1QHHA

Structure of dna helicase with adpnp
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
164
structure length
164
Chain Sequence
MNFLSEQLLAHLNKEQQEAVRTTEGPLLIMAGAGSGKTRVLTHRIAYLMAEKHVAPWNILAITFTNKAAREMRERVQSLLGGAAEDVWISTFHSMCVRILRRDIDRIGINRNFSILDPTDQLSVMKTILKEKNIDPKKFEPRTILGTISAAKNELLPPEQFAKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA binding mediates conformational changes and metal ion coordination in the active site of PcrA helicase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords PROTEIN (PCRA (SUBUNIT))
total genus 53
structure length 164
sequence length 164
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 1999-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1qhhA00
2J7PD 2OG2A 4TYYA 5A0FA 1Z6AA 5DN6D 5BYKA 2GETA 1YQTA 2FSGA 3H1TA 3GLIE 1ZM7A 4RZ2A 5FOUA 2GEUA 1JR6A 2J0QA 1DE0A 2D7CA 1AS2A 1KI6B 3EASA 1SKYE 4RZ3A 4MKHA 3I1FA 2GEVA 3NWJA 4DLUA 3MRSA 3REGA 1UEJA 4OBEA 4KAXA 4Q03A 3WMEA 2OBLA 2PMKA 4KJZA 2Q21A 4TL6A 1E1QD 5FBLB 1LV7A 1SGWA 3B1WA 3ASZA 3K0CA 5HTKA 4V0OA 4Q7JB 2W58A 5KYKA 2BEKA 2IXEA 3K9LA 4NONA 3FMFA 3GLIA 1KIMA 1G4UR 1FX0A 3SYLA 1OW3B 1Z22A 3AVWA 2OSBA 3AP3A 3LNCA 5AJZA 1Q21A 2FDCA 3K1JA 1KO7A 2BBSA 3OEHA 2ZRIA 2GILA 1AK2A 4JVNA 4GP7A 1YZTA 3A36A 3EA5A 4EDHA 3KFVA 4RVCA 1RRPA 1Z07A 3FFBA 4HATA 4B47A 2TMKA 3CONA 2D2FA 2VA8A 5C2JB 5JWRA 4TYNA 3DVLA 4F7WA 3AVUA 4LBWA 1T5LA 1F2UB 3PIRA 3GEIA 2CBZA 1C4OA 4LJ8A 4BLTA 5K8UA 3UMRA 5J4LA 4PO8A 2OUKA 4LRWA 4EAQA 3TGPA 4FXPA 4AYWA 1F60A 2VHTA 1CU1A 5L3RA 5G3YA 2FEOA 3GLFA 4JLOA 3WBKA 3T1OA 1E9FA 1G6HA 5KOYA 1GKUB 2J0UB 4NCIA 2P5SA 2FEMA 5AK0A 1EWQA 3AKYA 1NKSA 4CZ2A 4D2IA 5LDDC 5AUQA 3P32A 2OBNA 3MWKA 3ZYCA 3ADDA 4ACAA 1VG0B 4PAQA 3A58B 1VECA 1P72A 3D6TB 3CX8A 5KSOA 3CO5A 5DN6A 3A1TA 2A5FA 5GJVC 3QIAA 1PJRA 1NY6A 3T1TA 5AJXA 4LC0A 4LYFA 4ITRC 2HCBA 3HPQA 3FKSA 1DAIA 4Z54A 1KI3A 1T4GA 2FFBA 4TLEA 3RRNA 4BRUA 3CF6R 1E98A 2RGDA 3S1AA 2EFCB 4RKFA 4PSAA 3L0SA 1ZNYA 2NTYC 2C95A 2IX3A 2P6UA 4RCYA 4DHEA 2O8BA 4DUGD 1YZQA 3IPYA 4L4UA 4BE7B 4Q9HA 5AJWA 2AD5A 1FPMA 1KSJA 4M0LA 2Z5FA 3WY9A 4GBMA 3AVXA 3KQNA 2B92A 1BIFA 4O2LA 1J7KA 4N1AA 3O47A 3REFA 1UAAA 2NO6A 1G17A 3TVTA 4PHHA 3AP2A 2GZHA 3TQFA 2ZRMA 1KI8A 1QZXA 5EJEA 1KK0A 3C5HA 2ANCA 4HDQB 3LX5A 2WWHA 4JYBA 2PEYA 2R6CA 1HUQA 3T35A 2IL1A 1EFRA 4QGFA 1JR3E 3X2SA 1KMQA 1GNRA 1S3GA 2UVQA 1KZ7B 2DFKB 2HJVA 2VEDA 1ZJ6A 5FTKA 3UWOA 5CLLA 3AGQA 3T5DA 2GBLA 3WP0A 4A4DA 1DAKA 2F3RA 1ZCBA 2IYLD 5FBWB 3T15A 4A8JC 5B30A 5KNDA 4IOMA 2GK6A 2O0KA 2W6IA 4AKEA 1EFTA 1TNDA 4TTQA 3DHWC 4G5GA 4LV8B 4Q48A 2YWHA 2P6RA 2W83A 4MYHA 2BDTA 3CKLA 3D8BA 1W0KD 4OK5A 4Q21A 4RD1A 2YVUA 3C14C 1G6OA 1JB1A 1AQUA 3GLHE 1CULC 1Q57A 3KZ1E 4JVLA 4DDTA 2ATVA 2QPOA 5DE3A 1NN3A 4GFDA 5EZ5A 3I4LA 1IY0A 1TMKA 4DBLC 1LY1A 2RGEA 2KB0A 3VR2A 1N5JA 4DLXA 1E3MA 4IOKA 5JSZA 1E2JA 2WWFA 1Z47A 4UJ3A 3HU2A 1VHLA 3B1VA 4AIIA 4BZQA 3PQCA 5F2EA 3RWMB 1GITA 2NO9A 5FOXA 2O8EB 1NL3A 3TR0A 5BWMA 1KI1A 2ORIA 2BC9A 3OEHD 1PUIA 2R6AA 4LJ5A 1F5NA 1CJMA 2CL0X 4TTPA 1P61B 3L0PA 3LRPA 1KJWA 1ZCAA 3QKUA 4PPNA 4BRWA 3DMNA 3U60B 1E32A 1B0UA 1G19A 3WRYC 2GJ8A 4ZKEA 1KSGA 2IS4A 3B1XA 2QBYB 5EUMA 5EP1A 1N6KA 2JASA 4GPTA 2ZUDA 3GP8A 3B78A 3THOA 1NIPA 3SJCA 4KV9A 4TT3A 5FTLA 1J8MF 1D2MA 1XP8A 3LAWA 4M21A 4UNNA 4A2WA 1TF2A 4MGKR 1OXSC 3KTAB 1BMFA 4A15A 2O0JA 1W2HA 1Q1QA 4U5XA 1TEVA 1H8EA 2IXGA 4AD8A 1ZP6A 2EU8A 5G41A 5GJWC 2R2AA 4NP6A 4JLVA 2D62A 5DHAA 4PC3A 4HAUA 4AKIA 4B48A 1GDDA 1NG9A 1XJQA 3THWB 3HP1A 5B58C 1E2QA 2OHFA 2VP6A 3H0KA 1AM4D 3KKOA 4X8MA 2XAUA 2QNRA 3CIOA 3A6PC 3X1ZA 1P3JA 1S2MA 2JATA 4GP6A 5CJ2A 3VR1A 4DT1A 1C1YA 1V43A 4NYIR 1RE0A 1OSNA 4LYHA 4MQBA 2HUPA 4NCJA 1ANKA 1E2DA 4TSFD 2BMDA 4NYMR 4II7A 4Q4JB 5EE3A 3B8HA 5HE9A 1EG7A 3C5CA 2OFOA 3I73A 2E9SA 5D3MA 3MJHA 4U02A 1N2CE 3X1WA 3RS3A 5F3WB 2BVNA 1Z0FA 3QXJA 2YKGA 1CEEA 1Z83A 3CM0A 2ZJOA 5TY0A 3P4YA 1SVLA 2IS6A 2JA1A 3NDPA 1G1MA 1XTQA 2ZETA 2PX0A 2ZRLA 2CVFA 1VCIA 1M1YE 1Z0IA 4PQRA 2FFQA 2ZRNA 4G1UC 4ESVA 5AUOB 4OYHA 4GOJA 4G01B 5ELXA 5CM8B 3IQXA 4L5BA 4KSBA 1ESMA 4LDJA 3QEOA 2Q3MA 3RC3A 3KX2A 3OIVA 1NMXA 1Z63A 2EVWX 1GNQA 3BWDD 4KBGA 2CE2X 4LJ7A 1PLKA 1UBCA 4TLDA 4E09A 2BBOA 3LDAA 3BGWA 4PC1A 3SJZA 5TB5A 3OHMA 3I3SR 3EPJA 3A1WA 3ND8A 4YONB 3LW8A 1ZINA 4MUAA 2C99A 3RWOA 4PQFA 1VPLA 3VKWA 4CIDA 4R71A 3G82C 1DELA 3A4MA 5JI2E 1UKEA 2YC2C 2P67A 3QVUA 5IDVA 1FX0B 2OFWA 1D9ZA 5JSZB 1TAGA 1Z6XA 2IA5A 3W8NA 4LJ9A 4LCBA 1N0UA 1KK1A 1R4AA 2IUSA 3L43A 4LK2A 1N5IA 1F2TB 4C7OB 3EW9A 4C0SA 1SVOA 2QAJA 1NP6A 4MYTA 3EA0A 1AQYA 3T34A 1E2IA 3QKSA 4FN5A 3GCGA 121PA 2CDNA 2FNAA 3BH0A 1E1RD 1W48A 5J4VA 5BN4A 2ZYVX 3NIBA 4KU4A 4RD4A 4DRZA 4QBFA 1T0JB 5E4FA 4JSTA 1CJVC 2G3YA 5BN5A 2D06A 3R20A 2LWIA 3TSOA 4HB4A 4JJZA 4OHWA 1Z0AA 3MWYW 3NXSA 5IRCD 2WSMA 2VF8A 3GEEA 1FUKA 1W47A 4Q1DA 2JLZA 4PPFA 1MRNA 3MMPA 4DLWA 4M1KA 2RH5A 1XU4A 1A82A 1QHSA 2BKUA 2QZ4A 4YC7A 2BBTA 5FUWA 4C0HA 2ZJBA 4KLNA 1XTSA 3KKQA 3K0AA 2F9MA 2XX3A 1ZD1A 4TQAA 3W34A 3ZDQA 1NBME 3M0EA 4BLRA 1W36B 2C9CA 5EXSA 3EZ6A 1JPJA 1E2EA 2VP2A 3Q7QA 1VKJA 2REXB 4G3XA 4QFMA 3G5UA 3ZZUA 2O8CB 4WZ6A 5KDDA 1D8TA 3Q72A 2YV5A 3TSZA 4CW7A 2RMKA 1KSFX 5FH9A 3CR8A 1MO4A 3LY5A 4Q1EA 1MOZA 1T8TA 3WYFA 1N6IA 2FMXA 2Z4SA 2CCGA 2QGZA 3BOSA 1J2JA 2J0VA 3UG7A 1G5RA 2J5XA 4P31A 1R0WA 3LQRA 1ZIPA 3LFUA 3NG1A 4Q1BA 3CPHA 3FMPB 1P4SA 2ZVPX 3U7GA 4M1OA 4ZV4A 2C77A 1YR7A 3TK1A 4C3ZA 5F9HA 4MITA 3QKTA 4Q01A 3GLHB 5BN3A 4LJ4A 1DAFA 2ZSFA 4JLJA 5KTYA 3BFVA 1QBKC 2DYKA 3TUIC 3D3QA 4BUJA 2J59A 4JLMA 2J7PA 1N6PA 5LD2C 1FTNA 4TQ9A 3QG1A 3QSYA 2QM8A 4D4LA 3ICQB 4NTZA 1WB9A 4LJYA 1XRJA 4TTRA 2OCYC 4HLUC 4PZYA 3HU1A 5JBQA 4A2PA 1IJFA 2XOKA 4ASUD 3BJIC 3CRVA 4GOXA 5DI3A 4IVQA 4C0JA 5HZHA 4UKDA 2GDJA 1W7AA 3BBPA 5TDHA 3L8ZA 3DO6A 3PUXA 2NPFA 2VQSA 3FGNA 4UJ5A 1WCV1 2NO7A 2OAP1 4PHTA 1CJUC 4IEIA 1HEIA 3D7MA 4TT3D 2KE5A 3T1VA 4EPWA 2B8TA 1F6BA 2H5EA 5JEEA 1E2KA 2I1VB 1SKYB 3R7WB 2EFDB 3B60A 4W7SA 1LB1B 2EFEB 3W5IA 4QM6A 1NRJB 1XTIA 1Z29A 3EIHA 1N6LA 4BWYA 1A7JA 3IKJA 2R6DA 3RYTC 1E6CA 3WNBA 4EKDA 3FHCB 1S9DA 2BKEA 4DZZA 3WHLA 4QXAA 3TRFA 1L8QA 4LJAA 4G5OA 1OHHA 3ZS8A 4ILEA 4MUBA 3U3RA 1A1VA 2Q0HA 4V0KA 2PX3A 4JBXA 4P0TA 3DM9B 3ADKA 2VHQA 4DLSA 3LQQA 4KVAA 1OIVA 3VAAA 1OH8A 4JJKA 1W0JD 4YMSA 4BFYA 2RKOA 1S96A 4LBYA 1F2TA 2QAGA 3PVSA 4TQUS 2J3EA 1XMVA 1OXXK 3QEJA 3GMTA 3KQKA 2YWGA 4WIAA 5FBQB 1YRBA 3A8TA 2D74A 3KJIA 5E95A 1LF5A 2DWPA 1NKTA 3PUWA 3QKRA 4IDPA 2ZTSA 3LVQE 1IXSB 1Z28A 3UXMA 4BFSA 1XCPA 2ZR9A 2WWWA 1CR2A 3CNNA 4NBSA 2GKSA 4JLNA 2ZRBA 3ZH9B 3ZD6A 2VSOA 5FTNA 2QU8A 1ELOA 5L8VA 5J5CA 3U44B 2ZI9A 3HPRA 3DKVA 3EWAA 4KODA 2D3WA 4R7ZA 2QENA 2QTVB 2HF9A 1GL6A 1G8YA 3TW4A 4CT4B 2D2EA 5JCZA 1CIPA 1XD2A 3LBHA 2FN4A 4QHYA 5KPJA 4OQXA 2HT6A 4DJTA 4JL5A 5TXGA 2OM2A 2QEQA 4Q19A 1FNMA 1I2DA 4GMDA 4HUTA 4HAZA 1QHHA 1RIFA 2WOJA 4TMTA 3VHLB 4C2TA 3HU3A 2OE2A 3MAAC 2QRNA 1GKIA 3F8TA 1TADA 1JQJC 4BLQA 1BYUA 3IHLA 4TMWA 5GADl 2BJVA 3GLFB 1DS6A 2CLCX 5LB4A 1N25A 3K09A 2GESA 1G7RA 4KO8A 3ZZ0A 3EZ2A 4I4LA 4L9SA 4LSGA 1PLLA 1M7BA 5E7MA 4RFSB 3KXKA 4IEEA 4UNRA 5CDFE 1KKLA 4Z1MD 1GL9B 1N6OA 1TL7C 3Q5EA 3NVAA 2Z6VA 5BQ5A 1KO1A 1D6JA 1PLJA 1YVDA 1NLZA 2IWRA 3ZIAA 4YDHB 5FI1B 2ZE8A 2IHBA 2QMUA 2BCJQ 1P7CA 3CX6A 4XD7D 3I61A 2V1UA 1KAGA 1P73A 2QM7A 1PV4A 1PVOA 5EXXA 3SNHA 1KGDA 5CIQA 3AF3A 2A5YB 1TQ2A 4IDQA 4L8GA 2H8KA 2KJQA 4FCVA 1W36D 2ZSEA 5DNYB 3G0HA 3WMFA 1KNQA 3JZMA 1ZC3A 2WSSA 4M53A 1NNEA 4B44A 4D6PA 4EQ6B 5CYPA 1G3MA 3B1ZA 3QOFA 3E2IA 2XJ9A 1XXHE 2IYSA 2D4HA 5DLQC 2WJJA 4OK3A 2GCOA 2OBMA 3HWSA 4GT1A 3LLUA 4QGGA 8OHMA 3VNVA 2OCPA 3QKRB 2YNMA 4LWZA 4MRRA 2WKPA 2DB3A 2X19A 2O8CA 1XDBA 2WVJA 4WBSA 1RYHA 1XB2A 4EPVA 3GLGA 2QAGC 2IF2A 2WJVA 3IHWA 4A0FA 2AKAB 2P5TB 3VQTA 3U7HB 3THYB 5JWOA 2O8DA 1UBGA 5FOTA 1KY3A 1Z08A 3EC2A 4HDCA 4QGAA 2RGGA 2UZ3A 5GVRA 1DAHA 3K0AB 4IKEA 2GCNA 4B3CA 2ZRFA 4RFSA 5EP4A 3VX3A 1BOFA 5BW8A 4F93B 1N6NA 4QBIA 4DC9A 4L9WA 4BZPA 2X2FA 4NYJQ 3LD9A 1LTQA 5E3HA 5J40A 3VR5A 1G291 3WNDA 3GLIB 2QP3A 1T3HA 2ODNA 1YZKA 4OKSA 2PH1A 3FWYA 1OJLA 1A2BA 2GCOB 4MKGA 2RGAA 4JBYA 4WXRA 3QKSB 4NHOA 2F43A 1JR3A 2RCNA 1QHGA 5JRJA 3DMDA 4JSYA 1QHNA 3C41J 3W6PA 1YZNA 2H92A 5DYIA 1X3SA 3CX7A 1TPZA 2XEXA 4F38A 2ZXUA 3SHFA 1G20E 3OZXA 4IFEA 1R5NA 3CZQA 2NPIA 2FV8A 1FL9A 1OF1A 1SHKA 2ZRJA 1ZRHA 4TL7A 3PEWA 3IILA 3GJ5A 4KBFA 1E0SA 2ZU6A 5C18A 1DADA 1J70A 2F1IA 4JLDA 4Y0AA 4DIEA 2A3RA 4C0BA 4BASA 1NN0A 2P3SA 3Q85A 5FOVA 4TZ6A 4ZDJA 2BCGY 2ZE5A 4EUNA 1H8ED 1FOEB 2C8VA 2P6NA 3QJYA 3LBNA 4MGYR 1O87A 1J90A 4TYPA 5IHPA 4JT4A 4HB0A 4AK9A 1GIAA 2VIIA 3RC8A 1EFHA 2Z4RA 1XMSA 2ZEJA 1M8PA 2CNWA 1HQYE 2F1RA 2QPAA 3BAFA 4AG5A 4ZCMA 4D25A 4B71A 4JZKA 2ANBA 5KHOC 1SVMA 3CWQA 2VHUA 4MGZR 2PLRA 2WIBA 2WWGA 2GCPA 4OJKA 4URZR 5HCIA 3U7EB 3PJRA 2Y8EA 3ADCA 1S1MA 4HLDA 5JJIA 2ZR0A 3U4QB 4RD0A 1SXJB 1W44A 2BMJA 2ZR7A 2IYQA 3KKMA 2DR3A 1XXHB 1RKBA 5CIWA 3ICEA 5L3QB 2A5GA 5EE9A 1GZSA 3SOPA 1KI9A 2OAQ1 1U8AA 3U4QA 2W6JA 3FYHA 3HJNA 1U9IC 1AKYA 2FE4A 3CLVA 4IXNA 2NQ2C 3FKSD 5H1YA 4F92B 1BO6A 3B7GA 1U90A 3FMIA 5SZKB 1MO5A 1SHZA 1GG2A 3KQLA 1U0HC 3B5JA 3ZVRA 1FUUA 2CHGA 2X1VA 3LX8A 4WAUA 1ODFA 5FTJA 3QBTA 4FWTA 4B6FA 1G4AE 3U3MA 2V1XA 1KTVA 3A1VA 4NMMA 4V0ME 4UXIA 2F1JA 2WOOA 5HCNA 3ZS9A 2FFHA 2ZS9A 3SFZA 3SR0A 2WMOB 1NG1A 3WYGA 2CK3D 1W0KA 1RRCA 2PEZA 2HLDD 4PR0A 3VTKA 4D0LB 3AVVA 2IYUA 2R65A 3AF1A 2CXXA 2AX4A 1U99A 4C9BA 2H1LA 3TKLA 2EYQA 2MMGA 2W6ID 2V6IA 3NC0C 3LV8A 4A0RA 2XNSA 4H9GA 4NL4H 3IUYA 3R8CA 2RGBA 1VIYA 2MSEB 4MA4A 4TN1A 1GVNB 5AWFC 3TW8B 3AKEA 1X8JA 4PQYA 2QBYA 1E9EA 1XEWX 3NH9A 1YZUA 1UFQA 3CPJB 2R6GA 4MDFA 4DIDA 1NJGA 3NHAA 4E03A 2QP4A 1EX7A 2NG1A 3AP1A 2F3TA 3EIEA 4N0DA 5CJPA 4V0LA 4KFTA 1TUIA 2BOVA 5KNBA 1UBEA 2HJGA 1T5IA 2Q9BA 521PA 3IO5A 1QHYA 3ZZTA 4QL3A 2OEPA 2BEJA 3SDZA 2G88A 2BIFA 2FH5B 4CEJB 1KI6A 1COWD 2QTFA 4W9MC 1E79D 4DCVA 2ZROA 3AVQA 1SKQA 1OYWA 2CHVA 1XEXA 2H16A 2ZRDA 4EJSB 2NMVA 4B34A 1LNZA 4TSFA 1HQCA 3AUXA 1JR3D 4Q02A 3VR3A 3KFXA 4K46A 3WYAA 1LW7A 2QRZA 4I99A 5DIFA 3EC1A 4QC2A 4KXFB 3FDIA 1TF7A 4Y0VA 4G0NA 5DYGA 2QN6A 2C2HA 4OHYA 2GXAA 4DLZA 4AKGA 1YKSA 4BLSA 2RB4A 4DDUA 3RDPA 4KVGA 3T61A 1XWIA 3CRRA 3IEVA 3NHBA 2ZRPA 4AI6A 2W6JD 2JCSA 3BERA 4D26A 2OLJA 1T6NA 3I5YA 1R8QA 3WRXC 3RABA 3GJ7A 4BLOA 1FMLA 3K9NA 3KL4A 2NO1A 3AV0B 2ZE6A 1T3LA 1BMFD 3AVPA 3N5CA 4ON9A 5GJCA 4ZI3A 3BIFA 5KSZA 2V6JA 4XWOA 4DLVA 2A9KA 4Z1MA 1G3RA 2DFNA 1WBDA 3GQBA 3E1SA 3ND9A 2JEOA 4C4PA 3U44A 4AG6A 3BB3A 2IUUA 1S9HA 3C8UA 5HE8A 2VSXA 1Z06A 3TAUA 5HZKA 1ZNZA 1SVKA 3PEVA 2BHRA 1S8FA 4URYR 2J0SA 1MV5A 2JLQA 1CJKC 2A5JA 1DPFA 3ASYA 5FOWA 3THXB 1IN5A 1US8B 2AFHE 5D3QA 5SZHB 4BPBA 1NVXQ 1QG2A 4R9UC 1KDRA 1P2UA 4IHQA 3KJGA 5G40A 2A2ZA 3K0CC 2NO0A 2GNOA 2OILA 1Z3IX 2RHDA 3L2OB 4DLTA 4PZZA 3A37A 4ZCIA 3UWKA 1W2GA 4W5WA 5JWHA 4QM7A 1V5WA 3ETLA 3K0FA 1XBTA 4H1UA 4Q4AA 2QA5A 3KDSE 1IXZA 3OEED 4IVRA 3LH5A 4RZXA 4XVUA 5DISB 3ZVLA 1YR6A 1XJCA 3L0IB 4I1UA 1IOZA 3IPXA 3RSOA 4FMDB 2IYTA 1DARA 5FI0B 3U3OA 4IXMA 2OFXA 5EE0A 1KDPA 3R9IA 5HPYB 4A6PA 3KUCA 3IQWA 5KSYA 4P4SA 2EW1A 4MKIA 4AWXA 1KMHA 1RJ9A 2ECKA 5CYOA 3W6OA 4HUQB 2BM0A 3GJ8A 1MABB 2ZS7A 5L3QA 1F2UA 2G83A 3SBEA 5JS7A 1GRRA 5EXPA 5FR1A 4B2PA 1MH1A 4V0NA 2WPDD 4F4JA 5B2ZA 3RS4A 3FFAA 1Z8FA 2JLRA 4Q4AB 4B75A 4CEHB 1P2TA 3GJ4A 4Q47A 4KITB 1N0WA 2VP9A 1ZUHA 1U0LA 2FPMA 4HAXA 5DHFA 3PV0A 3R9WA 3I8XA 4DCUA 2BWJA 1R5OA 1T9HA 2GXSA 2KSQA 1R8SA 2GJSA 5FPKA 2QTHA 4M2LA 1SQ5A 4M1MA 1AJEA 5EP3A 3IIJA 4GOKA 3CR7A 1EESA 1DVRA 4RKEA 1GILA 1G7CA 4ACBA 5JFGA 3GLGE 2CK3A 4PSKA 4LC1A 2UZIR 3MWLA 4OQNA 1A2KC 4NH0A 4TLCA 1S4QA 1XPRA 2CCJA 1GRNA 1KNXA 3UANA 3KXLA 4HAYA 3WHKA 4Q4HB 2VF7A 2ZI4A 3SBDA 4ZKDA 5AUPB 5J47A 1CLUA 1K5GA 1H65A 2AHOA 4DUGA 2GBLC 4TMZA 2X8AA 2XNDD 2XOKD 3AF4A 4JBWA 4W5JA 1MO6A 4ASUA 4FI3C 1NVWQ 3KKNA 3MD0A 4I1SA 3PUYA 4Q00A 4DSNA 1VCMA 2EQBA 3VNUA 3IBGA 1R0ZA 5M04A 1DOAA 3EAQA 2QL6A 3Q9LA 4R98A 1LF0A 3B9PA 5KPDA 1R10A 1U9IA 2N42A 5JHGB 4IFBA 4LX0A 2JDIA 3W6NA 1KKMA 1NVUQ 2WKRA 3QI2A 2G1JA 4YXWA 2QMEA 1Z5ZA 1JBKA 1KDOA 3DPUA 4GZLA 2ONJA 5A4JA 1K5DA 1UPTA 3OFND 2QG6A 2ZRGA 4P33A 3QPWA 4DB2A 2W0MA 5EE1A 4YMUA 3BH6A 1YU9A 4KSCA 4NDZA 4E22A 2N46A 4J0QA 1P2SA 2O8DB 1YRAA 1WMSA 2EFGA 4QGHA 3QXHA 4XVRA 4KHZA 5F98A 4M1SA 4NYJR 3K53A 4FMCF 4LGMA 3Q5DA 4LPKA 4OI4A 1Q22A 2LKDA 4TLAA 4WOPA 1N0VC 3QPUA 2QP9X 1OIWA 3VKGA 2FSHA 2Q3FA 1VDZA 4G5QA 2QT1A 3KB2A 1OPXA 2OESA 4US0R 5K8TA 2PZEA 3IIMA 3OE7A 3RHFA 4CYMA 2FSFA 4UQOA 3MWJA 1NN5A 1Q1EA 2WPDA 4TMKA 1E2HA 1E4YA 2JJ8A 2PZFA 2JIZD 4O3MA 5J4HA 2KWIA 3RRZA 2V54A 1Y63A 2CMKA 4NCKA 4JLAA 1S3SA 2ZITA 3ECCA 1D5CA 3IO3A 4JYCA 1E2FA 4XVQA 1T3SA 2FGJA 3BORA 5EUQB 2AD1A 3W9YA 1W1WA 1X6VA 1JECA 1P75A 2G0TA 3K0FB 4CDGA 4YMWA 2A5DA 1XMIA 4AURA 1KHTA 2F6RA 4Q4HA 1XX6A 2FPLA 4PHGA 3OEEA 1ZYUA 3EPLA 2W00A 2YYZA 2RGCA 1IAQA 4A6XA 2PCJA 2JDID 1QDEA 3P26A 1H8HD 3KJHA 2GJKA 3ZQJA 3RAPR 2HYIC 3TE6A 2QROA 1G18A 1NVVR 3CW2A 2IHYA 4RSGA 2VTKA 3GJ6A 4BFUA 1YZLA 3DDCA 4C0LA 4M8NE 1E69A 4BEBA 3EPKA 1NVVQ 1EFUA 4BQSA 1XCMA 5HKKD 2CLDX 1KO4A 1Z6YA 1QHXA 2YC4C 1NF3A 2V3CC 1BYIA 3UK6A 3O8CA 1RPZA 3TVDA 4ZIRB 3B9QA 4US1R 4ZO4A 1FFHA 4KFRA 1KO8A 1JI0A 2FZLA 2GK7A 1XTJA 1D9XA 1JQLB 4I1OA 1M6NA 4A2QA 4OHZA 2R9VA 4GZMA 5FPYA 1EXMA 1O3YA 1ZD9A 2QE7A 3DOEA 1NSTA 3PFIA 4IDNA 2YINC 1COWA 2Q3HA 3IDQA 2WJHA 2GTPA 2J1LA 5TVKA 1F48A 4ZPXA 4TL8A 1W49A 2ZJAA 2QSYA 1ESNA 2JIZA 3NEYA 3VR4A 2KBEA 4KFSA 2WJYA 3NEJA 1D2EA 2GXQA 3JVUA 3M1IA 3O8RA 3I32A 1G16A 1E9SA 3Q8XB 2WJGA 4GNKA 3TJZA 4YQFA 2GJAA 4DT1B 3DKPA 1N3BA 1NBMD 2LCFA 1Z2CA 2ZUCA 2RGXA 3CB4A 3GJ3A 4I81A 4D0GA 3T06B 1KK3A 221PA 4LV6A 4XSHA 3P20A 4Q5IA 5CB8A 5DI9A 1CP2A 1E1RA 1X1RA 2ZYUX 3X1DA 4DSOA 1I4LD 2VPPA 4ZDIA 5B64A 2H57A 3MG9A 5CDFA 4EFLA 4MRNA 3PUZA 1XEXB 2VP0A 2WWYA 4JLBA 4E07A 2ZQ5A 1ZU5A 4K81B 3VR6A 1S1CA 1P60A 2YOFA 5FPTA 3KKPA 4IDOA 5JEDA 3MLEA 2I3BA 4URXR 2IC5A 3K0SA 4CEJA 1PUJA 1AGPA 4JLPA 3R8FA 1OXTA 1U8YA 2YJTD 1SXJE 2OXCA 2ERXA 1FQKA 1VG1A 3W90A 3GEHA 2ZRCA 4XJXA 3X1XA 2L0XA 5FOSA 3CH5A 1P62B 3VFDA 5KSPA 3C7KA 1TQDA 2CEAA 1M7GA 4B35A 2CJWB 5A5GA 1T8UA 4M4SA 3EZFA 4US2R 2F55A 1E99A 2DBYA 1U0JA 4HLCA 4LHVA 3TBKA 5JHHB 3KJEA 2IS1A 3TMKA 4QBHA 1KJZA 4HEJA 1Z6TA 2VBCA 4Z8YA 2CHQA 3U3KA 3UATA 3LLMA 1AS3A 1NLYA 4OL0A 4IW3B 3AVYA 1X1SA 4IOJA 3UPUA 4R2HA 2GEDA 2I4IA 1FTSA 5KDOA 1NLFA 2O0HA 3LA6A 2B7CA 1IJEA 4MKFA 2C98A 4WZAE 4URVR 1GP2A 1M34E 2BMEA 4OI1A 5KNCA 2BMFA 4KCGA 3D31A 2BBWA 2ZUBA 2ZSBA 1LVGA 3AVTA 1DO0A 2J46A 1DAMA 4ZI2A 1CTQA 4B76A 5FFMA 1IBRA 1R2QA 3DOFA 4GRAA 5JZVA 2CCKA 2JAQA 3VU9A 4RY2A 2J41A 1ONBA 1GRQA 1K6MA 5JI3E 3N2EA 3CPEA 2FPKA 3IGFA 3UKDA 4FINA 1OFUX 2ZJ8A 2XXAB 5JRZA 3LVRE 3BK7A 2V7QA 4N3NA 1G8PA 2AFIE 2DPXA 4BECA 4B6EA 3WMGA 1UKVY 3L82B 2ZAOA 4YMVA 4AKHA 3RS7A 1E0KA 2IYXA 4MDEA 3C16C 1VHTA 4EQ6A 2PJZA 1MT0A 1IY1A 3GLHA 3QXCA 2QUZA 2XNDA 3H86A 4NCNA 1G64A 3NBFA 4PXAA 2C5LA 4CEIB 1TU4A 1GKYA 2DWQA 3LXXA 5C4MA 1KDTA 2F9LA 4M9SA 4PTLA 1ZD8A 2MMCA 3CF0A 1UDWA 2PT5A 4A8JB 2KI5A 4LBZA 4LYJA 3TR5A 4EPTA 1U94A 3AVOA 3AF2A 2HV8A 1HA3A 3GFOA 4IJMA 1QG4A 1VCNA 2ZI5A 2W2VA 1YHNA 3GD7A 4Q9IA 2E87A 1Z0JA 3CZPA 4TYQA 4A0HA 4GL2A 3PEUA 5JJKA 2VP5A 4PAOA 3AM1A 1VTKA 4EIWA 3K8YA 3F3YA 4O2RA 5EP2A 3LWNA 2A7QA 2G6BA 3C15C 1Z6GA 3NC1C 3QXSA 1NBMA 1W4BA 3SC3A 4CEIA 2IYWA 1E9RA 2AK3A 4IRUB 4P32A 1RVDA 3QF7A 4WXPA 1YE8A 4BFTA 1GTVA 2YZ2A 4LUCA 4FCTA 4EPRA 3EXAA 4NKRA 1XFAA 4FMDF 4TMXA 1ZBDA 4PHFA 2X2EA 4M1WA 1HV8A 2WZQA 1B23P 1W4AA 2DHRA 2Q9CA 2MSDB 1Z0DA 3RVBA 4HLUA 3LO5A 2GZAA 4RJLA 3SYKA 4QRHA 2CL7X 2P65A 3MCAA 1LS1A 4QJ3A 3RS0A 2N1BA 3N2IA 4TWZA 3NBXX 5LBIA 2VLIA 1I4TD 2ODWA 3OIWA 1OFHA 1VYVA 3GJXC 3OFNA 4LV5B 4X8LA 1DTSA 1G8HA 1XD2B 4D4JA 2QY9A 5J4YA 3O8BA 1RZ3A 3CRMA 4G5SA 1SVWA 4UXHA 3PG5A 1IQPA 4PC6A 1R7RA 1ZM9A 4KI0A 2XTNA 4MYUA 3OESA 4XWKA 5L3SB 4JT2A 1Q12A 1R0YA 2AK2A 2JGNA 2XTMA 2ZRAA 2ZYWX 1TTTA 2HEIA 4POAA 4BZXA 3I72A 2JLXA 2WTUA 5CB6A 2J45A 2ZJ2A 3T5GA 4Q9KA 2HT1A 4KFUA 3AKCA 3CH4B 2WAXA 1P6XA 3AH8A 3KB1A 4IVPA 1CJTC 2VL7A 2ORVA 4UXJA 5EZ6B 1ZU4A 3FKQA 2YHSA 3ZIAD 1SZPA 3UIEA 1ZAKA 2AR7A 2ZJZA 4A8JA 1KY2A 2QMOA 2Z83A 4WVFA 1E96A 2REOA 3I62A 5FPSA 4XH9B 3U6BA 5DO9A 1XTRA 1AZTA 2IXFA 2ODEA 3SQWA 1Q1BA 5FL3A 5GJBA 1WDTA 4ARZB 3EPHA 3EZ7A 2ZJYA 3K0EA 2PJRA 4V03A 3LW7A 2ZE7A 3EWSA 3PEYA 2P0EA 3QUSA 1I4DD 2XB2A 3W3ZB 4MGIR 1DO2A 4PPQA 1UADA 4DWJA 4TLBA 4JVMA 1ZM3A 2Z43A 2QPTA 1E9AA 2C04A 2O8FB 4URUR 1MKYA 2XB4A 3EZ9A 1PZNA 4LHZA 1XF9A 1UBFA 1OYYA 3KXIA 2WMNB 1G41A 2XSZD 4UNSA 2O8EA 4X8OA 1W5SA 1SXJA 4Q7MB 1Y3AA 2GVZC 1L4UA 3RSLA 2AWOA 4ZIRA 4F91B 4DDWA 5P21A 4LBVA 1YZGA 3K70C 3GFPA 4U7DA 5E7IA 1XZPA 2QSZA 4B32A 1RRGA 2GVDC 1G5PA 1CBUA 2B21A 2JLSA 2AWNA 4Q9JA 1FP6A 1TF5A 2IUTA 4BEJA 2WHXA 3CRQA 5CM9C 2V4ZA 4A0GA 1YR8A 2GRJA 4PC7A 1P2VA 3EARA 2IYYA 3PR1A 2ZU0C 5FR2A 3WP1B 4B2LA 3SFVA 4FCWA 1SULA 3ZGXA 4CGZA 1TEXA 1E79A 2WICA 3CUEF 2X77A 3BFXA 3FTQA 4P4SB 3TQCA 1XD8A 1JEEA 4XOIA 5HR5A 2XZOA 2VO1A 4OI0A 1DEKA 3U3JA 2ORWA 1SXJD 1NN1A 4QKQA 1MR3F 3V4RA 3SU8A 5IK2A 3HR8A 1KK2A 5F9FA 4JKIA 4XTRA 1IN6A 3ZVMA 1OE0A 1EFRD 1G3UA 4EPYA 2G0NA 1QRAA 1JALA 4W5HA 3E5HA 1XEWY 5FL7A 1AKEA 4RD3A 1RC8A 2NZJA 4CT5A 2F43B 2XZLA 2WAYA 1OB2A 2QQEA 1E1QA 4KYIB 1XPUA 4EFMA 5JLJA 4DVGA 1T0HB 2FA9A 1EWRA 2ODBA 1CRQA 4DSTA 4OQFA 4B3XA 4HLQB 3WXMA 2B8WA 4LOAA 5FBVB 1UDXA 3HR7A 4ERNA 3OIUA 2IW3A 4XTCS 1EX6A 1DBSA 4ESHA 1OXVA 2VP4A 5B57C 2IF0A 4QHSA 1T91A 4Q4LA 1JXOA 2HXSA 1HT1E 5JJLA 4DSUA 4D4MA 3DL0A 2FFAA 4A1FA 1Q3HA 3HYTA 2EWVA 1KI4A 2DCUA 4LY6A 4TMVA 5AJYA 1CR1A 3SZRA 3P27A 1OH6A 1ZUNB 1OKKA 3F5FA 3TUZC 4GDFA 2V7QD 1OH7A 3RRMA 5FUXA 2R62A 4QHTA 3LXRA 1HY3A 4OK6A 1P5ZB 3K70B 4XWAA 1ZUIA 1CKEA 1FW6A 3B2EA 3BFKA 4UNPA 2ZVQX 4BLPA 3IIKA 1AA9A 4CVNA 2DFLA 5CITA 2IBMA 3BB4A 4DCNA 4Z51A 4C30A 3BRWD 5LB2A 1WA5A 1CF4A 3B13B 4PSVA 1E9CA 2CNWD 1Z0KA 4P4TA 3AQ4A 1SXJC 1KAOA 3H84A 1L7VC 1XTKA 5IF9A 1CRPA 4BFVA 2BJWA 2IYVA 5FUYA 1R6BX 3U5ZB 2ZAMA 1TUEA 2C96A 5C46F 4EJSA 1SVIA 3NH6A 4BGDA 5L3VA 3THYA 2NOAA 4LHXA 2C9OA 821PA 1CXZA 2A78A 4GI7A 1MO3A 1M2OB 3QF4A 5H68A 2OO7A 2V9PA 4Q1AA 3HDTA 4I1VA 1HT2E 2JJ2A 1SVSA 2JJ1D 3FVQA 4HZIA 1VG8A 1ZW6A 1E94E 2YWEA 4Q7KA 5CLQA 1ZVQA 2ERYA 3GPLA 3EG5A 4QOSA 3NBZC 2RGNC 1II8A 2PZGA 3AKDA 1JAIA 3FOZA 5KDLA 2JLWA 1NY5A 3K09C 3TNFA 1JJ7A 3KUDA 1W46A 1U2RA 2FSIA 3QY0A 3SJBA 2SHKA 2FG5A 1G8GA 3OIYA 1P9RA 1KMHB 2ZSAA 1LFDB 2W2TA 4FMBB 2CVHA 3R9XA 3ZVNA 2WKQA 3HYRA 4DEYA 2ZI6A 4LHYA 2C03A 4YXWD 2G1KA 4M1YA 2AN9A 2LKCA 3P1JA 3SI7A 1FQJA 2ZS8A 2GWHA 3MJRA 1NIJA 2QGNA 1D2NA 3PUVA 3ZJYA 3TAHA 3QE0A 2AXNA 4MH0R 1GWNA 4EJSC 3H2YA 4DCSA 2GXUA 5D3MB 1G8FA 3SYNA 4D0NA 1JEDA 4EFNA 3QG5A 1Z2AA 1XPOA 1OT3A 3LBIA 1OB5A 1EFCA 5CK4A 4V0MA 4DLYA 1IN8A 1LS6A 4F4IA 1HURA 3A4NA 4HI0E 4XIGS 5DI3B 1IXRC 4B3DA 2ZI7A 2ZRKA 2PLFA 4RD2A 4TYWA 1MABA 1OXUA 1XNJA 2RGNA 3SS8A 4PPGA 3TH5A 1UM8A 4M9ZA 3CBQA 4URWR 5BXQC 1JJVA 5CK5A 1Q3TA 3B1YA 4LZZA 5EXTA 3THWA 1HE8B 2O52A 2V8OA 1I2MA 3TUJC 4DKXA 1E9DA 4A36A 4OHXA 2AKYA 2IS2A 2QAGB 4ZDKA 3AF0A 1IN4A 2GAAA 4LHWA 2OXRA 5DH9A 5JS8A 3VKHA 4B3GA 4ARZA 3AUYA 1NI3A 2DFTA 4RZUA 3V9PA 2ZM5A 4P3YA 2OLKA 3U7FB 2AL7A 4LI0A 5HKKA 4Z8XA 2ZJ5A 2WIAA 1WBBA 4UNQA 1ZNWA 2A30A 4BFZA 1ZIOA 1E2NA 2YOGA 2QMHA 1U81A 1FNNA 4PZLA 1KSHA 1XZQA 4MRPA 3RS5A 2P2LA 1GFIA 1H8HA 1VYUA 2XTZA 4HSEA 4A9AA 1RRFA 2OCBA 1M7HA 4Q18A 1AIPA 4QJ4A 2IYRA 1W4RA 3RLFA 5KU1A 4PAMA 2Q9AA 1G21E 4B3BA 2HDNB 1S0UA 4LPSA 3W5JA 5DGXA 3ZD7A 1OIXA 4ABYA 2JLUA 1DAGA 4PO9A 2I1QA 3IBYA 3WNCA 1E9BA 1X8LA 4KLZA 1II0A 2WWIA 3M6AA 1KO5A 1GUAA 3NTUA 3RRYA 2B7BA 4Q7LA 4NYIQ 3NBYC 3RANA 1E2LA 2ZREA 3SEAA 1RJ9B 1L4YA 2YWFA 2R44A 1ZM4A 3F0TA 2V55B 4A92A 3KQHA 4AY2A 4CRWB 3BE4A 4WA7A 4JMPA 1QHIA 3L0OA 1OFIA 4OHVA 4Q9LA 5K8LA 3QXXA 3ZQ6A 2ZIAA 3TLXA 3SJAA 2GJ9A 1DAEA 2XJ4A 1A4RA 3B85A 4BFXA 5J4KA 4L15A 1RW4A 4M9QA 1G7SA 1MRSA 4AYXA 4QNMA 2ZSDA 4QJ5A 2GHIA 2GZDA 4YLGA 5FBRB 2MSCB 1VCOA 4FWIB 4C0QC 3QVVA 5K8IA 1G7TA 2ZYTX 3BB1A 3RS2A 2CJWA 1CR4A 5JMTA 2RAPA 3JZAA 2REBA 2YOHA 2ZANA 3ONWA 3NDBB 5FL7D 1FMJA 2OV2A 2VRWA 1DG3A 2OT3B 1X86B 1HH4A 4V02A 1J8YF 4M22A 4MRSA 4JKYA 5FPHA 1E4VA 2NIPA 3DM5A 5LD2B 2J9RA 3K9GA 2EYUA 5SZIA 3PXGA 1XEFA 2JLVA 4M1TA 2PL3A 1OKKD 1OLOA 1TQ4A 4BFWA 2WV9A 2F1HA 2PBRA 2PT7A 3QBVA 1TU3A 5SZJA 2O8BB 4CEHA 3TIFA 2FOLA 5FUVA 4F4CA 3T1QA 1II9A 1C9KA 3V4FA 5G3ZA 1GL7A 4NZYA 3UG6A 1F3OA 1IM2A 1BKDR 1JXMA 1W5TA 4JS0A 3O8DA 2FWRA 1EK0A 2C78A 1OHHD 4YMTA 4DLRA 1ZM2A 1UKZA 3AGPA 1WXQA 1II8B 5AUNB 3A1UA 1GM5A 3B82A 4FMCB 1QHHB 2FF7A 5DSZA 3CNLA 4ZCLA 2VSFA 3Q7PA 1R0XA 4B33A 1IONA 4D4KA 1FP7A 2BV3A 2H18A 4D81A 3VU9B 1G3IA 4OQMA 2HF8A 1N5LA 4FIDA 1IN7A 3VX4A 4S2EA 2XXAA 2NGRA 1GAJA 1OV4A 2DY1A 3FB4A 3A4LA 1Q20A 3NKVA 4H1VA 3FMOB 5JECA 2JLYA 5ANRB 4IDHA 2J87A 3VMFA 1AGRA 2J0UA 1CS4C 1JNYA 4TZ0A 1Q44A 3SN6A 1KYIA 3FE2A 1OH5A 2GAOA 1K8RA 4EPXA 2VHJA 3MGCA 2VYFA 1N6RA 1OFTA 3J81k 1E0JA 1VG9B 3A1SA 1WF3A 3FHTA 5IK2D 5L3SA 2XZPA 5AR1A 3GJ0A 3DEFA 1R5BA 1US8A 4KYUA 2XGJA 4JLKA 3PENA 5BYJA 1KI7A 4LYAA 5KO2A 2R6FA 3SE0A 4NCHA 2W2XA 4Q66C 3U6KA 1XD9A 1DG1G 1E2PA 2XITA 2HLDA 1M74A 2IEYA 2AXPA 4M9XA 1NSFA 3MSXA 4OJQA 1U8ZA 2QQ0A 4E5UA 2PCLA 2HYDA 2WBLC 2QORA 1E0AA 2HXYA 3CNOA 4GMXA 1HE1C 2ZRHA 2K5UA 5JCPA 1ZMXA 4DDVA 4P4UA 1IHUA 3CRW1 2GA8A 4L16A 2WSSD 2H17A 1YJ5A 4PC2A 4HDOB 5C4GB 3BC1A 421PA 3L8YA 4QBGB 4A82A 5TMPA 4O0MA 3M4YA 1AZSC 1BH2A 2IYZA 2BM1A 1X8KA 4TL9A 1BS1A 1W0JA 5H70A 1GSIA 3K70D 4NPHA 1VYTA 4D82A 1JPNA 2XSZA 1KJYA 3T12A 3CWZA 4NU0A 2UKDA 1Q0UA 3ADBA 4MRVA 721PA 1ZNXA 1AN0A 2NZ8A 3FPAA 4Q1FA 3U61B 4B3FX 3AEZA 3EX7C 1KI2A 1IY2A 2O5VA 2FGKA 2FX3A 3H4MA 2PMDA 2IT1A 2IK8A 1E2MA 2FJUA 2EFHB 2OCAA 3IEUA 3OAAD 4FW9A 3KQUA 3AB3A 4PX9A 1W36C 4ZDWA 2IEZA 4NYMQ 5GVSA 3C4JA 3S1AB 2OZEA 4XSGA 3QNUA 3I5XA 4PANA 5EQTA 3B6EA 2DWOA 3OE7D 1CR0A 1VMAA 4RCZA 4R2IA 4B43A 1WP9A 1XXHA 4DCTA 4HB2A 4HUQA 2O8FA 4GSYA 1TX4B 1WQ1R 4DB4A 1RYFA 5TARA 4JL6A 6Q21A 2GF9A 4D80A 4WW0A 2E1RA 4DEXA 3KTAA 1RFLA 1XMJA 3SQXA 621PA 4NE2A 3K9HA 4HB3A 4B73A 1UKYA 3E70C 4XD7A 2EWWA 5C1BA 2C9YA 1NJFA 3RNLA 3GLFE 3PCRB 4JIMA 1FZQA 4C0KA 1HTWA 2KBFA 3I92A 4MYCA 1XJ0A 1P9NA 4OQLA 3QPVA 2ATXA 4N0EA 2FZ4A 1GOTA 3ZLJA 3TSWA 3QF4B 1EGAA 4HZUB 3QQ5A 1L2TA 2R8RA 2ONKA 2WJIA 2Z0MA 1N6HA 1NMZA 3QENA 1N5KA 4G5RA 4IOLA 3GFTA 1UJ2A 4O25A 2F7SA 1JAHA 5EE5B 2D7DA 2H7VA 1HYQA 1QVRA 3W3AA 5G53C 4CF7A 1P9WA 1TQ6A 2HCJB 2WWXA 3SHWA 3BXZA 3THXA 2J7KA 2WM9B 4HZUA 1KOFA 3PITA 1Q1ZA 2JJ2D 2JJ1A 4C0AC 3X1YA 1ETUA 4RFVA 4B2IA 4PO1A 1G3QA 4DXAA 3Q3JB 3FHOA 3DZ8A 1QVAA 3BH7A 4QNRA 1VIAA 4B74A 3MUFA 4C2UA 1J99A 4X8HA 2CL6X 3CF2A 1G5TA 3P4XA 5KUTA 2ZI3A 4HAWA 3BD9A 5LPNA 1NMYA 4WZBE 4LJ6A 5E7JA 3OAAA 3V00A 5H8WA 4PFSA 4FD2A 1KZGB 1U98A 4HYYA 2ASEA 3UMFA 5AJVB 4K8OA 4YDSA 2VH5R 1WRBA 1XCGB 1UF9A 3N70A 4JVSB 5UKDA 3R7WA 2QE7D 3UMSA 3EIQA 1A5TA 2VHCA 4Q1CA 5FTMA 4JL8A 1QF9A 1ZC4A 1GNPA 2QI9C 3DZDA 1G9XA 2G77B 2GF0A 4Q4JA 1AS0A 2IWHA 2RHMA 4QG7A 2ZPTX 1YR9A 3U2QA 4S35A 5IT5A 3I8SA 4C7OA 3JVVA 4RD6A 4U00A 3VHXA 1W4CA 3W8RA 5TV2A 1WE2A 3WBJA 3OF5A 3GLGB 2FU5C 2G9NA 4AC9A 4HAVA 3MFYA 2B6HA 1UEIA 4AYTA 4OI2A 3BS4A 2CE7A 2W0SA 2Q6TA 2CLSA 2QT0A 1E2GA
chains in the Genus database with same CATH superfamily
2RI6A 2RHWA 3OZGA 1U8CB 4KE7A 4TYYA 1XAHA 2P9QA 2GETA 4JZYA 1LFAA 1IM5A 2FSGA 4KIGA 4YJ2B 3R6LA 4GOOD 5TEVA 4MWSA 1Q2UA 4NFYA 1GDTA 1OH5A 3OIGA 3EASA 3CURA 2QQGA 4HUJA 4GKBA 1YSCA 1OOEA 3A4YA 1NU8A 3A4VA 2Q2NA 3HKDA 4KWHA 4RZ3A 1RXVA 1ZAYA 4E2XA 1YJQA 1V4NA 2GPAA 3NWJA 2GZ1A 3WWZA 4FLMA 1JFLA 1UJBA 1Q0RA 4Q03A 2W71A 4ZOLA 1QFMA 1QX3A 2OBLA 2WTEA 3B1JA 4KJZA 1JQKA 1T35A 1OYVA 2B4KA 2P9GA 1ISFA 2RHJA 2XUKA 4MULA 2EKLA 2BP7A 2D0OB 4X84A 5FBLB 4ENVA 1SGWA 3QVGA 4EB0A 1N78A 3ASZA 5CDYA 2COEA 4V0OA 1L5NA 1BDIA 1V5FA 3RH0A 4D02A 1NW4A 5EQDA 4EF5A 3GVPA 3GFFA 1K6XA 2Q1SA 4HFMA 2ZIUB 3WRVA 4F71A 3PXUA 2OSBA 3NP9A 4MQ5A 3U48A 3H5OA 1YB7A 3LNCA 3IAFA 3RFFA 3IDZA 4RJTA 3K1JA 1KO7A 3F6BX 2L17A 4HEHA 4OGKA 5DEOA 5KVCA 1KVTA 3ROGA 5KCZA 4S2UA 2JFWA 3A36A 4HH4A 1XDUA 3C3MA 4BTEA 3KFVA 1YRWA 1NKVA 5D85A 4ZOQI 4P83A 1JLHA 3P0IA 1EM8B 4UVGA 1X1QA 2AOUA 2XMBA 1DXQA 4Q24A 5ADWA 6AT1A 2WFZA 3PNQA 1MOSA 1CY7A 1T5LA 1FLNA 1F2UB 2LE0A 4BLTA 4LJ8A 4ZRDA 2NO4A 3LYUA 4EAQA 1RYMA 1ZCJA 2JIOA 3K96A 4FXPA 4K8RB 3GX1A 1CU1A 3G9ZA 5ARDA 5L3RA 4EHHA 2OHIA 4IIFA 2QNIA 2X3UA 4L4XA 5IVPA 1Z88A 2EX4A 3Q0EA 4DL9A 1JDNA 3VSBA 3WBKA 1NLMA 1SD2A 4EBBA 1GKUB 2R8ZA 1B8VA 1K9VF 3DS8A 4KR9A 3FDZA 3NCHA 3OI7A 3T1HB 1RQRA 3CXUA 3HUTA 1W9HA 2JFPA 3B7PA 4B6GA 3P32A 3MWKA 1JILA 3L0BA 2EF1A 3A58B 3WLKX 5DSTA 5AKKA 1VXRA 5K8JB 1V2GA 1OLXA 2GBIA 3CO5A 3LQ2A 5A05A 4A16A 2B4QA 5EIOA 3QIAA 3UJ9A 5DK6A 3M6XA 5I7RA 2WJWA 4WNAA 4NBKA 3H3XA 3T7SA 1EX1A 4AJHA 4B87A 1SOWA 2HCBA 4I5FA 3SZUA 3HGMA 4Z54A 1IZ0A 3NBUA 2BONA 3TINA 1P5HA 1E6UA 3KPYA 1XNQB 2IY7A 2GBGA 3AUKA 3BRCA 4HD8A 1JTEA 1MJGM 4PSAA 2NTYC 3DPIA 1W8DA 1ZITA 3U09A 4S1VA 3TZ6A 3VZDA 4RCYA 2O8BA 4DHEA 1ECPA 2H9AA 4TMFA 4XR9A 2JZNA 4EW1A 1RXCA 1TT5B 1R12A 3PQ5A 3VKFA 4KKXB 1WM1A 1X7HA 3HKDB 3A6ZA 3PC2A 3SIWA 1MVNA 2PYZA 5JPIA 4Q9HA 1FPMA 4M0LA 4GBMA 1NJ1A 2P9ZA 5K51A 3KQNA 4JD5A 1E66A 1J7KA 3O47A 3REFA 4RXTA 1G17A 4GMFA 3O6VA 3HI6A 4TV9F 2WE7A 1NI5A 2YMQA 1ZPDA 3AP2A 3TQFA 4D99A 5K3EA 1KI8A 4CCYB 3K92A 1RFGE 2C9DA 2FLKA 1T9CA 4RTPA 4D9BA 1UDAA 4CTNA 3ETGA 5DWVA 4PGAA 2COUA 2X22A 3L05A 3PD7A 3CJRA 4HDQB 4JYBA 3JVIA 4OPMA 3WHIA 5KAMA 3K0HA 4DF3A 3TNDA 4WT7A 4BQFA 1XDZA 4CM4A 5JMTA 4DWWA 1AKUA 1P0QA 2JFVA 1JR2A 1JR3E 2WG2A 3X2SA 1TYEB 5A03A 3DDOA 4RZQA 4BN0A 2VQEB 2JGAA 2YDYA 3WP0A 2GBLA 5AKLA 3V8NA 4ZOBA 3LQ1A 5FBWB 4A8JC 5B30A 4MUEA 1N2CB 5KNDA 1EFAA 2ZUTA 1AUQA 1ZGBA 1EFTA 3EXHC 1H05A 3KQVA 4LV8B 2YWHA 4BEWA 3Q3IA 3SPXA 1NX9A 1C14A 3EFHA 4QTTB 2I6FA 3OF3A 4LNUA 4RUKA 1GZDA 1G6OA 1T25A 3AYXB 1M1ZA 1PJ2A 5I4IA 5L9AA 1PWXA 1Q57A 4FHEA 4JVLA 2ALJA 3DQPA 3LLVA 3NGMA 4JJ6A 4QPPA 5DT2A 3WKDA 5JAQA 4XIYA 2JCYA 4F1JA 2QPOA 3HRKA 4UOZA 1ZJ5A 1A97A 2C92A 1R0CA 1X1DA 4Y2YA 4HTFA 5DX1A 1E92A 1P1KA 1NMSA 1LY1A 2RGEA 2KB0A 2VDVE 3F9RA 1NQUA 4HBZA 4CJXA 1U2DC 4OM7A 1E2JA 2OSVA 3ZU6A 1Y48E 5BSVA 4UJ3A 2DJ5A 1VHLA 3B1VA 4AIIA 4BZQA 3PQCA 3LNTA 1GITA 2NO9A 1B8OA 3FCYA 5D5HA 3OU7A 3MC1A 3FYUB 2ORIA 1P44A 3OEHD 5C80A 5HXAA 2R6AA 4LJ5A 2P1DA 1Y4DE 2CL0X 2QXYA 2EQ5A 2XCQA 3QYAA 4NV3A 5CA1B 1KJWA 4XA8A 3BE5A 1YIOA 2AG1A 2JCXA 4PPNA 4XJSA 3U60B 2Z8ZA 4XCXA 1E32A 1MF7A 1B0UA 4J7UA 4OQDA 3SLGA 4BLVA 1GFSA 1PBNA 1BXRB 2GJ8A 1KSGA 1FUEA 2D4AA 3GGDA 4E3WA 3FDXA 4FNOA 5EUMA 4BGVA 1YDMA 3N0XA 3SG0A 3BMNA 1N6KA 4RE6A 5BMVF 3NVKI 3ND6A 1L7QA 1A5ZA 1P2FA 2ZUDA 3K6JA 3PJGA 1Y1QA 2Y0CA 2OP0A 3DOJA 1ZR2A 4LF9B 3BIWA 4LKRA 3VPGA 1M6WA 4WASA 1MXHA 2XUQA 2ILVA 5FTLA 1TQHA 4YN3A 5CCBA 2PGLA 5DGHA 3KC2A 1M6VA 2GAIA 1FFEA 4YRKA 3KTAB 3LBAA 5FI5A 4V2IA 2NVUB 3GLVA 4UC0A 1TEVA 1ZP6A 2EDCA 2EU8A 3QFHA 4NP6A 5G41A 5TQ0B 2I2CA 2R48A 3H9GA 4O1HA 3HFGA 4AKIA 3FNGA 4LQ4A 5I9BA 3D59A 3ZCXA 4HQ6A 1BWQA 1D0VA 3O7MA 4RDIA 1XJQA 4D9FA 5JH7F 1NG9A 1Z18A 2WHQA 2RAUA 4DRXB 4HT3B 4ZI7B 1ODSA 2VP6A 3BDVA 5KHAA 5AM5A 3G0DA 4P7JA 2CVQA 2QNRA 5EMJA 1S89A 2HA2A 2B34A 5E1OA 4CDMA 4B9EA 3A6PC 4DV7B 2SCUA 3AV3A 4R01A 4AFNA 4KPYA 2GBCA 4C6TA 2EL9A 1WHTA 5CBKA 1C1YA 4MQBA 1I5EA 3W1WA 3TLZA 1ANKA 4JI0B 5DWQA 4J7XA 1Y7HA 2BMDA 5EE3A 4II7A 3ZY2A 6GPBA 1DKLA 1U2GC 1UT6A 3C5CA 3GFRA 3Q8WA 3SQLA 3TTXA 3ITKA 1G20A 1TEZA 2Q1UA 2GQ0A 3LC0A 3JQFC 3UK0A 3RS3A 3GCWA 3QXJA 1CEEA 1Z83A 4OXQA 2ZJOA 5DOVA 5REQA 3UMGA 3PA8A 3P4YA 5AKHA 3NDPA 3IB6A 4PBRA 4HWSA 2IY8A 4PQRA 1BJKA 2FFQA 1G66A 2ZRNA 4IINA 5AUOB 4OYHA 3TIVA 3WGLA 4BUZA 3IAXA 3AI1A 3RQSA 4EHKA 3IQXA 3VPAA 4R9RA 3QMVA 3KYJB 4GMGA 4YBRA 2MYPA 4YJHA 3QEOA 4O5OA 1BS9A 1M2KA 2OV3A 3M6FA 3OIVA 3GBSA 1NMXA 3DP9A 2WD7B 1Z63A 1JDVA 1A9XA 1BDMA 3BWDD 3OKCA 4WN3A 4DS3A 1PLKA 2FPSA 4NIMA 4TLDA 3JQ7B 1J00A 1ZUWA 3B1FA 2F62A 1J21A 2BBOA 3DMRA 4I6GA 1YB2A 4PN7A 4XQ0A 4OAPA 1WMBA 5IKEA 4PXSA 4D9GA 4JY7A 4P3OA 4RJKA 3JQ8A 2R6R1 2I55A 3QVLA 4C4YA 3D1JA 4UARA 2DBVO 2BFDB 5DHUA 4ZVKA 2C99A 2PRIA 3JD2A 3LFTA 3WGYA 1XZ8A 3QELA 4UHDA 3VZCA 4I5DA 1V8BA 1NJ2A 2OFWA 1MPTA 4MLCA 1UMCA 1HEUA 2PMEA 4AMYA 1Z6XA 2IA5A 2FW7A 2Q2VA 2UZ0A 1UP6A 1N0UA 3UGTA 3L43A 4LK2A 4OD0A 4ZYLA 1FW8A 5H4HA 1SVOA 4FOSA 4QYSA 5ADUS 1KR2A 1Q95A 3A1CA 1NP6A 3R5FA 3ESZA 2E1PA 2VJQA 3R6GA 1RI5A 1CDDA 1UZUA 2QLNA 4ZVLA 1E2IA 3D1VA 1PL7A 5H02A 3GCGA 4R4JA 2CDNA 4O4IF 1GGJA 5DW0A 1ETHA 3GLKA 4E1AA 1HDIA 1W48A 1E63A 1P29A 1V16B 2FFRA 4CKXA 4QOIA 5BN4A 4FB5A 3PDHA 2A9QA 2Y05A 4V24A 2R00A 4TTVA 3IR7A 2O2IA 3OICA 4OSPA 4O29A 3L7IA 1T9GS 3A9CA 3WGNA 1R9MA 2G3YA 4LOHA 4K9KA 1U2ZA 1Y8ZA 5BN5A 1ZVKA 1LJUA 1JIJA 4RV5A 3V3KA 3TSOA 4EI9A 5ALGA 4MS4B 3CLUD 4JJZA 4JT9A 3STYA 3C70A 3MNFA 3WYNA 5BR4A 1GSAA 1E1NA 1IUPA 3MWYW 3NXSA 1Z4NA 1HDXA 4IQ8A 3VI4B 3DEIA 5E2AA 2Q1WA 3RF7A 4DLWA 5AW8A 1OU0A 2RH5A 1XU4A 1A82A 2BKUA 1JG7A 3KP1A 4MMXB 2BBTA 1BU5A 4YH1A 2B78A 3KKQA 2BPOA 3VUEA 2PT9A 1VIVA 1E61A 2F9MA 3NJ4A 5C31A 2VPXA 2HSZA 4EG0A 5BQ3A 3GJTA 4WLFA 3M0EA 3KSUA 2X0EA 3HCOA 4BQNA 1MD9A 2QD4A 3NV9A 3ORRA 4DIKA 1R64A 2Z5LA 4ZO9A 1U1FA 5G4KA 2GEBA 3DVQX 5FWXA 4G3XA 4QFMA 3ZZ1A 2YV1A 4LMRA 1QZUA 3CF4G 4FN4A 4R1MA 5ULLA 3VNAA 1USGA 1UKAA 1HEYA 3JQ7A 1PT8A 4JEUA 2XA2A 4XM1A 4CUJA 3L79A 3R7NA 2RMKA 4PNHA 2LD4A 1DQNA 1KSFX 3T9BA 3VC1A 2DF8A 4L0MA 1MO4A 2QRKA 5AESA 4ZVUA 1MOZA 2JK1A 2AQKA 4X7RA 3WYFA 2FMXA 2Z4SA 5H3CA 3BOSA 1J2JA 1C3EA 4CMCA 1OI3A 3TQHA 2F8TA 1G5RA 2E4XA 4P31A 1QR6A 2YQ4A 4YV1A 5CG2A 2QNBA 3P45A 3ONNA 4X7MA 3FI9A 3A11A 3WFJA 2HK9A 2ZVPX 3A1FA 5T4BA 3H2SA 1YBAA 3L6UA 2DGDA 1YR7A 2G08A 2C7PA 3FJYA 3I2JA 4MITA 4Q01A 5BN3A 3AOEA 4LJ4A 2ZIWB 4JLJA 5CB0A 4UNIA 3BFVA 3L0CA 3TUIC 3DUFB 4ENSA 5LD2C 3H05A 1HBJA 2OL4A 1BA3A 2NLOA 3QG1A 1V8OA 3RSSA 4RCVA 3UK2A 4D4LA 5KTOA 3BQ9A 5LQMA 3UMMA 1WB9A 3P5BA 3JALA 1W25A 1J42A 2WW8A 5FCDA 1ZD4A 3DBRA 4FLEA 1MTZA 4MWZA 3GCZA 2B8EA 3HU1A 4L51A 3SDBA 3HUUA 2DERA 2PANA 1DIAA 1OI4A 2ATCA 2XOKA 2YHBA 3H42B 4I4NA 3V4ZA 4E5KA 4RTOA 1Y81A 4GOXA 1Z6PA 4IVQA 3RIEA 1Z33A 4TTTS 2H0RA 1MB9A 5HTOA 3RU9A 4KQEA 4LK3A 1U5AA 4RKYA 5DGTA 5FLKA 2NPFA 3F5QA 3FGNA 2NO7A 2AN1A 3LA8A 4O4IB 2CUKA 1J0AA 2C97A 4TT3D 2KE5A 1X7YB 3II6X 3T1VA 2H5EA 4GGOA 4KO1S 1NVDA 4X1KA 4BDTA 2H7CA 3MXTA 5JEEA 4N3AA 4OLBA 3ABSB 1SA0B 3E3OA 3MWEA 4ZK6A 4A26A 3W5IA 3ENZA 3P9KA 4EGFA 1Z29A 4QJIA 2ZWPA 2F67A 2BMWA 4I2VA 3JYNA 3E58A 3FIJA 3C43A 5DRYA 2P35A 3W2HA 2RIPA 3WA6A 4V2UA 4I6EA 1L8QA 3U7QB 3VPDA 3ZS8A 3WGZA 1HSZA 4G84A 4HEA1 2Q0HA 4NR0A 3KQYA 4JBXA 3HHPA 2OAEA 4FR5A 2JFHA 1GZ6A 4A73A 4V3CA 1FNCA 3ADKA 4L78A 3ZX4A 2VHQA 1O5TA 1RBYA 3T8YA 3C3DA 1W35A 4UCFA 4HGOA 5E7QA 3BT7A 4JJKA 4BFYA 4Y2TA 1OAAA 4AKTA 1S96A 4TRJA 4CQMA 2ZSUA 1DV2A 1NW6A 2FPXA 1QQ7A 2QAGA 2Y67A 4MQUA 4NCAA 3GRVA 1T4CA 2DHQA 2J3EA 1OXXK 2BKXA 3QEJA 3A26A 2IE8A 4WIAA 3K20A 1YRBA 5AHRA 1G21A 1F4VA 2D74A 3K71B 3KJIA 5JASA 1LV8A 2WWTA 2DWPA 1NKTA 2AEFA 2ZLBA 5FWYA 2XUJA 4MWEA 1DINA 2ZSKA 2XE8A 3DE6X 4NBSA 4MROA 2YMPA 4KDFA 5ECYA 2FYTA 2GKSA 1GA1A 3E03A 2KLHA 4X95A 3R9KA 3HN6A 4GICA 3A6JA 2QU8A 1N33B 5P8WA 4CKWA 2BTQB 1Q7TA 2CJXA 4KGXA 4N03A 3U44B 4OHBA 3RUDA 1A04A 1DKNA 1FU4A 4ZRNA 3VNBA 3NHYA 1TA4A 4YACA 4FP9A 2PNJA 1DBVO 2QTVB 3BXXA 3IVXA 4REMA 5KIAA 3TKYA 1XA4A 4JEIA 4O4HA 5IVDA 1CIPA 4MMYB 1PR6A 2F2TA 2FN4A 4QHYA 5AK6A 1AUXA 4DJTA 2HT6A 3W9UA 4DABA 4TRRA 5TXGA 2QG9A 2QEQA 3ELUA 3J7AC 2WFMA 5K8VA 1HSOA 2QZZA 4JXKA 1J39A 4JC8A 4GKAA 2HWYA 1TVKA 4NQZA 5E6SB 3WLPA 4AF6A 3RUPA 3TL3A 1QHHA 1KQFA 2WOJA 3NAZA 4FJ0A 5DIZA 4XGRA 4DCMA 2QRNA 3F8TA 3BJZA 3EISA 3TIIA 1BYUA 4TMWA 3R7LA 2QOEA 2NWQA 1YCDA 2CLCX 3LZ6A 1V48A 1Y8QB 2H1HA 2PBZA 2ZAYA 5E38A 5E4YA 1AGYA 1G7RA 4FDLA 4G0YA 1FRFS 4I4LA 4LSGA 1FYFA 1NR7A 5E7MA 1YXMA 1JT9A 1O96A 1YULA 1BCSB 1SNYA 1TUGA 4YP1A 3ZVKA 3JVEA 3OQVA 2WB2A 4KR7A 1A1SA 1H0RA 1NF2A 3KXKA 5I7AA 4IEEA 3HP7A 3OX3A 5CDFE 5BSRA 2D3TA 3RJ9A 1W5BA 4IDEA 1QO0A 3FPJA 1DDGA 5E8RA 3HFSA 3BIJA 1ZH6A 1ORTA 3PEEA 2C9ZA 2Q4RA 2Z6VA 4X1YB 2CDRA 1VJ0A 2HA3A 1A8QA 1Y3DE 3PF9A 4YQYA 3HLKA 3KAKA 4LSZA 2BTEA 4U2EA 4YDHB 1DT5A 1VKNA 1BGWA 1SXHA 3QEBZ 1KRXA 2IHBA 2QMUA 2BCJQ 1P7CA 1MC8A 2REQA 2UZ1A 3ILYA 2OP1A 2CB0A 3IVRA 3OPYA 3CZRA 3PX2A 4JQOA 4LRQA 3UHOA 1QIFA 3KOYA 5DM60 3SNHA 5F23A 3KEFA 3W2TA 3DZJA 1ORHA 3HCEA 3E7XA 3ZY6A 1PKXA 3HLTA 2KHZA 3AF3A 1TQ2A 4IDQA 4L8GA 5JMOA 1GQYA 2KJQA 3HVUA 5T4EA 1W36D 1QIDA 3M4XA 2R85A 1CRWG 5ALPA 1U5CA 1KNQA 1RLTA 1TAHA 1Y3CE 3G0BA 4R1OA 5ETJA 4FIZA 3RJ5A 2WSSA 3S99A 3WMWA 6ADHA 1QSGA 3H0CA 4MQFA 2WP8J 1DL5A 2DTEA 4UHFA 1GAXA 1KBQA 3ELYA 4TM7A 5K2MA 1Q7GA 2H59A 5JPDA 2R25B 1QB8A 5L45A 3A3OA 3FROA 3S5UA 1JDPA 1JIQA 3GAFA 5DLQC 4DC1A 2WJJA 1YS7A 4EG8A 4PAGA 3ZXIA 4QGGA 3LLUA 4AJ9A 4DR6B 5MN4A 1C9YA 4LJLA 2OCPA 4TSKA 1A95A 4LWZA 1Q0ZA 4TUYB 1DTEA 1PJBA 3ZHOA 1EBUA 2C59A 2O8CA 1XDBA 3EIXA 1QH9A 2E89A 1ZD5A 2KYRA 1UWCA 2VNJA 1RYHA 4MRAA 4OYLA 2YJZA 3V8MA 4EPVA 4QSHA 5I8PA 3RADC 2QAGC 4KW7A 3SQMA 4A0FA 4Z4GA 3WGQA 5D7NA 3GB9A 4G0QA 1UBGA 3ITEA 5F5LA 1E4EA 3ANYB 1Q17A 1PD0A 3LHDA 2RJ3A 4X9XA 4LY9A 5EA2A 3RBZA 4BL5A 2GCNA 4FYJA 5FPQA 4RFSA 3T7AA 2AW3A 1PJ4A 4KXXA 2A4KA 1A7UA 3LC2O 1YMUA 4M9RA 4ETWA 5BW8A 2Q6VA 4QBIA 4RLSA 3JWEA 4O5AA 3BGDA 3GJQA 1LTQA 3LD9A 2UU9B 5DHRA 2F1KA 1ORDA 3PRHA 4XR4A 1VGQA 1NE2A 1Y98A 1G291 4JNKA 1U0FA 5T5QA 1ZWLA 2DE0X 2ODNA 1YDEA 2H1OA 3Q7RA 4OKSA 3FWYA 5C7YA 1NFRA 5DYWA 1H1TA 2RGAA 4JBYA 3ESQA 4NHOA 1XL0A 4ER3A 1JR3A 5AM3A 3IXMA 4F45A 2Z8YA 4KX5A 2C1ZA 4DBLE 3SP1A 5AW4A 4DPLA 4QQRA 4TMYA 5FFFA 1L4BA 3V7UA 5JV5A 1ILEA 1U04A 2LPMA 3EXEA 4DR4B 3RFXA 1PGJA 1F4PA 5DYIA 4ALIA 1TPZA 1S3IA 3HBJA 2E48A 4E88A 4JU8A 1FFXB 1A5BB 1G20E 3OZXA 3SHFA 3LVFO 1OF1A 1T9DA 1V7QA 1XAJA 2ZRJA 3L6OO 2OXTA 3OD5A 4PONA 3PEWA 2FX5A 3O0DA 5KNDD 2OR3A 2ZBEA 3BTVA 3QX8A 3DVSX 1E0SA 1FS6A 2WJAA 1SC6A 1UJ4A 2ZU6A 2QR2A 3FNQA 1AMUA 2F1IA 1MC5A 4RFLA 3L7AA 4Y0AA 4DIEA 2F48A 3CH6A 4C0BA 4FSDA 1NN0A 4CQNA 1G0OA 2P3SA 4EO4A 4TZ6A 1PS8A 3PC8C 3ZOKA 4OH7A 5D1NA 4MUYA 4Z6KA 4ZDJA 2ZE5A 4OGFA 1NDQA 3R41A 1H8ED 1FOEB 3WI7A 1CY0A 4BC1A 2OTCA 4EUNA 2GR9A 1OZ0A 4JT4A 3E22A 3L7LA 3O1IC 4DLAA 3QGMA 5JYDA 2ZEJA 1D7AA 3BF8A 3LWZA 5JNTA 1HF3A 1HQYE 1FTYA 3LQKA 4I8IA 5IVHA 4D25A 3OLXA 4JZKA 4LN1A 2JIDA 3TEJA 5LUBA 5KHOC 3ANXA 3QVJA 3L0YA 4MZXA 4NNJA 3VZBA 1ENZA 5FQOA 2GCPA 2ZXFA 2RI0A 3ZOZA 1KS2A 1QG6A 3CUTA 4EUKA 4GP9A 3ADCA 3PJRA 4HLDA 5LMNB 6REQB 4ITUA 4K1LA 1W44A 4ZZ2A 2FWMX 3PRKE 5LNK6 3ASUA 5AI4A 5ITSA 4AT1A 5DWDA 1Q1GA 2WIJA 3ZE7A 4G85A 3I37X 2WK1A 2P1RA 4IQ4A 3EXIA 1P39A 3L8CA 3O1LA 3DF7A 1IH8A 3KV1A 2VNHA 1GHTA 3L9XA 1GZSA 3OFKA 1KI9A 3OTIA 4JXZA 2OAQ1 3CGWA 3U4QA 4J1QA 5D3ZA 5CFRA 3E9ZA 3NYIA 2FN9A 1AKYA 4IXNA 5ICFA 4ZOAA 3AERA 4H0FA 5D6OA 2EZ8A 2P9CA 3B7GA 1P8JA 3L8HA 3IOYA 1FDUA 5SZKB 1ZN7A 1MO5A 1DIHA 2DM6A 4BUCA 3TBFA 5JU6A 4QEKA 3KQLA 1U0HC 3U37A 3IUSA 4N6OA 3VDNB 1ODFA 5BMVB 3LGSA 1MW9X 4YCDA 4XAQA 1VI5A 3DJFA 4ZFNA 3GNSA 2NP6A 3JD0A 3N8IA 3QH4A 4DKJA 3Q9SA 3DFIA 4OHCA 3QPDA 4BV9A 1XK7A 2QSJA 1QO0D 2C4WA 3PTZA 2GHTA 5DXFA 1XNGA 1NG1A 1Z56C 4D4IA 3N9IA 3R0QA 4BMPB 2CK3D 1KZYC 1W0KA 3PUKA 4FHGA 3DBHB 3VTKA 3AVVA 2IYUA 3AF1A 2AX4A 1ZOSA 4QQFA 5K3FA 3TKLA 2EYQA 2MMGA 1J0CA 1SU8A 2H9YA 1JU3A 2V6IA 2HRCA 2C4KA 2SKEA 3HEAA 2II6A 4A0RA 4H9GA 4MW2A 3IUYA 1DBPA 4GUDA 1F2DA 4P38A 4PNPA 3R8CA 2MSEB 4G2TA 1Z4KA 1X8JA 2O7NA 2XUHA 2NU9B 3HY3A 3OOJA 3Q0IA 4PGGA 4B45A 1E9EA 1XEWX 4W9NC 2FP3A 1OWMA 4K26A 5MN6A 5L6LB 2UUAB 1QHFA 3C6XA 3CPJB 1YC5A 1GPYA 2R6GA 4YAGA 4MDFA 3G49A 3KUUA 4DIDA 5CA0B 5IAKA 1GTMA 4E03A 5HWSA 3GZJA 1EH5A 1EX7A 3AP1A 3CUKA 8ADHA 5CJPA 4AJ4A 2P11A 5HQ3A 1TUIA 1V8FA 2BOVA 4XUDA 2HJGA 3Q9NA 1QHYA 4O3FA 4QL3A 2FQWA 3AHDA 3VVBA 2BIFA 2W2KB 4TWAA 3HN2A 4NLLA 3TQOA 5HX7A 3M7IA 1S7GA 2G7ZA 2ZYDA 4JYAB 1P0IA 2ZROA 1PR0A 1PEDA 4CLRA 5FOQA 4I9GA 3OSZA 4DYVA 3QUBA 2YH2A 4KGZA 3VVMA 2NZUG 4UBMA 1Z45A 4TSFA 3NTRA 4BVFA 4Q02A 3WYAA 2PSHA 4M8KA 4COOA 1QQTA 1I6WA 1SC9A 4QC2A 4KXFB 3I0MA 4AJKA 4DGSA 1N1MA 2QN6A 3DEZA 3V1TC 2XHEA 2RB4A 1XRLA 5C53B 5DM4A 4YCSA 4KVGA 5JZBA 5HDQA 2WABA 2QHXA 4WV3A 4I3HA 3T61A 3VSEA 1LDYA 2A59A 3TE7A 1IOLA 1SBQA 3DPSA 3VNSA 4AI6A 1NI4A 4XYBA 1CUGA 1H93A 2XAAA 3PUJA 3U7JA 5A4MS 1FMLA 1Z4PX 5KYUA 1F7UA 3AV0B 1XROA 1U8UA 3NT2A 1RTKA 1JHUA 2ZYSA 1PCXA 1ZN8A 2V3WA 2X8JA 1TB4A 5IANA 1G3RA 3H9EO 2B0JA 1TLLA 1KMNA 5I4BA 1JTVA 1V4BA 3HKBA 4RVGA 2Y1FA 5EL0A 1YDGA 1KU6A 5CT5A 5K0BA 3AIOA 3C8UA 3WLRA 1WX1A 1XTBA 1Z06A 4X20A 2QRGA 2WUVA 2Y76A 4ZO7A 1ZNZA 5GONA 4INAA 1SVKA 3AC0A 1PI3A 2BHRA 3ZU5A 4L75A 1ZICA 2FSSA 1MPXA 1X2EA 3FWZA 3GRUA 1JN0A 1SD1A 1T8YA 5G0UA 1MV5A 1F9EA 2PQ0A 2VSQA 3PFNA 3TMYA 1ZR4A 1A8IA 4A2CA 5HUHA 2GBFA 1DPFA 5CP8A 4FKZA 4X93A 5FOWA 1X1TA 2ZUFA 3LBYA 3MCVA 1GXSB 3BD7A 5SZHB 4BPBA 1N1GA 3SHOA 1X13A 2HF2A 4R9UC 3T0IA 3RASA 4UZFA 4C1BA 1B41A 1G63A 1ZA2A 2NXJA 3ROPA 5EAIA 4DLTA 2TMDA 4EZEA 1XEAA 2K6GA 1ZZGA 1GDHA 1U2GA 3HACA 4JR1A 3A37A 3VNRA 1TJ4A 3WJAA 4DBVO 4I3GA 3IA2A 4RAOA 2QW8A 3FRHA 3OMWA 5LQAA 4QM7A 1V5WA 1NBOA 1RQ2A 1H0HA 2JH3A 3ETLA 2I0FA 3W7AA 1GGFA 2GO1A 3WLTA 4F06A 2YFYA 4ZD6A 3IV7A 5FBZA 2PUTA 3CKKA 3S3TA 3IP9A 3K8QA 5LQUA 3LH5A 3N6VA 5DISB 1GG9A 4B0PA 1ADBA 1KAEA 4ND3A 4DNPA 4HADA 1XRNA 1DARA 1N0IA 2R68A 3BULA 4M76B 5FI0B 4EX6A 1NVAA 4TUYF 3CZCA 3R9IA 4M60A 4JP1A 1EEXB 3CISA 1USUA 1DB3A 4P4SA 5B1EA 3AEKB 5B3JA 3ZXXA 4JI4B 4NJMB 4F4DA 2B4AA 3FAKA 4MW0A 4JJIA 4AWXA 5JAPA 5J23A 1ISJA 4LGCA 5CYOA 1VOTA 3N74A 2ODQA 3S70A 3AQIA 2VF2A 4R5HA 1F2UA 2G83A 2NVBA 4OL9A 5CVVA 1LJLA 4QIHA 5EXPA 4B2PA 5JS7A 3Q10A 4UMVA 1XRPA 2WIFA 4V0NA 3TBHA 5K2OA 5KTRA 5B2ZA 1SBTA 2A84A 3Q2KA 3SSNA 4ZYZA 4NOMA 1P1HA 4Q4AB 3THSA 5A06A 2Z5GA 1P2TA 1BMTA 2PZAA 2CFOA 5JFTA 2ASVA 2P7IA 3PV0A 3FDFA 4HAXA 4TS9A 3HO8A 4G1VA 1DWOA 4PCVA 1ZOPA 1R5OA 2GXSA 2SCUB 4HSGA 4OV6B 2VT6A 5HF5A 5A7HA 5MFPA 2QTHA 5ERXA 3HM9A 4M1MA 2ZJFA 3HKCA 5EP3A 1GFWA 3AM3A 1PDOA 2XIQA 5AKZA 1P1BA 1P1IA 1I6KA 4RKEA 5IM4F 3ZHVA 1VP9A 3ITDA 2CK3A 3O9VA 4IXWA 3A6EA 5HBGA 1DT3A 4OQNA 5C5IA 1Q6YA 5FA8A 2O57A 3ZIDA 3NVDA 1KH2A 4NH0A 4TLCA 1S4QA 3IE1A 4Q3LA 4G56A 4NMHA 3SMVA 4D3DA 4W99A 5K3SA 3TLBA 4MICA 1FYWA 2OBBA 3ROKA 3UANA 2HMVA 3CUYA 2ZI4A 4JC5A 3SBDA 4DUPA 1O03A 1CLUA 5BPHA 2G72A 2PUJA 1KGSA 1O2DA 1U2DA 4X6YA 6YASA 1P91A 1BQEA 2GBLC 5B4TA 1QRTA 1QTQA 3NFYA 2XNDD 2F59A 1VJGA 2XOKD 3AF4A 1R6TA 4JBWA 4BVGA 5G0TA 5HZGA 3C8DA 4K28A 2VSNA 1VCMA 2EQBA 8GPBA 5LQKA 5AKIA 1WLSA 3HKBB 3BREA 3OZFA 5BQPA 4C87A 3GYGA 3UM9A 3W05A 2VCYA 3FJ1A 1R10A 4CKBA 2N42A 2O20A 2RHRA 3CSDA 3WHPA 3W6NA 5KZMB 1YQEA 1KKMA 2W2NA 2NTEA 2ID9A 4A91A 3ZNQA 5JY1A 1KDOA 2G25A 3PDWA 1THGA 3T9CA 5BUZA 1SUIA 2BAGA 2QI9F 4XYMA 1UPTA 3PYMA 1BH6A 3B7WA 1E58A 5JANA 1WXWA 4KE6A 2GLTA 1RXUA 2X4GA 2POQX 3NI2A 1OBHA 4YCMA 5CHYA 2QTMA 1T5BA 2N46A 4E22A 4IKOA 3GNQA 4N47A 1P2SA 4B8YA 2O8DB 1YRAA 4L8WB 3ZGYA 2EFGA 3I5UA 1C2TA 2AEJA 3HRHA 3QXHA 3B38A 2GWRA 4C89A 5HA5A 3FAZA 1BGVA 5LQCA 2C2KA 1ODKA 3AUSA 2JLWA 1AD2A 2R751 4R05A 2Z8XA 5A0TA 3G8CA 3Q2IA 3Q5DA 5IF3A 4TLAA 1N0VC 3RJZA 4B3IA 1SK9A 1X7ZB 5TSDA 1T2CA 1HFWA 2C2ZA 4ZANA 4DM7A 2XMCA 5M2QA 2HIHA 1OPXA 2OESA 3U16A 3A2LA 3LFHA 3ODPA 3RHFA 1L7NA 4O2AB 1QPBA 4UQOA 1E20A 3SEFA 3PC8A 1Q1EA 2PR7A 3U4GA 4YJ3F 2Z4TA 2VQFB 3NTLA 2FPOA 4O3MA 5J4HA 3RRZA 2AZTA 4O8CA 4ZTZB 2VPIA 4L0DA 1JHDA 4UMFA 1I8TA 2VRCD 3QE3A 1Y8CA 4RADA 2WQ7A 3CVUA 2O7QA 1D5CA 1NAIA 2HLHA 2I2BA 3FCUB 3P19A 1E2FA 2FGJA 3RJMA 2WYVA 2AD1A 3GC6A 3NYQA 1Z15A 2OD7A 2CVOA 1WMFA 2G0AA 1RHQA 4IIHA 4KQ1A 4PS0A 1U3GA 2LVBA 1XYVA 2RONA 4KTVE 4WK0B 1PZHA 1YJ8A 4IFTA 1P75A 2G0TA 4L8YA 1NBEA 4YMWA 4DXHA 5BQXA 3VM6A 3F98A 2F6RA 4GBGA 1H3NA 2B1GA 4Q4HA 4V0RA 5IN4A 5JDCA 3E61A 3ELDA 3QPAA 4LGYA 4AZTA 1YL5A 2XQFA 5T3UA 2GAFA 1IDOA 3I05A 3L8MA 5HRUA 4GKKB 3DNMA 2JDID 3KJHA 2GJKA 3NT4A 3ORQA 2VJNA 1PN3A 3D6HA 3OTOB 4N65A 4E6EA 2PXCA 2XD4A 1KZ9A 2IHYA 3IXQA 4YASA 2R84A 3N3AC 1UBJS 3QFCA 3EPKA 2Q5QA 3GUZA 5IMBA 2UUCB 3QZUA 1JVNA 2GARA 1KPGA 1SMKA 1N9GB 1WS6A 1B15A 1XCMA 3CQ9A 1KO4A 2EF0A 1RZRA 1CNFA 2VJMB 5A02A 2E6UX 4BNTA 2FWPA 5HMLA 1OFGA 2VNIA 4RQTA 4TKLA 1UMDA 2ZZKA 1FFHA 5H59A 5IC4A 4D42A 2GK7A 2C07A 3AXTA 3PBKA 4HMOA 4WMLA 4XWTA 5EERA 1FJHA 2ZYGA 3I0ZA 4M1QA 4M9CA 2DBQA 1JXQA 5KCMA 1TYAE 4A2QA 1ZHOA 5AOAA 2NYAA 3P9CA 1ZD9A 5JO9A 4CIYA 2VBGA 4TVOA 3PFIA 1COWA 3ODGA 4UPDA 1Q14A 3DMFA 2J1LA 4FZ3A 2X7XA 1F48A 2YVLA 2IPAB 2XPCA 2IRWA 2FF5A 4ZPXA 2ZZMA 3SSMA 4JC0A 2PGAA 2HCFA 3WLJA 4LXIA 3ZN2A 3T3GA 2NVWA 4G1FA 4RF3A 3UAVA 2JIZA 3L6DA 4ARCA 4ARIA 2KBEA 1FXUA 4RSRA 3N2KB 3OQHA 3S81A 4MR7A 5TPWA 1D2EA 1PK9A 1ZOIA 2ZOSA 4RVHA 3JVUA 4GNKA 4AY4A 1RU3A 2WJGA 2X4IA 3IJEB 2XWPA 1V7ZA 2GJAA 2WPNA 3DKPA 4WLUA 2ZUCA 5C8VA 2RGXA 3CB4A 2G67A 1U3VA 3GEMA 4I81A 3GGPA 3WIUA 3OFJA 4BRSA 1EZZA 1NQVA 1GEEA 1ZGZA 5EYPB 2AOUB 4LV6A 1NAHA 4PRYA 4F9GA 1XDDA 3I30X 5SYMA 2ZYUX 1X1RA 3X1DA 3BWYA 2AFHB 4Y2XA 5FYQA 4DSOA 3M82A 2VPPA 4ZDIA 2TS1A 1E1DA 4RANA 3UGKA 5AK3A 1A9TA 3HHEA 3R1IA 4MRNA 4OKIA 3PUZA 4YECA 5AVUA 4RTMA 2WWYA 3HCFA 4JLBA 4N0PA 2AC4A 4E07A 4DG9A 1CUVA 2ZQ5A 1ZU5A 1YACA 3WL4A 4C08A 4OMFG 4TXHA 2XY4A 5JEDA 1JDBB 3KL2A 3EGOA 2I3BA 2NV6A 2GLXA 3ZJTA 1JIVA 1DI0A 2IC5A 1PUJA 1DAOA 3OVMA