1QHHA

Structure of dna helicase with adpnp
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
164
structure length
164
Chain Sequence
MNFLSEQLLAHLNKEQQEAVRTTEGPLLIMAGAGSGKTRVLTHRIAYLMAEKHVAPWNILAITFTNKAAREMRERVQSLLGGAAEDVWISTFHSMCVRILRRDIDRIGINRNFSILDPTDQLSVMKTILKEKNIDPKKFEPRTILGTISAAKNELLPPEQFAKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA binding mediates conformational changes and metal ion coordination in the active site of PcrA helicase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords PROTEIN (PCRA (SUBUNIT))
total genus 53
structure length 164
sequence length 164
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 1999-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1qhhA00
1KSGA 3GJ6A 1JQLB 4QNRA 3BORA 3ADKA 1G4UR 5LB2A 1AIPA 5CJ2A 4I81A 4RKEA 1OIWA 3X2SA 1Y63A 1AQUA 3R20A 2OXRA 5J47A 2ZI6A 1ESNA 4Q1EA 1Q1ZA 2X8AA 2DB3A 4M8NE 2ZR7A 2W00A 1YE8A 4Q4JB 2ODBA 1KK0A 5GJBA 4E22A 1FQJA 1SVLA 4TYQA 3T1OA 4DSTA 4IRUB 3ZGXA 4HSEA 4ESHA 3KXKA 3PXGA 1JAHA 3CPJB 4N3NA 2ZS8A 3ZD6A 1P5ZB 3IO3A 5CM8B 3U6KA 1G8HA 2AKYA 4IDOA 5E7MA 5CK4A 1GL6A 5HE8A 5LB4A 3TQCA 4WAUA 4PC6A 1VCOA 3C4JA 3TK1A 3WYFA 4F7WA 3RS0A 1J99A 2PJZA 1M6NA 4Q4HB 2ZVPX 4GBMA 2W6JA 4Q9IA 4CEJA 2QRNA 4JT4A 2EWWA 3KJGA 1GITA 1R8QA 1T4GA 3IIKA 4IEEA 4ZO4A 4U02A 1ESMA 1YQTA 1BS1A 1FUKA 4E07A 1ZNWA 2C99A 4B2LA 4NHOA 1M1YE 5HPYB 1II8A 1I2DA 1SXJA 2J3EA 3TGPA 4QBFA 4Y0VA 3QXJA 2EFGA 2ZI9A 4TYWA 3QKUA 3RS4A 4D80A 4KLNA 4JLAA 4LHVA 3CX7A 5JSZB 2JLYA 2QT1A 2AFIE 1V43A 2ZSAA 3F5FA 4QGAA 4EJSB 1VHTA 2D06A 2ORIA 2REXB 3ND8A 2H17A 2H7VA 4OHZA 3QKSB 4XVUA 2IYYA 2YJTD 3MWKA 1P2UA 4F4JA 4IOKA 3PG5A 4DDUA 3AVTA 1XCGB 1G7CA 4Q66C 1N6KA 5FL7A 2IS4A 2OG2A 1TU4A 3ICEA 5GADl 1VKJA 2AK3A 4M1OA 3GJXC 4L8GA 1VCIA 4UXHA 2NZJA 1KZ7B 1IQPA 1ZJ6A 3B6EA 1JEDA 1MOZA 1KY2A 2EQBA 2RH5A 3E1SA 2AXNA 5AR1A 3K70B 4UXJA 2BMDA 4LHWA 2LCFA 2NOAA 5BN4A 2ZRNA 3NEYA 4LHYA 2HDNB 1COWD 1UEIA 5BYKA 4LZZA 2PEYA 1U0JA 2B92A 2QI9C 1KJWA 4QOSA 5DE3A 4IDHA 3TVDA 4PO9A 3U3KA 4TYPA 2QBYA 2FEMA 1FFHA 5LDDC 3TJZA 3SYNA 4TZ6A 3L8ZA 1ZM4A 3CRQA 3V4FA 3TH5A 3PEVA 2XXAA 2QTFA 4V0NA 1IXZA 2H92A 1E1RA 2QP9X 1ELOA 1SVWA 4C0BA 1TPZA 2GAOA 3QXHA 1QRAA 2GK7A 1DPFA 2HF8A 3SZRA 1W1WA 2XZOA 1AQYA 4EFMA 1IHUA 2NO1A 2IL1A 1R0XA 2CHVA 3GFOA 5CITA 2C2HA 4ZKEA 4KODA 4W5HA 4G0NA 5FTMA 1VIAA 2WVJA 1R4AA 2HXYA 2ZSBA 3FB4A 3HYRA 1EX7A 5JJIA 1HURA 2RGAA 4FINA 5FPYA 3AM1A 5FUXA 3LAWA 2Q9AA 2JLRA 1IJEA 3UMRA 3AEZA 1XJCA 3EAQA 2IUTA 4C9BA 4LJAA 2CNWA 1KI4A 4TLAA 2JAQA 3C16C 2NGRA 2R62A 4DLYA 1G3MA 1HQCA 1I4DD 5F3WB 2X1VA 3VAAA 4RD1A 3RSOA 1VG0B 2IYUA 4MKFA 3THXB 1S1CA 4JYCA 2ZUDA 4AKEA 1G6OA 3Q3JB 1OJLA 2YWFA 2PJRA 4AKGA 1GVNB 1NNEA 2K5UA 4PC1A 2CXXA 2H1LA 1M8PA 2GZAA 3B2EA 3LA6A 3LWNA 4B2PA 2IS2A 4C0JA 1COWA 3B1WA 4HB3A 1NF3A 5G3ZA 4JIMA 2JLWA 1M7GA 2LKCA 1YKSA 1ZUNB 2REOA 3TUIC 1A1VA 2BM0A 2F3RA 5JHHB 5BN3A 1GNPA 3KTAB 1KJZA 4I1OA 4OK3A 2MSDB 4Q4HA 2XZLA 4CEJB 3AVYA 4BLPA 3B13B 1XWIA 4DLUA 3MWJA 4JLMA 3UXMA 121PA 5FOSA 1AA9A 3I8XA 4HDQB 1AGRA 2GXUA 3H2YA 3K0EA 1L4UA 1IY2A 4PAOA 2YYZA 1DG1G 2ERXA 4JLOA 4O0MA 1VG1A 3QY0A 3TBKA 5BWMA 3K09A 4MGKR 5FOVA 3WP0A 4BRUA 1J70A 3K70D 3N2IA 1UPTA 4YDSA 3NKVA 2IX3A 3RAPR 1B0UA 4QM6A 4NCHA 2R65A 3QUSA 1GM5A 4OHYA 1W44A 4TYYA 1S0UA 4TQ9A 4HAVA 2IYZA 4Q19A 4QRHA 4B3CA 4QGHA 2DCUA 2RAPA 4DLRA 4LYAA 2IF2A 3RWOA 1X1RA 3F0TA 2Z4RA 5EZ6B 5FFMA 5EZ5A 1OSNA 5C1BA 2JLUA 2A5YB 4HB0A 4LCBA 1Z07A 5C46F 3TE6A 4ZIRA 3R8CA 1ZYUA 4YC7A 4KU4A 1GDDA 3FHCB 4XH9B 3CZPA 1IN8A 3LBNA 4Z1MD 2NZ8A 4LJYA 4PQYA 4H9GA 2ZE8A 3QNUA 2JJ1A 1XCMA 4JVSB 3K8YA 2IT1A 4LC0A 2NPFA 4B43A 1UKVY 4US1R 3R9WA 1RJ9B 2JIZD 2JJ2A 4M0LA 1CXZA 3U6BA 3SI7A 3QVVA 2CVHA 4HDCA 4KVGA 2CLDX 2GCNA 4R71A 3UPUA 5FUVA 2FN4A 4DCTA 1OYWA 1ZCBA 4DDVA 1DAEA 4PPFA 1OFIA 1XZPA 4TSFA 1P9WA 2ECKA 3AF2A 1DBSA 4EFNA 4PR0A 5EP2A 5FR1A 3I73A 3KZ1E 5HTKA 1E4YA 4V02A 1EXMA 3ZZUA 3QOFA 3AVXA 4UQOA 3FMOB 2WTUA 4A0RA 1M34E 3QJYA 4BLSA 2H57A 1KGDA 4QXAA 4TT3A 4MRPA 1OXVA 2PX3A 2Q21A 3NBFA 2OBNA 4LRWA 2IYLD 1W5TA 1QHXA 1XCPA 1DO0A 2VHCA 1GILA 4GP6A 4RY2A 3RWMB 3U7HB 4YMTA 4DHEA 2ATXA 1UDXA 3CX8A 2FJUA 4YMSA 2BJWA 4M9QA 4KSBA 1SVKA 4U5XA 4A15A 3ZLJA 4LV5B 4LUCA 5FTJA 2XSZD 5JS8A 1YR7A 3S1AB 3AF0A 1U90A 2W0MA 4AG6A 2R6CA 3HPQA 4EQ6A 1QVRA 1BYIA 4AIIA 2XNSA 2ZJBA 2WKPA 2FSFA 4LPSA 1ZCAA 3GJ5A 1E2HA 1NMZA 3QKTA 4LJ4A 2QEQA 1LFDB 1F2TA 3EPHA 2ZRAA 1Z06A 3FDIA 2ZRFA 3X1XA 2QAJA 4BZQA 3NIBA 1DAGA 2OZEA 3CNNA 1X3SA 2FG5A 1TL7C 4TMKA 1L2TA 4B76A 4HZIA 4HATA 5EE9A 4B3FX 3ZVNA 3EZ6A 2ZS7A 3DOFA 3E2IA 1YU9A 5HZHA 3O8RA 1H8EA 5DI9A 1P73A 5FOXA 2P6UA 3DZ8A 2FFQA 2OCPA 4ACAA 3Q5DA 3W6NA 3EPKA 5F9FA 4KFUA 2QL6A 2D7CA 4QKQA 5K8UA 1UF9A 3LBIA 2DFLA 1G7SA 4G1UC 4RD6A 1JECA 2OBMA 1Q22A 2BBOA 3P27A 4WXRA 3DM9B 4B48A 1NG9A 2BKUA 4B3GA 3P4XA 2D2FA 5AJXA 5DH9A 4YMVA 1NSFA 5TARA 3NG1A 3N70A 1D5CA 1WDTA 1YJ5A 2KB0A 2WWIA 4XSGA 5DN6A 3VU9A 4B35A 2GNOA 3PUZA 3SN6A 3V9PA 3FE2A 2VLIA 4KCGA 2H8KA 3OFNA 2J0UA 2J0SA 3P20A 3P32A 5BQ5A 2QE7A 4AYTA 3TMKA 4FW9A 4B75A 2WWYA 1MKYA 3JVVA 2GDJA 2PMKA 2Z6VA 5K8IA 1CJTC 4WOPA 3BAFA 4XD7A 521PA 2CK3D 3T12A 3VR5A 3WYGA 2OFOA 4ZDWA 2V9PA 3I5XA 2WOJA 1IOZA 2ZITA 2AWNA 3A1VA 1HEIA 3FHOA 1WF3A 3RRZA 2I1VB 2BBTA 5CYPA 4KBFA 3AVUA 3VR6A 1MO5A 5J40A 2CE7A 2R8RA 4LJ7A 2X19A 2Y8EA 4BRWA 1AS3A 3B1XA 1KK3A 4NL4H 4OKSA 1Z6AA 3IQXA 3UIEA 3W3ZB 1AZTA 5JI2E 4MA4A 1J2JA 4LPKA 5EQTA 4NH0A 1US8A 4Q1DA 3R9XA 1LF0A 2DY1A 1R10A 2WPDA 1XB2A 4E09A 4HLCA 3AVWA 3EZ2A 2RKOA 4US0R 1ZIPA 3R8FA 4PFSA 2G88A 2JCSA 1JR6A 1BH2A 5KSOA 1XXHA 5FPKA 4GZMA 2FX3A 1NVVR 3GEHA 4FMBB 4BZXA 5D3MB 1NG1A 1ZD8A 3Q9LA 4B33A 2QM7A 3BOSA 2RGCA 1S9DA 4TLEA 3BGWA 4XVRA 3K9NA 1H8ED 5J4HA 4PPGA 1IN5A 3I92A 2HT6A 1G5PA 1W4RA 4GRAA 5GJCA 3T35A 3WRYC 5L3QB 4CVNA 4ERNA 2VTKA 5B57C 4TMXA 1E69A 1XTJA 4Z8XA 1FMLA 2JDIA 4A2PA 2ZREA 1KKLA 2JLZA 2C9OA 3SU8A 5TY0A 4X8MA 4RFVA 4PHFA 2FZLA 3GLFA 2Q6TA 2JJ8A 5KPJA 2ZJOA 4QBHA 4M21A 3OAAD 4P31A 5IK2D 3HU2A 3EW9A 4JLDA 1QZXA 4NE2A 5FH9A 4JKIA 3ZS8A 4OI0A 3OFND 2GCPA 4JMPA 1KOFA 5HKKD 4MITA 2DR3A 2QE7D 3HYTA 4D4JA 2ZSEA 1R0ZA 1E2MA 2P5SA 3B1VA 1GRNA 4C2UA 1E1QD 2ZRDA 2QNRA 1UKYA 4E03A 4X8OA 4ABYA 2IW3A 1E2LA 1KSFX 1GP2A 2QZ4A 2ASEA 2WV9A 3B85A 1G5TA 2DBYA 3K1JA 1ZU4A 3ZD7A 1EG7A 2ONKA 1JJVA 1YVDA 5FBVB 1II0A 5J4LA 2XZPA 3IPXA 3GCGA 4OYHA 5L3RA 4DT1A 2FPMA 3Q8XB 5A4JA 2P5TB 1ANKA 3G0HA 1AKYA 1XRJA 3QPVA 4FXPA 4EJSC 1NMYA 1IN7A 3MSXA 2C8VA 1BIFA 4I1UA 4PQFA 4WXPA 3PVSA 2GVZC 2IYQA 2A5JA 3K0AA 1Q3TA 3GLHA 4HLUA 4Q9HA 4M1MA 4DVGA 2AD1A 1KNQA 1OPXA 4LDJA 2L0XA 1R5NA 4Q00A 1OKKA 5AUQA 3T5GA 3K0SA 5DLQC 1XTSA 3VKWA 1IXSB 1H8HA 2NQ2C 2BV3A 1G4AE 3BB3A 3Q7QA 5GVSA 4CEHA 1Z22A 2WM9B 1DAMA 4C3ZA 4F93B 4XWOA 4P33A 3FMPB 2GRJA 4HAUA 2KSQA 2HT1A 2ORWA 4JBXA 5A0FA 3LX8A 4P32A 2EFHB 3CM0A 5L3SB 2XB2A 1D2MA 1W47A 2RGGA 2WJJA 2D2EA 1OXTA 3QKSA 3BFVA 4D82A 3CZQA 5JWHA 4MYUA 3BH6A 2UVQA 1Z2AA 1VPLA 3TNFA 4MGZR 2R9VA 2RGNC 2VL7A 4HAXA 2D74A 2FOLA 1O3YA 3OAAA 5IK2A 5KNBA 4NYJQ 5SZIA 1E2PA 2ZANA 4NU0A 4OQNA 1JR3E 5SZJA 3NH6A 2W58A 2O8BB 3GFPA 3HDTA 1HV8A 1UKZA 5KNDA 4URVR 4G3XA 2FSGA 1LB1B 3C5CA 4G01B 2CVFA 4BFSA 1RIFA 2FF7A 1AS2A 4XJXA 5JHGB 2ZAOA 3HWSA 1Z5ZA 2G9NA 4DRZA 1HH4A 4RFSB 3A6PC 4M1KA 4C0KA 2ZU6A 1US8B 4JLNA 3GLIE 1CIPA 2VHQA 5EP3A 1OIVA 5H8WA 3EWSA 1W49A 2ZUCA 3AUYA 4MYTA 1S9HA 1W46A 1XEFA 1S8FA 5KSZA 4AYXA 1G291 3W6OA 1WP9A 2IYRA 3RSLA 3SQWA 4A6PA 1WQ1R 2WHXA 1W4CA 5D3MA 1ETUA 5G40A 5FOUA 3UMFA 5FBQB 2Z4SA 1LF5A 4ZPXA 2VHTA 3CUEF 4DUGA 4GMXA 1GL7A 1EFCA 4PPNA 1XMIA 3CR8A 3OEEA 4KHZA 2RGDA 4P4UA 1X86B 2EVWX 3PUWA 1C9KA 2Q9CA 1JAIA 3VNUA 1NL3A 1OKKD 2GHIA 2YWEA 1HUQA 5KSYA 4BFXA 3KKOA 3UANA 5LBIA 4TMVA 3HU3A 4C0SA 1U8AA 3AVVA 1AZSC 1E9AA 1G17A 4FMCB 3SS8A 1KI2A 3PQCA 3ZYCA 1XEWX 1VYVA 5CLLA 1U9IC 4ZDKA 4QGGA 4MRRA 1DS6A 2DFKB 1XJQA 1A2BA 3KJHA 2BMFA 1MABA 2IBMA 1G3IA 5KDLA 4DIEA 4TL6A 2VQSA 1NBMD 3AKEA 2IK8A 3CRVA 1YZGA 4FN5A 1Q44A 2Z5FA 2YINC 1U9IA 4GMDA 2IF0A 2PLFA 5FBLB 3IIJA 1ZAKA 5JCZA 1NN0A 5BXQC 2DWQA 2P6NA 3Q5EA 2GXSA 5JEEA 3L8YA 3THXA 1Z3IX 2KJQA 2ZRJA 3OZXA 1KY3A 5BN5A 1W36B 5AUPB 2BEJA 4JL5A 2MMGA 4OI1A 1UAAA 2G83A 1A2KC 5CIQA 5B2ZA 3SJAA 3GJ8A 3QF4A 2AL7A 4F92B 2FZ4A 3Q85A 5FI0B 1VYTA 2XGJA 2QMEA 4UNPA 5JECA 5DYIA 1P2TA 1HYQA 3FMFA 1GNQA 2QY9A 3PFIA 4L16A 2JLXA 4FMDF 4KITB 2TMKA 3R7WA 1GTVA 1VG9B 3SEAA 2G3YA 4DCVA 3W34A 3ZS9A 1E0SA 1KDPA 1XTRA 1ZC3A 4LGMA 3SYKA 3RS5A 2IWRA 1ZW6A 1KI1A 5G3YA 1Z29A 2PT5A 2C5LA 4PHGA 4O2LA 3EC1A 3RHFA 4EPVA 1M74A 4CT4B 2WIAA 3LW8A 3D7MA 5C4MA 3ZVMA 1T0JB 1W4AA 5TV2A 4US2R 4CGZA 2YOFA 3QEOA 2J46A 3BRWD 3CF0A 4U7DA 2YOGA 2VA8A 1WRBA 3TSWA 1FMJA 1XEXA 3UMSA 5GJVC 3N5CA 3AVPA 3DL0A 4TL9A 2C03A 6Q21A 1CTQA 1R6BX 2O0JA 2W6JD 3IIMA 3SHFA 5FBWB 1TQ6A 5KDDA 2A5DA 2CCJA 3EWAA 3CRMA 4FMDB 4JLJA 5JMTA 2IEYA 1I4LD 1PZNA 1PUIA 5LD2B 3DM5A 4YQFA 2B8TA 4PO1A 3KFVA 3LNCA 4L9SA 4NCNA 1FP7A 1M7HA 1SXJD 1Z8FA 2F43B 2QA5A 5FI1B 4PTLA 4D0NA 1XDBA 1E3MA 1Q57A 1Z0JA 2ZJYA 4BWYA 1KZGB 3RS7A 3MG9A 1KHTA 5P21A 3G5UA 4DSOA 3L0OA 1P75A 1YZUA 2JLQA 3M4YA 3T61A 3TRFA 1T0HB 3NEJA 1NIPA 4ARZB 2E87A 3UWKA 4AC9A 1G9XA 1RYFA 1CP2A 221PA 1XU4A 1E0AA 3B60A 1JPJA 2BBWA 2QPAA 1SKYB 4KV9A 2PBRA 3X1ZA 4O2RA 2QQ0A 3SJBA 1EFTA 1T9HA 4GT1A 4M1TA 3OE7D 4MGIR 1UJ2A 3RS2A 4BECA 2YZ2A 3V00A 3MFYA 2CJWA 4MKHA 5AK0A 4URYR 2OLJA 2RGBA 3SYLA 3A4LA 4NCKA 2V7QA 4PPQA 1OT3A 1KDRA 2B21A 4F4CA 2X2EA 1EGAA 4AK9A 4NZYA 1WBBA 3TVTA 2R6FA 5EUMA 3TW4A 2OFXA 2GK6A 1IY0A 1T8UA 2WJIA 4XTCS 3TQFA 1LV7A 3SHWA 1E79D 4CYMA 2GF9A 2O8EA 1R5OA 4HLUC 2QTVB 1XEWY 4ASUA 4F91B 2OESA 2RCNA 3AF3A 3EA5A 3BE4A 4TQAA 1CJUC 2DWPA 1WE2A 3NHAA 4YXWA 4DJTA 1YHNA 3AKYA 1E1RD 4TTRA 1D8TA 4GP7A 4GZLA 4Q7LA 4GL2A 4HLDA 4LYHA 4PO8A 1VMAA 2O0KA 3CF2A 1RJ9A 1E9FA 2QN6A 2Z83A 3QG1A 1XTQA 4GOKA 3U4QA 3B82A 2GCOB 2ZJ5A 4JT2A 1OH8A 1P62B 1N25A 4OBEA 4ON9A 1BMFD 3C41J 3FHTA 1E0JA 1Q1EA 4Q9JA 4MDEA 2JEOA 3P1JA 1MO3A 4KYUA 2GXAA 2J0QA 4PHHA 3U3MA 2GEVA 1OH7A 4LHXA 1VHLA 2ZRLA 3DOEA 3LRPA 3IBYA 3PUYA 4ILEA 4TLDA 3GJ7A 4B3DA 4KFSA 8OHMA 2XTMA 1E4VA 1G16A 1KI8A 3EARA 1CR1A 4JVMA 5G53C 1XD2B 3GP8A 1UADA 2V3CC 1XPOA 4B73A 4ZCIA 1EFRA 3KKNA 4AWXA 2J7KA 1PUJA 1G3QA 2UKDA 1ZNZA 1RKBA 3KFXA 3EG5A 4DDTA 2CNWD 3QXCA 3RRMA 3U3OA 2WOOA 1NP6A 2ZR0A 3IO5A 3AGPA 1E9DA 3FKSA 3EIQA 3QXXA 2O8CB 1HT1E 3PR1A 5KSPA 1ZD9A 4Z54A 3MUFA 4LI0A 2ATVA 2ZETA 2J5XA 4JLVA 1YR8A 4IW3B 621PA 2V7QD 2PZEA 3S1AA 3EC2A 1SHKA 1N6RA 2VH5R 4OL0A 4XIGS 5B30A 1KTVA 4A6XA 4M1SA 1N5KA 2G6BA 3CRW1 4YDHB 2QROA 1OB5A 2VP4A 5GJWC 1GNRA 3WMEA 3CB4A 3PCRB 4Q4LA 1F48A 4JYBA 3AV0B 3SC3A 3LQRA 3VX3A 1DO2A 1OXXK 4Q01A 4QFMA 4A1FA 4ASUD 4DCUA 4CEIA 4D2IA 4YXWD 1S1MA 1X8KA 5JBQA 1E9CA 4NP6A 5ELXA 1EFUA 3TR0A 2QT0A 1T91A 2W6IA 1GKUB 1JR3D 1NKTA 1SZPA 2FFAA 3GFTA 3LH5A 2IEZA 1QHSA 1AKEA 2VHUA 2V6IA 3T1QA 4A8JA 1TADA 1CJVC 1K5DA 2ZAMA 4MKIA 4LJ5A 5J5CA 3LLMA 3I62A 1GKYA 4YLGA 1BMFA 3A1SA 1W7AA 1G3RA 4LY6A 4S35A 1X8JA 2QAGC 3TKLA 3FPAA 1II8B 2REBA 3FWYA 5CDFA 4RZXA 1FP6A 3RRYA 3WBKA 2A3RA 2OXCA 4C0LA 2ZM5A 1Q12A 2HLDA 1IBRA 4NDZA 5JSZA 5IF9A 2J41A 4PSVA 1HE8B 1V5WA 5SZHB 3THWB 2VEDA 4EDHA 4Z1MA 3TUZC 1DTSA 3PENA 3WMFA 4LBVA 3KKPA 4HAZA 2C96A 2ZU0C 2J7PD 3CIOA 2OCAA 3HR8A 1JALA 4B47A 3ETLA 2JJ2D 2ERYA 2JIZA 2ZRGA 3IGFA 2N1BA 3BS4A 3VX4A 5F98A 2GXQA 1D2EA 4QHSA 5CYOA 2HXSA 3QSYA 5GVRA 1P9NA 1T5LA 2VHJA 3B8HA 1RRFA 5EE1A 4FWTA 3A37A 2IYWA 2I3BA 1J90A 4IOMA 5KYKA 1R2QA 1T6NA 3O47A 1ZRHA 5KNCA 1A82A 4WW0A 4TSFD 4EIWA 1ZVQA 2GEUA 3AUXA 3L82B 2YKGA 3PV0A 1LW7A 2HEIA 4KFTA 2J9RA 4C4PA 4RJLA 3SQXA 2EFCB 3D31A 4FWIB 2F3TA 2QSZA 3U60B 1E96A 2IHYA 2WMNB 3LLUA 3UG6A 4D4LA 4TT3D 1ZNXA 1XMJA 3PEWA 3V4RA 5JJKA 1NBME 1KMHA 4YMWA 2P65A 2W0SA 2HJGA 3RVBA 2XXAB 2GCOA 3C15C 1BYUA 3WMGA 3BK7A 3J81k 2W6ID 2HUPA 3EZ7A 1SKYE 1JJ7A 3MJRA 1DEKA 2QU8A 3A8TA 4KXFB 4P4SB 3L0IB 5JRZA 4MDFA 3OIVA 1ZM9A 3K0AB 3OIYA 4C7OA 1PLLA 3W6PA 4BE7B 2OO7A 5L3QA 3KJEA 4AYWA 1E2GA 2IXFA 3LQQA 2YWGA 2PEZA 1LNZA 3VKHA 2PCLA 4NCIA 4Q47A 4TQUS 4X8HA 3THYB 5DGXA 3SBEA 3DEFA 3MCAA 2NO7A 3AGQA 3GLFB 5BW8A 4AKHA 1GRQA 1QHIA 1C1YA 1W0JD 3KXLA 3MWLA 4RZUA 3EPJA 1CRPA 1RW4A 3VR4A 3BXZA 3BH0A 1WCV1 4PANA 1FNMA 2CEAA 4TL8A 1SVIA 4URXR 2H16A 2AX4A 1F6BA 3IEUA 2OAQ1 2ZE5A 4Z51A 2A5FA 3RRNA 4RZ3A 3TIFA 2AWOA 3E70C 3L2OB 2OCBA 4B3XA 4Q03A 2VF8A 4Q1FA 3QPWA 1T8TA 2C98A 1G18A 3C14C 4XOIA 4NYMR 5FPSA 4URWR 1EK0A 4RZ2A 1PVOA 1TF5A 4JJZA 4A0HA 4JS0A 2Z43A 4CF7A 3LD9A 3K9HA 1KSJA 2WWGA 4F38A 1HTWA 2P67A 3LXXA 1RPZA 4WZAE 1RRGA 1Z2CA 3K0FA 2O8FB 1CEEA 2ZYUX 3EA0A 1NIJA 4FMCF 5FR2A 4RFSA 4J0QA 2FGJA 1C4OA 2CCGA 5TXGA 5DN6D 4D26A 3HJNA 2XEXA 1CR0A 1FL9A 1SHZA 3GLHB 1XF9A 2PMDA 4A8JB 5M04A 1XXHE 3KB1A 1BOFA 5BYJA 3ICQB 1E9RA 4Q7KA 1NN1A 1R0WA 2DPXA 4HUTA 2PH1A 1J7KA 1N0UA 3Q72A 4EKDA 4RD3A 4D0GA 1UBFA 5KOYA 1NMXA 2Q3FA 2WAYA 4IFEA 3QBVA 1KO5A 3FOZA 2V54A 3K09C 2O8DB 2G0NA 4HAYA 2DFNA 2CL6X 4WVFA 1CR4A 1XFAA 5EE0A 1XMSA 2A9KA 1N0WA 3SFZA 1SGWA 3TR5A 2LKDA 2R6GA 2WPDD 3CLVA 1NY6A 2C95A 1QHNA 3FFAA 4EPYA 3PIRA 4TYNA 1FTNA 1JXMA 3I32A 1KO4A 5AJYA 2EU8A 1ZM2A 2ODWA 1TU3A 4FCVA 2OBLA 5JZVA 3IQWA 2AKAB 2BC9A 1SVOA 1N6IA 4MRNA 1CRQA 2NG1A 3TW8B 1S3GA 4DLSA 3VNVA 3ADDA 1Z6GA 2ZEJA 1UFQA 3CKLA 4Q21A 1GRRA 1GAJA 4QG7A 3K9GA 3U61B 4DXAA 3AP1A 4QHTA 4V0KA 2A30A 3ND9A 3W8RA 3I72A 4TTQA 1IAQA 4NONA 4GDFA 1G3UA 1P60A 3BIFA 4HUQA 1XZQA 2JDID 2QMUA 3RYTC 5FTLA 2ODNA 1KMHB 3QKRA 3VTKA 1U0HC 4W5WA 1NLYA 3SNHA 2QQEA 5CK5A 4Q9KA 5AJVB 2A2ZA 3FKQA 2C77A 1D2NA 1KIMA 4QGFA 5DYGA 2F55A 4GOJA 2KI5A 4LJ9A 2R6DA 3A1UA 1Q1QA 1U0LA 4MYHA 1G7TA 2VBCA 4C7OB 5HZKA 5AJZA 4LSGA 1EFHA 3F3YA 4O25A 4W7SA 4BLRA 2GA8A 3CX6A 3CNLA 3JZMA 4DEYA 3AKCA 3L0SA 1X6VA 1G8PA 1S96A 3IDQA 5CLQA 3WRXC 3THYA 1FTSA 1XTIA 1Z83A 4EPRA 5H70A 1F2UB 1N6NA 1D9ZA 1E2EA 1II9A 1FPMA 5DHAA 3T34A 4XWKA 2P0EA 3CONA 2WKRA 2V4ZA 2GZHA 2OT3B 4RVCA 2OILA 1SULA 1Z0KA 3CPEA 5FPHA 1XEXB 4QNMA 3ONWA 4A9AA 1WA5A 1TQDA 5EXPA 5KHOC 3DZDA 3RANA 2GBLA 3B9QA 3QE0A 2FPKA 3Q7PA 1E6CA 2QM8A 4WA7A 1DE0A 3A4MA 1VECA 2JASA 3C8UA 2VP0A 3ECCA 4JLPA 1TQ2A 1DELA 3AH8A 4PC2A 4QC2A 2XB4A 3OIWA 5JWRA 4POAA 4PZZA 3L0PA 1W5SA 1JI0A 1H8HD 2ZPTX 5HCIA 5JRJA 5FBRB 2IXEA 4BFZA 2PLRA 3WXMA 4AD8A 1QG2A 4L4UA 4R2IA 1G7RA 1GZSA 2XOKA 3BBPA 3MAAC 2GJ8A 2IXGA 3WNCA 2WJVA 4BEJA 1RYHA 1KSHA 3R7WB 4ZDIA 5B58C 4TLBA 3I5YA 1J8MF 1IM2A 1FX0B 3IKJA 3CBQA 3NBYC 4LBYA 1W48A 1GFIA 1W0KA 1D6JA 1OIXA 4D81A 2A7QA 3T15A 2AD5A 2WWXA 2ZRPA 4B6EA 2B6HA 2OUKA 2P3SA 3ZZ0A 2QPTA 4PSAA 1HQYE 5E7JA 1OH5A 5J4YA 2CHQA 3RNLA 5HCNA 2HV8A 2BCJQ 2BVNA 2J0UB 2WSSD 1N3BA 3VFDA 2O8DA 2J0VA 4OI4A 5TMPA 3B78A 4M9XA 2VP9A 2FEOA 2VYFA 4WZ6A 4A82A 3D3QA 4IVQA 4MYCA 1P72A 2BJVA 4CZ2A 4JBWA 821PA 2IS6A 2WJYA 3U3RA 4JSYA 1L7VC 2SHKA 4R9UC 4HI0E 1Z6XA 4XWAA 1QVAA 5KPDA 3PEUA 1Z0DA 3MRSA 3ZH9B 3TUJC 1P4SA 2VIIA 2C78A 2QAGB 4HAWA 3RABA 1YZLA 2OLKA 1TAGA 3AP2A 2F43A 1VCMA 1RC8A 4ZCLA 3IPYA 4DLWA 4IOJA 3X1DA 1OXSC 2FNAA 3X1YA 3U2QA 3PEYA 2PZGA 4N0EA 4CIDA 3E5HA 1OW3B 4TMWA 4DLTA 3GQBA 2ODEA 4M22A 4V0OA 3B9PA 3U7GA 2HYIC 3AF4A 3IBGA 2EW1A 4LBZA 2GWHA 4I99A 1IONA 1ZMXA 3HR7A 1YRAA 3A1TA 2BBSA 2GBLC 4DKXA 4HLQB 3ADBA 1A5TA 5EXTA 1CKEA 2X2FA 1GIAA 1DADA 2PX0A 3QQ5A 5CB8A 4UKDA 3VR3A 2C9YA 3LV8A 4G5GA 1UDWA 3GPLA 4A36A 1EWRA 2WKQA 4IKEA 2BWJA 4PSKA 3VMFA 1UM8A 1NBMA 1MRSA 4BFTA 2A5GA 1UBCA 5EP4A 4LYJA 2ZQ5A 1SQ5A 1KI6A 1QHHA 1GG2A 3CO5A 1KO1A 2V8OA 3X1WA 2F9MA 4JKYA 2XITA 1XBTA 3H86A 1OYYA 1CJMA 1G1MA 4EAQA 2YC4C 4F4IA 2GKSA 2IYXA 1W2HA 2WBLC 4H1UA 2O8EB 4A0GA 2WSSA 4IFBA 2ZI7A 3GJ0A 3RDPA 1E2KA 4M9SA 3CR7A 1PLJA 1GSIA 1YZNA 4GFDA 1GOTA 4LBWA 4PZLA 4RSGA 3KXIA 4CW7A 2EFEB 3ZIAD 4RD4A 2WIBA 1MV5A 2ZSFA 4ITRC 4IXMA 2YWHA 3UG7A 3EASA 1PJRA 2R2AA 1I4TD 2YV5A 2BKEA 3CW2A 4HDOB 4H1VA 1OFHA 2A78A 1NRJB 2VP5A 4BUJA 3U4QB 1U81A 1N6LA 2ZJ2A 2ZJAA 4M2LA 4NTZA 3M6AA 2ZYTX 3KQKA 1YZTA 4M9ZA 4DCSA 4A8JC 2BMEA 4V0MA 2BMJA 2ZTSA 1DARA 1ONBA 2QMHA 3LFUA 1JPNA 3BB4A 3OF5A 4Q4AB 3FFBA 4IVPA 4NCJA 4URUR 4Q7JB 3NC1C 2G1KA 1XPUA 2J59A 5AWFC 1KKMA 3NC0C 4FCTA 1F60A 1XD2A 2GETA 1XPRA 1VYUA 4RD0A 1CULC 2VPPA 2D7DA 4E5UA 2QTHA 1G6HA 1OFUX 1FX0A 3SJZA 4HB2A 3MGCA 4URZR 4PHTA 2OV2A 2P2LA 2XJ4A 4OHVA 3O8BA 5IRCD 2FGKA 2GJKA 2GF0A 2ZR9A 5A5GA 4B6FA 3THOA 4C2TA 4KVAA 1KMQA 1LVGA 2UZ3A 1M7BA 1M2OB 1N5JA 2OEPA 1OHHD 2GESA 3CF6R 4GSYA 2NO0A 1GKIA 2GTPA 1MR3F 2AN9A 3RLFA 4B34A 2O0HA 4WIAA 1P2VA 4G5QA 1ZNYA 5E4FA 1Q1BA 2FU5C 2CMKA 2ZVQX 4MRVA 4B32A 5IT5A 4KAXA 3ZDQA 4G5RA 1S4QA 2QP4A 3LY5A 3LVQE 2BEKA 2WWFA 4ZCMA 2WWHA 2ZJ8A 1MT0A 4KFRA 3FYHA 1KYIA 5DNYB 2O8BA 2E1RA 2ZI4A 3WBJA 1FW6A 2ZSDA 2FWRA 4NPHA 4M1WA 4MUBA 1E94E 1N6PA 4CEIB 1EESA 2ZRBA 3LW7A 2FFHA 4FCWA 3BH7A 1ODFA 3NDBB 5EE3A 1VTKA 3REGA 4RCZA 3OE7A 1TEVA 3H4MA 3U44A 4A2QA 4LHZA 1G20E 2C9CA 1Z63A 3D8BA 3UKDA 5FL7D 2F6RA 3EXAA 3GEEA 1E9SA 3NBZC 3OIUA 2MSEB 4GPTA 2IHBA 2N42A 2W83A 5K8TA 1WB9A 2AK2A 2KBEA 1MO4A 4QJ5A 4CT5A 4P4SA 1LY1A 2HF9A 1P61B 1QF9A 1RZ3A 3CPHA 4MGYR 1E79A 2F9LA 2QUZA 3NDPA 4X8LA 2OAP1 2PCJA 5JWOA 1G41A 3BD9A 4KBGA 4EPXA 5E7IA 2DWOA 1TF7A 2BM1A 3A36A 4IOLA 5LD2C 1T3SA 3F8TA 2CHGA 2F1HA 2IYVA 3GJ4A 5DO9A 1KI6B 3CH5A 3G82C 3ZJYA 2J1LA 4N1AA 4UNQA 2F7SA 1NVVQ 3ZVLA 3SFVA 5AUOB 5KDOA 1E2IA 1OHHA 4TZ0A 4DIDA 1W2GA 4RKFA 1ZIOA 3K0CC 5G41A 3PJRA 2YHSA 2FSIA 5DI3A 3DVLA 3PUXA 2ZXUA 2JLSA 2CCKA 2CL0X 4XSHA 3QG5A 3FVQA 4OK6A 2W2VA 2Q9BA 3ZQJA 2ZRHA 3B1ZA 1D9XA 1SVSA 3A58B 3KKQA 4NKRA 4KJZA 2FV8A 4LOAA 4QJ3A 2W2XA 4PQRA 3GLIB 1QHGA 3AF1A 3N2EA 4UNNA 3UWOA 1E2FA 4GI7A 4AI6A 2NO6A 1EFRD 4GOXA 4Y0AA 4RD2A 1F2TB 2QGZA 3OHMA 2H5EA 2N46A 2Q0HA 1L4YA 2ZRIA 1FNNA 3W5IA 3QF4B 4ZV4A 1TX4B 1ZU5A 1E2JA 3VHXA 5LPNA 3AKDA 3K0FB 2ZYVX 3WNDA 3FKSD 2PL3A 4NYIQ 5KU1A 5DISB 4N0DA 2GJAA 2GEDA 2W2TA 1RE0A 2B7BA 4FD2A 1TF2A 5FPTA 3FGNA 4M4SA 3BC1A 1XJ0A 4XTRA 2V6JA 2IUSA 2DFTA 3VR1A 4HZUA 2V1UA 4DCNA 4OHWA 1DAHA 4BZPA 3NBXX 5EJEA 3HU1A 1SXJB 4YMUA 1N5LA 4DB4A 2XTZA 3GJ3A 3IUYA 1OV4A 2FH5B 4LJ6A 1G5RA 4LV8B 2H18A 2QG6A 3GLGE 5SZKB 2V55B 3QPUA 1ZUHA 2RHDA 1Z0AA 1KO8A 1OFTA 2J87A 2VSOA 4EJSA 1R5BA 4ZI2A 2YNMA 1Z6TA 1JBKA 2JATA 4II7A 4OQXA 1NVWQ 1JB1A 4QL3A 5JI3E 3WYAA 2WZQA 5DIFA 1X8LA 5JCPA 1JR3A 4L9WA 3SR0A 4MQBA 3KQHA 1P3JA 2DYKA 4JLKA 4UJ5A 4R98A 3DMDA 1G8GA 2R6AA 2ZJZA 4KI0A 1HE1C 3KDSE 4R7ZA 3WY9A 3I8SA 4LC1A 3C5HA 1P2SA 4L15A 1NLFA 1PLKA 1GL9B 1UEJA 1E2DA 3W8NA 1YR6A 3EPLA 3SE0A 2BIFA 2ZI3A 5J4VA 3VHLB 4NYIR 5E95A 3CWQA 1J8YF 3QI2A 3WHKA 1N6OA 1KJYA 2GVDC 1FUUA 2HLDD 4BLOA 3QXSA 4U00A 2O8FA 1JEEA 4IDPA 4M1YA 3W5JA 2ANCA 4K81B 3KX2A 2XTNA 2CDNA 4UJ3A 1GUAA 2G1JA 4QHYA 1DAKA 3AQ4A 4DDWA 2FSHA 1G8FA 4ARZA 3TAUA 1O87A 4OI2A 3RC8A 1S3SA 3MLEA 2J7PA 2FE4A 3I3SR 3AVOA 5F9HA 3I1FA 2GILA 4MRSA 4PC7A 4Q7MB 2ONJA 2ZRMA 1HA3A 1ZINA 2JJ1D 2VSXA 3ZQ6A 5J4KA 2ZE6A 2ORVA 4Q48A 1NJGA 1NVXQ 1NVUQ 2XJ9A 4MH0R 5JLJA 2O52A 1LS1A 1E99A 1E98A 1BO6A 1N2CE 3QIAA 2XAUA 2YOHA 3VKGA 4OQFA 4B3BA 4FIDA 5K8LA 1L8QA 4M53A 5DSZA 1R7RA 2BDTA 2BHRA 2D3WA 1E2NA 3NH9A 4P4TA 3SDZA 4PAQA 3TLXA 4EPTA 5EP1A 4V0LA 1VIYA 1F2UA 2R44A 2WMOB 1JNYA 3EZFA 4XVQA 2OE2A 5DI3B 5FTNA 1Q21A 2NMVA 1B23P 2AHOA 3ASZA 2V1XA 2C04A 4DSUA 5EE5B 1OE0A 2BOVA 3IILA 3RC3A 5TVKA 2O5VA 4QM7A 1MO6A 3DMNA 1K8RA 5UKDA 1T5IA 4L5BA 3U7FB 1AS0A 3B5JA 2WJGA 3H0KA 2AR7A 1CLUA 1KDTA 5FTKA 4W9MC 2OHFA 1ZUIA 2HYDA 4DEXA 3CNOA 3U7EB 2XSZA 1YR9A 4PX9A 3QKRB 2VRWA 4HYYA 4KYIB 3NWJA 1W0JA 1Q0UA 1LTQA 2HCJB 4TLCA 5C4GB 4JBYA 1G19A 2MMCA 3L43A 1F5NA 3NTUA 3KTAA 4BPBA 3UK6A 4UNSA 2QENA 3GEIA 1TTTA 4ACBA 4G5OA 1RRCA 4HZUB 2XNDA 3MWYW 4TWZA 1OLOA 3QEJA 1P7CA 2O8CA 5FL3A 3ADCA 4AY2A 4DLZA 4P0TA 4QBGB 3U3JA 1KAGA 1U2RA 4LJ8A 1F3OA 1TMKA 4D6PA 4Q18A 4C0HA 4KO8A 1R8SA 1NN3A 3EX7C 4BFWA 1P9RA 2HCBA 2VP2A 1Y3AA 3BB1A 4PZYA 4I1SA 2E9SA 4QBIA 4TL7A 4PC3A 5JJLA 5JS7A 5L3SA 1P6XA 3ASYA 1XTKA 2VF7A 2OCYC 2ZE7A 1I2MA 1KK1A 2PT7A 1DG3A 3H1TA 4IDNA 2IYTA 1A4RA 4OJKA 2YVUA 4YONB 1Q20A 1Z0IA 2CBZA 4D0LB 4ZKDA 3T1TA 4ZIRB 4A4DA 4ESVA 1AGPA 2GAAA 1U99A 2ZI5A 1Z6YA 4HEJA 5F2EA 2P6RA 3ZVRA 1QDEA 2RGEA 2QSYA 3H84A 4JL8A 3GLGA 4C0AC 2FDCA 2QAGA 2ZYWX 3D6TB 3EZ9A 5KO2A 3NHBA 3FTQA 3W3AA 5EXSA 2MSCB 3BERA 4O3MA 2VSFA 3WP1B 2NO9A 4GNKA 4AURA 4FI3C 4XD7D 5JEDA 2CK3A 4C30A 4Q1CA 3QVUA 3HP1A 4IHQA 3R9IA 3SBDA 5HR5A 1K6MA 4JVLA 4LYFA 4IVRA 1DVRA 2ANBA 1KK2A 1U98A 2AXPA 2RHMA 3O8DA 2Z0MA 1E9EA 3TAHA 4CRWB 4Q5IA 3T5DA 3WHLA 4BGDA 4OQLA 2FPLA 4UNRA 1SXJE 5D3QA 3KUCA 4B44A 4BFVA 3K53A 2QGNA 2EWVA 1G21E 4IJMA 5B64A 3BWDD 4BFYA 4K46A 3THWA 4DSNA 1QG4A 1ZM7A 2ZIAA 1NN5A 4Q02A 5EXXA 4B74A 2ZS9A 2LWIA 2XNDD 1KO7A 4PXAA 1NKSA 4NYMQ 4LV6A 1YRBA 1SVMA 2YC2C 2ZRCA 4D25A 2UZIR 3NXSA 5L8VA 2NPIA 1U8YA 2VP6A 4JSTA 1RRPA 2F1RA 4W5JA 1YZQA 4NBSA 5H68A 1XD8A 4OJQA 4Q1AA 2AFHE 5CJPA 1KDOA 3MJHA 2F1IA 2GZDA 1E32A 1MABB 4BQSA 3LO5A 1UBEA 1Z0FA 3LDAA 3T06B 2ZRKA 4PAMA 1ZBDA 3GD7A 3KUDA 1ZD1A 2G0TA 4QJ4A 4BEBA 2WICA 3QF7A 2CLCX 4TMTA 1E9BA 1CR2A 2FA9A 4JL6A 2KBFA 3SOPA 1WBDA 4DC9A 1NI3A 1Z08A 4OQMA 1ZP6A 1VCNA 1A7JA 4DLXA 2Q3MA 1SXJC 1W4BA 4UXIA 2OFWA 2WSMA 5HKKA 3CRRA 5HE9A 4A2WA 2IYSA 3PITA 2CE2X 3CH4B 1CU1A 2KWIA 4V0ME 3EIEA 1E1QA 5TB5A 2J45A 3QBTA 2EYQA 1XD9A 1MRNA 3DHWC 3A1WA 4DLVA 2IA5A 3A4NA 2QRZA 5AJWA 1H65A 2CL7X 3W90A 1TUEA 2ZUBA 3KQLA 2IS1A 1QHHB 1WMSA 4DB2A 3O8CA 5TDHA 1KI7A 3EIHA 3BFXA 1VDZA 2JA1A 1E0KA 3KB2A 2IUUA 3GLFE 4B2IA 1HY3A 1AK2A 2CLSA 3I4LA 4KSCA 3K9LA 1RVDA 1SKQA 3KKMA 4OK5A 3VU9B 4A92A 1W36D 1PV4A 1KI3A 2BCGY 2JGNA 3OEHD 5C18A 1OB2A 3FMIA 2WWWA 2OM2A 4HB4A 3KL4A 3QENA 1CBUA 2PZFA 1XMVA 2XOKD 4BLQA 4EQ6B 3B1YA 2QP3A 3LXRA 2XX3A 3JZAA 1JXOA 3LVRE 3KQNA 1RFLA 5FOTA 4Q4JA 4AG5A 4BFUA 1S2MA 1DAIA 3HPRA 4WZBE 1R0YA 4D4MA 2GJSA 1CF4A 3IHWA 3IHLA 1W0KD 1CJKC 1IN4A 1OXUA 5C2JB 3BJIC 4OHXA 5FOWA 4CDGA 4V03A 2NIPA 3M1IA 421PA 3GLGB 2ZROA 4DZZA 3T1VA 1WXQA 4Q4AA 5KUTA 3RS3A 2FFBA 3TSZA 3U44B 1W36C 5AUNB 2EYUA 4JZKA 1AN0A 2GJ9A 3DO6A 2KE5A 5H1YA 3VQTA 4NYJR 1YZKA 3K70C 2EFDB 1FOEB 1NLZA 1TEXA 4KLZA 5E3HA 3P4YA 4K8OA 1K5GA 3P26A 1XXHB 1JQJC 2QPOA 4BLTA 1N5IA 3AVQA 3C7KA 1FQKA 5EUQB 3KJIA 4TTPA 2RGNA 1X1SA 5CIWA 1EX6A 4Q1BA 1N0VC 1FZQA 2QORA 2FMXA 2D4HA 3AB3A 4JLBA 4JVNA 3VR2A 1G64A 3MD0A 2CJWB 1NJFA 1IY1A 2HJVA 5FUYA 3REFA 3U5ZB 3BFKA 1OH6A 1ZC4A 5IDVA 1NSTA 2I1QA 3GMTA 1QBKC 3GLHE 1U94A 1Z47A 4LX0A 3K0CA 4WBSA 2F1JA 1AM4D 1QHYA 2WJHA 1XX6A 2I4IA 1KI9A 4DUGD 2RB4A 2RMKA 3DPUA 3OEHA 2B7CA 1DOAA 4EUNA 4AKIA 4D4KA 3OEED 4Z8YA 4S2EA 1HT2E 1TQ4A 2G77B 4EPWA 5IHPA 3MMPA 5ANRB 3W9YA 3WNBA 5KTYA 4DBLC 3DKVA 4LWZA 1N6HA 3IEVA 1GWNA 3GLIA 1EWQA 1XP8A 4R2HA 4LK2A 4P3YA 1TUIA 4IDQA 4JJKA 3TSOA 1KNXA 5CB6A 2QBYB 3I61A 4C0QC 1UBGA 4HUQB 1T3LA 3AP3A 2VO1A 1CS4C 1E2QA 3OESA 4DWJA 5L3VA 2B8WA 1Z28A 2NTYC 2IWHA 4MKGA 1VG8A 3PUVA 2JLVA 5CM9C 4DT1B 2WAXA 1IN6A 1MH1A 1TNDA 3LBHA 3SJCA 4ZDJA 4IEIA 2Q3HA 1BKDR 2RGXA 3LX5A 2X77A 1G8YA 1UKEA 2OSBA 4EFLA 1ZM3A 5CDFE 4TN1A 3B7GA 4TMZA 1U8ZA 3NVAA 4A0FA 3JVUA 1XNJA 1IJFA 4Q9LA 5JFGA 1T3HA 4I4LA 1KAOA 1LS6A 4B71A 5FUWA 4I1VA 2IC5A 3ZIAA 2DHRA 5DHFA 4IXNA 4CEHB 3DKPA 4RCYA 3UATA 721PA 1IXRC 3DDCA 1AJEA 1DAFA 3CWZA 1Q3HA 3ZZTA 4G5SA 3KQUA 1NY5A 4ZI3A 4MUAA 4BASA 2D62A 3M0EA 4NMMA 1OF1A 2QMOA
chains in the Genus database with same CATH superfamily
4LQ4A 1YJXA 4M86A 1KA9H 3DDZX 3GJ6A 1L5ZA 4JEMA 3WK9A 4EM6A 3RTEA 1X39A 5KAPA 3AO0B 4AF6A 5BWOA 2HZBA 3E1KA 2NU9A 4HGRA 4RKEA 2P7HA 1G20A 2Z9DA 1BHJA 4Y67A 1DX6A 2OXRA 2QQFA 3UAYA 4FNOA 2Z1DA 2XLCA 4OHRA 3ZI7A 4RU1A 5CH5A 1VZ3A 2H7YA 2HF2A 5FKJA 1KK0A 3V8PA 1FQJA 5CLHA 4L76A 2NU8A 5BSWA 4N41A 3RJ9A 3ICVA 4U4AA 2QVXX 4MARA 1DT5A 4UHFA 3LSTA 1JAHA 1YDFA 3CPJB 3Q0TA 3PXGA 3D5EA 1R12A 1P5ZB 3E8SA 5FUBA 4YRFA 4D5GA 4RX1A 5F9MA 1V5GA 3VO1A 4UUOA 3WR5A 3O8LA 4DY6A 3IJRA 3QV2A 4GQAA 4J8PA 3QEMB 4WFQA 3UM9A 3D43A 1ZFNA 2QW1A 3P2YA 5HMMA 2LVBA 3LOPA 3C4JA 1PS0A 4IHKA 1U1CA 5GPBA 3W77A 5IUKC 3IP3A 1AURA 4P83A 3RS0A 3ZU3A 2AQIA 3GXOA 4RADA 4PEVA 3KVOA 4UULA 4Q9IA 4CEJA 3SIXA 5ALVA 1SA0B 1RJWA 1WM1A 1T4GA 1TZBA 2PKRA 3AI2A 3BXXA 5FD8A 2MYNA 4EARA 4ZO4A 1AMUA 4E5NA 1YQTA 4J2OA 1ZNWA 2XWSA 5HCUA 5CD9A 2J3QA 2V4UA 2FX2A 4H7FA 4ZHQF 5GINE 4KH1A 4QYXA 2FXVA 4QBFA 4AJIA 3JR3A 4QEZA 3PTLA 4M7RA 3A9TA 2RG7A 3RS4A 3SF0A 1WMBA 5DTJA 4FEAA 2YS6A 5JSZB 1RWWA 1UUFA 5K2OA 1C81A 1V43A 5E2AA 5CFRA 2R7MA 5G4LA 4BPRA 2ORIA 2R751 2REXB 5SV2A 2ZYHA 2I7DA 3H8SA 3P0EA 2FSVC 4W9RA 5IVDA 2OMKA 3AB7A 5KWJA 1A9TA 5IJ9B 1M2JA 2BGMA 4G4IA 4C14A 4F4JA 5KYGA 2H8GA 1LKZA 4IOKA 3H0EA 1XCGB 3D4PA 1NDHA 2AW5A 3ILHA 2P2SA 3LQ2A 1NBOA 4WY5A 2NQ8A 2X8JA 5AHOA 4BN4A 4TVSA 3DJFA 4OXIA 3VRHA 4M1OA 4UXHA 2IDZA 3LC1O 5I7FA 1O97C 2BUAA 3NCTA 1MOZA 4Q9AA 2PMCA 1M2EA 2XDAA 2WA1A 1D0IA 3F7OA 1YDEA 3R5SA 2LCFA 4B81A 2ZRNA 1KFBB 1JKIA 4QJBA 3PQDA 5DRTA 2P35A 2B83A 3K2QA 3ZWQA 4KR6A 2C7GA 3SZOA 4EK9A 2FEPA 2XGSA 4PXSA 4J7AA 3DEZA 5FP0A 3TFQA 1SC4A 5D5PA 3TVDA 2HRQA 3TJZA 4UBLA 3SYNA 5AXAA 1APBA 5LZ8A 4BGUA 1JLSA 1QGAA 2AFHA 1V1MA 3SC4A 3TH5A 2I9PA 4FT2A 4IV0A 3PDIA 4D0RA 3AYXB 4BNGA 1U7XA 3T7IA 3HY4A 3UHPA 1SVWA 2G71A 3MINB 1TPZA 2GAOA 3DPIA 3OEWA 1IE3A 2GUWA 3PB3A 4GZ6A 5HS6A 4C04A 4GMHA 1WCXA 2QVCA 4FTWA 1E7MA 1E2BA 2GK7A 4YJ3A 2EG9A 1TT5A 4HADA 3PSAA 4FUQA 1P0IA 1KQNA 4YPFA 2W8ZA 4R3WA 2VPWA 3ZCTA 1FDVA 1K5HA 1NYTA 2C2HA 1YU6A 4FX5A 1SIUA 4K9OA 4W5HA 5F2OA 3FIUA 2AI2A 3K2IA 5ERXA 1FDWA 3FB4A 3QYPA 2WUFA 5EUBA 5A5FA 1EX7A 4OP1A 3HGTA 3EF1A 2OD9A 5FPYA 4GI5A 4AXXA 1M1NB 4XYGA 4HVLA 5HX7A 4OF4A 3OKPA 1Y9EA 2BFDB 5G1NA 1WUTA 4O33A 5ES4B 1L5HA 2H6EA 3AEZA 1XJCA 2UVDA 3V6LA 4NATA 2WQ7A 1JEYA 1JKJB 1RM4A 3K31A 2CNWA 1KI4A 2W2KB 4PFKA 1H0KA 3KSRA 4BB5A 2XT0A 4QODA 5MGNA 1N9ZA 4A0QA 1J8DA 3JQBA 3BXGA 1IHDA 1I4DD 1E5XA 2X1VA 2B5VA 1OLXB 2CJXA 4RTPA 1DDOA 4YAOA 5K01A 3HCCA 3RSOA 4JDUA 2IYUA 1WW2A 1QKKA 3DTVB 5DMHA 4FZRA 1XTTA 2DT5A 3UGKA 2ZUDA 4AN0A 3Q3JB 4RSHA 1X15A 1VE1A 3ZW9A 1GVNB 3B52X 3PDJA 1NNEA 3E5NA 1AV6A 4WNAB 2RHLA 2FUKA 3B2EA 1MMFB 4KXWA 3TDNA 1C0EA 3ZQKA 3LF1A 1HLPA 4HB3A 3DE3X 1JG2A 5ESDA 5G3ZA 2JLWA 3L0YA 2FWAA 4MROA 1LI4A 3DULA 2LKCA 5AM1A 4B7UA 6YASA 3TUIC 2IHUA 2REOA 4KDFA 1GNPA 2BSXA 3L0CA 4Q4HA 3LUCA 2MSDB 1FJXA 3MXTA 3QA9A 4HRXA 4QAQA 2AG8A 4LE1A 1AO0A 3AVYA 3LECA 4N7MA 3NPAA 4DLUA 4X9XA 4AFNA 1QRRA 4JLMA 121PA 2GYUA 3UHOA 4I3FA 5FOSA 4HDQB 1WKCA 1ODSA 4NBUA 2BH9A 1R8XA 1A69A 4DIKA 1KEWA 1PGPA 1Q92A 3ZBUA 4NY1A 2W6CX 5IBRA 1T8SA 4JLOA 3EXIB 1DTEA 4OV6B 4OAQA 4PGGA 1VG1A 3QY0A 5BWMA 5LMZA 3SMVA 3TOSA 3WP0A 2OQRA 3N2IA 4N3BA 2JZNA 4U63A 5HTOA 3K70D 2IX3A 2PYIA 2HGZA 4NCHA 2R65A 1XR3A 3E9RA 4MICA 1JN0A 4FFOA 4QSHA 4A5SA 5CXUA 6GPBA 4TQ9A 4HAVA 4I7EA 2X8WA 4QRHA 3V8MA 2RAPA 2AMLA 2IF2A 4NWIA 2GFQA 2CKMA 5EZ6B 5FFMA 3C8MA 4FB5A 2A5YB 2O5RA 5HRCA 1Z07A 3CZCA 1ZJWA 1ZYUA 3GHYA 4FVTA 4ZVSA 3F2IA 1Y1LA 5IP5A 5GGXA 1IN8A 5DWVA 4EW6A 1Y3BE 1Q14A 1NI4B 2EBUA 4JP5A 3KAJA 1DQRA 3TAXA 4UTVA 4YHHB 2UZ4A 1EZ4A 2A33A 2QT9A 4H9GA 1BW9A 2YYYA 4PQYA 1GJRA 1AN9A 2C84A 4JVSB 4LC0A 4B43A 1I7DA 4DIOA 3DMYA 4QXQA 2ZZNA 1KMIY 4LXHA 4R6WA 1FA9A 3R9XB 3R9WA 4GU5A 4OQZA 1K63A 2NTNA 3NGXA 4KAAA 5CFPA 5FWNA 3U6BA 4TWJA 1XROA 4BO9A 1KAMA 2XA9A 2CVHA 4UPEA 4XPZA 2E7ZA 5E4YA 2GCNA 4OXYA 4EATA 3W7VA 3NXKA 3UPUA 4JOBA 1P2FA 1WW3A 1HWYA 5HKAA 2BELA 4PPFA 5LYYA 2WM8A 2GBPA 1OFIA 1WCWA 1XZPA 4HS9A 4J7UA 9MHTA 1QZ3A 1VKRA 2CW5A 3R7FA 3ZCUA 4RTSA 4EFNA 1C1HA 3REQB 1H94A 2J9YB 5EP2A 1ACJA 1WG8A 3WTBA 4KG7A 4FYIA 1E4YA 1IB6A 4GWKA 4UDYX 3QOFA 4ZO7A 3AR2A 3A06A 4UQOA 4CMAA 1WZ2A 1NMEA 2O2YA 4F3RA 1XQ6A 1M34E 5DXAA 3N8KA 1SM4A 2WF7A 4N8DA 4IIDA 3CSUA 3I09A 2B1RA 2ZYIA 3LL7A 1QH8A 4JP1A 3OMWA 3STHA 2O2IA 5L6MB 2OBNA 2BRUC 4QDJA 1BQEA 1ENPA 1O94D 5BOSA 1B1AA 3Q87B 2I3DA 2VHCA 4O4LB 2EAUA 4E30A 2HNKA 2DFPA 3G9ZA 4HWOA 3B3QA 4X20A 1ZZEA 4YMTA 2QR3A 2PMBA 2YHIB 1J09A 1UDXA 2FLWA 2GBCA 1M76A 3CX8A 3MRTA 5DLDA 3ZY2A 2A0WA 3UJNA 2Q3CA 4K03A 3H6KA 4HVCA 1BRMA 3PJFA 4EB0A 4A15A 2QVLA 3C3MA 5H4HA 2X1MA 1CS0A 2X7HA 3ZLJA 2R25B 5FTJA 4B79A 2Y1DA 3SHQA 4X6UA 4X91A 4HZGA 5C4IA 3AF0A 4WNYA 4AG6A 3V9AA 1ML3A 3EEIA 3G1UA 5BNTA 2R6CA 3HPQA 1WVGA 4NEGA 1RIIA 4A8TA 2WKPA 2VF5X 1QC5A 1PSDA 1E2HA 2P4SA 2Y1KA 3DWEX 3TGWA 3W04A 3VDNB 4C43A 4NQRA 4PG7A 1AQ6A 4DV0B 3IXMA 3PJEA 4Z7QB 5IKXA 3H0CA 1KJ9A 1Z06A 1GZ5A 2GGSA 3FDIA 2VK4A 2ZRFA 2O3RA 2B8JA 1FNDA 2VCHA 2HBYA 3QE9Y 2PGLA 2HK8A 2WFAA 2BGLA 1P6QA 1X3SA 3FWPA 2FG5A 2HO4A 2ZKIA 3H1GA 3KT6A 4W6QA 4B76A 4XIJA 1Z9BA 2CLMB 4RBNA 5EE9A 3ZVNA 1A98A 3KPVA 2J3MA 4JI6B 3PNVA 5ALYA 1Z4MA 4F04A 2JVKA 1H8EA 1XLUA 5KZMB 3AG6A 3ZDEA 3DW3X 5AI9A 2FFQA 1CUAA 4CODB 1QCZA 1HDIA 1HOXA 1VL0A 3O0DA 5DTMA 3BGSA 3EY9A 2D7CA 3O7MA 2DFLA 4XSVA 5L4LA 1JECA 4ZVOA 2OBMA 2OXTA 1Q22A 2F8LA 2Z2IA 3C48A 2J3JA 2WZCA 3HRIA 4AJ2A 3K9BA 1T34A 3EXG1 3QELA 1NG9A 2BKUA 3BWCA 5B6JA 5IASA 2QOEA 2WF9A 2D2FA 2WFMA 5DH9A 5BPHA 4NH4A 1NNSA 3FNEA 4GVXA 2BKXA 4LZAA 5DYNA 3NG1A 5TARA 1EAMA 1CY7A 3S8YA 1MZPA 1YJ5A 2KB0A 2WWIA 3OVMA 5E8RA 3VNSA 5DN6A 3TG8A 4B3MB 1A5BB 2Z1MA 4CG1A 1XG5A 1CR6A 3FE2A 3NYQA 2RH9B 3F6YA 2H8KA 4YACA 2XQJA 2J0UA 2I7VA 2AEEA 4TM8A 1N1GA 4FW9A 4DLPA 3LZCA 3L01A 4ZVKA 3V8BA 2OB1A 2GDJA 1HNZB 4ND1A 4K87A 5CCBA 1YASA 3DF7A 3T12A 2CK3D 3VR5A 3F73A 5EJ2A 3WYGA 3MMNA 4GGMX 3HHEA 2WOJA 2AWNA 3A1VA 4KQHA 4R8LA 1NRXA 5CYPA 5TS2A 1SQSA 2HTEA 3OOSA 4GM0A 1CYEA 2A0FA 4KWEA 2R8RA 5AI5A 3TBHA 4JJIA 3NAMA 1G5QA 4EUHA 2H2WA 4RE5A 2WQ6A 3VNBA 1AZTA 3KYCA 3NIDB 3SZLA 4WFIA 4WCFC 3WKAA 1TI7A 3SE7A 3NW9A 4R0MA 2G1PA 3V8RA 2PRKA 2O5CA 1KJJA 2JFQA 4RIHA 4RHYA 4Y2SA 3AWIA 3AVWA 3EZ2A 2GAIA 1SJ9A 4US0R 1SXPA 3DDWA 2JCSA 4TKUB 5J9FA 1HNWB 1JR6A 3KQYA 5EKTA 3HFSA 3K72B 3T52A 3W2HA 2H48A 5FPKA 4AKSA 2FX3A 3GLKA 5D3MB 1NG1A 1BGXT 4FFMA 2Q3BA 5CEJA 1Z8NA 1EDBA 2I8AA 4QD3A 3BULA 1X77A 3BGWA 3FW1A 4DUZB 4K9MA 3I9FA 1PL8A 3IOEA 2J8ZA 4M0EA 3MSCA 1C8BA 3QVGB 4RJIA 5ALQA 1IN5A 2OCXA 3ODGA 4YWJA 3SBOA 4JDPA 3A11A 3ZWKA 4GRAA 5L3QB 2HBQA 3AOEA 1OVGA 2Z2ZA 4ZMBA 1OGIA 2VTKA 3HG7A 5CMLA 5B57C 2UUCB 1E69A 4Z8XA 1FMLA 1W85B 1E64A 1XC7A 1QS0B 1KKLA 2H0RA 2X2PA 2C9OA 2ZREA 5F64A 3SU8A 5ABPA 3D2BA 1DPGA 1U0TA 3AI3A 1XP5A 1DMRA 2AEFA 3AHDA 3CZ4A 3DV0B 3CUSA 4PHFA 4WZZA 3GLFA 3SXUB 3HB1A 3MAGA 2VH1A 3OAAD 4P31A 4TTJA 1IB0A 4UKDA 4C5BA 1JHDA 4JLDA 4NE2A 1F6WA 5CJJA 5FH9A 2VKQA 3AERA 3FPKA 3NEPX 2APJA 3NHRA 4TN5A 4ZQFA 5HS4A 2WQZA 4BN0A 3OFND 1ID8A 4YGXB 1SXIA 2VKTA 4MITA 1A9QA 1AB6A 4MVWA 4RJJA 3QVTA 1E2MA 3UA3A 2VF4X 2H00A 5FWXA 2DQYA 3TRHA 3IP5A 1GP2A 4B85A 5CTAA 4EF4A 3AHCA 3B85A 2I8LA 3PHHA 3IEXA 3GGGA 4LIPD 1P5HA 4MQ6A 2DBYA 1ZU4A 3ZD7A 3PFWO 4BWGA 1A1SA 2V45A 5B4TA 2Y1WA 1IMOA 4LNUB 4WFJA 2XZPA 5J4LA 2YBDA 3IPXA 4OYHA 2FVXA 5L3RA 3R7NA 5EVJA 1YDMA 4EO9A 5A4JA 5CG1A 4HWKA 4EJSC 4NXMB 1IN7A 1YDWA 2NU7A 3Q3CA 4IIVA 4R2LA 1FFAA 4IF4A 4NE7A 3ZWXA 2GVZC 3VTFA 5JTTA 3BMXA 3K0AA 4Y1RA 3UXHA 4JJ4A 4O4IA 5DXFA 4CG0A 4OQDA 2R8PA 4ZYYA 1EDDA 3R5XA 1QP7A 1OPXA 5ADUS 2H08A 3QE2A 1LVUA 3OCJA 5AUQA 1OKKA 3AHIA 3BN3A 3T5GA 3PX2A 4PLZA 1Z4LA 1XTSA 5DLQC 3K0SA 2ACWA 2H2HA 1XZIA 3MW8A 1G4AE 2VDPB 3BWBA 3NO4A 5D7BA 3TI9A 4EO4A 2X8LA 5GVSA 4Y2RA 1Q7CA 4TV9A 1T5HX 1UAYA 1I80A 4W99A 4V1CA 2CVZA 2HXGA 1JSRA 4P33A 4UFOA 4B4OA 1L5OA 1B93A 5E9QA 1PL0A 2RAFA 4ZOAA 5K7SA 4Z2AA 3PWSA 3NJ4A 4DMGA 3ESAA 1UT6A 4BMOB 3JRNA 5A0FA 1DJOA 1PD0A 2EFHB 2OR3A 2VDWB 2G5CA 2CJYA 1D2MA 3CM0A 3NIGB 4K6OA 4BX2A 2PY6A 4OXQA 2D2EA 4K0RA 3QKSA 3UAZA 4D82A 2UYHA 1NRWA 2ZFUA 2UVQA 4MYUA 3TNFA 2MIIA 2VL7A 3OOJA 5DM1A 2WIGA 1YMQA 3AK4A 4G86A 5KNBA 2ZBDA 1CERA 5SZIA 4D43A 2QTNA 4NU0A 1NT2A 1ZI8A 3G9QA 5IM5A 4L27A 2GZ2A 2PGJA 2I4OA 1A8SA 5FUQA 2DZDA 1UKZA 1T8PA 2IQ5A 2OGSA 4DQDA 5A04A 1I1QB 2SBTA 2XCIA 1JDNA 4L22A 3O3OB 1RIFA 2FF7A 1USIA 3ESRA 3S8EA 2J3LA 3TFOA 4KFCA 5JHGB 3KE8A 1E7WA 1T0UA 1LRJA 2IPXA 1ADJA 4Y1FA 1HH4A 2Z8YM 2OBFA 1PFWA 4XLTA 3A6PC 2VXCA 4E2FA 3ZDXB 4MWGA 1DBWA 5MFPA 2VZEA 4AZSA 1J0AA 3QYJA 2ZJ3A 4Y6GB 5ADVA 2ZUCA 1H2BA 2HAEA 2OCLA 2Q62A 2NP7A 1XYVA 4NBRA 5KSZA 3LT0A 1ICIA 3IAS1 3MJVA 5C51B 2YZMA 1RQ7A 1WP9A 2IYRA 4UU0A 4H3SA 3AW9A 3KVNA 1P0MA 3RSLA 2FJ0A 3AJAA 4A6PA 3SQWA 2LE0A 5G40A 1M2HA 5HEKA 4TTTS 1RBYA 3AOEC 4ZAVA 3CVWA 4YTEA 3PVCA 4PPNA 1MH9A 1SOVA 3CR8A 3GFSA 3S2UA 1UJ6A 2BI7A 3OE5A 3LE8A 4H60A 3PUWA 2QE6A 4D8WA 1A9XB 1YK1A 2K6GA 3N76A 4UFPA 5IJWA 3VXKA 5EIBD 1N7IA 1GA1A 4EHIA 3M49A 2QM0A 1ZAYA 3SVLA 4L07A 5LBIA 2PWPA 4LVUA 3AVVA 1EUCB 1U8AA 1X0XA 2CUNA 4QO8A 1XDGA 4XM2A 3HUFA 5IDWA 2XCLA 4UOZA 4I2NA 1XEWX 2CEKA 2P27A 1IUNA 1Z5PA 3H4TA 3TCNA 4XYBA 2J4DA 1I13A 1DS6A 3PZRA 3M5PA 4HDMB 4IF6A 1A2BA 1GNLA 3NHFA 5FORA 3T1NA 3AJEA 1QPZA 2IBMA 3HGMA 2JGIA 3UT5B 3V4OA 1GCGA 1N0HA 2BFFB 4TL6A 2VQSA 2X5JO 1ZY2A 3W0LB 3AKEA 3CRVA 3FWZA 4ZV9A 3P96A 3MTIA 1BJKA 1KYQA 1RU3A 3WMXA 3FCEA 5I9NA 4ZHQA 4GMDA 5FBLB 2PLFA 3RF6A 1RWXA 4LGCA 3EEBA 4FFNA 5EGNA 3Q5EA 4FFSA 2BFOA 2WKSA 3K2BA 3Q6MA 2OCIA 1CCWA 4HQRA 1QFSA 5LZ5A 3U31A 2RGRA 3EGCA 3L8YA 3THXA 1RAEA 3OZXA 1TZMA 3ZDRA 1RQ2A 1W36B 3N8NA 2BD0A 2P69A 2BEJA 1C7JA 4OI1A 4DA4A 1UAAA 1Q74A 4U5QA 5CIQA 5B2ZA 5E8JA 1C1DB 3Q85A 3EEQA 2FP4A 5FI0B 3KKZA 1KH3A 3O4GA 2L17A 1D1SA 4MWDA 4UNPA 3NFYA 4G0QA 1HYQA 4BNYA 3PFIA 4Q7QA 1VG9B 4A03A 2Z3WA 3E3LA 4QWMA 1GNVA 3ZS9A 1KDPA 1VJ1A 3IP6A 3HZZA 4FZ5A 5B2EA 4CI9A 4KYTA 3ENNA 1DV1A 4XWWA 4GMKA 2QJTA 3IT3A 4ZAZA 5JH7A 3BBLA 1V8OA 4NU8X 4UE6A 5FYQA 3HI4A 2C5LA 1AOXA 4GM1A 2M6LA 2UVPB 4BXOA 4EPVA 4HEA1 1M74A 1YS4A 1ZK3A 4EVRA 1LVHA 5JTUA 2QMYA 3PXCX 3GEGA 5DVZA 2QRQA 3LF2A 2ZATA 3AFHA 3KHSA 4ZRDA 4ZZ1A 4Y6OA 3I01A 5K3FA 3RC7A 4YY3B 1NLMA 3CUWA 1GDTA 2BEVB 1ENOA 2O57A 2X7XA 5C4MA 3DVQX 3O03A 1GGMA 4ML3A 2F17A 4R9VA 3NONA 4CGZA 3SEZA 3QEOA 4NZZA 3ZTYA 4BBJA 1WPGA 4O2AA 4CMGA 2F3SA 4LZOA 1XVUA 3MWEB 1CQIB 4P0QB 3AJ8A 4KO2S 4YCJA 2CUKA 3BAZA 4IZ6A 4WOCA 2PG3A 2VNSA 3TM5A 4CL2A 1IL0A 4Q3NA 1UC9A 4FDMA 1I2BA 2Q7XA 2WB4A 3IODA 2Z2XA 5FBWB 3LXMA 3L41A 1TQ6A 4UDOA 2A5DA 2P2YA 2CCJA 3GCXA 3DZFA 1WSBA 5JW6A 1PR3A 4INJA 1Z12A 4WMLA 4YQFA 3IQZA 3UO8B 2B8TA 4E15A 3EHEA 3KFVA 3P2IA 4PO1A 1N8SA 1AA6A 1FP7A 1M7HA 1NVBA 1SXJD 1Z8FA 4V3BA 4D0NA 4UOEA 2BP7B 1XDBA 1F3LA 3LQKA 4EG1A 5J63A 4BWYA 1VQ1A 2UZ0A 4JQZA 4IIXA 4KGDA 1KZGB 4KIFA 3MG9A 4IUCS 1Y8RB 4F1JA 1P75A 3ZOZA 2JLQA 3S2GA 4EX7A 3DTTA 5FJJA 1S2NA 1NIPA 3NEJA 1YFZA 5CU7A 4DIMA 1M10A 1KFJB 1YQUA 3IUEA 4TZTA 4ALLA 2ZPUA 4J0HA 3ZWOA 4E4YA 3UHAA 4IDEA 4S1NA 1G9XA 1NM5A 3ET4A 1CP2A 221PA 1ZIYA 1XU4A 3IT0A 3LCCA 1UFVA 2CUTA 3PDHA 4RHCA 4S2UA 2F67A 1ECGA 1C7IA 2PBRA 1NJ2A 3OTHA 4Y9SA 3RAFC 5AXDA 3WL6A 1EFTA 4BECA 2YZ2A 3EF3A 4WLFA 3SG0A 4DV1B 4G0YA 4MKHA 5AK0A 1RXVA 3RYIA 2Y67A 3E9ZA 3J80A 2BGJA 4NCKA 3IT1A 1G8JA 5D00A 3GOHA 1L7OA 4EY4A 3QE3A 4DCJA 4IZIA 4MAFA 4ALKA 3LU1A 1EGAA 1GN9A 3D6UA 3OOWA 5A4MS 2PRZA 3V55A 4LSWA 1H1LA 5ALUA 1TK2A 4QUDA 4N03A 3TW4A 3UKJA 1P0FA 5EIBC 2OFXA 5DHPA 2GK6A 6REQB 1KEEB 3M81A 4I3GA 1M72A 2WJIA 4P92A 1PGOA 3VUFA 5BYKA 1BX1A 3L7JA 2R66A 1HG1A 2HL6A 3H1EA 3LHIA 1WB6A 5AI4A 1R5OA 3SIWA 1HDYA 1RQGA 2B1IA 1N0IA 1NV9A 2QS9A 1ZHOA 2XPCA 1XEWY 4CLXA 4F91B 4KX3A 4OYLA 4CMIB 4B5KA 2PD6A 3EA5A 4AO8A 4E08A 1WE2A 5EIFA 1BW9B 3KP1A 1Z37A 3LYUA 2WK1A 5DM0A 1P1FA 2ZTVA 4GZLA 4NBWA 3ABOB 4LYHA 1F8YA 2WE7A 5PGMA 2Z83A 1GFSA 4B4DA 4DXDA 3GGPA 1CRZA 4XGQA 3TPCA 2Q5JA 2WTXA 5ERYA 1AXEA 3WNVA 4W8GA 5JARA 2WHEA 1MA0A 4BRZA 4C4AA 2I87A 2GCOB 2ZJ5A 3OE4A 3V7FA 3R6WA 4OBEA 1RWOA 1Y0BA 1K75A 3C41J 3HXPA 4HVTA 1CUFA 1INLA 1E0JA 4NFHA 5IAGA 4HDNA 4LXTA 1XAHA 1JMKC 1Y80A 1JH8A 1MNQA 2BHSA 3U3MA 1EVQA 4WVLA 4LHXA 1UWLA 2IEDA 1YD7A 5C7IO 1XPJA 3WQSB 4TLDA 3LRPA 5AKEA 3FYSA 4ILEA 4MULA 3GJ7A 3EH1A 3LKZA 4HTFA 8OHMA 1E4VA 3ROKA 2OFPA 1EQUA 3HA5A 1L4LA 4JVMA 3G9TA 5K6TA 1T9AA 1XPOA 3B12A 3ZD9A 4ZCIA 1SPXA 2YWDA 3KWMA 4X45A 4AWXA 4DQXA 1IC6A 2J7KA 1G3QA 1DU4A 1YV9A 4HQFA 1ZNZA 2JFPA 4IY1A 5H3HA 4G8BA 1K6EA 2O1XA 3QXCA 4R2KA 3U3OA 3GRCA 2WOOA 1NP6A 3MJTA 1QH9A 3A6DA 2LTAA 1NDQA 5BQ3A 4RK7A 2GASA 2VRBA 1FK8A 3CYFA 4HX9A 2O8CB 3PR1A 5LNK1 2IVFA 4UHJA 3ZZ1A 4EYKA 4YUAA 1EUDA 1SBYA 5IAKA 4CETA 4LI0A 1TYDE 1Z16A 2J5XA 3KBOA 4C7VA 621PA 1FNSA 2EW8A 4DTIA 3N8DA 2NU9B 2I0FA 3OCUA 3ZQUA 4G26A 4RHEA 4OL0A 5EWMB 1PVDA 1ZUD1 3ONNA 1NAHA 1X70A 3PHLA 3ZNNA 5THKA 4YCSA 2QRHA 3QZUA 5EL0A 4YRSA 1F5SA 3PVZA 1PJ4A 1SRQA 2WHYA 3WB1A 1O97D 2JANA 1V4VA 2CLLB 3TKAA 2NU8B 4BC1A 1T4CB 3HVRA 4Q4CA 4JYBA 1RJFA 1KYXA 2LR0A 2BE7A 2JEZA 2XKKA 3UK0A 1OXXK 3VX3A 4Q01A 5ER6A 1R00A 4RPJA 1J39A 1TK3A 4UM9B 5CLIA 2RHJA 1BHSA 3JQFC 2IEAA 1T91A 2W6IA 2XUDA 2EGUA 5KKAA 3RUFA 1I33A 1SCUA 3P71T 3ZBPA 3LH5A 1QHSA 5F33A 1BROA 5ED0A 3DYBA 3T1QA 1ILWA 3KUUA 1Z68A 1CJVC 1K5DA 2IHZA 1PT6A 4S3MA 3RSQA 1FY2A 3U39A 3I62A 1GKYA 2J4FA 2YY5A 3A1SA 1W7AA 4J43A 1ND6A 2FUG1 2QWXA 4GG1A 4S35A 4CL0A 5CLJA 4E11A 1ADYA 1Z3CA 4N6NA 2REBA 3OZEA 1UDRA 2M6KA 4MPPA 4K9LA 4RZXA 5CDFA 1LV8A 4AMVA 4BNXA 1QTNA 4HDKA 3I6ZA 4WADA 2OXCA 4C0LA 1J4AA 1HX7A 3G2HA 2FEKA 3ISTA 3RFXA 1XZBA 2FMIA 1HE8B 1M2VB 1L4GA 1V5WA 2YCBA 3EVBA 5SZHB 2ZB8A 5I9TA 1ITZA 5KI6A 1DKRA 3O5AA 4FILA 2JAHA 1O5TA 3TOVA 4EDHA 2BSQA 3TUZC 1TO6A 3WMFA 1TIBA 3IAXA 2BY4A 1H5UA 4E14A 2QJOA 2JS7A 4DILA 5C37A 2A92A 2C3MA 3CIOA 4G6ZA 4FFDA 3U4MA 3ETLA 5I8ZA 4CHGA 2ERYA 2XUZA 3VR2A 2PKYX 2VHYA 1JYFA 1Z5GA 2XR1A 4IJVA 3OPYB 2JAPA 1D2EA 3ESYA 2VNJA 1UBJS 2EX1A 3T5PA 3TO5A 5CB0A 2QL7A 3QSYA 4REMA 3A37A 2CYAA 3U9SA 4E5YA 5HW0A 3CNBA 4R1SA 3EGXA 3FMVA 1A77A 3IVAA 1KEKA 1RRMA 4Q12A 3V33A 3O47A 2YJ4A 4ZEMA 4UQLA 4FOPA 1DOZA 1NUAA 1RXCA 4G36A 5MN4A 1DV2A 3MOGA 1ZVQA 3R3YA 4FEGA 2FRXA 2GEUA 3GGJA 5D87A 3ZXXA 1H9CA 4KFTA 5IEJA 4G0MA 4INAA 2EFCB 4FKZA 3PR2B 4U9IS 4FWIB 2F3TA 2FW1A 1WUJS 2Y92A 4M9RA 3U60B 2WMNB 2Y68A 3CR3C 1WOMA 4TT3D 2E4XA 4Z0PA 2P9QA 3LUPA 3LLSA 5IHXA 1KMHA 5I45A 2Q6KA 1WSWA 4G07A 4Y8VA 1KXZA 1Z35A 1K8XB 3BXEA 3OC6A 4QVKA 3WV5A 3NFRA 4RA6B 3I2IA 4R9NA 4DBZA 3NKFA 1U9YA 3PYMA 1L7MA 1YJAA 3GDFA 2REQB 1UXIA 4KXFB 1EE9A 2XMRA 4NV0A 1OLSA 5HBRA 3BA1A 3EFBA 5MFZA 4MDFA 2OKCA 2XXAA 1D09A 1B4DA 1JDJA 3RUDA 1H22A 1B14A 2AW3A 2Q3LA 3SGLA 2IYFA 4C7OA 5K6AA 1PLLA 3R40A 5L3QA 3UYLA 3P9QA 1QH0A 1YCGA 1E2GA 3I37X 4HSGA 1Y1KE 1GUBA 1ZGBA 1TD9A 3LQQA 2PEZA 3IJPA 2Q1YA 4Q47A 1R8YA 4BQEA 4XYLA 4O0LA 5CBPB 1PR0A 2Y4OA 3DEFA 4KQGA 3UB4A 1BZYA 2G4LA 3SHVA 2C29D 1QZUA 3VAYA 4CUKA 1LWOA 3KXLA 1C1YA 1WAMA 4LF9B 1RW4A 2XUQA 3QU4A 4N5MA 2WDPA 1WCV1 5KQSA 3MPOA 4LQDA 1JG4A 5CRIA 3CLHA 1FNMA 2CEAA 3FLMA 1L5LA 1T43A 3VH2A 4URXR 2R79A 4UM7A 4RHUA 3WICA 3D5QA 3ZI0A 5IULC 3KT8A 3IKTA 3OPXA 3B3GA 3ZHYA 3FUVA 5AVKA 1Y3CE 3D1LA 5DHQA 3TYXA 5JSQA 5K8CA 3IEUA 2OAQ1 4JQYA 1I24A 3QLVA 4YI3A 3HYNA 4FQ8A 3DBOB 4PNZA 3ZZNA 3V7UA 1DRWA 1SC9A 2E85A 3IUQA 4RF4A 4Q1FA 1KVRA 3THRA 6LDHA 1CW2B 2C98A 4R16A 1GYPA 3BILA 4KQ6A 1OWOA 3OI7A 3CTMA 5DM70 2X3UA 4L7VA 3CLUD 1PVOA 5KNCD 5D6OA 1SO8A 3ZWBA 2Z43A 1FTQA 4CF7A 3LD9A 3M1LA 3T7RA 2PMWB 1JQEA 4F38A 1HTWA 1QOQB 1ZLYA 4AF8A 2HK6A 2PXHA 1YJQA 1W76A 2WRZA 3CEHA 4FMCF 4IDCA 4RFSA 3RSGA 3ANYB 3DQQA 3PT9A 1UAGA 2FGJA 2NAPA 4IGIA 1VIMA 3G17A 4RIGA 3COPA 4PLGA 3H75A 1U7HA 2HU7A 5TXGA 4X24A 1BXGB 1M1YA 4Y1RB 2XTJA 3EIOA 4B40A 1XF9A 2PMDA 4LZLA 1PJAA 4LXQA 4BB0A 3TXAA 5BSFA 2O06A 2YY6A 5H3CA 3JWJA 5BYJA 4EP1A 1E9RA 2TS1A 2WC1A 3A4VA 3BTOA 4H16A 1AKRA 2PH1A 3RRFA 4E94A 3R9KA 2PL1A 3F6EX 4DRXB 1QTQA 4Q24A 4FGJA 2R8ZA 2ZBGA 1HG0A 4QLBA 4RD3A 3EDOA 1V3VA 4Q16A 3DFMA 4BJHB 5KOYA 3FOZA 4WINA 2RAUA 4MUEA 2V54A 2O8DB 1J22A 2EG5A 3HI6A 4KZPA 1E3DA 3PIIA 2VDWA 4GZ3A 3M6UA 1HEYA 4F7DA 1GQOA 1V16A 2QX9A 1OX6A 1HQKA 3C3CA 5L53A 5EE0A 1XMSA 2BEWB 3OP1A 4KQKA 3GK3A 3H18A 1EE1A 3TR5A 1PQYA 2C5FA 4FYJA 3UMYA 1QF6A 2LKDA 5IZCA 3S0JA 3EYAA 3MZ0A 1GVHA 5FADA 1FTNA 1GFZA 3DXYA 1BFKA 1QFJA 1Z8DA 1WO8A 2QTBA 3DC7A 3I32A 4KB5A 2DUNA 1KO4A 5AJYA 3VYSB 4BKQA 2EU8A 4WY8A 5EJ4A 5HIKA 2OBLA 3UWMA 2RDMA 3EOZA 3O83A 2BC9A 3WISA 2QPLA 1CRQA 2FDXA 1M67A 2NG1A 4MW0A 1S3GA 2Q6LA 3QBEA 3TW8B 4DLSA 4QICA 1Z6GA 3VNVA 2ZEJA 1UFQA 1L7XA 3CKLA 4GPBA 3UK7A 3WL4A 4W8OA 1QORA 4QG3A 1GRRA 4U7GA 1GAJA 1ZKDA 3GRVA 1QCYA 4MINA 1NKVA 5KYWB 4DXAA 3TTUA 4D99A 1EP3B 4NG5A 3AR5A 5KWVA 1FU7A 4TZKA 3C6MA 1LI7A 1BVYF 3MJEA 4MW7A 3S3TA 5DX0A 5JANA 2NTEA 3W8RA 3I72A 4GYJA 3UUEA 4NONA 3C4VA 5DLPA 4UCWA 3BMQA 4CQJA 1XCOA 3BIFA 1XZQA 4PLPA 4I8DA 3RYTC 3MT9A 1JJFA 1DBRA 2H1HA 2XIQA 1KMNA 1NP3A 3L1JA 3WNZA 1Z5NA 4OA8A 2YFHA 2D1SA 4YJGA 3LYAA 3RD5A 3TLGA 1JFTA 5B4UA 3KALA 2QQEA 4TKVB 3ZWVA 4Z9BA 5I7VA 3M4ZA 5JDCA 1MV8A 1WKVA 4AS1A 2FF5A 3MS4A 2JH8A 4MP3A 1D2NA 2FE1A 5DYGA 5BN1A 2KW5A 4OUKX 3QFHA 2KI5A 3JD0A 1HDOA 1B8UA 2C2WA 4GOJA 4LJ9A 3SMQA 5I7HA 5EMKA 3RV4A 1WZUA 1U31A 4A26A 3ANSA 4MYHA 3EISA 2VWGA 1H3FA 1SUAA 3A14A 3N7TA 4WBNF 5HZKA 1URPA 1V96A 1XQYA 4NAHA 1VC2A 5L4SA 4X6YA 2RJOA 1JKXA 2Z5GA 4CN9A 3E61A 4IJQA 3D1VA 4J4HA 4E46A 1X6VA 1S96A 2Q28A 3ONVA 3WRXC 3FDZB 1FPQA 2INGX 2G80A 1XTIA 1D4FA 2A4KA 4EPRA 1L7AA 2FR0A 1AY0A 3G8YA 4DR2B 3O1LA 3ZWCA 3E84A 1EVYA 4K6HA 4P86A 4I6EA 5DBIA 4EKGA 4HCJA 2P0EA 2E55A 3KLBA 2ZT8A 4LHEA 4EUEA 3PRKE 2D5LA 2EATA 3LC7O 2YMMA 2OY0A 3PSHA 3ITNA 1DHRA 2LIPA 4G0PA 1FTGA 4ZQIA 1RTTA 2DQSA 3PGA1 1DWUA 2GYYA 3CFYA 2HM7A 3OLYA 4PYLA 2GBLA 3B9QA 3GY0A 2OZLB 1SIWA 4WA7A 1D4ZA 3A4MA 2HJWA 1U0SY 3SX0A 4FDLA 2QRVA 4AM8A 3DQPA 4XYMA 4E1BA 4F45A 4ZN6A 4XDGA 4MEAA 3ITKA 3OIWA 2OYCA