGB 4GOND 4DIOA 3C5WP 3JQFA 3QE9Y 4DT1A 4ZTUB 1IIRA 3PWZA 1TXGA 1XTUA 3GYBA 4NNJA 4GFDA 1UBHS 1Z35A 1JJ7A 2A5GA 4EWLA 4YRSA 1U4SA 1C7RA 4P4UA 5KKAA 4JX8A 3RE1A 4BAUA 4ZDIA 1P62B 5KNBA 3M6LA 4FNAA 1E9SA 4Y3UA 1U2QA 4J3JA 1Z2DA 1W2HA 2G1KA 1O94C 4YJ3F 3IOBA 2OP0A 1BNCA 4QO7A 3UWSA 1PJ3A 2NVUB 5BOVA 4Q7QA 5LDHA 1CDEA 4EG3A 4JBNA 2QZZA 3Q1KA 5C1PA 3ETGA 2Z9CA 3CIOA 1B42A 3VNVA 8MHTA 3Q3IA 1UFQA 1CFJA 2XUJA 4B3MB 1NI5A 1NU6A 4YTEA 5C53B 1YA6A 5GZ3A 4CEJB 1L2TA 1QOPB 2CCGA 4FYXA 4TTRA 1GG8A 1NNLA 3ETDA 3I92A 3OPNA 3S1AB 3AERA 2YY7A 3JQGA 3VYWA 4W5TA 3BHNA 2QTCA 1MFPA 3ASVA 1D7AA 4EI2A 4IHJF 1ZJZA 1U0RA 3ZW8A 1NR1A 3AIMA 1NJ1A 1NAIA 4O1IA 3T0IA 5HIMA 1PHRA 4DR2B 1RDFA 2DP4E 3PVSA 4FFPA 5I4KA 5CFLA 4TYQA 4UOZA 3WG9A 4K7JA 4QDOA 1J42A 3D4PA 2HHHB 2SECE 1FMJA 4OQ4A 4HRVA 2I3ZA 1E3WB 1W4RA 4BB0A 4FU0A 4FC6A 4OMCA 1GFWA 2QIOA 1NVMB 4U00A 5FUMA 1CJBA 1JZQA 2NO7A 4MV8A 2IH4A 1H4VB 1LQUA 1LZKA 2DFKB 1AK1A 2C00A 2Y1CA 2QL9A 2ZSIA 3R1IA 4LW8A 3PP8A 2HJGA 3CUEF 1OXKB 3UF0A 4W8GA 3FROA 1CZLA 3IULA 1BDIA 5E0KB 3QKIA 1P1JA 4LRUA 3FAZA 2W71A 5ADHA 4PPQA 1L9XA 2C2KA 1A76A 1II8B 2CMKA 3RRXA 1AO0A 2BTQB 1YZGA 3CX6A 2NO5A 3DHNA 2AE1A 1EB8A 2OD9A 5KOJB 2H18A 3HUFA 4ITRC 1E66A 1JTVA 3FCAA 1MC5A 4MKHA 3H9QA 4RH1A 5CPFA 5FRDA 1KJ8A 1KZ4A 1LNZA 2XDWA 3KKLA 3WV4A 3PT5A 5BR8B 4DW8A 3BQ9A 4EJ6A 3RVRA 3A6EA 2QL5A 1YGYA 3H83A 1X9GA 2QTVB 1DX9A 4KQCA 4RABA 4WJKB 4WUTA 1KJJA 2D8AA 1VMDA 2DKNA 4GX0A 4HNQA 3L6DA 1QJ4A 3DTVA 1KNXA 1DADA 5F3RA 2ZU6A 2AJ8A 2CUZA 4PHFA 3D0KA 3B1WA 3KFVA 5TB5A 1B3BA 2R96A 1RHRA 4UHDA 4ZO8A 4ETWA 1KGSA 2I54A 1BCRA 4DQLA 3W2IA 1TUGA 4Q1EA 3EGIA 1NRWA 1G5QA 1E7WA 2EG5A 1U8UA 2VL7A 2WBLC 3AILA 5M29A 1ZZGA 2QUZA 4Q3AA 1QORA 4X3OA 2ZJ0A 5FOUA 3RFFA 4Y0AA 4JKOA 2OM2A 3D6MA 1RM5A 1ZCFA 2VCYA 2ZYSA 4ZALA 4IF4A 1TK9A 2EJTA 2QZ4A 2GPYA 3ICVA 3N2IA 1U1GA 4YFYA 1NOIA 2OFOA 2VP4A 3NFRA 2BELA 2MSCB 2QM3A 2GF0A 3AP3A 4Z4GA 3RK4A 1KI6B 3VKFA 3E2MA 2D62A 4RA9A 2H9IA 1RYBA 3E8SA 1A8SA 3G89A 3OLWA 4HDCA 1J5PA 4LNAA 3L0CA 5I7SA 1P91A 4CLRA 1AIPA 3RSLA 1W581 3K4HA 4E6EA 3T1YB 5EZQA 1L5QA 3FOCA 4IVNA 1VL0A 1E2NA 1IOVA 1RYNA 3ABOB 3FX2A 4IDHA 5JY6A 1CR2A 4DREA 4MWSA 1I33A 4BDTA 4DDWA 5BWNA 7ABPA 2PFSA 1KY2A 2V6FA 3EGDB 5CB4A 3NW9A 3I6ZA 2ROQA 4ZVNA 2I2XB 3CKMA 4PTZA 4QUAA 2WKWA 1ZRNA 4WKOA 5EJ4A 4ZDKA 2HRBA 4CT4B 3MRSA 1IPFA 2H08A 2F62A 4NCIA 5BR7A 3ITKA 4YX9A 4W9NC 4WASA 5KX5F 2GEBA 4FT2A 4RTOA 2J6BA 2JFFA 1FUUA 1ABEA 3O1IC 3GNQA 6REQB 5HRCA 2HDOA 2WWRA 3HGMA 1VRWA 1ODFA 2F2TA 5G41A 2BGTA 5BN5B 1LBTA 1PJLA 2J3DA 1B2LA 2Q46A 1C0LA 3B1KA 3QE2A 4OY3A 4R0NA 4UHBA 2B98A 4X00A 5CVJA 3KL2A 3K0SA 1QQTA 3KXIA 2VDWB 3KOWA 4B6FA 2UZ4A 2IXFA 4M1MA 2AYZA 1EK6A 1ULTA 1QE0A 2VNSA 2GF9A 4O4IF 2O4CA 1DKRA 3SYTA 4A8JA 2XMSA 3CU5A 3L02A 3LKBA 2NUPA 3LPDA 2B82A 1KEEA 2IHKA 1MF7A 2HL6A 1RQ7A 4DR5B 5DRTA 3TBHA 4E5PA 1ECJA 1A8UA 1B15A 1QK5A 1U0NA 2E21A 2NSYA 2Q5LA 3PI7A 4LY0A 5DSXA 5EZYA 4BLSA 1UPTA 1KGDA 4TM8A 5EUQB 1OBHA 5AJYA 2EKLA 5IFLA 4D4JA 3SHTA 1LEHA 2EAUA 1PLJA 1Z8NA 3QY9A 1NE7A 5CK5A 5C4MA 1FJXA 1J8YF 1I3MA 1EFDN 1GAJA 1G18A 4HLDA 2QNBA 3QVWA 2UYQA 1Y7HA 2C07A 2HF2A 4LYYA 4QGHA 1M8PA 4RKRA 3GRZA 4C4YA 3H1PA 1IXSB 1AS0A 4JD5A 4DV0B 1ZI6A 4WKNA 3UKJA 3CLUD 3GEMA 2JIMA 1QIIA 3N86A 1Z39A 1GGMA 2B7BA 4JITA 4KZKA 3J81k 2ALJA 3HYTA 2IVFA 4F12A 2ST1A 3AIKA 2X19A 1EWVA 2D7CA 1LTHR 2JEYA 2X3YA 3V7UA 3VR4H 4DWVA 2DQKA 5K1ZA 3GJSA 4UHHA 5IAOA 1H3NA 2GESA 1YR1A 3DMGA 2VZ8A 3K6KA 4XB6B 5ALQA 3RUAA 3T3MB 2V8BA 3AC0A 2Q3CA 2J0EA 5EHQA 1P2BA 4RD6A 2BDTA 2HF7A 3ANLA 4LK2A 3UAWA 4BO8A 4E32A 1F9AA 4GR4A 4XGIA 4BXOA 2LIPA 1GEGA 3UWOA 1XIVA 4R1QA 3MFYA 1ZY2A 5JYCA 1T4GA 1PVVA 2JJ2A 2OZPA 1ODLA 3IQHX 4HQRA 3V8MA 3RVSA 4ER0A 3SZLA 3WS7A 4K6GA 3S70A 2LCQA 5DHFA 1O8CA 3D3EA 3DQQA 5HMLA 4H6WA 5EIFA 1CJKC 1FYWA 3TX6A 3W9YA 2AZTA 3AVVA 5CVUA 3BFVA 4M0MA 2R6CA 2VDKB 3DXFA 3FUVA 3GVCA 4EY3A 1G1MA 1ZA1A 1R0ZA 3PNVA 4ICIA 4UD2A 3M82A 4YAKA 1O03A 3IDZA 1I4DD 2VPIA 2QR2A 3CNQS 1KI9A 2OC4A 2XXAB 4L4SA 2SBTA 4N03A 1YTLA 1T15A 4L9RA 3MD9A 4MIEA 1JW9B 2ZUEA 5JE8A 1IWBB 3GMIA 3IMCA 1XPUA 2QZSA 4UUNA 3IJEB 3CR3C 4W63A 1EVZA 1O95D 1QB7A 2XGOA 3T5BA 1RWNA 1XZNA 2HCFA 1YUMA 4YALA 5E9WA 4EECA 2AKYA 2OCYC 4IJWA 5FBHA 2ZWVA 4YUVA 3EDOA 2X4IA 1UK9A 4TLAA 3ICEA 3LBNA 2EFJA 1GGNA 2PM8A 1DP4A 4QT0A 3E9DA 4RD4A 3FYDA 3FNBA 1YL5A 5JALA 1SQFA 1A72A 5FPHA 3ULKA 4DLXA 1QIMA 1Y5IA 4GOLD 4EVRA 3CVUA 1CRZA 4G37A 1SCQA 3B9PA 5T8KC 4OHWA 5D7BA 4ZK2A 1YUBA 4LMBA 1FC0A 1JSRA 4QBHA 1NRXA 4CLDA 2OHJA 1H2ZA 2JF0A 2OHFA 2RMKA 3PD0A 2VYVD 4AZ0A 2B3DA 1JBQA 1HFEL 1FS4A 2MMGA 2VDOB 2JVJA 1PN3A 3TD2A 4FGZA 3PHHA 3EQ9A 2R79A 2ID4A 5CB4F 5KNCA 2IITA 3ML1A 1P18A 1R5NA 1X74A 2WV9A 4CDNA 3EZNA 2ZYIA 3L8YA 3X1WA 4ZHQB 2EEPA 2C5GA 1LRLA 1U2TA 3OCXA 1E1KA 4RDHA 5EHGA 3PQ2A 2BPOA 2YZMA 2JVIA 1ZW1A 3C7AA 3DMTC 4C4OA 1IXYA 1NUAA 2ZUSA 5E4FA 1TZMA 5BUCA 4GC5A 4P0PB 3IUEA 3IERA 5F2EA 4C22A 2PUDA 4HQOA 4BLTA 4ZZ3A 4PVCA 2QQ0A 4J1SA 3EWSA 1PKEA 3NP7A 4PFKA 2I7VA 5IUNC 1UBNA 2PZAA 1GPUA 1GUZA 5FWYA 5L7WA 1TM1E 4Z3OA 4DCSA 3KXPA 4IDAA 2EYUA 3O8DA 1M0TA 3FIJA 3R4VA 2BGNA 5CB6A 3OX2A 4XQEA 1WBDA 4BQNA 1LLQA 1TJYA 4ZVSA 3OQNA 2C88A 3B9BA 1Q7RA 3PICA 2R1VA 3CLTC 3CZ4A 4ARZA 4TT3A 2VNIA 3KNZA 1E8NA 3JQGB 1C5KA 1XZKA 3GG2A 4UAUA 2JFZA 4YRFA 3TRFA 1NF3A 3JWJA 4BFCA 3RC9A 3AUJB 4WY8A 3OOJA 3G6KA 1G4UR 5KBYA 3UKDA 1QAQA 1P7WA 3INTA 4BYMA 3Q2OA 1I3NA 4QLOA 3IPRA 3V33A 5EE9A 3ZGYA 2BM9A 1WB9A 2I4IA 1RZRA 2RAVA 4MNTA 1LB1B 1SCUB 3RC3A 1O95C 5A2GA 2W6MA 3WE7A 3PIDA 4Q4AA 4Z8YA 5AXCA 4DBVO 2CW5A 2KQUA 3NHLA 3DV0A 1T8WA 5BW4A 5LQNA 3LUDA 1VJ1A 3OKCA 4PSUA 1EX7A 1ZGBA 2C1ZA 1SG0A 1TVKA 4XD2A 1L3BA 3VR3D 1KYTA 1LFDB 3WLKX 4CG3A 2RJ3A 4LC0A 1KDTA 2MIIA 1I2MA 2ZCVA 3EAGA 3WRXA 3TTXA 1D8TA 4LPSA 2DBZA 3NAQA 1P5HA 1S7CA 3TQOA 5CB0A 3E7WA 1VL1A 1J9GA 2VF7A 4DZZA 1C2TA 1FUEA 5JASA 1MOSA 1CHNA 4D46A 1IEWA 3KQTA 4RETA 4KDEA 3EDCA 2NIPA 4UE3S 2BEVB 1I7SB 3IODA 3KETA 3PGLA 4IIJF 1U0LA 3ORHA 4F5YA 1U90A 1OB5A 1G8YA 1MN6A 2KS6A 4L5IA 4JVMA 1OFUX 1JQ3A 1ZM4A 3OBBA 1TZ2A 1BXRB 1XN4A 2A57A 1N8SA 2DUNA 3MB8A 2PFGA 1ZXLA 4LXHA 4YJFB 4ZAZA 5HCUA 3GUYA 3KQSA 1FU8A 2HXGA 3IIIA 3QF7A 5JAQA 4Q9HA 3VU9A 2DHCA 4TSFA 2WUEA 3KTDA 4B3CA 4Y67A 1GY8A 3IJPA 4EKYA 3VZCA 4JNCA 4EIWA 2UUOA 1ZA2A 3MCZA 1MAUA 4JEMA 3RC7A 3LQFA 4LIPD 5B3LA 5JDIC 2JJ8A 3MWEA 2W6JD 1XTSA 4J1TA 2FG7C 3B5JA 1GSIA 2AJCA 2FE1A 2M1XA 1GILA 5EIOA 5JXHA 2J08A 4MYCA 3AQIA 3GWGA 3VR4A 4M55A 3N1UA 3OPQA 2GARA 2OG2A 2QRLA 4ZCRA 1N6NA 2D3TA 3BXZA 4W7HA 2B34A 4ER5A 1KS9A 1JHVA 1W2GA 3B1XA 1AT1A 3KQMA 3KWJA 5ANRB 1LQ2A 2YJGA 2VF4X 3Q8LA 5H68A 2I2FA 4BQIA 4GPTA 2NO6A 2V7UA 3NNDA 5I8WA 3DOHA 1OB2A 2UYYA 3SZMA 3G8YA 5CFRA 2W00A 1YS7A 4LZWA 3CJRA 3LF2A 3NTOA 5IRCD 3HXKA 1PVOA 3TLJA 5AJZA 3UHFA 1KDOA 2A0FA 3FNFA 4U7GA 1RC1A 2IPXA 3GVHA 3E6AA 1DIOB 2Q5CA 3HVIA 1SBHA 2NWQA 5CVEA 1PWHA 3GJZA 3ZVMA 1FNSA 2C2OA 1E3LA 4L74A 5I7AA 1XAHA 4YAFA 2Q6IA 4CI0B 2NPFA 1Z2AA 2YW2A 4HQ6A 4AZWA 1YZYA 2V6JA 3H9UA 1BQEA 4OLJA 2IEYA 2VYFA 1NYLA 1L8OA 2NYRA 2Z2ZA 1WNFA 2Z8YM 2XF2A 1M6VA 3S2YA 1E4EA 3BK7A 5COQA 6REQA 1ORDA 1DPFA 4GGPA 1E3JA 1P7YA 4L57A 2GBCA 4Z99A 3PYMA 5IM5A 1PZEA 4Z0PA 3OVMA 4DC9A 2Z8XA 2AG1A 2I1WA 3IAM1 4LF6B 2P0EA 1JEQB 3TZHA 3ZDFA 1S4MA 4RTQA 4IDGA 4O63O 4CL2A 3K6RA 5CHYA 3FHLA 3TBFA 1OW3B 3SIXA 4ERNA 2IYFA 2R7KA 4MMZB 4Z7JA 1JDJA 2ZBQA 1JA9A 1UXGA 1XQVA 1ZIDA 2I71A 4H7JA 2FEPA 4DQVA 5L3QA 1UWKA 1SU7A 5C0OE 5EE3A 4EHHA 3HR4A 3PYLA 1JMVA 1G8AA 4M1YA 4F1JA 1Z16A 2BRUA 3PDCA 3QI2A 3A4YA 1DEXA 4XX1A 4B8ZA 3T0GA 4BFXA 3GF4A 1A5BB 1BN6A 2MYTA 2IXBA 2WLSA 4HDKA 2C54A 5K2MA 1G7RA 3BTOA 3VTFA 3BAFA 4AICA 1PDWA 1X2EA 2C77A 3L06A 1WU8A 2IX3A 5CURA 2AMYA 3UH0A 4AB1A 3CCBA 4BE9A 2BBSA 5BOSB 3CLSD 2XUGA 3HSKA 1KDYA 2GEDA 4HZGA 5JZMA 1WDTA 4BL5A 3N8DA 4NE9A 3L0DA 4OLFA 1F4PA 1TD1A 2XDAA 3EDYA 1LGYA 2IE0A 4PG7A 1HWYA 3CEAA 2VI5A 3LHFA 4I4IA 4Y1FA 5FBZA 4B40A 3GPIA 2QX9A 3KT3A 1TU3A 4X8MA 3Q4GA 3ONFA 1KRHA 3ZLVA 4D4LA 3HHEA 3PTZA 4JMLA 3PDJA 3D4NA 5B58T 1Z7BA 1AUOA 2J4CA 3GRUA 2P9EA 4PBRA 3FCCA 2FJPA 4KTVE 5B3KA 5LA6A 2QQ5A 4I9NA 1PTJC 4P81A 5AXAA 2KM1A 3ND6A 1KJYA 1SBQA 1MX1A 3NEYA 4X6XA 3CRRA 2QU8A 1XPJA 2A92A 2Y6UA 4JSRA 1JNXX 2O0MA 1NOKA 2AOVA 4WFKA 4PXYA 1I94B 3WSVA 1XKXA 5K3BA 5TLSA 2RKBA 4E3WA 1YO6A 1Y6QA 4LY3A 4XFJA 1ZXBA 2XE7A 5J9FA 4HEA1 2RHWA 1L7PA 3MTAA 1DIHA 4BYGA 3FPBA 3MTJA 1Y63A 3U7HB 1SJ9A 1P75A 1TAUA 3I6BA 2XCIA 3OOSA 2VJAA 1PX0A 1YE3A 2ZTUA 4GYWA 1YQDA 3OZEA 1Z08A 1L7XA 4WKCA 1XFAA 3H75A 3D6NB 2HNAA 1AA6A 2FR8A 3FE2A 4HBGA 3G2PA 1E92A 4DKJA 4IZOA 1RAGA 2WT8A 5DT9A 5A0FA 4ES6A 5FUQA 2ZWMA 2FZLA 1UKBA 2NSDA 3MJRA 4AO6A 1X8XA 4GLJA 1R0LA 2V6BA 4Q4HB 4LXGA 3IUJA 4CYMA 3R0IA 2F1OA 4R0VA 4Y30A 4PC3A 4C5CA 1WSWA 2M98A 3D8NA 4JQZA 3SG0A 2YN0A 5KO2A 4WZZA 4MRMB 1I6LA 4EA9A 3T3GA 4R01A 1JEYB 3A7DA 3RVLA 3NYQA 4E07A 1AURA 1E94E 1OV4A 4JC8A 1TT5A 1K6XA 2YDYA 2WB2A 4BMPB 2QTNA 5J1SB 2OCAA 5ALYA 2DWPA 3MWLA 3VO2A 1H66A 4ZJPA 5HKAA 4KW7A 2E7ZA 1NXXA 1Z2PX 2JFOA 1K6EA 3GFSA 2WJYA 3HJTA 2B2XA 3SNHA 1TYAE 2PH1A 2WTBA 2M32A 2AC7A 2Q7OE 3OIFA 5DLYA 1V9LA 5CD1A 2YIVX 1QIHA 3ZXYA 4I14A 1QVVA 1NXTA 1QO0D 4JI0B 3I34X 4RIGA 1XU9A 4J91A 3T7EA 3WIUA 4DMLA 1L4YA 4BO7A 1KIMA 2OOSA 4G3XA 4V0QA 5ED4A 1HYGA 3K0FA 4KFUA 1Y4ZA 3MS2A 1CEXA 1U6JA 4IGEA 1Y1SA 1PZNA 1E9AA 1R6UA 3RM3A 2XOKD 5J2UF 3PIIA 3DQPA 1X15A 3U16A 2AOUA 5ENZA 5CFZA 2HA4A 1QKKA 1N8KA 3OJEA 2XBMA 1HBJA 1PR9A 4XVRA 1YMQA 2PT9A 1SWVA 4ZDWA 3U44B 1ZCZA 1YONA 2EX4A 4J0GA 2QV7A 5JMPA 3FBWA 2JLSA 3PTLA 5DP2A 4CQMA 1C3LA 1CHDA 3FR8A 5ISMA 3P2IA 3EPKA 4O33A 5DNAA 4MROA 1XTZA 1LNSA 2ATIA 3QELA 4GS5A 2Q3JA 4MUNA 2DPGA 4Z53A 4G5QA 1QIGA 2BE7A 1F5NA 3KT6A 3LXMA 3URMA 4PLCA 3WZLA 1PGQA 2IHJA 3RW9A 1GQOA 3QJGA 4CM6A 4ZVLA 2XDQB 3VI3B 4U6NA 2SKDA 1AHPA 4WZ6A 3KJGA 4LX0A 3VVLA 1IMJA 3STTA 4XEHA 1F8UA 3HYLA 4C04A 4DMMA 1NVFA 1PBTA 1LSUA 2A0YA 3IMFA 5GONF 2XV1A 3QLUC 4FWTA 1HZJA 3ETHA 1YKGA 3JQDA 3S5JA 2WG0A 1O6BA 3OG9A 3U81A 4D1YA 4EPWA 2XSZA 3KYCB 5JU6A 2QG4A 2XMPA 5BYJA 3R23A 4RVGA 3QBEA 3RREA 3AF6A 1HDZA 2ABWA 3V9AA 2G4VA 5I8PA 1NKVA 2XLBA 4Y98A 1LRJA 5AESA 2O54A 4P98A 4DADA 4QQKA 2YV1A 1P7ZA 3SS8A 3UJBA 1V1MA 1F4LA 2NP7A 5HP4A 3A6ZA 3CRQA 4K9PA 3DDCA 3F73A 3PX7A 1F6WA 1OI3A 3CZAA 1U0EA 4YRIA 3L0OA 1XV5A 2O8DA 3JD4A 1Z6PA 3ZWNA 1FW6A 2FRXA 4DB2A 3PRJA 1G60A 5DGCA 1FFHA 1U7XA 1OU4A 1RMYA 3DO6A 3QWHA 1PNTA 1EDDA 4OGFA 3OJOA 2HR1A 4BMCA 2N0SA 1RYDA 1YFLA 4D8VA 3CEJA 2FW1A 1HDYA 2AR9A 2JJ1D 5I4IA 2QU7A 3TBKA 2XRMA 3AEUA 4BVAA 4MOWA 3U31A 5DHTA 2YRFA 1KI2A 2R65A 2ZULA 7MDHA 4JVSB 1P2GA 3I76A 1TC2A 4HMPA 3SGLA 3F71A 4BAZA 1R3UA 4RGVA 2HZ7A 3SBDA 4IVRA 1PWZA 3GJXC 3P9SA 1C81A 5DCWA 5BT9A 4EJSB 5K8JB 3VOAA 3N0WA 2WSLA 2AMVA 1O97D 1KJWA 2A1UA 2JDIA 3H9CA 3N2GB 3HSYA 2ZZNA 2CYAA 4B0OA 4RY2A 2L69A 3LDHA 3FVQA 5B3AA 2QRMA 4ASUD 4I4TB 3BYZA 4PAGA 1FYFA 4CCSA 5K01A 3OTIA 3O3MB 1U9CA 1TUEA 2BCJQ 2OE2A 2R5NA 3A4VA 4JROA 1T5HX 2GVNA 2QUIA 4RIIA 5ECDA 3UXMA 1R37A 2BR3A 1U0SY 2ACKA 4ZYXA 2G9RA 2Q8NA 5DSTA 3OQIA 4LMAA 3GXOA 1UPUA 4PX5A 4H15A 3E2IA 2J31A 1G0OA 3KB8A 1L5RA 4R71A 1ONOA 5JMOA 1OT5A 1ZNZA 2H2WA 2Z2JA 1YE5A 2AFRA 1CB7A 2CUKA 2DQ4A 1NI4A 2XTZA 5JVDB 3SQXA 1XRRA 4GNRA 2QGFA 2I7DA 3FCEA 4B47A 2X0RA 5ADWA 2JLAA 3ZWXA 1XYGA 3GGSA 5HX7A 5KINB 1U9YA 4G5GA 3GQBB 2I29A 4OQDA 221PA 4QDZA 1H0SA 1M6WA 1NQTA 2ATEA 2BEWA 2NTJA 3LRPA 4YJ2B 3WJ2A 4EOGA 2DM6A 2FUEA 3NWPA 4KWIA 3SSOA 3DHVA 3EE6A 3UJ8A 5J4VA 3OFND 2J9XB 5DASA 3I9OA 4H3KB 1J8MF 3E7FA 3PZRA 4B76A 4S1PA 3H9JA 1MIOA 3MUFA 3RVQA 5CM2Z 2P11A 1JHYA 3SWWA 1THGA 5F3WB 3ETJA 4OQLA 4HH4A 3T5DA 1I32A 5SYAA 2Z3ZA 4O4HB 4QFBA 3OPMA 4NBRA 1Y3DE 3CW8X 4CMJA 4W5WA 4B87A 2QX6A 1HQYE 3L7DA 3JVVA 2CD7A 1U7UA 3QBJA 3IAEA 3M4YA 1J00A 3Q0TA 1Y9AA 4K86A 3MBKA 3UYLA 4EHJA 1Q7EA 3SS9X 5EN4A 2UAGA 1DUVG 1F5SA 5D6NA 3SC3A 3NHAA 1ZYUA 4YDSA 3AESB 3VNQA 3WMRA 1F2UA 3C0KA 4R1SA 2CLOB 1M34A 3AF4A 4JBXA 3WA6A 5IAAA 1CD5A 2YZGA 3DAYA 3P9CA 3TK1A 1YTUA 2YX1A 1E0AA 2ZAMA 1NXPA 5EUMA 4BNJA 4NBVA 1CUHA 3VJMA 3AVUA 1MIHA 2RDMA 1C4KA 4KHPB 1MRNA 4N4AA 3RYFB 3WWZA 3CHYA 3NCHA 4RHFA 1KO7A 5KAMA 5BRAA 4US0R 4AO8A 2I0FA 4U2DA 5CX4A 1Z0FA 5C8YB 1OH7A 3F6PA 3IQZA 3NNNA 4P7GA 2OXTA 2YYSA 2FG6C 2W6JA 3SHQA 4KSCA 5DM70 5E8RA 1NW3A 4O4LB 1R18A 3KEFA 4BTVA 1QIEA 2NPOA 3TB6A 5KNDD 3WGZA 4OXRA 2QN7A 1UC4B 3PUHA 5K3OA 3UAXA 2G06A 2IU4A 3FHOA 3CEMA 1TLLA 4O02B 1WR8A 4QX6A 5AVXA 1PFGA 3STVA 3G1TA 4BJ1A 4JVOA 2ISQA 1QH8B 4D9BA 2EP8A 1Z56C 2FN3A 3LVQE 3HRIA 5CGQB 3UMFA 1TU0A 1AN9A 1QNLA 2I65A 3E7PA 4JYZA 3ETLA 2I2DA 3H5VA 3HPRA 1FRVA 3K72B 4ME6A 5DX8A 3TQCA 5C52B 3ZDBA 2C3MA 4KVFA 4IICA 2O50A 4O0MA 1HTWA 4P9NA 4EL0A 1VSVA 4UTNA 2ZRJA 4X65B 2VF8A 1ZIYA 3AM4A 4PZYA 2OB2A 5LC1A 1NR7A 5CLFA 2REOA 1Z4MA 3T5TA 4YCDA 1DDGA 4PTYA 1JXQA 2P5UA 4FYHA 1JZTA 4UNNA 5DEIA 5C31A 4CF7A 4PLFA 3GLGE 2JI9A 3SICE 3DGEC 1GN8A 4P8RA 3S2SA 2PMCA 2I6XA 3C6KA 2R8BA 2QY9A 4QOIA 3IO5A 1E4VA 2AUTA 1DTWB 4YIKA 1BJRE 1MCZA 3BGSA 3DM9B 4PONA 4M1QA 4LAFA 4GPD1 3A04A 3DUFA 3HWSA 3TIFA 3TRDA 3V7FA 3T61A 4ZC8A 2Z0MA 3FUCA 4BNTA 3W6PA 1Y89A 4UZSA 1RWXA 1ULBA 1E77A 1E9FA 4UVEA 4OFZA 4W1RA 2X0NA 4TWAA 1P5ZB 3QEOA 3VKWA 4MDFA 1FDOA 3HM9A 5C8ZA 4ND1A 4Y2TA 4DXDA 1CF4A 1AXGA 2FJ0A 1Y7TA 2W7TA 3GCXA 3GRCA 5AM2A 3Q2KA 1IZ9A 4F96A 4HQLA 3T15A 4DQXA 3GHYA 3L77A 4DLYA 4M1ZA 2YL2A 4PX2A 1YI0A 2JHPA 2D1QA 2VTKA 1UBTS 2V3WA 2CMHA 4X84A 2ZIFA 1JKIA 5THKA 4DWWA 5JNWA 1TQDA 3AF3A 1EGVB 2VAPA 3D54D 3ZNNA 1XJCA 5C1BA 1A2QA 4D4IA 3DHEA 2FDCA 3SFVA 3IQDB 4BZZA 3PF8A 1XEWY 5LD2C 4I55B 2GYUA 1D2AA 3A05A 1DCTA 1DJNA 3LLCA 1FYXA 1VI5A 4KKVA 1QRUA 3NGLA 2GKSA 2GYYA 2ODBA 3CM0A 4I9FA 4PTLA 4C0KA 1KAOA 3JWHA 1A3CA 4K88A 3EF3A 1LK0A 1L4UA 1VHQA 1Z6GA 3RUHA 1LWNA 3PZBA 1PL8A 1MEEA 2O8FA 3AQ4A 2UV8A 4HFRA 1TTPB 3IAM6 4RNDB 5AUPB 1E6LA 3F46A 5H82A 2OOKA 3H7AA 4KQKA 1KZ9A 1L4KA 3N07A 4NEQA 5EXPA 4CR6A 2DPXA 3UC9A 5IK2A 1NJFA 3C1UA 1NVXQ 4X7RA 1E1CA 1VECA 2JIZD 1X92A 4NU8X 5IK2D 1ESEA 4G9EA 3ET4A 3OEHA 1U7TA 2PD6A 2P3SA 2R68A 5IU6A 3FPFA 1NURA 2JAUA 1E9VA 3BMXA 2GD2A 3M3HA 4WEOA 4CDGA 2QVZX 5B5SA 5BUSA 1AOXA 4PAQA 1RVV1 1O97C 1PSWA 3PFWO 1RLUA 5DTIA 3NBZC 3DBHB 2A35A 3IIJA 2P62A 3K96A 3EVAA 3PDUA 3ONEA 2V7PA 4CN8A 3JQ8B 3T3EA 2EJCA 1L7RA 2PXXA 3MD0A 2H0QA 4J2HA 4U3JA 2VDMB 4WZBB 3ACDA 3JQAB 1X2BA 3SI7A 3JQ7A 3EGXA 3G3EA 4MXDA 3FLMA 1KO1A 5GIOE 1GQQA 2X6QA 1X3LA 3A37A 1RRCA 2Q1TA 3RUEA 4TKZA 1JZSA 4Q16A 3SKVA 2HSZA 2UYGA 1ZAKA 5M5BA 1IH8A 4R40A 2QB5A 4B3RB 5CLQA 1BW9A 1Q1BA 4GVXA 2GZ3A 3PFKA 2E0IA 3R3HA 4LJAA 3GBPA 4U2KA 1OWOA 2GCGA 4XARA 5C8XA 1TUIA 1YB5A 2OHXA 2AXNA 3VR5A 5AHKA 1Q7TA 4S2EA 2CF6A 3B1ZA 4OM8A 4D96A 2R8XA 3ESAA 3QNWA 5HJ5A 2BM1A 3M1LA 3DAHA 1R6VA 2DUJA 4X8OA 2NU8B 1PJQA 2BKLA 4HEJA 4RH0A 1P44A 3DEHA 3QHAA 2VO1A 3TN7A 3QPCA 4WVFA 1N92A 1H5QA 1GCUA 1I1QB 5J2UA 1DBIA 1L1FA 1BKYA 4OQYA 3SJBA 5J5VA 2ZRFA 4GVLA 4Y8VA 2O48X 5I9LA 2J3LA 3CUSA 2I7CA 5B1HA 3Q3GE 1C3VA 4RTLA 3RCBA 4C4TA 4F4HA 3A1TA 2AG8A 4EGSA 5BV8A 1SHUX 2OXFA 4NFHA 1RP1A 4LJRA 5AJWA 1Y4AE 4V03A 4BNIA 1ILEA 2OFFA 3ZQUA 1A9SA 1N8NA 4MWDA 3EPHA 2A1UB 3LYHA 2HQSA 1C9DB 1G20E 2JAHA 3L01A 3R0JA 4POAA 5ALGA 5EIWA 4R6WA 2Y2VA 5FAKA 1RWWA 2XWPA 3GRFA 4HLUC 2EYQA 3ZW9A 4MQFB 3WYDA 3V2GA 4BQPA 3QWAA 1WF6A 3H05A 4BVBA 4KQWA 2NZYA 1F2DA 5IDVA 3ID6C 3BK1A 3LKVA 4WHMA 1PTJA 5ERGB 1G2OA 3DZDA 4FUQA 4UUMA 4EB6A 1TVCA 1WW3A 4BOYA 3QPUA 1FRNA 1OR8A 1SVSA 3QXXA 1TGYA 4XIJA 4XWAA 1DBQA 2XHEA 6LDHA 4KO1S 2WIAA 2GZRA 2O5VA 1KQNA 3UATA 2V96A 3WHPA 1J1UA 3R40A 1SUSA 2GRAA 4IMPA 2EQ5A 2QNRA 2NG1A 2OZVA 4GMKA 4NFYA 2R2GA 3AEKB 1Q3KA 3K92A 4JSYA 4IIGA 2HNBA 1I4OA 2APJA 5JVDA 3IGFA 3PJEA 2VC2B 3ZK9A 2B37A 3IPCA 4HDRB 5HKKD 5DTJA 1DS6A 1S6YA 1BIFA 4LOJA 4AZ3B 5KNBH 4HEQA 4Z7OB 3IO3A 4Y9RA 3KPVA 2I2BA 3L4SO 3ENKA 1YDEA 3PC7A 3AERB 4PSKA 2OV8A 3DTVB 1L4FA 4ZAVA 2BEWB 2ZUWA 4G2TA 4GYYA 4UCXA 3HVHA 3AJEA 1PW5A 4YVFA 5DHRA 4HB4A 1M6HA 4POOA 1GR1A 1GAWA 2FZKA 3PE4A 3IEPA 2C2GA 4Z8XA 1ODKA 2W4QA 4L5CA 5EP2A 1L3CA 5AM5A 4DMRA 4GEKA 5CNJA 1M7GA 1YR9A 3E5RA 4L5JA 4RYDA 5E7QA 4PYOA 2EATA 4ZCIA 2C8LA 2PD4A 4LXUA 4JNKA 4LWOA 4NCXA 1N5MA 2ADOA 3R3YA 4WFQA 3IPAA 3KSAC 3OM1A 3NM4A 4HGYA 4FE4A 1RJ9B 3R7AA 2FP4B 5FL7A 1ZD2P 4INPA 3ENQA 4JASB 1S3SA 1SZPA 3KQUA 1SUIA 3BRSA 2J67A 5AKXA 5HQJA 1V41E 4GRIA 1SCBA 1E0JA 1EFLA 2Y0DA 3OWHA 4ID9A 1KFEB 4RHEA 4DDKA 4CTMA 5AW2A 4RQTA 1INLA 3IEIA 4NC9A 3X1ZA 3WLHA 1PUJA 3E1SA 4G36A 3AF2A 4CHGA 5A6SB 4RKWA 4D3DA 1GRCA 1YBVA 3IIEA 2ZBRA 1YVUA 3E61A 2HIAA 3P2KA 5D84A 3UXYA 2ZZMA 1UKVY 2WYIA 3S8MA 1U94A 1NP6A 3FLBA 2BP7B 3VISA 4KQ1A 2FVYA 1WLSA 2Q2WA 4F6CA 1FIUA 1Z5NA 4LCJA 4FCWA 3N8IA 5A9TA 1XRNA 5F78A 4F3TA 2C9OA 4TLCA 1NVBA 4XCXA 3VR2D 3FZGA 4OFWA 3ABSB 3J7TA 2RE8A 2HJHA 1K6IA 2A2ZA 3Q6NA 2P9YA 3HYRA 2CCJA 4H17A 3WFIA 1VCOA 3WWPA 3IAS1 4NBWA 4KACA 2IOFK 4TL6A 5BV1A 3EK2A 3SSAA 1UXHA 5J3JA 4O59O 4QG3A 2HREA 2OK7A 3IHWA 2WMDA 1XCOA 1AN0A 1NSFA 3AWIA 3QBTA 1TLFA 2DY0A 4P93A 4A6EA 2FEAA 1EFPA 2GD0A 4XGKA 5MGNA 1YB6A 3MHPA 4BNMA 5I47A 4I8XA 2BZGA 2B6HA 2W2XA 2Z2XA 1TCCA 6Q21A 1XDZA 2Q1SA 1BEEA 1W88A 2QUAA 2VTDA 1XF9A 3AY7A 4R81A 4BLWA 1AKEA 1P4AA 1JKFA 2I67A 3CGWA 3ASYA 3EISA 2XCLA 3FB4A 3OETA 3P52A 2PY6A 3KSZO 4KPUA 1AJEA 1X1QA 1G5IA 2G4LA 3CV3A 1LWOA 4P5PA 4TL9A 4TTTS 5C37A 4LF8B 3FFTA 3FNQA 2HYIC 1TIKA 4MVWA 4MHSA 3N75A 4Q7KA 3QU4A 5FOQA 5D00A 4O5OA 3COZA 4QEZA 5K3FA 1PS8A 1RI5A 2I4MA 3HNPA 1ZD8A 2PEZA 3BB4A 4FFMA 2FK7A 1Q1NA 4FWBA 3H8WA 3UWMA 1J6UA 4IGKA 2CL5A 1LLUA 4GQAA 3WJ1A 1Y6GA 1XHFA 2VH2A 4G5YA 1KI4A 2XJ4A 2V7WA 2O2SA 4URHA 4R0MA 2WJVA 1EGAA 1U9ZA 2ZI5A 2FEMA 4HEA6 1XAIA 2VJQA 4HC4A 3DMHA 4ZO9A 1XPOA 1V7ZA 3ZVNA 4EY8A 1K4KA 1OFTA 3DAOA 3P20A 4N9WA 4CM5A 3HB9A 1M2GA 2GAFA 3KJEA 3WNZA 4A73A 2JFNA 4LZJA 4HWKA 4L6CA 4YN3A 1JLRA 2ZE7A 3LDAA 3RU2A 5BWMA 4RQUA 1Q0TA 4BZPA 4W5HA 4GMXA 1NBEA 1VE3A 2DQZA 4E13A 5AK4A 5DF1A 5AJXA 5DW3A 3WK7A 4IQFA 1GNVA 3LUCA 2JLUA 2PMFA 3HKEB 2C31A 1I9CA 4WESA 4UTRA 4TLEA 1M8FA 4A0QA 4Z49A 4OXQA 1JKJA 4RORA 2QG6A 1O95A 3PITA 1RS0A 2CJPA 3S3TA 2IHTA 2ZRLA 3KIPA 2M1ZA 1YVEI 3N05A 2XUDA 3NKFA 1TFUA 4II2A 4Q7LA 2RHJA 3AVQA 4JEUA 3WMWA 2H4JA 4NZPA 3NHFA 5CDFA 1DAPA 1MDBA 3G5AA 4GBMA 3VO9A 5AVSA 1TJNA 1E32A 3ZQKA 2I62A 2GBLC 3T8YA 4LJ9A 1QR2A 1ZO8A 3GHHA 3KHUA 4ACBA 3W5DA 3AFGA 1XDBA 5T6MA 4B4DA 1D07A 3FNIA 5HQ3B 4NS1A 5FDFA 2OESA 2AS0A 3P0FA 5BN4B 4DJJA 4INAA 1CVRA 3ROXA 3G2KA 3BD8A 3CT4A 3CEHA 2PMKA 1SVUA 3EGWA 1HV8A 3M5DA 1LV8A 4F8YA 1YJ5A 1WDWB 2HZBA 4WVLA 3DLPX 4DLRA 4R3NA 2XYHA 3GCGA 2X9LA 1SD5A 2EG9A 3F78A 3JTMA 3PVZA 4HQKA 1YCDA 1FRZA 3NPAA 1Y5NA 3ENNA 3NYIA 2FW0A 4P4LA 5DGXA 3LC2O 4Q4CA 4RTNA 4J0FA 2QOEA 4E1VA 3AM1A 1QSGA 1Z83A 2CFOA 1GDTA 1GYPA 5EP4A 4MR9A 5I9TA 3VZSA 1ZOIA 2FSVA 4ZMSA 2A1IA 4IHAA 4YHHB 2XNCA 3PCRB 4CT5A 1DC4A 4B0PA 4M0FA 5DTEA 1YH3A 1ESZA 4IILA 1PR3A 1IQPA 1DI0A 4C07A 5FUVA 2RAFA 3CX4A 4OHCA 4CNBA 5A02A 4G97A 3SLRA 1WP9A 1OXUA 3FDZA 3I9FA 3KDAA 1FNBA 5HRUA 3W7VA 4ASUA 5JNUA 1QZZA 5EJ2A 3VAZA 1PO7A 4BWVA 3OQBA 3OOHA 1NXWA 1Y82A 3HRHA 3KTAB 4OI0A 1N2OA 1LS6A 3RU3A 4HAYA 1KHTA 5EIHA 1Z5OA 3EXEB 1P7PA 2GNOA 2B1QA 3GBVA 2PNFA 3NIWA 3S44A 2QTHA 2X8AA 3G0CA 3LC7O 3OFSA 3IEUA 4E11A 3T52A 1P0PA 1WF3A 3FKSD 4DARA 2Q1YA 2Y27A 4GOOD 4B6RA 1JG7A 4JI4B 4CQNA 1LPMA 2PAAA 3L1IA 2R8RA 3K15A 1GGEA 4HWOA 4A36A 2C5EA 1OX5A 2ZATA 4FFNA 3QUQA 2GWRA 3FM9A 1IY2A 3K5IA 5T57A 2WSYB 3DVRX 5CBPB 1RQNA 3I58A 4CM3A 5DBIA 1FXWA 1SXQA 1USGA 1BE1A 1UXKA 2BTEA 3CNLA 2HCRA 2VHZA 5AIAA 4R5HA 5C2JB 3JVUA 3IDFA 1WHSA 2GN1A 2OZLA 1HRDA 1JI3A 1A9YA 1VZ2A 4OI1A 1B6TA 3WV5A 3DMRA 3OIYA 1WXIA 5K3DA 4P08A 5L7YA 5BYBA 1TA0A 1W36C 2P9BA 4DEYA 1BFDA 1JB1A 1E1QA 2AR0A 3H87A 3N8KA 4UBMA 4L5BA 4C05A 1OAAA 3PFCA 4YMWA 3N8GA 1HE3A 4YT2A 3SKYA 2A9PA 4A82A 2I6TA 3IILA 1A1VA 2PUFA 1HX7A 4K1LA 1ECCA 2OKGA 4IUDS 1CJMA 1ZD5A 1GAQA 2IXGA 3FJ1A 1USVA 1JAZA 5JAOA 1OI7A 3S28A 2ADFA 3WC4A 3KUDA 1DAIA 1DAKA 1WNTA 2HJSA 3M4NA 1Q0ZA 1T0IA 3LKDA 1E1MA 2EARA 1SXJB 2IZOA 4QG7A 3LCVB 2Q41A 5ALRA 1Z2CA 1G3IA 2PMWB 3NEPX 3ONDA 4N0EA 3B3QA 5I9SA 1FBTA 5C1IA 3SZGA 1C3XA 1J21A 2G6TA 3A10A 3GLHA 1SCKA 3DR5A 3MJEA 3P97A 4LNHA 4MTCA 3VNAA 3ROZA 3UBTA 1W93A 3GXBA 2HPVA 3G88A 5E3HA 2YS7A 4FOLA 2XLCA 1GAXA 4E4RA 2VT7A 1VMKA 3SN6A 4XPZA 1GM5A 3GELA 2R84A 3N0RA 3SYRA 4QTZA 4UHJA 1BGXT 1TK3A 2ZTLA 4J0CA 4ZT2A 4L22A 2PSEA 3QW2A 4G56A 2OYCA 3IJRA 5L95A 3WHIA 4EHAA 3NVDA 1BAPA 1HE4A 4G0WA 4NEGA 2CMGA 2GN8A 5C3UA 3LX4A 4CNQA 1OJLA 3ZLUA 1J7KA 1YFZA 3IXLA 5CH5A 5BW8A 1CSEE 2Q4RA 3GBSA 3O83A 1JALA 5B58C 1PQ4A 4HNRA 3AKEA 1E2UA 4OX9B 3HEAA 4IDQA 4K9SA 4RLQA 3V1YA 3R6LA 2XTJA 5GVRA 5EPUA 4RZUA 1DO8A 1OASA 1BX1A 1PFWA 4V38A 3T7TA 5K5EA 1OH6A 3G8AA 1JIKA 1ZK1A