1QHFA

Yeast phosphoglycerate mutase-3pg complex structure to 1.7 a
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
240
structure length
240
Chain Sequence
PKLVLVRHGQSEWNEKNLFTGWVDVKLSAKGQQEAARAGELLKEKKVYPDVLYTSKLSRAIQTANIALEKADRLWIPVNRSWRLNERHYGDLQGKDKAETLKKFGEEKFNTYRRSFDVPPPPIDASSPFSQKGDERYKYVDPNVLPETESLALVIDRLLPYWQDVIAKDLLSGKTVMIAAHGNSLRGLVKHLEGISDADIAKLNIPTGIPLVFELDENLKPSKPSYYLDPEAAAAGAAAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a phosphoglycerate mutase:3-phosphoglyceric acid complex at 1.7 A.
pubmed doi rcsb
molecule tags Transferase
molecule keywords PROTEIN (PHOSPHOGLYCERATE MUTASE)
total genus 81
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature ec 5.4.2.11: Phosphoglycerate mutase (2,3-diphosphoglycerate-dependent).
pdb deposition date 1999-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1qhfA00
2YN0A 1DKLA 1T8PA 1QWOA 3FDZA 3HJGA 2YN2A 4D4KA 3O0TA 2ENUA 5CX4A 3LNTA 3DCYA 3QPWA 4PGMA 1YJXA 5AJXA 3NFYA 2P9YA 1H2FA 3BIFA 4FDUA 4D4MA 1UJCA 2P75A 3D8HA 5CU7A 1E58A 2EKBA 1UJBA 3PGMA 3IT0A 2H4XA 4IJ5A 1QHFA 1EBBA 2GFIA 2A6PA 3NTLA 3K4PA 2P2YA 4IJ6A 1SK8A 3QPVA 2AXNA 3EZNA 3K4QA 3E9DA 3EOZA 3GW8A 3IT1A 5PGMA 2HPAA 1ND6A 4HBZA 2P6MA 1C81A 1E59A 3MBKA 2HHJA 4GPZA 1XQ9A 4JOCA 2P6OA 4D4LA 3MXOA 3DB1A 1C80A 4TSRA 1YFKA 4ODIA 4AROA 4PZAA 3GP5A 2F90A 1SKAA 2P77A 1DKNA 5AK0A 3FDZB 2H0QA 3F3KA 2ENWA 2OWEA 3D4IA 2P78A 4ARUA 4PZ9A 1DKOA 1V37A 1RPAA 4MA4A 2RFLA 3ZHCA 4JOBA 5CDHA 1QFXA 3GP3A 1DKMA 2WNIA 2EOAA 3QPUA 5HR5A 3IT3A 1DKQA 5AJYA 2WU0A 1C7ZA 3D6AA 1FZTA 4EO9A 4JODA 3KKKA 1RIIA 1BQ4A 1K6MA 2IKQA 2P30A 4QIHA 2P79A 5AJZA 3C7TA 2DWOA 2WNHA 3E9CA 1CVIA 2H4ZA 2P2ZA 1SK9A 4E3WA 1BIFA 4ARSA 1RPTA 3F2IA 2H52A 1SKBA 4ARVA 2BIFA 3E9EA 4GPIB 5AJVB 4D4JA 3IT2A 2P9FA 2QNIA 4EMBA 3LL4A 1NT4A 1FBTA 2DWPA 2P9ZA 2A9JA 1H2EA 1TIPA 1IHPA 2PA0A 3LG2A 2EKZA 2I1VB 1DKPA 5AJWA 1BQ3A 1ND5A 4FDTA 2HIAA 2OWDA 3OI7A 5HTKA 3FJYA 3R7AA 1V7QA
chains in the Genus database with same CATH superfamily
3O4JA 5L4LA 3LCVB 1WTAA 3OPYI 3GIDA 1JE0A 4ZVLA 3TSAA 3OCZA 1M1YA 1SVWA 1E3LA 2J9RA 5LJLA 3JWJA 2PSDA 3GL9A 4LTMA 3V7YA 2I9KA 2Y1CA 4TVOA 1Y34E 1XCPA 4H7JA 2CT8A 3E61A 1E62A 2YWGA 2OOKA 1Y1TA 3EF0A 4WCVA 1ZK2A 3UGTA 1J06A 1GT91 4QQRA 2DTDA 2PSHA 4EA6A 3ED1A 1VG0B 3HKBB 1AXRA 2BBOA 4G8JA 3VNVA 2BKEA 4DE5A 3WYFA 3OTIA 5ICSA 3DZDA 5K4HA 2GA9A 1LLCA 2WKQA 3NJ4A 2XB6A 2ZTUA 2CJXA 1CS4C 5LVAA 1SCDA 4DA4A 3WY9A 3LX8A 5BR4A 1FTNA 1OA0A 2NYVA 1YDEA 4QASA 5T8KC 2QRJA 5LP6A 1QQAA 4ZOQI 5EQFA 3V8EA 3TD6A 2JLXA 1T4DA 2ILTA 3HRHA 5FPSA 1J8VA 1I0LA 4FNGA 4TWJA 5FPYA 1OT3A 2Q7OE 1C9DB 3TL3A 1M2WA 1JU9A 1H2ZA 1NYQA 4GOXA 3S44A 2Y67A 3K30A 3LCCA 4Z4QA 3K09C 2CVOA 4I1IA 3S40A 3X1ZA 2MR5A 2ZATA 4JLUA 5CJJA 2PSSA 5H83A 5JH7F 1KXZA 1GDHA 2RJNA 1XZQA 2HLDD 3FWKA 3DYVA 4NPAA 3TMYA 1A9OA 1M6WA 4ZPJA 1TF7A 4TRJA 2P2LA 3H2GA 1GU1A 1W5EA 4DM4A 4XWKA 2XRMA 1E7WA 3NDPA 5CTAA 1QTNA 3Q7TA 4RLSA 4URZR 1DQYA 2VJOA 2EW2A 4AJLA 1PWZA 4JYCA 4LA4A 4HVCA 4G5FA 4N12A 4D81A 4HEHA 1T3ZA 1V96A 1XE3A 3WR5A 2HZBA 1PFUA 1NOKA 1UFOA 1K86A 4WJZA 1F0NA 4UDYX 5CURA 1WDMA 2I4NA 4PTZA 3WYAA 4AVYA 3L7JA 3PHHA 3QVXA 4M49A 1SXHA 3CZ4A 3A27A 1NNSA 1BE8A 4MROA 5B4TA 3T95A 1BXGA 5JPCA 1T8SA 3WGZA 1QHHB 2GF2A 1JR3E 3DEJA 4RGVA 3ZDYB 4XOUA 3CCFA 3G2OA 3C5EA 1G17A 5AKLA 5MFZA 4G41A 5K0LA 1ZY2A 3W6PA 2AXQA 1SNYA 1KO7A 5KAPA 5FO1A 3L04A 3QV1A 4GWLA 4I0WB 3W9SA 3OJXA 1VYTA 3LD9A 1JT9A 2IY9A 2WDPA 4TX1A 3VNAA 3D64A 5EJIA 2YWEA 1N2BA 5A5EA 4NR0A 1E1LA 4IIJB 3HO8A 4Y2SA 3AB3A 3RJMA 1TC2A 4FN4A 3M2TA 1SKUA 2I2XB 1OZ0A 4FFMA 4MUFA 3ZV3A 1V16B 5KU7A 5LOVA 3D8SA 1REQA 4KDCA 3E3LA 3FHOA 3VU0A 3P26A 2XDYA 4OOEA 4II3A 2VO1A 3AB7A 1SHZA 2DAPA 2IZOA 4OJYA 1LK5A 1VLVA 4F11A 2V3WA 1K89A 1OFUX 5KSPA 1Z4NA 1DXQA 1U2GA 1XYGA 3PSAA 1JEYA 3SQDA 2UUBB 3M9XA 1AZWA 2POQX 4G5HA 4RKYA 5JG7A 4IV5A 2WP8J 5AK5A 3ZK7A 4JGGA 5A9SB 1VIMA 2R68A 3HKDB 3GV0A 3E15A 5DM70 1XN4A 1WXWA 1Y7LA 2QENA 4JFRA 2AKAB 2R6HA 2ZTHA 4TTTS 2D54A 4G89A 5FDFA 2F9LA 1YQDA 2IHJA 3B5JA 4L74A 2ZSEA 3W34A 4DQUA 3RSSA 5GADl 3NFYA 3GCXA 4KVZA 2JKVA 1VKJA 1JDVA 3NVMB 2EQ5A 4HWRA 1FBNA 2W37A 2IXDA 2JFHA 1MC5A 2Y27A 4GWGA 1YS1X 1VECA 2DR3A 2FW0A 2IYSA 3K6KA 4P4TA 2HKIA 2XZDA 2K87A 5KX5F 5DNUA 2ACVA 2YC4C 1U1CA 1WSWA 5CBKA 2PRSA 3NOVA 5ESRA 5BYAA 1KJWA 1BS9A 2FR0A 2WM3A 3JD0A 4XX1A 3EJWA 3W3AH 1FIUA 5AWFC 3BEOA 1GUDA 3BYZA 2C2KA 5K4GA 1XZDA 2CB0A 3UXHA 3A06A 5DIFA 1XQXA 4ZYWA 4MVJP 5DBFA 5DWVA 1XN1A 2UVPA 3DDNA 1CR1A 1NVWQ 3ZUGA 4MQBA 3CQ9A 4QVGA 4BMOB 1WETA 3G3EA 1YUBA 3M89A 2GD2A 1QYXA 4L7VA 1POXA 1BW9A 2Q0SA 2AUMA 1IWPB 5CEFA 3Q85A 3AIIA 4QUAA 2W42A 3FOZA 1KQPA 4BQFA 1L7DA 1GGKA 3VDXA 3QPCA 5KYYA 5ESXA 1E1CA 4GM0A 4PG8A 5F1PA 2YIDA 1AKWA 2CFCA 4Y6OA 1PWHA 2ZRJA 3ER9A 4O4HA 2IEDA 3OE7A 4DT1B 3OWOA 1Q0PA 3WMGA 3I1JA 2OAGA 3G7UA 2I99A 1CZKA 4KUGA 3NV9A 2FI1A 2W70A 2C78A 3VKHA 4QU5A 5I7WA 1P5JA 1OCEA 5C8YB 3I6MA 2CMGA 3CA8A 1DVRA 4KREA 2IZ7A 4XTRA 2V9CA 1PR2A 2D59A 4KO2S 1Y6GA 1HKUA 2WLTA 1RI4A 3JQCA 1C3XA 3K9QO 3PKJA 5LNK6 4W5RA 4AS1A 1FLNA 1UEJA 1A9QA 1ZA1A 2YW2A 4N54A 3UNXA 3NHRA 2YXBA 2B4RO 1E1MA 4KXQA 1QYDA 2ZXEA 4M4SA 3Q9UA 1F5SA 3E9QA 3REQB 3PWZA 3A4LA 1NXOA 4K9LA 3KOWA 3QQ5A 4ID9A 5EIXA 2I22A 4BGEA 3FVRA 1M1UA 2DCMA 3KAKA 4FHGA 4MPDA 1GFIA 1P3JA 1JVNA 1NPYA 1Q95A 2W83A 3HZOA 3OZ7A 5DB4A 3F3YA 3FNIA 2VZ8A 3PR3A 5DVZA 1W85A 2PLWA 4X63A 1YKFA 2FX3A 3CEHA 1I2BA 4V0OA 2FCAA 5CLIA 1W49A 4U7PB 3UMVA 3PGXA 4YYZA 3AESB 4IOJA 4ZEWA 5C7LO 1W35A 4HTFB 5A3SA 3OURA 4ZODA 5CXUA 4WEQA 3WRXC 2ZZNA 2QYOA 4CIWA 4DG8A 2R1TB 1PLKA 3OFVA 2VJKA 1EK1A 1S7CA 2ZRFA 1ZWKA 5TQJA 1KVSA 3ZUPA 5LQNA 4Y2HA 1DCKA 1U94A 3VPHA 3FCOA 4DWJA 3VX4A 1PW7A 1DUVG 2UU9B 1ZC4A 3HGQA 3ASYA 4B3RB 1JPUA 1VE6A 5MDHA 2GN9A 4ZO7A 1YIAA 2ZI6A 4RKRA 1O97C 4NOJA 1Y1QA 2G28A 3V6MA 4NSNA 1E1KA 1MABB 1OPRA 3B3AA 3CG0A 4J03A 3TQFA 4CCWA 2BVNA 3CKKA 3AT1A 3QVUA 2C5FA 1Y82A 2QGZA 4YVFA 4EY4A 3P5SA 1KMMA 4FHEA 4H3VA 4KIJA 5KTKA 1IBMB 3E58A 3IAFA 4JLAA 7GPBA 3X3HA 3IR6A 1TVMA 2BRUA 2EZUA 3CRZA 3WYNA 2Q3LA 3AHHA 1FEZA 3HN7A 5FBWB 5KYXB 5DNAA 3C3AA 1RHKA 3L6BA 3ICQB 4PVCA 4RCYA 3WGYA 1P5ZB 1JEQA 1VXRA 2A0UA 2NADA 2YIJA 3I4FA 3BILA 4IDQA 3T52A 2WAMA 3PE4A 2UZ1A 3B7GA 3IVXA 2VVTA 3DEFA 3SEQA 4WLOA 4H9GA 1E92A 1QC5A 3NP9A 4Y2XA 3GHYA 3VO2A 1DHRA 1Q7EA 4RABA 5D51S 4LFCB 4JQSA 3ACBA 4GS5A 1FRQA 4LJ6A 4QQ8A 3EUEA 3E9DA 5DM2A 2NM0A 2CHQA 4Q34A 3DOOA 5L4SA 1M8FA 3PFNA 4Y18A 1PR3A 1TKAA 2DJIA 4YPVA 1RWNA 3K8QA 1W0KD 3NDJA 2J87A 3OLWA 5KMGA 5KWJA 3DEIA 5I5EA 2GK3A 1MZVA 2ZW9A 3RK4A 2Z0MA 1CK4A 1G8AA 4JJEA 3HA3A 1UFKA 4IZ6A 4DBZA 5CLJA 5KQRA 1SOWA 3N8GA 1WCIA 4FC7A 5E0OA 1CWUA 2IH4A 4J8PA 2JGNA 1E3SA 1ETUA 2BELA 3G6KA 3T38A 2R6FA 4FB5A 1QTRA 1UOPA 2ECFA 3KFVA 3OT5A 1KJ8A 4MSUA 4TS3A 4ND8B 1DEAA 1QCYA 4PQEA 1QQBA 1I7SB 1Z2PX 1LUAA 4CMHA 1QRRA 4U2BA 4NNPA 1TZBA 3NHUA 2FK8A 2JJ1A 2WIGA 3E5NA 4XB6B 2ZB4A 3FA2A 3KLOA 1A8QA 3CJQA 3AILA 1L5HA 3ZI7A 3FTFA 3I5XA 1NVAA 1UFRA 4Q5IA 3ZE6A 3U7QA 1Q6YA 4IXDA 5A7GA 4MS1A 2AEFA 2FZEA 1XPOA 2FEPA 1N8SA 1Q14A 3G88A 4BC1A 2JIQA 2ZSFA 4OHVA 2UUCB 2UYOA 1VKNA 5HR5A 1KBQA 2EHJA 4J07A 4RH3A 1QNLA 4M8LA 4B2YA 4F5DA 3AETB 4BKOA 3HEAA 1ZH8A 1F0PA 1L4YA 2D5AA 2W6QA 4WNAA 1YR6A 4M53A 4BKRA 1ULZA 5JIBA 3I23A 4LF7B 4AG6A 2J0QA 1UJ6A 3EBPA 4JXKA 4UM8B 1IN1A 4GU5A 3MLAA 1U99A 3AEUA 4NBRA 4ZTZB 2HCTA 1K4KA 1S1MA 3EPKA 3KX2A 4MUMA 3PPYA 3W8EA 3VYTB 3WQBA 1K06A 3DJFA 5FD8A 2WWVD 1BDIA 4JL6A 2LNDA 5HIKA 2AZ4A 5BUQA 3T1YB 1DBWA 4CT4B 1WB6A 2IUYA 3M6AA 3FYUA 4YJGA 4EUSA 2Q8PA 4PRKA 3BC1A 2EKZA 3ROQA 16PKA 3RWBA 4GHWA 2HK9A 3BD9A 4PZCA 3K2EA 2QTVA 5JCZA 4WD3A 3DE2X 5HIMA 5CITA 2YJ6A 5BN1A 1E2MA 3RJ5A 3V1NA 4HGRA 4OKIA 4PC2A 2Q6LA 1M6YA 4NLLA 1D07A 2MSNA 4HDSA 1AF4A 1TVKB 2FX2A 3J81k 4JR2A 3CKMA 2VJBA 5AK4A 3LNTA 4TM7A 1NY6A 4NECA 1SUEA 3QUBA 3LT0A 2JRCA 3PITA 4X71A 5T3YA 5KNCD 5L7TA 4IXNA 3DFFA 4AP6A 3CR7A 1DG3A 1RI3A 4EJMA 1X1QA 3Q11A 4FDVA 5TQ0B 3HK2A 2EJVA 1O1YA 4LQCA 1WV1A 3KDSE 4EOGA 6REQA 4DV1B 2W6ZA 4EL0A 1UKVY 1Y3BE 2R0QC 3P2JA 1Z4MA 3AY7A 4XM2A 1KC3A 1B14A 5K3AA 2YVLA 3C97A 3FNBA 4JUBA 221PA 1F3OA 1OXBB 4V02A 1VXOA 4MS3A 1ZK0A 3BJZA 3TSCA 4B4KA 3ZZTA 4DJAA 1GKLA 3CSUA 4I2NA 2ZP1A 5DGHA 4XD2A 4D9HA 2ZYTX 4XXHA 3RYIA 1UPXA 4XUEA 4CV1A 2HQRA 1ZVVA 2A59A 1SVSA 4ND7A 5CDGA 1XWIA 2UZ3A 3PHCA 4C2AA 1UDCA 3BHIA 2Q4EA 1DO0A 1P91A 3OT1B 4P84A 4RPIA 3R5HA 1RLIA 1NLUA 2PXAA 2W2PA 3HQ4O 1WKCA 2X41A 1N8KA 2YY6A 2N9UA 1G21A 2JD1A 4YUXA 5AVUA 3TGLA 1ABEA 1CQWA 3TRDA 2NO7A 5E4JA 3LS2A 2VHEA 1MBZA 3ESXA 5ETJA 1J42A 1TADA 3DZJA 4GMKA 2ENWA 3OE4A 4O1IA 3VKUA 1G41A 4CM4A 1KEKA 4JP2A 3CF4A 3G5AA 1ISFA 1GAXA 3AI7A 3VYUB 2QM0A 4WNIA 4DCCA 4PW0A 2ONJA 2JW5A 3RG2A 3DHEA 1UDAA 1ZCBA 1IN4A 1GZVA 4BNLA 3EZYA 3WIVA 1IZZA 2JHFA 1HE2A 3B1WA 3WYCA 2CCGA 3PG5A 2D3WA 5FBVB 4OJKA 3SGLA 5FUXA 2X2OA 3U4DA 1R0YA 2OP0A 2YFHA 4RMJA 4WN9B 5LQSA 2QVGA 3IODA 3O3MB 4BDSA 4EEZA 1NR1A 4KFUA 1TD1A 1QO9A 2JGDB 3HBLA 3KXDA 5FOQA 2IEBA 3OKPA 1E2IA 2FE4A 4LOKA 5J2UF 1A5ZA 4F85A 2PGAA 2H06A 2WM2A 5JR3A 1UIMA 1Y6FA 4E2FA 4G5SA 1SOMA 4G0VA 1SK9A 2I4OA 3ZV7A 1LZKA 5AI6A 5JC8A 5LD2C 3NBMA 4ZDJA 3C3XA 3MTGA 1FSFA 1U3FA 4AS2A 4C05A 5TS3A 2G08A 5LXTF 3DGEC 3PKZA 4B45A 2ZEJA 3GBVA 1UMCB 3CB4A 1VB5A 2B35A 2NU9A 3GDGA 4IDEA 4U7GA 3TLAA 5K3BA 3A4TA 2QORA 4DRYA 1S8AA 4RX1A 2XLCA 2RGNA 1TJYA 3RHSA 3CC8A 1E8DA 3WSWA 4EUHA 3CNBA 1BXGB 2I1VB 4EYQA 3UK6A 3NCTA 4PHFA 3ZYCA 4EZEA 3MB8A 2QS9A 1N8NA 1SZPA 3BMCB 4YT4A 2P9QA 2OWDA 5BR1A 4NULA 1ZN8A 5KCZA 3DDWA 2FG7C 3KBOA 3AHJA 1Z47A 2BCJQ 3H9QA 3NOOA 5AHXA 4W8GA 2FPPA 3UXYA 5FL3A 4E5UA 3EGXB 4XX0B 1T2EA 1A2QA 3QEKA 5I4CA 2Z83A 3IALA 5I7EA 1XF9A 2VT7A 1HTBA 2QL5A 2E89A 1ZGHA 3D5QA 3NH6A 2FN7A 5LR6A 3D7LA 4GKAA 1IHYA 1KY5A 3ZWOA 2QDKA 1NV8A 3WNBA 1EEXB 1KRHA 3B1JA 3BZUA 4JEIA 2NTJA 4KMMA 1XMPA 1AKYA 4LGCA 5LDDC 2OCAA 4EX6A 5LOVB 2JGRA 1BVRA 1NAHA 3OPYB 4R81A 4UEOA 5AW7A 3K9GA 1I94B 1B3RA 3R3HA 3CX6A 2HSDA 3EE6A 3OEED 1E2KA 4JT2A 2YFQA 5CDFA 3K72B 1VP3A 2OCLA 5HF8A 1DCMA 4DDKA 4DRXA 4ESHA 3U19A 2IS6A 5G1OA 1RVDA 4QVIA 4POAA 3EVNA 4PCAA 1H4VB 4GP9A 3FKQA 4BP3A 2NU6B 2Z9BA 4L4XA 4EO4A 4YA6A 1GJRA 3O3OB 4ECEA 1T9GR 1FF9A 4ZD6A 4O4JF 1K7SN 2RHLA 2WYOA 1N6LA 5IBPA 1TJPB 5E7MA 5E6RA 2HOQA 2ZJ1A 3LTEA 2GERA 4QG3A 4XFJA 4RVSA 2VSFA 2J0UB 4PR3A 4U6QA 4DAEA 3VU8A 2G40A 3UO8B 3CUWA 4L02A 1P18A 3LWBA 1V8DA 5KHOC 1UODA 1Y9AA 2JFVA 3EDRA 4KGVA 4UBKA 3U17A 4UCWA 1ADYA 3FOFC 1TZCA 2CFSA 2YBEA 2V74B 4J2HA 4N3NA 4W1RA 2O2YA 2V7XA 2O1EA 2Y2UA 2ZRDA 1GPJA 1FU8A 1IBCA 2BFCB 2CLLB 3UMCA 5JAUA 3B3GA 2IKSA 3MUNA 1JPJA 1LA2A 2IHBA 1P4HA 3N39C 1CUYA 4EG5A 3O2JA 1KC1A 2JBAA 1TD9A 3UAOA 1K7EB 1Q5PA 3IHKA 1H69A 1RJFA 3RVNA 3M81A 2XWJI 1DFIA 4PICA 4ZGBA 3A2KA 3D4IA 3AEYA 3IDSA 3CWQA 5LJIA 2BL4A 5AIBA 5BYKA 3V3TA 1G5IA 4UPEA 3W5BA 3D3QA 1JNYA 1WPXA 4BUCA 2J3MA 1DLIA 4CMGA 2PJRA 3VAYA 3W6NA 3KYJB 2WTNA 2XUFA 1X86B 1BJRE 2ZRKA 1GAJA 1C2TA 3WGLA 1KSFX 4UUMA 2W11A 3ZH9B 2F8LA 3QU2A 2IHKA 1E1QD 3IELA 4WA7A 2IA5A 3TW0A 3GEEA 1ZUNA 1FOEB 4FJ1A 3DM9B 1DO8A 3AI3A 3H1TA 1E60A 3EG9A 3L0YA 2E1RA 2HQSA 2G09A 5AI9A 2EL7A 5JNVA 3LP8A 2PKWA 4KXFB 3V00A 4CM9A 2G5TA 4KGZA 5I7RA 1FE8A 1ENPA 1FP7A 2HMUA 2OHOA 1CKEA 2I66A 1TQ6A 4IO1A 3AVPA 3I8OA 3ROFA 3SYTA 3SD7A 3VGJA 2X5NA 3ZCVA 3BREA 5KNCA 1GCGA 1FBTA 1C7QA 4EHJA 1RAEA 2R4QA 4HZIA 1PEYA 4M38A 4UNRA 2CXQA 2R47A 2PBLA 2WM9B 3HN2A 2TSYB 3M70A 1IY9A 4KEAA 3QPBA 1X1RA 1H2XA 4DDVA 5MHTA 2ZAOA 2JKZA 1ONOA 1EWRA 4IM7A 3LPNA 1LDMA 1DKLA 1IUNA 2WWHA 3MCAA 2O19A 3PDWA 4BV3A 1LVUA 4D4KA 2PGJA 2OLJA 1WPRA 3IKLA 2A9FA 1E5DA 4I1VA 4G4GA 821PA 2J1LA 2Z1NA 1BHJA 3LKDA 1JDUA 2OBLA 4GI7A 3ZNOA 1Z4OA 3BWEA 3A6JA 2RSLA 2GZ1A 5FWNA 1QJCA 1OYWA 1ZMTA 1RVV1 2P9YA 5IJ0A 4LCJA 4YPOA 2QN9A 1DE0A 2GUWA 2ZE6A 1T0UA 2REQB 2ZWMA 1U6KA 5A7HA 3UKDA 5LMUB 1UJBA 3FW1A 1VHTA 4U2GA 3EXIA 3RT1A 2WWYA 1XNGA 3LQ1A 2OAEA 2X4DA 3MUOA 3V5NA 2YQZA 1FQWA 1MA0A 1KZYC 3PGLA 4L5AA 3TD9A 4EFNA 5CLFA 3TIVA 4IDHA 2G0NA 3ZY4A 3B7PA 3N7AA 1SK8A 3H5AA 4LMRA 4EENA 1D0SA 5A06A 2GEFA 3TX2A 2UZ4A 4U7TB 3ONNA 1SB8A 1AU9A 2R44A 3LW8A 4MV0A 3SI7A 1T2DA 3F6CA 4OXQA 1EDDA 1W76A 1CB0A 4XAQA 4D9NA 1ZH4A 5HXAA 2C1XA 3KSRA 1GTZA 1SN7A 4DSZA 1Y5NA 1U8FO 2E4UA 3KKMA 3CNNA 3Q7RA 3UC9A 1E2DA 2HHJA 4PBRA 1H5NA 4IQGA 2FFQA 4Y2JA 1N2CE 1L5ZA 2JJ1D 2P4EA 3DQQA 3QKSA 1N4AA 3IUYA 3OMXA 3Q1KA 2L0XA 3RFTA 3VDNB 3ZU4A 5DYTA 4HNSA 1WAMA 1N5IA 4TSRA 4ZOAA 3QI2A 4D9CA 4QC2A 1IY2A 1THMA 5FQOA 2UZ1B 2XIQA 4BX3A 5BWLA 3F4KA 4R2IA 1RXSA 5G2OA 4MGIR 1E4VA 1U1DA 1JAXA 1U6IA 3DJYA 4DLTA 2GM9A 2QRHA 4BO9A 2DUNA 4HBGA 1QX4A 4K6FA 2HF8A 3VPXA 1QO7A 1XIVA 3QXCA 3BK1A 5JWHA 2VQEB 2ZI3A 1KKLA 3CRVA 1I4DD 1KYIA 4GZ3A 3EZLA 2Y05A 2DSTA 4MWOA 4DN6A 3Q1LA 3A3PA 1E1QA 3HADA 4TKVA 1HDGO 3ML1A 1DMSA 1JT2A 1OFHA 5GJCA 1WCWA 4HOYA 4UVEA 4LJLA 3FTEA 4MYRA 5EXEA 3DBRB 4FSHA 1ETHA 1RRCA 4MQEA 1HEUA 2JGJA 2RKOA 3UWMA 3SWWA 2F3TA 1GZUA 3R3YA 2YYZA 2JAQA 1P45A 1U0HC 4L2IB 1KR5A 2NNWB 3DKIA 1BHO1 3IQWA 3R5KA 4V3BA 1I9GA 3UWKA 4P5DA 3MELA 2HTEA 3RAGA 3ONEA 5FLKA 1N5DA 2R8ZA 3O75A 4FUQA 2X76A 1QZTA 3VPBA 3IE1A 3LC0A 2QUJA 2WJPA 1V5FA 2FPUA 3PLNA 4XE5A 1DXOA 5FNVF 5HNKA 2ZUWA 2DHCA 1KI3A 4OHWA 5AO9A 3BIOA 3PFKA 1WHTB 2M32A 4J0QA 1Z6QA 5I3ZA 4RMNA 3SFVA 3KKLA 3ZGYA 4OI0A 2V03A 1L4MA 3PNLA 3VO1A 3R40A 4NKRA 5GP1A 2F48A 3BEDA 3AHDA 2IQIA 2P9GA 4KACA 3UMSA 5CVTA 2B36A 3UJ6A 4TUYF 4UNQA 2HMTA 2R6AA 2CE2X 1TPYA 2X22A 1QR2A 4GYWA 4YR9A 1OJ7A 1KYTA 2G36A 2GN6A 2I34A 3E8XA 4PFSA 5KVCA 1CVLA 2FQWA 2C7GA 4KPGA 3QY0A 2HCJB 5MF6A 1SRQA 1GQSA 3G8BA 4NBLA 4R7TA 1E1RD 4BZQA 5EOVA 1VKZA 1Y98A 5CEJA 1VRVA 1T5LA 3HNPA 3VBEA 2UYCA 1CFZA 1IU9A 5TC4A 1CZLA 1EU1A 1P81A 1YV9A 2QRKA 2GN2A 2GXSA 1NV9A 1M2VA 1ONSA 3EXG1 4IEEA 4LUCA 1NURA 2RG1A 2W2OA 4K28A 1CUBA 3MN1A 5JS7A 1MZPA 3AX6A 3IUJA 1XD8A 2JAXA 1SCJA 1UP7A 2HDNB 3P1JA 1T9DA 4PG5A 2OGUA 4YRMA 1MEEA 2ANBA 4TTIA 4FD3A 4LSGA 2X2EA 1YWGO 3DEZA 4DCVA 5A3QA 3FI9A 4C01A 5CD1A 1TJ4A 4IMJB 1O57A 3U7GA 5KNBA 2BM9A 3NOXA 1UBRS 3G2PA 4KL8S 5IF3A 4J91A 3E23A 5LPNA 3BTUA 3GFQA 3QX8A 4PSCA 2FUNB 5GGXA 3W5SA 3HCWA 1KU6A 4O2AA 1ZIYA 2PAFA 1J25A 2UXDB 2YHBA 5BSFA 3RAFC 3RUCA 1SHUX 5FJJA 3VGPA 3FZNA 4X65B 4KO3S 1J8FA 2PQ2A 3QUQA 4IVPA 1HG1A 4V03A 1U0OC 4CLRA 4YCCA 1JDJA 2OYRA 3QWFA 4BBZA 3S0JA 2OSBA 4U7FA 4BO8A 4IDBA 4YAEA 2IGBA 4B4UA 4RCZA 4WERA 4X00A 5FWDA 4L4SA 3V80A 2IYZA 2PYDA 2VJMA 3CVXA 2J7PA 3G5UA 4OQFA 5UKDA 2W2QA 3EAFA 2FWBA 3C7AA 3CRW1 3WNVA 2F4VB 3BD6A 3CY6A 1UM9B 1FFXA 4RS3A 4QDTA 3GB9A 3QLUA 3E9RA 1E61A 1H9AA 1O9HA 4HGYA 2VTBB 5K05A 2IYVA 4RMHA 1Y8RA 1Z35A 2X0FA 1QVAA 5KO2A 4Q6BA 4IFBA 2VKQA 1CB7A 1W36B 3A28A 4JY7A 3W5AA 4RELA 1E6MA 1IG3A 4JFAA 3NBAA 2ETVA 4UBNA 4AU1A 3R20A 3TL6A 3AIOA 2F9MA 1JI3A 1R12A 3GBPA 5AOCA 4Z53A 3UY4A 2OTCA 1QU2A 1TECE 1JYSA 5C34B 1UKBA 2PKRA 2WU4A 2XUQA 4LVCA 4OI4A 5DNEA 3GLHE 4PO8A 4H16A 3EWNA 3MGKA 4JB0A 4YP9A 1KVUA 4AJNA 4D3FA 4QBKA 2MSWA 3W0LB 2W9XA 3CF6R 4F92B 5KJ6A 3EPRA 2R2GA 2EF0A 2C8LA 3PQ5A 4HI0E 3MTAA 4UKDA 5CUQA 5F1YA 4JLWA 5GQSA 1TIPA 1RWBA 2DF8A 2H1WA 3WJAA 4LZJA 1GUAA 1Q1BA 1EM8A 2H6EA 2YCLA 1TTTA 5LWQA 5K0TA 4KWCA 4RVHA 1BMTA 2CXSA 1P1IA 4Q7EA 1PWXA 4PU0A 2ACKA 3TIIA 2R79A 5JCOA 1KVTA 3UK0A 3H18A 3BK2A 3CE9A 3EZFA 3L6OO 2WKWA 2AOXA 2QRQA 5CIQA 4ZVNA 1XZMA 3DXFA 1YRYE 4YV2A 1JJFA 1EQUA 2XY4A 1X7WA 4M8KA 1G5QA 4YQEA 3U61B 3HO1A 3A25A 1MHPA 3BGIA 4ZO9A 1UT5A 2G7MC 5AKZA 3F8WA 4L7QA 4QDJA 5TMDA 4ZVSA 3PU6A 4EW2A 2EXXA 1N1EA 2AX3A 1N2HA 3GOQA 2EZTA 2H4YA 1EDZA 1XA3A 3LT4A 1FYVA 4JJKA 2YNMA 3LUCA 1GTJ1 3H13A 3KTAB 3TJZA 4AG5A 1KTVA 1RMTA 1QF9A 2QPTA 4F2GA 1PQPA 2YXEA 4DDWA 4BB9A 5JAIA 1Z62A 2IYWA 3PJGA 4LX8A 2DY0A 1PHPA 2O8NA 5T6MA 2GM3A 3PYMA 3TAXA 5BR7A 1K9SA 4D25A 4U7JA 3BHMA 4D42A 1T24A 1U9IC 1P1HA 3CPJB 4DZRA 3CNEA 4YI5A 4DF3A 1NXXA 1YJBA 2BOVA 1Z0FA 3AXSA 3EDQA 1N25A 1WPQA 4OLHA 3HVKA 4NHEA 4OM8A 1DKRA 3IO3A 2EERA 3NDIA 1ZNWA 3L6RA 4CM1A 4L07A 1CEXA 3JAMA 3IH5A 4WK4B 5HP4A 5JJKA 3D7NA 2X7JA 1V3UA 3P45A 3TLXA 1XDGA 1OU4A 4MVWA 1YZGA 1GPDG 4GP6A 4YPFA 2IU0A 3I8XA 1T6YA 1VL6A 4OYHA 2M6SA 4Q1AA 4BNXA 4URYR 3OCCA 5H16A 3REGA 5LBUA 4UZSA 4H1WA 1OXTA 2PY6A 4I14A 4PZAA 4A8JC 4B3HA 1MX5A 2Z3ZA 3AJDA 2R1ZA 4Q4LA 4WUTA 3ENWA 2Y8EA 3DTVA 2OFXA 1SXJB 3NWOA 4G8BA 5E8RA 1ILWA 3WGKA 1Y1SA 4HEA1 4AJ1A 4AT1A 2FZ5A 4RD6A 4P0TA 3T5CA 2GRAA 8OHMA 3DFUA 1I7PA 1RXUA 1VI6A 3QEJA 4V0QA 5AQ1A 3V7WA 1FSPA 1N7GA 2QTFA 4IVQA 5CJPA 2V65A 1C3LA 3JQAD 3A3OA 3QYAA 1QYIA 1MJFA 1WMSA 4TLBA 5J40A 5JYDA 4QT4A 2AE2A 2JLZA 4ZT2A 3D7KA 2JJYA 1FJGB 2BFBA 4EO9A 4TRRA 1C4WA 2PNJA 2HEGA 4MP6A 1QRAA 2DX7A 1GCOA 2Z08A 4FGUA 4GPTA 4BCBA 4DLZA 3II6X 3DW1X 2CLOB 5K6AA 3SHOA 4UNSA 5DBHX 5IUNC 3OQJA 4RIFA 3KZMA 4XZ3A 5EGSA 2C95A 4G6ZA 6ADHA 3IILA 1U7OA 4B33A 1NASA 4D0RA 3L40A 1I4EB 3I53A 2JD2A 2GNOA 5BQOA 3WQHA 4HFJA 4YROA 3DAYA 4PG7A 4ZAZA 4ALMA 3AKZA 2PV7A 1ZG3A 1YE8A 3K70C 2XZOA 1NMQA 2P9ZA 3A1DA 3M33A 4RVNA 2ZR8A 1XUOA 1B2LA 2C7BA 4YAIA 4V38A 3ASZA 3ZD7A 3U62A 4IMRA 3BWMA 4LWPA 4DNXA 3AM1A 4HYTA 2FQ1A 1XD2B 4UEJA 1DTWA 4IDCA 1YBHA 1E5QA 2OQRA 4ON9A 3RUFA 1HE4A 1SBQA 2QAJA 1S7GA 1TYBE 3C15C 3OF3A 4HQ6A 1RWMA 3WZLA 4KHPB 4XQEA 1G59A 4NBKA 4MDEA 4LMPA 5DPMA 3P2KA 4IAOA 4UZFA 4BBPA 2NUTA 1YKGA 1C0LA 3M6XA 3ROGA 1JRLA 1K5DA 3SM3A 3K9LA 3N9IA 3LM8A 4R5HA 1RYMA 3B9QA 4KAXA 1WSBA 2Q0XA 3G9XA 1LBEA 3HDQA 4IJUA 4A16A 1FDOA 4W4TA 1E2EA 2Q5HA 5DGXA 4E46A 2J3LA 5FPPA 1M34E 1UK8A 1BXRA 2ES4A 1ULUA 1PUJA 2NUPA 1Q44A 1ZGCA 3GPCA 3I01M 4TQGA 3ZLUA 3JQ8A 2J6BA 5LA6A 2YXPX 2PMCA 4WW0A 4KE9A 1KDYA 3SS7X 1Z5WA 1BYIA 3T1VA 1G4AE 2A6PA 2BAGA 3GUZA 1D9ZA 2XWPA 2ZT8A 1VHJA 3AQ4A 1R2QA 4PVDA 4YP7A 4GYYA 2JFBA 5AMXA 2BFFB 4R69A 3LXUX 2W4MA 3AKDA 3T5MA 4YWJA 3ELBA 2HDWA 4XCVA 2WPNA 2ZRIA 4Y2PA 3TSOA 5KWVA 2RH4A 1GG2A 3L7MA 1CRLA 2XT6A 1OYVA 1SFRA 3KYDB 1ZL0A 3UCEA 3FCAA 4MJXA 5DEOA 2Y9PB 5F98A 2P67A 4W7IA 3I2GA 3TMAA 4IKEA 4TMYA 1Q92A 1O97D 2C3UA 4MPPA 2O5VA 1HOXA 3KZXA 1MNAA 5A4KA 3I83A 4NATA 1PVDA 2ZK7A 2XR1A 4JOCA 5GJVC 3CZPA 3ZD6A 2PX0A 2Q5FA 4I5EA 2FQXA 3V1KA 2OUKA 2OZLA 4QEZA 3ICCA 4JJIA 4RW0A 3R4CA 4ZOLA 4QJBA 1H94A 4RHYA 5D6OA 1NVMB 3ZKWB 1Q6ZA 1PBTA 3IC5A 1M1YE 1UFVA 3D5EA 2WPDA 2XTZA 1GL3A 1CQIB 2HCFA 3DMTA 3LHKA 3R3ZA 1VJGA 2ZJOA 2PX2A 4JBYA 3WK7A 1K92A 3K2IA 4GRIA 1W75A 1OVMA 1SIBE 2IOQA 3F1KA 3ZW9A 1E0DA 1F14A 2NPIA 1Q7BA 3LPAA 3Q6MA 5KZMB 4Z0NA 1O3YA 1PEDA 5LZ8A 1C30A 4M3NA 3ZCRA 1TJ3A 4EY6A 2I2WA 4NZOA 2ZYVX 4BNNA 4WWHA 1IXZA 3VOAA 2ZRCA 2P30A 3L8HA 4Q9NA 5IM5A 3ZD8A 1QIFA 3N0WA 3U3KA 1OLXB 1UZAA 3L7LA 1O87A 4HX5A 4EHBA 3BMNB 1OXMA 4OTZA 1CVIA 3I39X 3KO8A 5CFZA 4K9KA 4LCEA 5KYTA 4Q47A 4KXNA 3FFTA 3ZGNA 2XTMA 3E22A 1RHUA 1N8TA 2HJVA 4BY9E 4GZ5A 3G0IA 2KB0A 2IYEA 4NE9A 1C5KA 1KL7A 1NUAA 2PS0A 2QNIA 2K5UA 3H2JA 2IYTA 4MAFA 3U7QB 4BQNA 3DDZX 1FRZA 2O3TA 2Q6TA 3MJVA 1RPZA 1V8ZA 4MEAA 3C14C 3E48A 4QXPA 4LYHA 4KP7A 5CDYA 1NW6A 4JIGA 3EGOA 4MWSA 4MYTA 2WJHA 2WNSA 1PFGA 4D9KA 1BEEA 3AETA 1D6SA 2AJCA 3ESRA 1VBKA 4L08A 4CLEA 5K0EA 1U2RA 3DKVA 4PX3A 5FOVA 4DR1B 3S55A 2OEPA 5C1DA 4LJKA 1FFBA 1M73E 1PE0A 3TB6A 3CTPA 3TNJA 2AT1A 2P3SA 3ENZA 3ETNA 4GNKA 5SICE 4N49A 2QBYA 1A9TA 1NN1A 5TGDA 2JAWA 4RNDB 2H2HA 2ZYAA 3BBPA 3KELA 2VRNA 3JALB 1Z2EA 2PV0A 1YVDA 3NPAA 3I6YA 4NU0A 3QG1A 4D5GA 3ZXIA 3N6XA 1SUFA 1U8UA 4P3NA 3R3VA 1L3IA 2HQOA 3FYUB 4YJGB 4UVHA 3E27A 4PX5A 1MB9A 4FHCA 3SJ7A 1VSUA 2VNHA 4M1QA 1XNRB 4ITUA 1GPH1 4CMEA 2BF7A 3BSSA 1SOVA 5T64A 4IXTA 5FADA 3L6DA 3N87A 2HR1A 4ZT6A 3AKCA 3NT2A 4DTCA 1M0SA 2C3PA 3STXA 1U8YA 2D4AA 3DFIA 1M6NA 2FSVA 1T15A 4KK3A 1E20A 2JLSA 1GLVA 1AKEA 4F5EA 3HYNA 3MFYA 4V0SA 1DBPA 1TO6A 2YINC 4EPRA 4J49A 1VBMA 3DLHA 1QORA 1SBNE 4US0R 4PPNA 3IIEA 3R5SA 5ERGB 4IRMA 4G1CA 1CTQA 1J07A 1X1DA 5AM0A 4CMIA 4O4LB 3FETA 3BJMA 1GQFA 3HKBA 2OR3A 1EWQA 2X58A 3EIOA 3LYHA 4ACBA 1J8YF 2VBGA 1JTFA 4HDOB 2ORYA 2Y9MB 5CTJA 5DP1A 4RE5A 3BK7A 1UBKS 2NYAA 2QG6A 2RHBA 4G0UA 1VLZA 1UZNA 1X8KA 1Y80A 4DBLE 2CHGA 2FMXA 3I9LA 4HH0A 7REQB 1CG6A 2ZUSA 1D2EA 4G0YA 3AINA 4XIFA 3SSNA 1PR1A 4LXIA 4TSKA 1UXJA 1U3UA 2EKQA 4LC9A 5F7XA 5EEHA 3VR0A 2IWRA 3L9WA 4UNPA 4HDNB 1XU4A 1CUEA 1R4NB 1FUIA 3EGEA 3MM4A 1E9VA 2E5WA 2ZSBA 3V2GA 5B64A 3HXQA 4ZAWA 1OAKA 1L5WA 1SC6A 3UHPA 4JSRA 1DCFA 1PI3A 5B6PA 4HEJA 3KYCA 3NWBA 3C6XA 4ENVA 1XA4A 3HZHA 3UUEA 3AOGA 3NHJA 2GJ8A 5FEMA 3QKWA 1MAUA 3TBFA 4AMUA 1XPUA 4KNYA 5B53A 1QZ3A 3MWYW 1V45E 1MR3F 3CISA 1HL7A 4Q3EA 2DWOA 3C3JA 4TN5A 5I3CA 1S02A 4F84A 2R96A 4Q3OA 2I65A 2OBBA 1FLAA 1XU7A 5G3ZA 3ZBTA 3Q0TA 1IRXA 2J5RA 3G7NA 2B0JA 4JEMA 2EP8A 2FOIA 2NQTA 4LE1A 5JHHB 2JJQA 5KSOA 1J70A 1B4DA 1W6RA 3L2OB 4W1PA 1PKXA 4ZAXA 4C1BA 4BGDA 2XCRB 2FN3A 2Q9CA 3KZCA 4WCFA 5JMOA 1KRWA 1OAOC 1Q3TA 2ZIXA 3QHQA 3L0BA 3T4UA 1P5FA 1P6XA 3TNLA 3JVIA 3ZU5A 5JXIA 2XB2A 1LDEA 4RZSA 1YR1A 4KK4A 3T0GA 1ZJ4A 1KE2A 5A71A 4X1KA 1BROA 2QI9F 2JFFA 3HDYA 1SG6A 2A7QA 2E1PA 3IDFA 3KSMA 4OQLA 4QODA 1DO2A 2XX3A 5FWYA 5J58A 2JIMA 2XECA 1QVVA 2HBZA 2QMYA 2UAGA 5KHAA 5DO9A 2DQYA 5EEGA 2DT5A 1KO5A 4QGAA 4BV9A 1DBSA 1Y89A 3DF7A 3PA8A 1XTKA 4QUJA 3RG8A 4BL5A 1Z29A 2N75A 5EMKA 4YR7A 3QLJA 2PFSA 1P6UA 1ZJ5A 2WE8A 3VTFA 4CUZA 3H8JA 3E5HA 1AQYA 1W30A 3IBFA 1AH2A 3F7NA 5HF9A 3HYTA 3OZDA 3TNYA 4DMKA 4KXMA 2RGYA 2G25A 4HDRB 3PD0A 4L3OA 4P34A 2AG5A 3LK6A 1J33A 4FOSA 4OXKA 1D5WA 1QHFA 1U7TA 3KE8A 1QGAA 3L82B 3OIUA 1Z15A 4KG7A 1KK1A 4P3XA 4A1FA 1E18A 1MLDA 3WICA 1RXYA 3GN2A 3BE6A 2WUWE 4L5YA 3RSZA 2QZ4A 3H6GA 3VZPA 4BO3A 1SAYA 3JAKA 4WZZA 4CKBA 1ZONA 3CNQS 4PAOA 5BT8A 3ZLBA 1E9AA 2ZRLA 3JZAA 4UEWA 1JW9B 3GG9A 3GDHA 3AR9A 5AW5A 3STVA 1RQNA 2J4DA 3FWPA 3Q7EA 4ZJPA 2PWYA 3VOBA 3CZCA 3QFCA 4DS3A 1F2VA 3OZCA 5BWNA 4MWZA 3CH4B 3FZYA 3H0EA 4J1QA 2LCIA 3AF3A 4JA0A 4RF4A 1XAJA 4RPJA 5EIAA 3HVHA 4BGIA 5JMWA 5MN6A 5HHTA 2QMZA 3G13A 4K46A 3H4IA 4EZIA 3EULA 4O6VA 2H59A 1PNQA 2OY0A 3I30X 1NBWB 4FONA 1PKEA 2C57A 3WJ7A 4DCOA 3IBSA 4MCHA 5CW2A 3QVSA 2ICAA 3F49S 4FX5A 4TGLA 3RHZA 3FWZA 3WIEA 4ODIA 2GXAA 5B6JA 3OPMA 4BKQA 2A9KA 3LTNC 3OESA 1B6SA 5TE9A 3SE0A 3PNPA 4P3KA 4G0XA 1ACMA 4BNKA 2C2GA 2RAVA 1N2EA 1GSIA 3FMPB 2JHPA 2UYYA 3KT0A 4XJSA 1PD1A 3ZDCA 5K20A 3H9GA 3TQOA 1TM7E 3I9JA 4N03A 1NVFA 4OD0A 4DEXA 1SMKA 3Q3IA 1L4KA 3CZRA 4HH3C 1RAFA 5H4GA 5IVDA 3HJBA 1XVAA 3PCTA 4Y6RA 5IJZA 4ZCTA 1LLQA 1X70A 3V4ZA 3GA5A 4E4YA 1I6KA 3AR7A 5J2UB 3SKXA 3JRNA 4OQDA 2Y4OA 4UATA 3UUWA 1DWUA 2X5JO 1RHMA 3RVDA 4L5JA 3S1AB 4HLQB 1KSHA 1BKDR 4EVQA 4WLUA 3KWMA 2V97A 5DP2A 5EKUA 4C78A 3RS7A 4Q3AA 4EGJA 5IKMA 3KLPX 4URVR 2MYUA 5DSZA 2V4MA 4RVOA 5FBKA 5IS2A 3RM3A 2QTRA 3D3JA 3NTUA 4NYMR 5IYZB 1ZKDA 2ORWA 3ZVMA 2LE0A 3D8NA 4OK3A 1VJ5A 1FP4B 3EQ6A 1HE8B 2XHEA 3P97A 1Z7YA 2RGRA 2RGXA 3RAEC 4XARA 4E5MA 4CTNA 5U1PA 3ZR4B 4EMBA 1Z18A 4C0AC 2OK8A 3N6RA 1NU8A 1FFYA 2VDQB 4G67A 3IPLA 4FBMA 1RKQA 1S4MA 1XPJA 4DW8A 3WRVA 1VPDA 1WMDA 3ZH2A 3SAJA 5EIWA 3LYAA 3O21A 4U6SA 1TAUA 5IH7A 1PR5A 4OX9B 1HT1E 4P6VF 1WQ3A 1YUMA 2IJGX 2HD4A 1JIQA 1R5BA 2J5QA 2N1BA 3F71A 3LOQA 3NOQA 4J4TA 5HDQA 5C51B 4W5QA 3FM9A 3X1DA 1GZ6A 4M6WB 1N75A 3Q8XB 5G02A 3UA3A 5BN5A 1JXAA 3O31A 4KXYA 3SVTA 3FE2A 1TUBB 2XYHA 1J5EB 1C9MA 1CJMA 1CJUC 5B2EA 4WFKA 2JLRA 3NALA 4LI0A 3RVSA 5BMVA 4C0XA 4HNGA 3KHUA 2GEJA 4IEIA 2C4HA 1OJLA 5TMEA 5FA5A 5CFRA 2OV1A 4ALLA 1SCUA 3VKWA 2Q3JA 1ZOOA 1KWKA 1T29A 3PPVA 5FBHA 2EWVA 4JGBA 5I4BA 4RACA 4MAAA 2OB2A 3QWBA 1P5RA 4NE2A 2OFOA 3U4HA 4AZ3A 2A3RA 3AKYA 3PHLA 5DHSA 1EDBA 1TE2A 2IPOA 4CCAA 2XDAA 3DKKA 3M3HA 2CCJA 4Q19A 3A11A 4GBMA 3R7WA 1GKUB 1SZCA 3QWIA 1KYXA 2VJNA 1VLLA 1ULBA 4YCSA 3NS7A 4V0RA 3HSSA 1U3WA 1S9DA 3BMQB 3KSAC 1FNSA 4ZU1X 1JHZA 2EG9A 1M74A 1B7GO 1P0CA 3PDUA 4Q3KA 2YY7A 3D0KA 1GGMA 3SBDA 4C22A 1JG6A 4R68A 5BSMA 3FDFA 2G83A 4HDKA 3K6JA 5LLTA 3B6ZA 3HBAA 1XALA 1TQ8A 4BASA 3R4VA 5JZ9A 4ML3A 1G98A 2ID8A 1JLKA 4R2WA 3LC7O 4R1LA 3D8UA 3FH0A 2HA7A 4AUEA 1QZZA 3FG9A 3MJDA 3HXPA 3Q3HA 3DAHA 5F5XA 2DH6A 4PC3A 4MVJF 1Q7TA 1SC4A 1XEXA 1B8UA 5L3ZA 2JEZA 3WP0A 5AXDA 3KJGA 1W2WB 3KR0A 1PGQA 5TMPA 3IPAA 4J7UA 3ZCXA 2C2ZA 3FHJA 2ERCA 1M5TA 1PFKA 5K3SA 1NXPA 1V8PA 4BJ3A 2H1SA 1S6YA 1IZ0A 2RGGA 4CKCB 3V2UA 2GARA 3KM0A 4N5MA 3SG0A 5JSFA 4IDFA 3LVQE 1FL9A 1ZSVA 2CF5A 1YBAA 2I67A 4RV4A 2HSZA 2Y1DA 4FE7A 5AVOA 4YMSA 1FP1D 2KS6A 4RFLA 3QMPA 3P8ZA 5EUBA 5BWOA 3BDAA 4IJWA 3G0DA 1CY7A 2X1VA 3GP3A 1DJOA 3G89A 4ZEMA 1ENZA 1UWVA 1UXHA 2Q7DA 10MHA 3BL6A 5FTWA 3T1OA 4GXRA 4CMCA 5K01A 1ABFA 3HM9A 1LPNA 1IHDA 3K32A 4IH1A 4CW7A 1U7PA 2QX6A 2EBHX 4AZSA 4HGNA 4HDMB 3OZWA 2ERXA 3K7EA 3B52X 3NIDB 1AGNA 2A94A 2V0NA 3FSGA 2Z3VA 3SZMA 1O9GA 1P7ZA 4DM3A 4ZYXA 1ZUHA 2MDTA 3B51X 2Y1EA 2W2LA 4Q3LA 5DM60 4C4PA 4UE2A 1CUIA 4BVEA 3NPMA 5JEEA 2FZVA 4K6HA 1VIDA 4LY0A 2KLBA 2XKAA 1AKRA 4MW2A 4OAQA 4AWBA 1J2UA 2XTNA 4R1NA 4AX8A 1GG9A 4M83A 2IK8A 4GPEA 1MH9A 4Q6WA 2QIPA 3B78A 2LRHA 3QTLA 2ZDHA 2VF2A 4GBED 5M34A 3SDSA 1SQFA 3OLVA 4UHKA 4ENWA 3K31A 2OECA 2P91A 3AL2A 3D2BA 4UD2A 4UAGA 5EIBC 1KSGA 2R62A 3USZA 4ASUD 2DC1A 4EA9A 3NAMA 4MQ6A 3GLGE 3BORA 1C30B 1VG9B 4M1EA 5BWBA 2HLNA 1Y5RA 4HLDA 3VH2A 1PIWA 3B13B 3G5TA 4JLMA 2HA2A 2VWGA 3PRJA 1BQEA 2P9EA 4YMIA 2ZVQX 1MTOA 1JZTA 3HCCA 2HJRA 3PRYA 4CT0A 4XYBA 2AW3A 2HBYA 1IXSB 3ZWCA 5BUCA 5BQ5A 3GA0A 2RH9B 2JI8A 4IDPA 2HFJA 3AM5A 4QSHA 1EFKA 2H3EA 5I7UA 1PGPA 2K7FA 2GFQA 1Z2OX 2OA0A 4WEOA 1KQGA 2C84A 4LXYA 3SEAA 3UW3A 3LC2O 1TIBA 3F6RA 4KQGA 1WUTA 2H9IA 2MYPA 3N2IA 2V4ZA 2WSSD 4DEVA 4F9EA 1JHYA 1M2HA 4ZPXA 5TY0A 5LP6F 1HG0A 4QU8A 1OWPA 2VNKA 1R9MA 2IUTA 4YGYA 1M10A 2PD3A 3FN4A 5DOZA 4QEDA 4L57A 1ESCA 4V0LA 4EB3A 3ZQ4A 2IEIA 1PTJA 2RCYA 2GF9A 3REQA 4EHDA 1T6ZA 1U2QA 2QR3A 1JIJA 3NV7A 4ES6A 5DN9A 1R5NA 4NBSA 5JQGF 4D02A 3FX2A 1UIRA 2HMWA 2J6HA 4G65A 1F8XA 1RAHA 2DCUA 1M1YB 1MB4A 2IP4A 1YRBA 1ISSA 3ANNA 3D0OA 3KQSA 3EVDA 1T5SA 2W2NA 1JQJC 4RMGA 1RBQA 4UJ3A 3X1WA 1D8TA 1E3JA 3ZJ4A 1NVXQ 1WDLA 3RRMA 2F1IA 3EFOA 4C4RA 4FDLA 3EODA 1QAMA 2BFMA 3HGMA 2HV8A 1S1CA 3UJDA 1WW8A 2EDCA 2OV2A 1SD1A 4JI8B 1R0CA 1R74A 1RTTA 2CEAA 2CZQA 3NBFA 5EJGA 3RC7A 1TM5E 3RUPA 4ZV7A 5FORA 1WBJB 5ICEA 5FOUA 2COEA 3WNCA 2P3OA 4CVNA 4JKOA 1FTWA 2ZIVB 4P92A 2JPDA 4HJXA 1J7KA 2AOVA 3GO4A 5TR9A 4OVKA 3E5MA 5DBGA 5JBNA 3QEBZ 2B4YA 2R60A 3QV2A 5CK5A 3OLYA 5JSKA 2TECE 1ECCA 4MV8A 3TNDA 1Q84A 1L7QA 1RXEA 4KHZA 3AY3A 2NTYC 3BCUA 1KFJB 3KAPA 3Q7PA 4FMCB 4LG1A 4NE7A 4AUMA 2D7JA 4J1TA 1EXVA 5ALDA 5LUAA 2R85A 3W8RA 3PNBA 4MRVA 2NV6A 5DK6A 1YACA 1JNXX 3OCXA 2H2FA 3K8YA 2JFQA 3I6IA 3MS7A 1H1TA 4UEQA 3LQQA 1IY0A 1VI5A 4LRWA 1X1AA 1RP7A 4NZYA 5E0KB 3ABSB 5T57A 3D7MA 1SGWA 3H97A 1JKMA 4BRSA 4DIEA 1YZQA 4U2DA 2V9PA 4FC6A 1KZGB 1XCLA 2Z8YA 2DQ4A 3ZHQA 2PQMA 1H1LB 3OIGA 1YC5A 4PBTA 2YOFA 4KE8A 4CI0B 4CM4B 1W47A 4IIJF 1T4BA 1G3RA 2M1ZA 2I91A 4QAJA 4YRCA 3IP9A 2QMEA 4YYEA 5LD2B 2VT6A 1Z4IA 2WD7A 1Z6XA 3OE1A 2REOA 3L8YA 4N5NA 2E4ZA 4QYMA 4Q93A 1TYEB 3V3KA 4F46A 3LBYA 5C46F 3SEFA 3PQEA 4MRRA 1KFKB 1IHPA 1TEVA 2WUDA 4V0MA 1XGKA 1XQVA 2ATEA 1U0JA 5LP1A 3A1VA 4Z9BA 5HZMA 1V4VA 3VR4H 3IUQA 3FLEA 5C8XA 1X2EA 4RO0A 4C03A 1GILA 2FPMA 1VFNA 4ZO8A 3K0CA 3KPJA 2QGFA 2DM6A 5JAOA 4BWVA 1EWYA 3OKAA 5FOTA 1QB8A 5JAZA 2YHIA 3FROA 1QBGA 3EIWA 3Q12A 4HRYA 2HCBA 2RK6A 3DCYA 1T4CB 2H63A 3D1JA 5FNZA 2VBCA 1PJQA 3IP8A 3NG1A 3RYHA 2ZYRA 3HZRA 2CEKA 4HWTA 3HACA 4UNNA 1ZJZA 5AUOB 5CR9A 1H5QA 4FFOA 1IM5A 1D9XA 1QHHA 2CUNA 2GAFA 3CNOA 3NHWA 5HF6A 2WV9A 2C8JA 4JROA 4I81A 1YAHA 1NC1A 1WP4A 2DHDA 2H4XA 3N75A 1OX4A 5FL7D 3T9CA 1E0KA 2P0YA 2W6ID 3FPFA 3EHEA 1WEKA 3IP6A 4INOA 4BFSA 3MMXA 3R5XA 1ORDA 4PLPA 5K8LA 3PX3A 1WSAA 2OHVA 4JOQA 3QNWA 2GM5A 1U9YA 5ELLA 2FFBA 3PWSA 5AW1A 3IIIA 1TF5A 5EJEA 3JQRA 5FB3A 1GTMA 3OFSA 1KEWA 3TKLA 2A9RA 2ZJAA 1V2GA 3SDZA 1LVGA 4GD3Q 2FSSA 4BIIA 1M8KA 1P1FA 1XXHE 2GUGA 1AO0A 1IXRC 2PZKA 3DTTA 4MDHA 2CUKA 1E99A 4DABA 4E6PA 2XZPA 1KK3A 2UUOA 3PF8A 3PFFA 2ADMA 5LYJA 5KYWA 4UM9D 1GDTA 3D3EA 4GE3A 4CDMA 2GKSA 4V3CA 1OBFO 2WA2A 4NJMA 5AVRA 2P1ZA 1WXEA 3G2LA 5JH7A 1FMFA 4P8RA 3ZHSA 1QIIA 2BGLA 2EJBA 4A8HA 3HJAA 4KXVA 2RHMA 3H99A 1RJ9B 1YQQA 3DC7A 3CG4A 3HCAA 3WBFA 4OB6A 2CMDA 2VAPA 5BV2P 1U2TA 2FA9A 3WLKX 2PUHA 3GLKA 2FH5B 2C9CA 3JS5A 3PT9A 4WXYB 1E6UA 3IEIA 4YCAA 3OTHA 5SY9A 4MPJA 2WHPA 1NT2A 4TYPA 4XW2A 9ATCA 1F6DA 2W6JD 3K9FC 3WIDA 1RXCA 4Z7OB 1T0IA 4H08A 1K88A 4EY5A 1KE1A 4L28A 5DXAA 3IMCA 2YQ4A 3D6AA 1CFJA 4KBGA 1O8CA 1NJGA 3U4QB 1EAYA 2AJ8A 3F47A 3NM4A 2E4AA 4N0EA 4FKMA 4MPRA 4BLOA 1PL0A 5HUJA 1EFAA 3UK1A 1ZM9A 4QM7A 4MS3B 1R6XA 1YOBA 4RULA 2PUEA 4Q12A 5BYJA 4PHCA 1E3IA 1WXGA 2AGVA 3H04A 3L4SO 3SZLA 4UCQA 1KOFA 2G9UA 2IYLD 4O8CA 2O8EB 3MRVA 1E5TA 3DF9A 4KQXA 5FULA 4KIUA 4MWEA 4ETNA 4TYWA 2A86A 3QIAA 3EEBA 3C5WP 2PMWB 2R8PA 5KSWB 3CPEA 4B7ZA 3F5FA 1T26A 3FSJX 5DHFA 1M2KA 1R0SA 1NT4A 4HRXA 3WL8A 1DTSA 2BMJA 2BC9A 1RZUA 1Z8FA 3AXTA 3PUWA 5EIHA 4EEXA 4E32A 3D3WA 1PNVA 4CIYA 3RIEA 1DKPA 4MI9A 2BI4A 5JCPA 4K9NA 3R6LA 1Q17A 3PDIA 3IXQA 1FB5A 1ZR4A 1EUZA 1USWA 4IMIB 4NWIA 5JY1A 1NNEA 3W9YA 1DRJA 1IFXA 2C0CA 2CXHA 2Q1TA 1QCZA 3NI2A 3CX3A 3WB2A 2ABWA 1PYGA 2G70A 3KPWA 3OLQA 3K0AB 4JJFA 4LDRA 4AWXA 2Q1XA 4FI3C 3WWZA 1AQJA 1YS6A 3TRJA 3FUTA 1FPQA 3LLVA 3WLOA 3GQVA 4BNGA 1L1QA 1FFCA 4Y1FA 3SEZA 2YMMA 4I1PA 5ESDA 3ZWKA 3A6KA 4FKZA 4RFSA 3KALA 1ZMRA 1QIDA 4FHFA 4TRMA 4Q3CA 4ZKEA 1ZI8A 1IBKB 2ZUEA 2YQ5A 2DERA 1LQUA 1J23A 1XD2A 2ZT6A 1J56A 3CZMA 2O23A 4BE4A 2VF5X 4JC4A 1WXXA 3ILYA 2O2CA 2XUGA 5ESWA 2XQVA 1J9ZA 4DCNA 4EY8A 4RTLA 1Z25A 2Y4NA 1OI4A 2XF8A 4WZAB 5B3AA 1KYQA 1NIPA 2P40A 1XXHB 2M1XA 1KQNA 1P61B 2VTKA 3NEJA 4UCXA 2HBRA 2HLPA 3ZQKA 1DJNA 4NP6A 1TT5A 4L6CA 3PCRB 1YL6A 2IEGA 4B87A 3HYSA 1U3VA 3DH0A 2CCKA 3KB1A 3KTFA 4B80A 2AOTB 5DX8A 5CT4A 5PNTA 2SICE 2X9LA 4M7PA 1H2YA 1L6RA 3F6BX 4WGFA 4JNCA 4QHSA 2Q49A 5CLGA 5GOTA 3DSRA 2HGZA 2FN8A 3JPWA 1JHQA 3LYLA 1IHOA 2EVWX 4WVFA 3SQLA 2CB9A 2W8ZA 5KPJA 4M0EA 1L1RA 1JLSA 1RLMA 1U9CA 2HJ9A 1T6BY 4K6CA 1PCXA 2WVHA 1BC5A 1PR4A 5CM2Z 5F78A 3R75A 2CJWA 3V32A 4Y98A 1NW7A 4FPXA 3VNRA 1XELA 2AI1A 1L1EA 1WZUA 3GCWA 4G97A 4RKEA 4PYJA 2ZT7A 3IBGA 3UA4A 1VSTA 4HD8A 5FOSA 4DSAA 5IFKA 3K71B 1TAHA 2RG7A 4FCVA 2A9PA 2DGDA 3UH0A 1K8ZB 3U3OA 3UF0A 4BCDA 3KQLA 1J5PA 1FCJA 1PV1A 1ZNXA 1NTOA 3HP7A 5FLYA 3UOGA 2DPMA 3OO1A 3G68A 4H7FA 4MH0R 5JD6A 3CT6A 4N8EA 2H7CA 3OCJA 3IVMA 4RLFA 1N0UA 2OMKA 1QYVA 5KYUA 2CGEA 5FUMA 1W4CA 2Z3WA 1EB8A 3OM1A 1F51E 3PEYA 5A4MS 3FDJA 3ONDA 3OY7A 2AG6A 4DLSA 2D74A 3HPQA 3BD8A 4C0QC 4EUKA 2VLBA 2GSWA 4MGEA 2ZS7A 4JUFA 4R98A 3VR6H 4A91A 1MO6A 1JJIA 2OZLB 2VDWB 1SU6A 3D5TA 3HU1A 1T9CA 4LZWA 2QU8A 4JUDX 4YLGA 2DPHA 3E9CA 4CIAA 2IRWA 1NG9A 3JD1A 4JELA 2PUFA 4BIMA 1C8BA 3RTAA 2NW6A 3H7AA 4JEUA 4Q4CA 1NP3A 2PMFA 1NNI1 3F67A 3OWHA 2VJYA 3H42B 4RGQA 4YRFA 3SXPA 3DTYA 2A78A 2DUMA 5EE9A 3VDQA 2OBYA 4AJPA 1B76A 1F8UA 2I2AA 4XKJA 4NCAA 2ZB2A 3GCZA 2INGX 4Y9RA 2ATIA 4L50A 4FCCA 2UYGA 3DOCA 5LZ5A 4NI5A 2AOWA 3JQBA 4R9VA 3F8SA 2I29A 3ISVA 4LBWA 1BXKA 5EI5A 4RD1A 3H9BA 2B25A 1UPFA 3HKEB 2B4AA 4UFNA 3LUKA 4IMPA 3X1MA 4ZZ0A 4OI1A 4QYIA 3COWA 3C1UA 3PHBE 2J8ZA 1PZNA 3WRWA 2QW0X 3KB8A 2J5KA 3OEHA 4GIBA 1PT9A 4BQIA 3L1KA 1ZA2A 3FCSB 1M54A 3N8HA 4B9AA 5DI9A 4J1SA 4KQ6A 1OLUA 1H05A 1E4OA 1TYAE 2VHQA 1FFEA 1U7XA 2WTXA 3AGQA 4FZVA 2ENUA 1SO8A 1O95A 1FFAA 3AEUB 1WOMA 4LBYA 4F3CA 1NWHA 4TPKA 3DZCA 3AP1A 5IUJC 5LYYA 2BI7A 3TO5A 3TLKA 5ADWA 3C6ZA 2VNIA 2OPBA 3EIUA 3ILSA 3Q6IA 3THXA 1NJFA 1VL5A 1UMDB 2FGKA 2C31A 3CR3C 3HY6A 1E2GA 4JUCA 4Z3KA 4NABA 3GPLA 3ANSA 3OX2A 5JD4A 2VPZA 1N5MA 1W29A 1FFSA 5HUQA 4UHFA 3OTOB 2I8LA 1B8PA 1KDRA 3FAKA 3UVEA 1C1DA 3UWPA 1G6KA 4L8YA 4NOKA 4WNAB 4EHAA 1U3CA 2JIZD 4PC1A 3HXMA 4BX2A 4LZAA 3R9KA 4X85A 3OJWA 3DBIA 3JQGB 5BUSA 1FS5A 3ZDZB 1Y4UA 2IE8A 1NMSA 2FSIA 3FIJA 1KA9H 3AF2A 3DWEX 3HZZA 5KTPA 1B23P 4I5DA 1GUYA 1D0IA 4IJMA 2Q9AA 1C29B 1DFHA 1XZPA 3DXYA 4HTFA 4PX9A 3JPYA 2RGUA 4YAOA 3R3UA 4JWTA 4DEYA 3OJEA 4HB0A 1ZM4A 3ITNA 4L0DA 1JWLA 3TTTA 4CCSA 3JQ7B 3N59A 3FZQA 3NRCA 4MA5A 4NAHA 1UXIA 1UBSB 2P69A 1DAOA 1X15A 2I3BA 4P0PB 3AIMA 3ISTA 3CLUC 4FEYA 5IAEA 1X39A 4EJFA 4CWAA 3EBOA 2XDQB 3F3KA 2JFUA 1VFPA 4E31A 4X5OA 2GCOA 5AJHA 4OSPA 2F1JA 1MABA 4C14A 4R8MA 1XRMA 1LNZA 4EWLA 1TZJA 2D8MA 2DEUA 1LX6A 1ZMOA 1RKVA 4M89A 2P2DA 4WOPA 1R5OA 2HX1A 5L6MB 3TAHA 1L4GA 2PKCA 4ZIRB 5L4NA 3PD1A 4TLLB 1ZOSA 2CLEB 1G7RA 2YYYA 3QEMB 1ZSNA 4GI3A 5A4JA 1FFWA 1XLUA 3BWYA 1VA5A 3EGDB 1Z2AA 4HEA6 3BL5A 1I2MA 5KYXA 1O4VA 3EXAA 4Y9SA 3KEQA 4NAVA 3M82A 2ZBPA 5DT2A 2K2WA 1IOLA 2V6FA 3M0EA 3H5WA 4TL8A 1G21B 3GMDA 1D7OA 1LPPA 2W6JA 3H65A 4JI3B 2C5GA 1HC7A 4XQGA 3AVOA 1G9TA 3DV9A 4IG9A 4IHJF 4BE9A 4YMVA 2PX4A 1SEVA 3O0DA 1YK0A 4OMDA 3NLLA 1ZK4A 2FPIA 4P4SA 2SKCA 4R9NA 4OI2A 4L8GA 2MCFA 4AJIA 1FVFA 3CWZA 5CCXA 2IYAA 5JAQA 2WF8A 3HUTA 1EA7A 5GY7A 4XB1A 3SKYA 1PLJA 5LLSA 3RFVA 3H3XA 4QTYA 3P2MA 3OE7D 1AKNA 1WMAA 1R18A 2VJLA 4W6QA 4HZGA 4UHJA 1MOQA 3HLYA 3K15A 4BLRA 5A02A 4HMQA 3CSDA 4WADA 1EJ6A 4K6MA 4BNZA 1EPUA 3P27A 4KI7A 2Z6AA 3HDVA 2MTBA 2ZRBA 3ND8A 1PFWA 4LI3X 2RIRA 1EUCA 3EWAA 4L6IA 1L8QA 3LLMA 4H6WA 3QVGB 4HN9A 2BGTA 1UXKA 3U9SA 4RIEA 3H3JA 1USUA 3LL7A 5EXTA 3KK0A 3DP9A 1YZ3A 2O50A 1I1NA 1MRZA 1W25A 3DE1X 2FEXA 2W00A 3GYGA 3PPWA 1N3LA 3K2QA 1GGNA 3BB3A 1V4NA 1BWSA 2VA9A 3REFA 3R6GA 5KPDA 2BDUA 1EVZA 3PGA1 1R6UA 4QFMA 4LDZA 2ZBQA 4ZTUB 3TXXA 2QTCA 4MB6A 1ZD9A 4RHCA 2WU8A 4UE6A 3UJNA 2C5HA 4IP0A 2XKBA 1VL1A 2ZIXB 3AUSA 4G0ZA 4RQAA 4RWEA 1PUXA 1TW3A 4A27A 1QKIA 1UBMS 1EXMA 2PU7A 3HCPA 4PYQA 4FGSA 1EFVB 2R6DA 1Q1AA 3ESDA 1LBHA 1Q1GA 4K05A 4BKUA 1W4ZA 3QHPA 2I87A 5JFGA 4F3KA 2VZ9A 2SBTA 1AC5A 1F5NA 3CZAA 3E4CA 3KT8A 4XCXA 2VC2B 5DF1A 1GSOA 1YQUA 4ZV9A 3CRMA 5CB4B 1LDBA 2BFAA 4C07A 3MZ0A 3NHKA 1UBNA 2QV0A 1LW7A 2GA8A 2BT4A 1REQB 3GT7A 1VIYA 1ZD5A 4K9OA 5FLEX 5KOJB 5FFNA 1QP0A 4PO9A 1UP6A 3B12A 4YRPA 1HRKA 3N2NA 3TSYA 1JAZA 1TF2A 2D5CA 1WS6A 3FFAA 3I73A 3EFHA 4ZARA 1QMPA 1DIRA 2RBEA 4EJSB 1XQWA 3DKPA 4GKVA 1BMQA 4W99A 4Z7NB 2IV7A 4D26A 1G6OA 1S01A 4R8VA 1R0KA 1DKNA 4C3VA 3U7RA 1X6VA 4Z9FA 1I7NA 2VLIA 4GO1A 3N53A 3F7OA 3D4PA 1X13A 2B69A 3F9RA 1SJ9A 3JAKB 4RY9A 1RYEA 1G19A 2PR7A 4UOQA 4WY8A 2FWIA 3DE3X 2A1TS 3EQZA 5FJIA 5JD5A 1PK7A 2GYVA 2W2KB 2JIDA 2W98A 3O8QA 1NWCA 3FJ1A 3ITKA 3CMMA 2RKBA 1XRQA 1JHRA 3LGAA 5FTJA 4P86A 2ZRQA 4AJ4A 2Z5LA 4ZMSA 4J2OA 5HK9A 4G9GA 1SBYA 1Z5GA 2IXTA 4MUHA 5DMHA 1QAOA 3SM9A 1W4BA 4YJ2F 4RK6A 3MYYA 4JSYA 5KYWB 2WU0A 3I9MA 4ROSA 4IHKA 2BE9A 2A33A 4W5HA 3WGMA 2AWOA 2NUAA 5GOZA 2ORED 1T2CA 4O5OA 4ER7A 1T5DX 5U4XA 4EB6B 2RI1A 3N3AC 5D5QA 5LXTB 5A7FA 2AVDA 4QOEA 5NLLA 5JSYA 4X64B 3DTVB 2AWNA 2B2XA 2OD9A 2X9NA 3HMKA 4O4IF 5GV8A 1PJ2A 2N42A 4TL9A 6GPBA 4EFMA 3WL3A 3RC1A 1RPTA 3UV6A 3ZWMA 3CZQA 4BX0A 4MA0A 1UMBA 5IVKA 4YV0A 5IFLA 2XVMA 2GS9A 2V98A 1EESA 4UVGA 1YB2A 3T3MB 4UE3S 5JRJA 3JWGA 4YCJA 2O7QA 4IW3B 4MCAA 4R3NA 2RH5A 1U7ZA 4YAFA 4LDNA 5BOSA 4MK4A 3WRYC 3T9EA 1CQZA 4CKWB 1IQPA 3ITDA 1Z36A 2XQGA 3ZHYA 4CXMA 3AV0B 4CI9A 1UINA 2XB4A 1I4WA 3BZWA 4Y7DA 5JJCA 5D86A 4G1EB 1NVKA 1E2PA 1O94A 4C3OB 3I58A 1LNSA 3MJHA 4NAUA 1R8JA 3S27A 3X0DA 1ZD4A 2WJ3A 1RRGA 1N1GA 4G0QA 4R6WA 5IPFA 1NONA 1C9JA 1RRVA 1EP1B 2GEKA 2J9ZB 2WJIA 1X94A 4R1QA 2H8GA 4U02A 3UMGA 3V4OA 3W9BA 5A2QA 4MARA 2A5GA 3SYLA 2E4XA 2H3HA 1P4SA 5ES4B 2VRBA 2X19A 3BDVA 3C70A 4YDHB 1MC4A 4RIIA 2WLSA 5J1TB 3K96A 1OI7A 3D0RA 4PQFA 2FY8A 1PJBA 2AYXA 5CPFA 3A4NA 4AJJA 1S9HA 3SICE 4C7BA 3I61A 4YC7A 1IWOA 1OB5A 1Q7RA 4XVHA 1Z5NA 5C1PA 5DSTA 4FGWA 4UAJA 3RS3A 5JS6A 3ZHZA 1R16A 5BRJA 2FUG1 4MV6A 1TUBA 5C1IA 1RPJA 2FX5A 2X3UA 3RC2A 3ZY6A 1KR2A 4ZZIA 3VOSA 4UQLA 1GR1A 1IAVA 1MP0A 3DL7A 3K0HA 1PS0A 3BKWA 4YT5A 2L82A 2J3QA 2IL1A 1USVA 1QHNA 3P4YA 4HAWA 2NU9B 1JAIA 3P0FA 3EQ9A 2OFPA 3H2KA 2ISCA 3GF4A 5EPEA 3J80A 3AJ8A 4JBWA 1DQPA 1LDGA 1UP4A 2ZJ2A 3KU1A 4K86A 2HAEA 4LRYA 2A1UB 3PXXA 1BXRB 2NUPB 3JW8A 3QLTA 4IXMA 4JC8A 4XASA 4AZ3B 3JQ8B 3PUYA 5F35A 4LXUA 5BRNA 1HNXB 3LP5A 3B48A 4JAVC 3IR5A 4CN9A 2CXXA 3KQVA 4BJ5A 1PZXA 3GVPA 3CLRC 2NZVG 3ONWA 2LPMA 1AT1A 4JX8A 2Q5QA 4IIBA 4OHFA 4R1OA 4RHXA 1F4LA 1WQ4A 2I6XA 3KWFA 5D85A 3ZBPA 1MOSA 4A10A 1PNOA 4W9NC 1CNFA 2UDPA 1XEFA 4MX8A 3GLUA 3WQQA 4NMHA 1X80A 4CFSA 5L6LB 2E48A 1USGA 2ZR7A 2ZRAA 2KWIA 3S5UA 3HGTA 3K1AA 2G06A 1L5NA 3UXEA 4MQFB 2MINA 3DBOB 1NG1A 5KINB 1RQGA 1K3FA 2YBDA 3U7HB 1GFZA 4X60A 3CEPB 2NPOA 1WDKA 1VKHA 2QE7A 2RKWA 2VAXA 1M66A 2JAUA 1NDUA 1RP1A 4G1VA 2Z30A 3TTUA 3TLGA 2PH5A 1NVDA 3O47A 1G38A 1HQKA 1K6MA 3U4QA 3N3BC 5CX1A 1DWOA 3GJTA 4AIIA 2EAUA 2X8BA 3ESBA 5EZYB 5JSZA 7MDHA 1A2BA 3ZHUA 1N33B 4XQ9A 4H7EA 4CM6A 1JHUA 4X1OA 4YJ3F 3M49A 4EKEA 4DB4A 4B81A 2FSGA 2YH2A 2VP6A 1YJQA 1FDUA 4PLCA 4ERXA 4L5IA 5A5DA 5HVNA 4LZNA 3Q8KA 3LCUA 1MOPA 3VC2A 3A36A 2VUHB 4E7OA 2RAFA 2C1EA 2ZTLA 5F12A 4AKGA 3NW9A 5AH0A 2AFIE 3LL4A 4H60A 3SC3A 1FK8A 2Q9BA 3PEEA 5EXXA 1RM4A 2W22A 3A1UA 1QS0A 3IVCA 1BE0A 1H2EA 3GFFA 4JLKA 1WCIB 1GQYA 2GXUA 3PD7A 4X1YB 4XR9A 4AZTA 4PNEA 4PZ0A 2GHIA 2RONA 2FYTA 1Z37A 2EW1A 2TRSB 3RLIA 1EE2A 3HJTA 4U2KA 3QVTA 3W1VA 2HRZA 3S1SA 2COKA 5LIRA 4KO8A 1TVCA 2WJAA 1Z4PX 4PO3X 4C4AA 2ODPA 2RD2A 3K5WA 3I1IA 2BMFA 3LLUA 3I42A 3IKVA 4RL4A 3OZSA 3TM4A 4B43A 5C8ZA 1MT3A 5LQAA 2OC4A 3A4IA 2A88A 2JGLA 4G4IA 1A5SB 2VP5A 3CUKA 3N86A 5DYIA 1FYEA 2FHSA 4L4YA 3UYLA 3O8NA 5C8YA 4L9WA 1JN0A 2DFTA 3TVYA 1BCRA 2C9MA 1EE9A 4YRGA 1WU8A 2YFYA 3ONFA 1GIAA 2HEIA 3HB0A 3O7MA 4XDHA 3WNQA 3IPCA 1CF2O 5EJFA 3AF5A 4M36A 4DY4A 1YTUA 2O8DA 4QICA 1C14A 4Y67A 1FMTA 3DV2A 3TF5A 1Y3CE 4IO0A 4QNNA 4HLCA 2ZJ0A 1IH8A 3RW9A 3AZOA 3IXMA 4JKIA 2C9OA 4DIFA 3CTMA 1B0UA 3LH5A 4UHBA 5ALGA 5ALKA 4KNWA 3ZK9A 4U7DA 3DDCA 5FUYA 3O94A 4C21A 1Y4ZA 5CCBA 2ASEA 4IGIA 1V7ZA 3QKRA 2D06A 3SNHA 3CW2A 3NIGB 4X3OA 5GWXA 2R7MA 2WJVA 1PFVA 4GM4A 1U1GA 3EQ8A 1XL0A 4FVTA 2GI4A 2CJYA 4B2PA 4F4CA 1DX4A 5IXYA 2B7CA 4YH1A 3RS0A 4YWHA 2IHTA 1E5XA 4K2AA 4GPZA 4X92A 3T5TA 4E4RA 1WB9A 1E4EA 2HDHA 1XWWA 3CFYA 4G84A 2ZU6A 4TT3A 4K40A 2GN1A 2XUDA 3PUZA 3FMOB 3HDGA 1M2VB 4RE6A 4CIBA 1HORA 1YHNA 4PYOA 5KQSA 2JFOA 1X7HA 3RVRA 4QGGA 1MQ8B 2R8RA 2ZJYA 2VUTA 1SWVA 3U4GA 3L1VA 2GHTA 1N5LA 3E7DA 4Y2YA 1X3SA 1SBZA 4BXOB 4O4JA 3P9PA 1SQ6A 4OQPA 1RFLA 3OBIA 4NYIR 5FPQA 3TLEA 1VMEA 3O2NA 4BS9A 3N2GB 1M7GA 4CGZA 1FA9A 1A4RA 1K7CA 4BNDB 3E9NA 1DDOA 1QH8B 1Y3AA 2P4SA 4A23A 3T0IA 2IS1A 5ILGA 1RQRA 4V2UA 4RSGA 2Y0BA 1Y81A 2V6MA 1GEGA 1QHIA 2PA3A 3KLMX 3V8PA 4CT5A 1Z28A 3R9IA 2OC9A 4HN4B 3ZIAA 3OG9A 1FMJA 4G23A 2GRJA 2B8WA 4PE5B 4QKQA 5H8WA 3KD3A 1AJEA 5KAMA 2GDZA 2COUA 1QP4A 4WL0A 1WZCA 4O29A 5AT1A 1QX3A 5IHPA 3D8BA 1PHRA 4B3MB 1V6SA 4YLYA 2G1PA 1L8OA 3V4LA 1GNPA 1Q3HA 2YZKA 4OHYA 3A4YA 1PJCA 3KC2A 5B1SA 1JMVA 1Q77A 2WQZA 3PX2A 2WOOA 4UAUA 1LY1A 4QXAA 3DZFA 5DASA 1EKXA 1T35A 3ZBQA 4BLVA 4LTNA 3MBOA 1ZW1A 2PJUA 3VUFA 4WDRA 3JVDA 2OFFA 4ARVA 3DFKA 2O8CA 1P80A 2WTBA 4RL6A 3O26A 2M98A 2FRDC 3LMKA 4R51A 5T3UA 4DIKA 2WF6A 3QVMA 3T9FA 4O2AB 2A2ZA 4B3GA 4R0NA 1M6VA 4XGRA 3MVEA 4XEUA 1IY1A 1DBRA 3PZRA 4IX1A 1H9CA 1NN5A 2V6GA 5JS1A 2L17A 3KJIA 4NH4A 1ND5A 3VV2A 2ZR0A 4Q1EA 1ULSA 1G7CA 2I76A 3M4YA 3R7AA 4HADA 5C8YF 1EDEA 3DLIA 3R41A 5HMMA 3DV0B 1YJ8A 3EPPA 1BD4A 5IKOA 4D8TA 4HMPA 1NLYA 3I0NA 1QGDA 3PRKE 4XOIA 2PUDA 5BQPA 1M75A 1SPBS 3IIMA 3WGHA 5K0ZA 2V5VA 4YQFA 2VJMB 1SVLA 2ZBGA 1G2OA 3AL3A 2LWIA 1FUYB 1YRQA 2ZJ8A 5HIIA 1CQIA 4B47A 4YAGA 5BSGA 4EYSA 3HBMA 3R0IA 4F38A 5L45A 3ESCA 1X9GA 4RVUA 4D4IA 2QVCA 3UJPA 1NRWA 1NYLA 3IAXA 2QTBA 5TF0A 1FXWF 4DMFA 1C50A 1FC0A 5BUZA 5A1JA 3DT6A 4Z9AA 4HVTA 2K4MA 5FTKA 4LFAB 2EP5A 4F96A 3G02A 3OIWA 2H1VA 4KMRA 3O8OA 2TYSB 2QR2A 4NZMA 3RYFB 3TW8A 4AW9A 3A05A 2X8JA 5HIJA 3AWDA 3FPHA 2PL9A 5C9ZA 4YXWA 1KYYA 2V7EA 4X24A 3PICA 5J2TA 4DCPA 4GOKA 4D4HA 3PNVA 3U4IA 1KP9A 2BLLA 1JR3A 3N2KA 2IX3A 3INYA 3WIUA 2RK4A 4CQNA 2YHIB 3J7TA 5K45A 3R7NA 1JVBA 4D9GA 2NX2A 1MAAA 4FHZA 4S1VA 3W9UA 1CJSA 3H9EO 5CXSA 1VIAA 4DV5B 1H8EA 5KTRA 4Q18A 4W9NA 3WO0A 3IDZA 2PZGA 1BEZA 2W93A 3MBKA 2FV8A 1X42A 4IOMA 1P9LA 3RUIA 1DL5A 4BN4A 4LC1A 3PRHA 1XXLA 3MW8A 3G5LA 3Q3EA 4GLJA 3WFJA 3QMVA 1W48A 2C96A 5JNTA 5KC8A 4AO7A 1KVQA 3F4BA 4HG2A 2P9JA 3N74A 3MT8A 5ECWA 1V1RB 3RK1A 1L7MA 3EOBI 4WK6A 1YR9A 2PDAA 3M3PA 4RPGA 1SG0A 2VS1A 3K4HA 3DT8A 1J00A 4WPGA 2CFOA 1SIOA 3RBXA 3CB2A 2NYUA 4QOFA 3CLSC 4ZVOA 4UXIA 1N2XA 1PJAA 8MHTA 2VNJA 1G21E 1YULA 1PUIA 2H4WA 2HU5A 3KU4A 3L0IB 4J76A 3NTVA 4J0JA 4MKGA 2CKMA 3U48A 2FPSA 3C87A 3W5HA 1XTRA 1JILA 3AP2A 3D8RA 3HV2A 3ZWBA 5B3JC 2J45A 3OQNA 1ZZEA 3U0VA 2H5IA 4AY5A 4JJ6A 5HQ3A 3RIXA 2HJSA 2J5BA 2QRZA 1G0OA 2D7CA 2GB4A 3GYBA 5AHWA 4C6TB 3ERCA 3VO9A 1SELA 2IKQA 1I3LA 5DNVA 2QY9A 5TRTA 3LZ6A 1XL1A 4Y6PA 5SYAA 4B6EA 4M8NE 4C7OB 3NNDA 1NF9A 4GL2A 2NXJA 5CVJA 1X7DA 2RHWA 3OPNA 4HFMA 3IDQA 4OUKX 3U3MA 1QIGA 2IF0A 3X43A 4HFRA 4C06A 2ZWVA 3KXKA 5AKXA 1DC5A 2P7IA 3R9XA 3V6LA 4HDAA 3ZDBA 4AL4A 3AUUA 3RAPR 2C4NA 2JJ8A 3KR1A 3NHYA 4JJZA 3EVEA 3PUHA 1HO3A 3GJXC 1SHLA 2HQ1A 2H17A 3SZRA 4RD3A 3NBQA 5IJWA 3ESYA 3NGMA 1GY8A 4PWYA 1WG8A 4TT8A 3RROA 4QLOA 1D2MA 5LMZA 3FPCA 2A92A 4AJKA 4OIMA 1EWVA 2BGUA 3HL0A 3GZJA 2J3KA 2R6ZA 3IPXA 1CZHA 1ZXBA 2WAYA 3SOPA 3UCFA 3L1HA 3SQOA 4EGQA 5JXHA 3G7SA 4EW3A 1CDOA 2FSFA 2X86A 4Z99A 5EERA 1U3DA 2HWKA 6YASA 4R6XA 3EIQA 5HG0A 4YXWD 4NL4H 2LGJA 2EHDA 3B1FA 3IQHX 4GBJA 5EHIA 4BO7A 3C3BA 2P9BA 3RKUA 3QE9Y 1H2FA 3OP1A 5DTJA 1FFXB 1RD4A 1XLVA 1NXWA 2XD9A 3WYBA 2NT3A 2AK3A 4GQAA 4RAOA 4AMZA 5TIIA 2J9FB 2RGBA 3L6CA 4WOCA 4CLHA 2VTBA 3KYCB 3P9IA 3ZJ5A 2CY0A 3LUHA 4YRRA 3KVRA 5LC1A 2CXRA 4IH4A 3M3DA 4AZ0B