1QHHA

Structure of dna helicase with adpnp
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
164
structure length
164
Chain Sequence
MNFLSEQLLAHLNKEQQEAVRTTEGPLLIMAGAGSGKTRVLTHRIAYLMAEKHVAPWNILAITFTNKAAREMRERVQSLLGGAAEDVWISTFHSMCVRILRRDIDRIGINRNFSILDPTDQLSVMKTILKEKNIDPKKFEPRTILGTISAAKNELLPPEQFAKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA binding mediates conformational changes and metal ion coordination in the active site of PcrA helicase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords PROTEIN (PCRA (SUBUNIT))
total genus 53
structure length 164
sequence length 164
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 1999-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1qhhA00
2VP6A 1QG2A 3FHOA 1ETUA 1VIAA 4GNKA 4GL2A 4QFMA 1KTVA 3LVQE 4PZLA 1YZNA 3UMFA 3ETLA 1EFRD 3TQCA 3HPRA 1WE2A 2F3TA 3VKHA 5FFMA 4C4PA 3C4JA 4O0MA 1HTWA 2ZRJA 2NQ2C 2YHSA 4QM7A 2VF8A 4PZYA 3EA0A 2REOA 1MO5A 3CF0A 3EZ7A 1V43A 1YQTA 4EAQA 1KKLA 3GLGE 4LJ7A 4UNNA 4CF7A 3TVTA 2W6IA 1KMHB 4ESHA 2RGCA 521PA 4HDQB 1U8ZA 2WSSA 2QY9A 4IDPA 3IO5A 1E4VA 4F93B 3P32A 1TNDA 3DM9B 4YMSA 3SU8A 1DARA 4Q9KA 4UNQA 3TIFA 3HWSA 3T61A 3K0FB 1G6OA 4IXMA 2Z0MA 3W6PA 4DCUA 1OPXA 3IPXA 4KBGA 2CJWA 1E9FA 2QM7A 4AYWA 1P5ZB 3QEOA 2QAGA 1NVVQ 3VKWA 4MDFA 4RKFA 5DI9A 1DE0A 2PX0A 1CF4A 2F9LA 2RGNA 2A30A 3T15A 1KMQA 2ZI9A 1A82A 4DLYA 4EPYA 1G41A 1U8YA 5KYKA 4LJYA 3U7GA 2MSDB 2VTKA 4B3GA 2DY1A 5CIWA 1TQDA 3AF3A 4H1VA 4JYCA 5C1BA 2FDCA 1XJCA 2BKEA 3Q5EA 1UADA 3SFVA 3GJ8A 1XEWY 1TQ4A 5LD2C 2WAXA 3ZH9B 3K70B 1NMZA 3FYHA 2GKSA 2ODBA 3CM0A 3QXJA 5JI2E 4PTLA 4C0KA 1KAOA 1OIVA 1FUKA 3B1YA 3TR5A 1L4UA 1Z6GA 4V0NA 5KDLA 5A5GA 2HYDA 3PEUA 4R2HA 4B3DA 3THWB 5LD2B 2SHKA 2O8FA 1N6HA 2AWNA 2B92A 2HEIA 2V9PA 3AQ4A 4IW3B 2XB2A 1E96A 3LQRA 4NE2A 5AUPB 1SKQA 2OUKA 1U0HC 2QPOA 3GEEA 5EXPA 2DPXA 2WM9B 4UXIA 5IK2A 1NJFA 3DPUA 5JRZA 2ZJ2A 1NVXQ 4MGIR 1VECA 4BE7B 2JIZD 2QENA 5IK2D 2ZYVX 3W34A 3OEHA 3LWNA 2P3SA 3GQBA 2QT1A 1G21E 4RZXA 1FOEB 2A5FA 2G88A 2C04A 3CLVA 4M1SA 4CDGA 1UEIA 5JMTA 5IHPA 4PAQA 3GLGB 2QMHA 5HZKA 3NBZC 2WSMA 1R0XA 3N70A 1OYYA 1R0WA 1S9HA 3IIJA 4O2RA 3KJIA 2REXB 2R2AA 4B33A 1RC8A 3MD0A 4DBLC 5CYOA 2EWWA 4F91B 4URZR 2XOKA 4B6EA 3SI7A 4HI0E 3EX7C 5DO9A 1KO1A 3IQWA 3A37A 3CF6R 1DVRA 2J87A 1RRCA 2G0TA 3B9QA 4HUQA 1ZAKA 3FKQA 4LBZA 3MJHA 4O25A 1P2SA 5CLQA 4A0FA 1J70A 4UNPA 4US2R 1Q1BA 4ZPXA 3SHFA 2X2FA 4LJAA 421PA 2GVZC 5J4YA 1TUIA 2OT3B 1N6KA 3I4LA 2QGNA 2AXNA 3VR5A 3K9NA 4S2EA 3B1ZA 5JECA 2H7VA 4MGYR 1CLUA 1S3GA 2GCOB 4PHHA 1Z47A 2BM1A 2CL0X 5HKKA 1YVDA 4HEJA 4II7A 1TTTA 3GLIE 2VO1A 4TYNA 2FN4A 5M04A 2XZOA 4M2LA 2GETA 4WVFA 2ERYA 3PUYA 2FPLA 2OFWA 2REBA 2GJSA 1Q1QA 4RKEA 3SJBA 3U3MA 2ZRFA 1PV4A 3SJAA 1NN0A 5TVKA 2CLDX 2YOGA 4UJ3A 3A1TA 5L3SA 2H1LA 1UAAA 2VHQA 5AJWA 4BRUA 2WICA 4EFMA 1NMYA 4V03A 3GJ0A 4RCYA 1UM8A 1AQUA 1OLOA 3GMTA 1GL9B 4DCTA 5JI3E 4B71A 3EPHA 4IXNA 1GTVA 2C9YA 1G20E 2RGDA 4POAA 1P9WA 1XEXA 4U5XA 3IBYA 4HLUC 2EYQA 4F4IA 4DXAA 1MOZA 5IDVA 5SZKB 3DZDA 3C8UA 2PT7A 3QPUA 1SVSA 2WMOB 3QXXA 4XWAA 2FFBA 2C5LA 2WIAA 2O5VA 2ZE6A 1KO8A 1RIFA 5J5CA 3UATA 3NXSA 2GXQA 3WMGA 3PEWA 2QNRA 4LYAA 2NG1A 4Q66C 4HAZA 4JSYA 4IEEA 1UBEA 3IGFA 2PMDA 4QJ3A 1AK2A 5B64A 3K0CC 5HKKD 4QHYA 2VSXA 2ZSBA 1DS6A 3E70C 1BIFA 2EQBA 3FFAA 2BEJA 4KVAA 4LHXA 4C0SA 1E3MA 2QT0A 3IO3A 3EIEA 5JRJA 3AV0B 1TU4A 3QQ5A 2LKDA 4M1TA 4PSKA 5GJVC 5JSZA 5JEEA 5FUXA 2R9VA 1I4TD 4HB4A 2IC5A 3A36A 4Z8XA 1EXMA 5EP2A 2BJVA 4LBYA 3KXKA 1NKSA 1M7GA 1YR9A 2GJKA 5BXQC 4ZCIA 1WXQA 3CRW1 4NCJA 2IS2A 4FMDB 2QORA 4CGZA 2PT5A 1RPZA 1RJ9B 5FL7A 4Z54A 1S3SA 1SZPA 3KQUA 3AVYA 2FH5B 1E0JA 3PQCA 1AGPA 3WBKA 3QKSB 3FDIA 1DAFA 3X1ZA 2FE4A 1PUJA 3E1SA 3AF2A 2D2EA 3SYLA 4LWZA 1U2RA 1E9RA 2D74A 4LI0A 2WOOA 2WWHA 1NVWQ 2HT1A 1UKVY 2NTYC 1U94A 1NP6A 2C95A 1LTQA 1DAGA 3VKGA 2ONJA 1N25A 2NPIA 1R2QA 3QPVA 2FFAA 3HU1A 3W8RA 5J4LA 4C0BA 4FCWA 4N3NA 3VHXA 5JHGB 2C9OA 4HB2A 4TLCA 5FUYA 4ZDJA 1W1WA 1QVAA 4MRNA 2LWIA 4GP7A 4LYFA 4D2IA 1W46A 2A2ZA 1C9KA 2GBLA 2V7QA 3X1XA 3KQLA 3HYRA 3U4QB 2CCJA 2J0SA 1VCOA 4MYTA 3QF4A 4LJ6A 2V7QD 4URXR 1VG8A 1E2EA 3IHWA 1Z28A 1AN0A 1NSFA 3QBTA 1N6LA 3AP2A 4LZZA 5HE9A 2G6BA 2EFGA 1FTNA 3KB2A 1E9BA 2B6HA 2W2XA 1P3JA 3D31A 1K6MA 3P4YA 4M9QA 3THOA 2WTUA 6Q21A 1YZTA 2J45A 3L43A 3D3QA 1XF9A 1KMHA 1AKEA 1M2OB 3ASYA 3FB4A 4QBFA 4CIDA 4C2UA 1AJEA 2AHOA 4Q9IA 4TL9A 4G5SA 1YZQA 3K0AB 2CDNA 4IHQA 2HYIC 3FFBA 4Q7KA 2F1IA 4QJ5A 3QXCA 1G7CA 1ZUNB 3NDPA 3NBFA 3NBYC 5ELXA 3O8BA 3EPJA 1NIPA 3HP1A 1ZD8A 2BBOA 2PEZA 4L9WA 3BB4A 1S1MA 1XWIA 3KB1A 2BEKA 2I1QA 5G40A 4OQMA 3HJNA 1KI4A 2P6UA 1US8B 2XJ4A 2WJVA 1EGAA 1WBBA 2ZI5A 2FEMA 1XPOA 2YNMA 2GILA 2EFHB 4TQUS 3ZVNA 2C2HA 1QBKC 3P20A 1OFTA 4BFVA 2NOAA 4DKXA 2CNWD 3KJEA 1YE8A 3TJZA 2ZE7A 2YWFA 3LDAA 5BWMA 4BZPA 4W5HA 4GMXA 3RSOA 5KHOC 3WRXC 1ZCAA 5TV2A 2F43A 1X8KA 2DCUA 4L15A 4NP6A 5AJXA 3JZAA 1ZP6A 2JLUA 2GWHA 2VRWA 2IWRA 4TLEA 4TL8A 2ZRMA 2QG6A 1NG9A 3PITA 1RW4A 3F0TA 4LV6A 2ZRLA 2Q3HA 3AVPA 4BZQA 1NI3A 4Q7LA 1KSFX 3AVQA 4UJ5A 3DOEA 5CDFA 2OFXA 3AB3A 4GBMA 3QPWA 1E32A 3KXLA 5JJLA 2GBLC 1LVGA 4LJ9A 4ACBA 4AKEA 3BC1A 1XDBA 2ZSEA 5TARA 3AP1A 3R9WA 2OESA 4Z1MA 2ODEA 1JBKA 4JVLA 3OAAA 3QEJA 3TQFA 5B57C 2PMKA 4GI7A 4NU0A 1HV8A 4ZCMA 1HH4A 1P6XA 4LV5B 4A15A 1YJ5A 3F5FA 4DLRA 4A0GA 3A8TA 3GCGA 5AJVB 5UKDA 4U02A 3PUXA 2DB3A 5DGXA 5KDOA 3VNUA 4PQRA 4KFTA 2ZU0C 1Z83A 5EP4A 1S4QA 1G291 2IEZA 2D7DA 2JCSA 4FINA 4NTZA 3WMFA 4YQFA 3PCRB 2CHVA 4CT5A 2QEQA 1IQPA 1VYTA 1II0A 2JDID 1OE0A 3A4LA 5FUVA 3TAUA 2IF0A 5JS7A 1WP9A 4YMUA 1OXUA 4Q4JA 4ASUA 4OHVA 4MRPA 1G16A 2DFLA 2J41A 3KTAB 4OI0A 1GNQA 1LS6A 4HAYA 1KHTA 4D0NA 2GNOA 4TSFD 2QTHA 2X8AA 1CEEA 3IEUA 3CF2A 3GD7A 1WF3A 3FKSD 4Q00A 1JAIA 3LBHA 3RNLA 2R8RA 2WVJA 4A36A 2FX3A 4GDFA 2X2EA 1IY2A 3I72A 4LBWA 4AWXA 2IF2A 1AA9A 2WKRA 2WOJA 1YU9A 1AKYA 2XB4A 1CBUA 1XBTA 4AYXA 2F1HA 2C98A 3CNLA 5C2JB 4KU4A 3JVUA 3R7WA 1J90A 2GDJA 2O8DB 4OI1A 1Q57A 1E1QD 2RGEA 2N46A 3OIYA 4JT4A 1JECA 4DSTA 4NZYA 2QM8A 1W36C 4DEYA 4KHZA 1JB1A 1E1QA 1CJTC 3C41J 4GZLA 4HSEA 2XTMA 4L5BA 3UANA 1UKEA 1W48A 4YMWA 4IOJA 4A82A 1A1VA 3IILA 4DHEA 4TWZA 1JQJC 4BLOA 1CJMA 2IXGA 4PPNA 4MYHA 5HZHA 3DVLA 3KUDA 1X3SA 1DAIA 1DAKA 2R62A 2F9MA 3FWYA 1S2MA 2GK7A 1SXJB 4QG7A 1N5LA 4LJ5A 2PZFA 4F92B 1Z2CA 1G3IA 1ESMA 4N0EA 3ADCA 1A2KC 3GFPA 4I1VA 5FTLA 3GLHA 3GJ7A 3WMEA 1J99A 5E3HA 3QKTA 2AWOA 3SN6A 4IJMA 1Z6AA 1GM5A 3ZS8A 3WHKA 4Q19A 4FD2A 5B2ZA 4TTQA 1KI3A 1RYHA 2D06A 1NL3A 1P61B 3U6BA 4TL7A 4TMXA 1KSGA 3X1YA 1XZQA 3FGNA 2ZR0A 2XAUA 1S1CA 1OJLA 2CCKA 1GL7A 1J7KA 2ZVPX 2O0KA 5BW8A 1L7VC 5B58C 1JALA 3WP1B 4DLUA 1QDEA 4WAUA 3FMOB 3AKEA 3GP8A 1G7SA 1CJUC 4IDQA 1ZNXA 1SVIA 2ZREA 4NL4H 5GVRA 1U8AA 4RZUA 5JSZB 1OH6A 4WZAE 3VTKA 3RS5A 2ODWA 4D0LB 1QVRA 3OF5A 3UIEA 3ZLJA 3RS2A 1PUIA 4KSBA 1LF5A 4HDOB 2ZUDA 4PC2A 2I1VB 4FMDF 3KQKA 1EFUA 1AS2A 3A1VA 4KODA 1FX0B 5L3RA 4TYPA 2J9RA 2R6AA 1P7CA 2WAYA 5DHAA 3UPUA 2ECKA 4BFSA 4Z51A 3EASA 1XP8A 4RD3A 5E7MA 4URYR 2NZJA 2WKPA 1P73A 3AF1A 1VYUA 2N1BA 2JASA 1PLLA 2ZRDA 5H8WA 5SZJA 5FOTA 3QKSA 4E09A 4NPHA 2B7CA 3FHTA 3PFIA 2XJ9A 4NKRA 3BH6A 1OHHD 3DMDA 1X6VA 1JXMA 2IYRA 2ZI7A 3NG1A 1XTKA 4BUJA 1OHHA 4JBWA 1GRRA 5JBQA 4RJLA 1U98A 4PHGA 2OXCA 1JQLB 3QVVA 2OBNA 3CWZA 4B3BA 2GRJA 3UWKA 2WPDA 4JYBA 3LFUA 2QAJA 3SR0A 1RKBA 5FBWB 1OT3A 1UBGA 4GZMA 1H65A 1HQCA 4I1OA 1E0KA 2Y8EA 1G6HA 3R9XA 3B1VA 3K70D 5EP1A 4X8LA 3DM5A 4CEJA 2G3YA 4KXFB 4US1R 1P4SA 2ZITA 2GZDA 3WY9A 2YINC 3W6OA 4JS0A 2FJUA 3OZXA 4XIGS 1TQ6A 3R8FA 2A78A 3CZPA 2B8WA 1VG0B 2VBCA 4CEHA 1JPJA 2PX3A 4PPFA 1R7RA 2C9CA 5DSZA 3NDBB 1RRPA 2Q0HA 1P9RA 2OCBA 4A9AA 2RB4A 2O8FB 4KJZA 2XNDD 1QHIA 2ZI6A 4MKGA 4V02A 5AK0A 1VCMA 2YC2C 4HLCA 3MWYW 5JS8A 1KDPA 4D25A 1D6JA 3TGPA 4PC7A 4TTPA 2O8EB 3CPHA 5BQ5A 4NONA 1G17A 4E5UA 3NVAA 1UKZA 4PQFA 4EPXA 3CRVA 4Q9LA 4UNRA 3R7WB 3RS0A 5FTJA 2RGNC 4AKHA 1U9IA 3NIBA 2C8VA 4ZKEA 3BE4A 3EIHA 2QAGC 1YR6A 2O0JA 4KVGA 4BFUA 1FX0A 3DEFA 2LCFA 3CZQA 2WWWA 1N6PA 4I1SA 2FFQA 1TF5A 4M53A 4PANA 5L3SB 1MH1A 2HJVA 3ICQB 1Z0IA 2EFDB 4OHZA 2RGBA 1KI7A 1ZU4A 4QNMA 4P31A 2Z43A 3KTAA 4WXPA 2UZ3A 5FBLB 3B78A 1IONA 1N6RA 4AK9A 2X77A 3ZS9A 4TMZA 2IS6A 1YRBA 1HURA 5GJWC 4DSNA 1ZVQA 1XEWX 3B6EA 3MG9A 1X86B 5EQTA 3LXXA 3VX4A 4ABYA 1W36D 1BH2A 2NO0A 3IQXA 3P26A 1QHYA 5AUQA 1XMVA 1CULC 1RE0A 1XMIA 4QJ4A 2YOFA 3U7EB 5KU1A 3GLGA 4TYWA 5DN6A 2VSFA 3BGWA 3GJ6A 721PA 5FPKA 3I62A 3TAHA 3AUYA 2FU5C 4LYHA 3QKRB 4LRWA 2ZUBA 4NYJR 3QUSA 4MRSA 4TLBA 1ZBDA 2GZHA 2NO1A 1RZ3A 3WNBA 4LHZA 2K5UA 1UF9A 5KSZA 3C14C 2J59A 4IOKA 1Z06A 2IA5A 2QMUA 5AUNB 4LC1A 1T3HA 3Q9LA 2YWEA 2IHBA 5KTYA 1XTQA 5J4HA 3D6TB 2C96A 2ZJAA 4C7OB 5JJIA 1CJVC 4KYUA 1GUAA 2GAAA 1P72A 1NIJA 2RKOA 4OK5A 1Q21A 1ZUHA 4UKDA 4LGMA 1C4OA 4FCTA 2JJ1A 1XD9A 2PJRA 3OFNA 4PX9A 5AR1A 3I73A 3WXMA 1SXJD 4RZ3A 3EW9A 4MQBA 3WBJA 1D2MA 2VP9A 3TLXA 5A4JA 3U7FB 3FMFA 5FBVB 1E1RA 1BMFD 1Q22A 2D3WA 1MKYA 4P33A 2QE7D 2OZEA 3QIAA 1TL7C 2A3RA 5DI3A 1XJ0A 4W9MC 3CONA 2IT1A 5H70A 1JR3A 1EG7A 1CXZA 1ZINA 1JEDA 2VA8A 2IHYA 5JJKA 5CJPA 4GOKA 4LJ8A 4OL0A 1RFLA 2H16A 1JR6A 1JI0A 1Z5ZA 2GEVA 1AS3A 1LV7A 4R9UC 3MMPA 3T1TA 1T5LA 4OI2A 3QY0A 1CR1A 4L4UA 1GNPA 3FKSA 4DVGA 3GLFB 1G3RA 1Z0DA 2R44A 2ZRBA 2ZJBA 3K09A 2BCGY 4RFVA 2WWXA 3UMRA 4PFSA 2AFIE 1OH5A 5JLJA 4B35A 4KO8A 4DSUA 5EE0A 2HXYA 2ONKA 4QKQA 4FI3C 1KI6A 3QBVA 3RWMB 1MO3A 4F7WA 4GOJA 3QKRA 3FMPB 2H92A 3ZZTA 1Z29A 2WKQA 1XU4A 2FF7A 5SZIA 4E22A 4XWKA 1XRJA 2FMXA 2Z4RA 4WZBE 1BS1A 1GVNB 2R6GA 2ANBA 1VDZA 3W5IA 1FL9A 3LX5A 1XD2B 4D6PA 3LD9A 3BD9A 1QHSA 1N5JA 3TMKA 1EFHA 1X1RA 1QHHA 3EZ2A 3MWKA 2O8CA 4C7OA 4DJTA 1JR3D 3GJ4A 1HT2E 3V00A 5DH9A 3KX2A 1T6NA 3IKJA 3GPLA 3BORA 1QF9A 3REGA 3LLMA 2IYLD 2YWGA 4JLVA 4HZIA 4Q48A 5E7JA 1M7HA 3CPEA 1NBMA 5HCIA 4TQ9A 1KK1A 1G3QA 3RS4A 1OXVA 3N5CA 4Q01A 2Q3FA 2Z4SA 4XD7D 5K8IA 3IEVA 1BYIA 1E79D 4CW7A 2XXAA 3BIFA 4KI0A 2KI5A 2XEXA 1Z6YA 5KSYA 5F9FA 4JL6A 4M21A 3TVDA 1E79A 2PEYA 3QOFA 2YYZA 2ZEJA 2E1RA 3BH7A 5D3MB 2MMCA 1VHLA 2A5DA 1VG9B 1ZNYA 4HUTA 1NG1A 2P5TB 3O8RA 4M8NE 5KPDA 4NYIR 2ORVA 1L8QA 2B8TA 3EC1A 4BFWA 3U4QA 1IBRA 1NN3A 1QZXA 3Q5DA 4TMVA 1XNJA 1KKMA 1E4YA 3U2QA 4LCBA 1DEKA 1Q0UA 3B7GA 4P4SA 5CB8A 1OF1A 1CR4A 1T8UA 2ZRKA 4FMCF 3OE7D 1G9XA 1CRQA 1NSTA 3D8BA 3O8CA 3A1WA 2Q21A 2J0UB 1JPNA 1IN6A 3LY5A 2E87A 4KITB 2WWIA 2ZS7A 1H8ED 1WQ1R 5KSPA 1YZKA 4TN1A 1OKKD 3W3AA 2QMOA 2QA5A 2JLYA 3AH8A 4YXWD 1QHNA 3U3OA 3LA6A 1WA5A 3OIWA 4CVNA 1IHUA 5KDDA 2HUPA 3Q85A 5FR2A 1COWA 4MUAA 1XTJA 5DLQC 1ZRHA 4MA4A 2ZJOA 3K0AA 1SULA 2HV8A 1TEVA 3RHFA 3C16C 2HXSA 3H84A 1N0UA 1R10A 1OXSC 2AK3A 3GLIA 4URWR 4O2LA 4DDVA 3ZYCA 4HZUB 1XEFA 2V3CC 4BRWA 1MABB 2W58A 4MRVA 4EJSA 3DKVA 2FV8A 3BBPA 1KZ7B 4TL6A 4AG5A 3CRMA 1KK2A 2J46A 4DDUA 5BN5A 2FGJA 2ZE8A 1Z3IX 2H5EA 4LUCA 4RFSB 1FQKA 2GXUA 3R20A 4HAXA 1C1YA 3K53A 1R5OA 3MSXA 3Q7PA 3SFZA 5B30A 2AD5A 2IWHA 3P4XA 2KE5A 5GJCA 1ZW6A 4D80A 3EZ9A 3L82B 4FN5A 1IN8A 1TADA 4IOLA 1XD8A 2YWHA 1SVMA 2OO7A 2EWVA 2JLXA 2KBFA 1P2UA 3LLUA 4Q1BA 2F43B 3IBGA 3BFXA 4PAMA 2RGAA 4CEHB 1T91A 3WHLA 1ONBA 1YRAA 3R9IA 4AURA 4B73A 1GDDA 2A5YB 4B2IA 5FOVA 2ZAOA 3M6AA 1IJFA 4GP6A 3LAWA 5JHHB 4B32A 3PJRA 3NHBA 3EAQA 3S1AA 1A7JA 4LDJA 4BLQA 1MV5A 5DYIA 2ORWA 5LB4A 3WP0A 2D2FA 4R98A 4TMKA 2BMEA 5BN4A 4G01B 3C5HA 2WWFA 2RHDA 1Z0KA 5TY0A 1XPRA 4V0ME 2ZXUA 4JBYA 3DL0A 2WJHA 3KKMA 4EFNA 1E2GA 3RS7A 2F1JA 3W3ZB 3SYKA 3E5HA 3GEHA 3B8HA 3LH5A 3VQTA 3BB1A 4BLPA 2ZRNA 1N5KA 1IXZA 1NMXA 2WPDD 1UBFA 1HEIA 5G3YA 5DI3B 1OXTA 1KOFA 2QN6A 4KV9A 2JLZA 1M1YE 1XXHA 2QP9X 2VSOA 1G8HA 3N2EA 4TQAA 3I61A 1A4RA 1XCMA 4DCVA 1VMAA 3NC1C 2WZQA 2GVDC 3KKPA 4HB0A 4LOAA 4YONB 3UMSA 4KCGA 3NH6A 3T35A 4AD8A 3OESA 3QF4B 1SGWA 5SZHB 3KL4A 2F3RA 1ZMXA 1WMSA 2IYUA 1KSHA 3TW8B 2ZI4A 2H8KA 5D3QA 2WIBA 3KQHA 1VTKA 4LYJA 3DMNA 2HCBA 3RRZA 1Q44A 1KK3A 2Q9CA 1Q3TA 1ZU5A 1ZM2A 1IAQA 4OQNA 1GNRA 5EP3A 4PQYA 1VYVA 1ZJ6A 2I3BA 2XX3A 3AUXA 3MAAC 3ASZA 5KUTA 3THYA 4TZ6A 4BFTA 4EQ6A 2P6NA 4JL5A 1KK0A 4RD1A 4HB3A 3K0EA 3OEED 4P3YA 2W83A 1P9NA 1EK0A 5LB2A 5K8LA 2PLFA 2R6DA 4JLDA 4WBSA 4Q21A 2BC9A 3V9PA 3NBXX 3PEVA 4C30A 4P0TA 3WNDA 3T06B 2RGXA 2JAQA 4C0JA 3TUJC 4HAVA 3ND9A 2QI9C 4OQFA 5HTKA 3LV8A 1R4AA 3FPAA 4B48A 4M22A 2HLDA 2V1XA 1CTQA 1LY1A 1VG1A 3B60A 4RZ2A 1SHKA 2F7SA 4EFLA 1NN5A 1HYQA 2FSHA 4G5OA 3LVRE 1NBME 1HUQA 3GLIB 2UZIR 2TMKA 4BFZA 3Q8XB 1ZD1A 1I4LD 1N5IA 3M1IA 4LHYA 1E1RD 2QROA 3A1UA 3KKQA 1JJVA 1VCNA 1NY6A 2EFEB 4K46A 4C0HA 1Q1EA 4WA7A 2ODNA 3RDPA 4AKGA 2WWGA 2ZANA 4Y0VA 4URVR 3ND8A 1K5GA 5AWFC 4NYMQ 1IM2A 3X1DA 1T8TA 3X2SA 2RGGA 4IRUB 5JCZA 1B0UA 3SYNA 2UKDA 2IUTA 1S0UA 3ZDQA 3BWDD 4MUBA 1CR0A 4ZIRA 3H1TA 3THXA 1E2FA 2GHIA 3PR1A 4WXRA 2CL7X 5H1YA 1F2TA 3KFXA 3ZVRA 1HT1E 1E2LA 2GZAA 2VP5A 2ZRCA 1D9ZA 4QNRA 3ZGXA 2V6IA 3W5JA 2GCPA 2YZ2A 2FSIA 4MDEA 1T3LA 3BFKA 3LXRA 3CX7A 3VHLB 4YDHB 5L3QB 3UK6A 1ZC4A 4LBVA 2BMFA 2ZTSA 4E03A 2AN9A 2DFTA 2HT6A 4IDOA 4P4TA 5BYKA 4L16A 2DWOA 1CP2A 3I1FA 4YLGA 3THYB 1BYUA 3V4RA 3DZ8A 3LW8A 3PUWA 1SXJA 2GJAA 3ADDA 1FMLA 1XD2A 4JLPA 4LY6A 4JMPA 1IN7A 2GJ9A 3QENA 1KO5A 1DAHA 4XJXA 3VFDA 1R5BA 2FZ4A 1YHNA 3CKLA 1M34E 2BMDA 3L2OB 4HYYA 3AKDA 1NKTA 2CJWB 4LSGA 1E2MA 3T34A 3IPYA 4FIDA 1SKYE 5C18A 3VX3A 5J47A 2AR7A 4IEIA 2WJIA 1MABA 1ZUIA 2PBRA 3AVWA 1UEJA 3R8CA 2ZYUX 1R6BX 2JEOA 3LW7A 2VPPA 4N0DA 1QHXA 3A4MA 3I5XA 2CBZA 1W4AA 4A4DA 1MO6A 2XZPA 2FFHA 2KBEA 1GKIA 4D82A 2QP3A 4DLZA 1W5SA 3HDTA 1GG2A 4BASA 5DE3A 2BM0A 2AL7A 1KI8A 2XZLA 1BKDR 2XNSA 4JZKA 4NH0A 4X8OA 3TW4A 2P5SA 4I1UA 2FSGA 4WOPA 4ZI3A 1GKUB 3BERA 3ZQJA 4B2LA 5DISB 1G3MA 3AVOA 4BLRA 1DG1G 4XSGA 5KPJA 4QRHA 1G64A 1JXOA 1TF2A 5CITA 4XH9B 3EARA 4HAWA 4N1AA 3GJ5A 4C0LA 2FPKA 1GIAA 4O3MA 1KDRA 121PA 2BIFA 4FWIB 4ZIRB 2OEPA 3NTUA 2AK2A 2L0XA 3DKPA 1EFRA 2A7QA 4QGGA 3H86A 2VQSA 2F1RA 1G7TA 2OSBA 3OE7A 3PUZA 2GEUA 4C0QC 3KJHA 1IN5A 4EQ6B 4FMCB 3BB3A 2J1LA 5JEDA 2D4HA 1T5IA 3NC0C 3QG1A 1UDWA 2QPTA 2ZETA 4LJ4A 3SEAA 4NBSA 3L0PA 5JWRA 2AXPA 3GEIA 4NCKA 2YJTD 3GFOA 4A6PA 5JWHA 1BOFA 4QGFA 1RRFA 3CR7A 1EFTA 1N6OA 2J7PD 3LBIA 4MRRA 5K8UA 1E2KA 3ZZ0A 3QJYA 4V0OA 2J7PA 1R8QA 5HE8A 2QP4A 4QC2A 3I32A 4RCZA 4ON9A 1FQJA 4BPBA 1CRPA 4NCHA 4RSGA 3IUYA 4DT1A 1BO6A 1UBCA 4GMDA 5KSOA 4GFDA 2VHCA 4IOMA 2RCNA 1JJ7A 3QNUA 2A5GA 4A8JB 4P4UA 2N42A 4ZDIA 5KNBA 4B75A 1P62B 4AIIA 1E9SA 3M0EA 4Q1CA 3THXB 1W2HA 2G1KA 3ADKA 3U6KA 4IFBA 3WNCA 1KNQA 4B43A 4DWJA 3VR1A 1TAGA 1J2JA 1D2EA 1E98A 1XTRA 1SKYB 3CIOA 3IIKA 3NWJA 1UFQA 3VNVA 5BN3A 1GL6A 2QRZA 4Q7JB 1KY3A 4CEJB 1L2TA 2NGRA 2CCGA 2G9NA 3UG6A 4TTRA 2RH5A 3I92A 3S1AB 2CE7A 2ZSDA 4M1WA 1Z63A 1NNEA 4QOSA 4C3ZA 1KYIA 1W0JA 4LHVA 5CM8B 1ZC3A 1CU1A 1KJZA 3PVSA 1ZM9A 2Q3MA 1OYWA 4TYQA 2ZRGA 3RS3A 1FMJA 4DLSA 2JIZA 1AM4D 4JT2A 4IKEA 1W4RA 5FTMA 3CR8A 1Z07A 2ZROA 3FOZA 3VR3A 1N3BA 1OFIA 2H57A 4A6XA 3QKUA 4U00A 1G3UA 2NO7A 1XCPA 4AG6A 1EWQA 3QXHA 2DFKB 2ZQ5A 3QG5A 4MH0R 3CNNA 1HE8B 2HJGA 3CUEF 2C99A 2DWQA 2KJQA 3L0IB 2HCJB 4C9BA 3F3YA 3TE6A 1S96A 3U44A 2XITA 3HU3A 2CL6X 4PPQA 1II8B 2CMKA 3BOSA 3SJZA 1G19A 1FPMA 1YZGA 3CX6A 3I5YA 1T0JB 2H18A 4ITRC 1R8SA 4MKHA 3CWQA 3NEJA 1RVDA 1LNZA 2ZSAA 4JLJA 4MITA 3T1QA 3G5UA 2QTVB 4G0NA 1E9CA 1NLZA 1P2VA 3I8XA 4C2TA 1F2TB 1KNXA 1DADA 1M6NA 3HU2A 2ZU6A 1U9IC 3PIRA 4K81B 4PHFA 4QXAA 3SZRA 4ACAA 3B1WA 3KFVA 2J5XA 5TB5A 2ATXA 4MYUA 2O8BB 2CXXA 4S35A 4XVQA 4Q1EA 1LF0A 3KZ1E 1JR3E 3BH0A 1D2NA 2WBLC 2VL7A 3U3KA 3AKCA 3PV0A 3BS4A 4A8JC 2ZSFA 2QUZA 3K9GA 4OI4A 3OAAD 4TMTA 5FOUA 4Y0AA 1QHGA 2OM2A 1AGRA 4JL8A 3RRMA 3PUVA 2VHTA 2ZS9A 2QZ4A 2BKUA 3N2IA 3AEZA 3EA5A 5EZ6B 2OFOA 2VP4A 3ZZUA 4UQOA 1JNYA 2MSCB 1KSJA 2GF0A 1U0JA 3AP3A 1KI6B 2D62A 4EUNA 4RVCA 4HDCA 2EFCB 4OK6A 1AIPA 3RSLA 3RC8A 1EWRA 3MWJA 4Q4AB 2ZM5A 2IYWA 2Z6VA 4D4MA 1D9XA 1E2NA 3P27A 3IIMA 2CK3D 4IDHA 5FI0B 3Q72A 4MKIA 5DIFA 4DLVA 1CR2A 4M9SA 3CH5A 4FMBB 5CDFE 4DDWA 5DNYB 1KY2A 1JAHA 4LV8B 2FGKA 4GOXA 2IYVA 4WW0A 4BQSA 1H8HD 4ZDKA 3W8NA 4CT4B 1P60A 1SVOA 3MRSA 4NCIA 1IXRC 3B13B 2IUUA 1M7BA 1T3SA 3EWAA 4QBIA 4RD2A 4F38A 1FUUA 5EZ5A 2OAP1 1ODFA 3H2YA 5G41A 1T9HA 4I4LA 1OH8A 5CJ2A 1E69A 4W7SA 3K0SA 1GKYA 1XJQA 2GAOA 3KXIA 3F8TA 3EC2A 3RWOA 4B6FA 2A5JA 2IXFA 4M1MA 1Z8FA 2YOHA 2GF9A 1SVKA 3T1OA 5EXSA 1GP2A 3MGCA 4A8JA 1E9EA 1N2CE 4F4JA 1S8FA 2GXSA 4BWYA 3A4NA 5JZVA 1IN4A 3GLFA 5D3MA 4BLSA 4DCSA 4NMMA 1UPTA 1FNNA 1KGDA 5EUQB 5AJYA 4YC7A 4D4JA 3T1VA 1PLJA 4XVUA 3CNOA 4G1UC 5CK5A 5C4MA 1J8YF 1TPZA 2CVHA 1GAJA 5LPNA 1G18A 4HLDA 2AD1A 4HAUA 1K8RA 1NY5A 1Q12A 4QGHA 1M8PA 2YV5A 4DDTA 4BFYA 1IXSB 1AS0A 4TMWA 1E6CA 1TEXA 2BVNA 1ELOA 2Z83A 4D81A 4YXWA 2B7BA 1QG4A 3J81k 5JCPA 3HYTA 4OJQA 4M1KA 4FCVA 2X19A 4A2WA 2C78A 2D7CA 3SHWA 5FOXA 1RRGA 3AM1A 2GESA 1KI1A 1W44A 3B82A 1AQYA 1U81A 2DYKA 4A0RA 4RD6A 2BDTA 4YMVA 4LK2A 3GLHE 1X8LA 1KAGA 4EPVA 3UWOA 5GADl 2CE2X 2XTNA 3MFYA 1T4GA 2JJ2A 3AGPA 3C5CA 1NRJB 4DLWA 3VAAA 4DCNA 5E95A 5DHFA 2FEOA 1DG3A 4NHOA 3TSZA 2ZR7A 3AF0A 3RRNA 1W49A 1CJKC 3W9YA 4ARZB 3AVVA 5HPYB 2QRNA 4V0MA 3BFVA 4AY2A 2R6CA 1XMJA 2CNWA 1G1MA 3I3SR 5CK4A 1R0ZA 1ZD9A 2IK8A 2QSYA 1XMSA 2Q9AA 1P2TA 1I4DD 1NJGA 4JLAA 5FI1B 2QSZA 3TR0A 1E2PA 1E2JA 1KI9A 1MT0A 3THWA 2XXAB 1K5DA 1XCGB 4HUQB 4DLTA 3IDQA 1CIPA 1UJ2A 1WRBA 5FOWA 1XPUA 4CEIA 2W2TA 4ZKDA 4JKIA 2JATA 2QBYB 2NO9A 2PCLA 4U7DA 1GOTA 2AKYA 1Q20A 2OCYC 4PSAA 5EJEA 3UG7A 4TLAA 3ICEA 3EZFA 1YZLA 3LBNA 4RD4A 3CBQA 3IHLA 1ESNA 2IXEA 5LBIA 1VCIA 3HR8A 4A2QA 4WIAA 5FPHA 4DLXA 2E9SA 3TKLA 4M0LA 3B9PA 4OHWA 5E7IA 4OHXA 3SJCA 4QBHA 3I8SA 4Q47A 2EW1A 2Q6TA 2OHFA 1SVLA 2JJ2D 2RMKA 1W47A 5FBRB 4M1OA 1IOZA 1TX4B 2MMGA 2AFHE 4UXJA 2J3EA 5KNCA 1R5NA 2WV9A 3KKOA 2G77B 4PHTA 2ZE5A 3L8YA 4OKSA 3X1WA 1OSNA 4Q4LA 2OBMA 5G3ZA 3WYGA 2IL1A 3TH5A 3G82C 4FW9A 1EX6A 4JLOA 4PXAA 1EESA 3AVXA 5AUOB 5E4FA 2OAQ1 1JEEA 4L8GA 1OIXA 1BMFA 2IYTA 5F2EA 1E2DA 4BLTA 5L3VA 2QQ0A 3EWSA 1ZCBA 2IUSA 4ZCLA 2EYUA 3O8DA 3OIVA 3U3RA 5DN6D 2QPAA 3CX8A 5CB6A 4PO8A 1OIWA 1WBDA 1ZM7A 1UDXA 2ZYWX 3CB4A 4XOIA 3T5GA 4AI6A 5CIQA 2GJ8A 2XNDA 4I99A 5FTNA 3OHMA 1E99A 5HCNA 4ARZA 4TT3A 5FL3A 2XSZD 4KSCA 3EPLA 2G83A 3TRFA 1NF3A 5CM9C 3K70C 1CKEA 1G4UR 2ZRPA 1NLFA 3UKDA 2QGZA 4LHWA 2A9KA 2WWYA 4JLKA 2AX4A 5EXXA 2V55B 1NVUQ 5EE9A 1W0JD 2ASEA 1WB9A 1GRQA 4PC1A 2I4IA 2ZUCA 4DUGD 2HDNB 1LB1B 3RC3A 1LS1A 1Y3AA 4Z8YA 4Q4AA 2YKGA 2BBTA 2JLVA 3FHCB 2PZGA 2BMJA 4HZUA 2NMVA 2PLRA 3U3JA 4CZ2A 1EX7A 4GSYA 2JLQA 1LFDB 1G8PA 4JVNA 5LDDC 4LC0A 1KDTA 2IBMA 4OJKA 1I2MA 1KO4A 3ZVLA 1Q1ZA 1D8TA 4LPSA 4JKYA 2AKAB 3QE0A 2VF7A 4D0GA 2MSEB 4DZZA 5EXTA 1DO2A 4MGKR 5J4KA 2HF8A 2JLWA 1Z0JA 4A1FA 2IYYA 2NIPA 1GITA 1X1SA 4J0QA 1SXJC 5FTKA 2V54A 1U0LA 1U90A 1OB5A 4K8OA 1G8YA 5IF9A 4H1UA 1OFUX 3GFTA 4JVMA 2RHMA 1ZM4A 1GRNA 4PAOA 2IS1A 4TT3D 5FOSA 4OYHA 3W90A 4QBGB 3QF7A 4B74A 4Q9HA 3VU9A 4B3CA 4TSFA 5C4GB 4CRWB 2W0SA 3EIQA 3B85A 4EIWA 4Q03A 3CH4B 4TZ0A 1SHZA 2ATVA 2YC4C 1W0KA 4KLZA 5FPSA 2JJ8A 2W6JD 1XTSA 2O52A 3B5JA 1GSIA 1W5TA 1GILA 4HATA 4MYCA 2GK6A 4C0AC 2Q9BA 3SQWA 3VR4A 2BHRA 2CLSA 1ZNWA 2FNAA 821PA 4QHTA 2OG2A 1N6NA 3BXZA 1W2GA 3B1XA 1X8JA 5ANRB 1Z6XA 4H9GA 4PC6A 1OFHA 5H68A 1MR3F 8OHMA 2WHXA 5FH9A 4GPTA 2NO6A 1OB2A 2J0QA 3AVTA 2OLKA 2W00A 2ZVQX 3RLFA 1XXHB 2ZJZA 5IRCD 2KSQA 4KAXA 5AJZA 1KDOA 5HR5A 2W6ID 1CS4C 1G8FA 1H8EA 2QE7A 4NYJQ 1VIYA 621PA 2JGNA 3ZVMA 3REFA 1G5PA 1AZSC 1RJ9A 2NPFA 1Z2AA 4GT1A 4XTRA 4AYTA 2V6JA 4NYMR 1COWD 1QRAA 1II9A 1XX6A 2PJZA 3ONWA 4ESVA 1DO0A 2F55A 2IEYA 2VYFA 4IDNA 3RYTC 3BK7A 4IVQA 1DPFA 1FNMA 1H8HA 4QGAA 1Z6TA 1RYFA 4DC9A 1E2QA 4XD7A 4BGDA 2VH5R 4LPKA 5L8VA 2W0MA 2P0EA 2ZRAA 5IT5A 1E2HA 2ZPTX 2P67A 5KNDA 4JLMA 3LQQA 4Q4HA 1OW3B 4PO1A 4ERNA 5GJBA 1W4CA 2VP0A 3KUCA 3QXSA 2GCOA 1PVOA 5L3QA 1W36B 3LNCA 5EE3A 3V4FA 4CEIB 2O0HA 4M1YA 3LO5A 5FUWA 3RABA 1I2DA 1TQ2A 4Q1FA 3QI2A 4Q7MB 4BFXA 2IYZA 1G7RA 3BRWD 3OIUA 3BAFA 4NYIQ 4TLDA 5EE1A 1W7AA 2QBYA 2C77A 2IX3A 3SBEA 1DELA 5TMPA 1TF7A 2RAPA 1GWNA 5F98A 2KB0A 2BBSA 3EG5A 3A6PC 1F60A 2GEDA 1OKKA 1WDTA 4ZV4A 4PO9A 1ZIOA 1FZQA 3K0CA 2CK3A 2WSSD 1VPLA 2V8OA 1XZPA 2W2VA 4X8MA 1TU3A 4OBEA 4D4LA 2GXAA 1W4BA 2V4ZA 2XGJA 1YKSA 4ILEA 4GRAA 2CHQA 1QHHB 3LX8A 3OEHD 4PPGA 2O8CB 5KOYA 2GA8A 1KJYA 3NEYA 3CRRA 2QU8A 4EKDA 4HLUA 3K9HA 2QAGB 4A0HA 2GCNA 4X8HA 4QL3A 4PR0A 1HY3A 1F2UB 1SVWA 1US8A 3GJ3A 3U61B 4PZZA 3ECCA 3CO5A 1F3OA 1FP7A 2FSFA 1M74A 1EFCA 1G5TA 3ZJYA 4P32A 2CLCX 5CYPA 3T12A 1Y63A 2HF9A 2VHJA 3ZQ6A 1P75A 1NLYA 5C46F 3U7HB 3ZD6A 3VU9B 3DHWC 1YR8A 1D5CA 1T0HB 5CLLA 1Z08A 2ANCA 1XFAA 3K9LA 2CVFA 3NH9A 3FE2A 5A0FA 3NKVA 2UVQA 4G5RA 2FZLA 1V5WA 5TDHA 5JWOA 3MJRA 2IYXA 1VKJA 3CW2A 4URUR 1Z22A 4BECA 4Q4HB 4CYMA 2PCJA 2ZYTX 3KDSE 4JJKA 4XWOA 3U5ZB 4PC3A 3D7MA 3K1JA 1OXXK 2FWRA 4QHSA 3DOFA 5KO2A 1IY1A 5TXGA 1R0YA 3ZIAA 4E07A 1F6BA 1E94E 3PXGA 1OV4A 4MGZR 3WYFA 1SXJE 3ZIAD 1G4AE 3G0HA 4DRZA 2OCAA 1G8GA 2OCPA 2DWPA 3MWLA 3JZMA 4DB4A 4EJSC 1SQ5A 3SNHA 1ZM3A 4A2PA 2WJYA 4KFSA 3ADBA 1B23P 2PH1A 2Z5FA 4P4SB 3EZ6A 3HR7A 1LW7A 2ZI3A 1HE1C 3PEYA 3WYAA 2ORIA 4BEJA 1A5TA 3KQNA 2ZJYA 2J0UA 3BJIC 1L4YA 1KIMA 4G3XA 3SDZA 2GTPA 3K0FA 3QVUA 2WJJA 4KFUA 4A92A 4DT1B 2V1UA 3W6NA 1PZNA 1E9AA 4Q9JA 2XOKD 1S9DA 3Q7QA 2CEAA 4OQXA 3O47A 4R7ZA 3AKYA 4XVRA 3U44B 4Q1DA 4ZDWA 2QMEA 3RANA 4ZO4A 1Q3HA 4RFSA 2JLSA 3PENA 4UXHA 3EPKA 2OXRA 4M9XA 1YZUA 3H0KA 2J7KA 3RRYA 1GFIA 3H4MA 2OV2A 4G5QA 1F5NA 2VP2A 2PZEA 2ZIAA 4NDZA 4BZXA 2P2LA 2J0VA 1DTSA 1IJEA 1VHTA 4WZ6A 3KJGA 4LX0A 4OHYA 5F9HA 1DOAA 4FWTA 4AKIA 4Q1AA 3OEEA 2O8BA 2H17A 4EPWA 4IVPA 2XSZA 1ANKA 2ZS8A 4B34A 2VEDA 5BYJA 3TUIC 3GLFE 4IFEA 4V0KA 4XSHA 4Q18A 2C03A 2JA1A 2BJWA 3SS8A 1IY0A 4Z1MD 1XB2A 1YR7A 3CRQA 3DDCA 2FA9A 4YMTA 2DR3A 4DEXA 1UKYA 3L0OA 3FTQA 2O8DA 1FW6A 2ERXA 4DB2A 1A2BA 1FFHA 3DO6A 4AC9A 2OBLA 2P6RA 4Q5IA 1N0VC 4M9ZA 3SOPA 1G5RA 4JSTA 2JJ1D 3KKNA 4D4KA 3TBKA 2IS4A 3ZD7A 2IYSA 1KI2A 1KZGB 2R65A 4FXPA 4JVSB 1O87A 1HA3A 4EPRA 3SBDA 2X1VA 4IVRA 1F48A 3GJXC 2ZRIA 4EJSB 3CPJB 4OK3A 1Z0AA 1KJWA 2OLJA 1ZIPA 2JDIA 3K8YA 3PG5A 5GVSA 4UNSA 4RY2A 3TNFA 3TSWA 4QM6A 3FVQA 3MLEA 2IYQA 4ASUD 1DAMA 4DIDA 4PSVA 5FPYA 1TUEA 2BCJQ 2OE2A 2CHGA 3FMIA 3UXMA 1FP6A 4W5JA 4L9SA 2BWJA 1MRSA 2ZRHA 1PJRA 2VIIA 4R2IA 5K8TA 3E2IA 4HLQB 3TUZC 2FPMA 4KFRA 4R71A 1ZNZA 2EU8A 3K09C 1NVVR 4B3XA 3SQXA 2XTZA 3VR2A 5EE5B 4B47A 1XXHE 4F4CA 2KWIA 2BV3A 4DUGA 3L8ZA 4RD0A 2BBWA 4G5GA 1DAEA 2R6FA 3EXAA 1NN1A 5G53C 1U99A 221PA 4DSOA 3LRPA 3VR6A 3VMFA 5J40A 3WRYC 3P1JA 2FOLA 3B2EA 2HLDD 2G0NA 4EPTA 3QSYA 4KBFA 3SE0A 5FPTA 5J4VA 2VHUA 3A58B 3OFND 4Q02A 3RVBA 1J8MF 1TMKA 5P21A 4B76A 2G1JA 4XTCS 3L0SA 2IW3A 3HPQA 3MUFA 3TSOA 5FR1A 4TYYA 1GZSA 2DBYA 4JLBA 2BOVA 4OQLA 1MO4A 5F3WB 2B21A 4B3FX 5FL7D 3Q3JB 3T5DA 2QL6A 1WCV1 1PLKA 2ZR9A 4JIMA 4KYIB 4NCNA 5DYGA 1XTIA 2DFNA 4W5WA 1HQYE 1II8A 2O8EA 3GLHB 3JVVA 3A1SA 4B44A 2JLRA 4ZI2A 1E9DA 3M4YA 1AZTA 4MKFA 4I81A 4D26A 4M4SA 3MCAA 3SC3A 2LKCA 3C15C 3NHAA 1ZYUA 2QQEA 2WMNB 4Q4JB 4YDSA 1F2UA 1E0SA 2EVWX 3AGQA 1N6IA 4JLNA 4JBXA 1O3YA 3AF4A 5FBQB 2ZJ5A 2P65A 3TK1A 1E0AA 2WJGA 4DIEA 2ZAMA 1XEXB 2DHRA 5EUMA 2F6RA 3U60B 3AVUA 3C7KA 4B2PA 1DBSA 4JJZA 1MRNA 2QTFA 4BEBA 1KO7A 1N0WA 3RAPR 1NBMD 4US0R 2YVUA 5JFGA 1OH7A 1Z0FA 2OILA 2NZ8A 4EDHA 1W0KD 2PL3A 1FTSA 1E2IA 2FG5A 2W6JA 2VLIA 2ZJ8A 4V0LA 4KLNA
chains in the Genus database with same CATH superfamily
1V6AA 2H2HA 3TRHA 3ZKWB 4J90A 3GC6A 1QF6A 2VP6A 2CXRA 1ORRA 3UJ3X 3T4UA 3HY4A 3KBBA 1OXBB 3THSA 4GL2A 1A9XA 1B26A 2W5UA 1T8RA 3DV9A 1W6RA 3JR3A 1T0UA 2IXTA 3EMBA 4PZLA 5LP1A 1FTYA 2KLBA 5K6AC 3ICPA 4PCAA 1EFRD 5A3SA 3VKHA 3JQBA 1C29B 2O23A 3C4JA 3W5VA 2NQ2C 1N7JA 4KX3A 3GA0A 2ACWA 3UC5A 3EA0A 4W7IA 1MX5A 5A06A 4Z5XA 1MO5A 3CF0A 3EZ7A 3U4GA 1PFYA 1V5EA 5KCMA 4NEHB 5GP1A 2OCXA 4LCEA 5AW5A 1MO2A 3ZIUA 3C3CA 4XIYA 4ESHA 3FGOA 3H5IA 3MJTA 5ALNA 1BDHA 5KQPA 1U8ZA 4RM3A 3NBMA 1YD7A 3DAGA 1UKCA 4KJXA 2BFBB 4QEDA 3VPGA 1BU8A 1SY7A 3LYAA 3SU8A 1J06A 1MB9A 1QO7A 1DARA 1V3QE 1WABA 2DPMA 2OV3A 2P4SA 2PA0A 3KEQA 2VZ9A 3O21A 4UNQA 3WYCA 4DJDC 2HFKA 3BD7A 3I1YA 4IXMA 3DZFA 4CUZA 1PZHA 3UO8B 5DMHA 1OPXA 3IPXA 4KBGA 2XUHA 2P3LA 2BW0A 5A5DA 5F21A 2QM7A 3V42A 2A1TS 1P1HA 3NASA 4OHPA 3KVRA 5TGZA 1XLTC 4AYWA 1NVVQ 2JJYA 1R4MB 1Q14A 3D2LA 4HDSA 2C8KA 4FD3A 2AEMA 4QVKA 2DTEA 3MINB 4DCOA 1EVKA 1M33A 3HJBA 1C4XA 1UBLS 1KMQA 1A82A 1H2XA 1G41A 1U8YA 2QX8A 3U7GA 2MSDB 3L8FA 3QLJA 1IBCA 4HDRA 3QITA 4QUIA 1E2BA 3SXUB 4JYCA 1SEVA 3GA7A 4E4TA 3ANNA 4EJMA 1VMEA 1V25A 3GJ8A 3U4HA 2YVQA 3STXA 4CIWA 2RG7A 4H1WA 3BPSA 4ND4A 3I2GA 3O3CA 1ZK3A 3FYHA 4TRMA 3SQOA 3H8SA 3B1YA 3H9EO 3TR5A 3ZE7A 4RVNA 3PWSA 1DIAA 3GNLA 4A91A 3FCXA 2HYDA 3THWB 4B3DA 1XUOA 3E1GA 2AWNA 5DFAA 2V9PA 1O5IA 2MYPA 4GYKA 4DDMA 1F2VA 5FORA 3OHSX 4GI1A 5I9NA 4UCWA 3SF8B 2OUKA 2PVSA 2PPLA 2QVXX 3AF5A 2C1XA 4UXIA 1YJAA 2WWTA 2ZIUB 2G63A 1J49A 3ASUA 1H6AA 2ZJ2A 1RJDA 3QLUA 4MGIR 2AJLI 3S68A 2QENA 4Y6GB 1VGRA 4G8JA 2WQ7A 1RWPA 5BURA 2Z4TA 3DF9A 1H1DA 2TMGA 3OT5A 4AXXA 4XQ9A 2A5FA 1RSZA 4MIYA 2O1WA 5CYGA 1UEIA 1RE1A 5HZKA 3EZYA 2WSMA 3VH3A 2I7XA 3N70A 1QV6A 1YL7A 3FH0A 3MT0A 1G6Q1 1HNWB 4GI3A 1ZOOA 1DEHA 4O2RA 3KJIA 4F84A 2GHQA 2BP7A 3V6LA 3DO5A 4KN6A 3IAAA 1TZBA 1RC8A 3K6SB 1QP7A 4DBLC 5CYOA 1NF2A 3B20A 3MWGA 4IJQA 5K0JA 2XOKA 5EMMA 1N0IA 1TZCA 2Y1OA 4KWEA 4HI0E 4LE1A 1Y6ZA 4Y9UA 3AI3A 3IQWA 4RF4A 1ZLXA 2R6ZA 3CF6R 4DLPA 4HHEA 1QDUA 4NJEA 4RHTA 3ZDEA 3FKQA 4LBZA 4PBSA 3MJHA 4L7QA 1P2SA 1Z5UA 2JZOA 3QX3A 5GONB 2J3IA 4MARA 3X3HA 3ITDA 2H2GA 2O3UA 3SHFA 2X2FA 2CNBA 1Z74A 3G6WA 2OT3B 3T5PA 1N6KA 3I4LA 4IS2A 1Z0SA 1Z4IA 1K66A 4B4WA 1L9KA 5JECA 2VBIA 3NYRA 4OHKA 1X14A 3GOHA 5CA0B 2H7VA 4MICA 3G2IA 1WU7A 4ZOLF 5AOAA 1Z47A 4IPTA 4MI6A 3DE2X 5A4MS 4W9RA 4DQDA 1FU4A 4YK7A 5KTSA 2CL0X 1YVDA 2HTEA 3OC6A 2NNWB 3OOYA 5JQGA 3HXQA 3OI7A 4E70A 4TVSA 1TTTA 3CH7A 3PPXA 2FN4A 5M04A 1F0PA 1WY7A 3PQ6A 2GETA 4CM9D 3A2MA 3FY4A 1N2CA 5C7IO 2E85A 4HCJA 2FPLA 1PV4A 1T2AA 3F6SA 5D5QA 2OV1A 3WKCA 1Q7GA 1G8JA 3W5UA 3A28A 4KLCA 3IAUA 3ZI4A 3R5TA 4L72A 5HIIA 1G21B 3EOBI 2HRRA 4YJDA 5B2FA 4EA6A 4YJHB 4D9GA 4R2XA 4R8LA 3BIXA 3LF1A 3TIIA 3HP7A 2IU3A 4CKYA 2CKDA 2VHQA 4G24A 1EJ0A 4IBOA 3RD5A 2WICA 4DYVA 3K4QA 4EFMA 2C3OA 3GJ0A 4Y9TA 2FZ5A 1ZJ5A 4AZTA 1T5OA 1UJBA 3GMTA 5JI3E 5LIPA 1CB0A 2P90A 4LXTA 1GTVA 1TLTA 2C9YA 2GPAA 1EP9A 3BDIA 5FWXA 1LFAA 2FMFA 3IMEA 4MAAA 1PT5A 2H0AA 3D6VA 3O26A 4MAFA 4HH1A 5ALTA 1ISIA 5KYVA 1MOZA 3REQA 1SKBA 4EARA 4KEAA 3NYWA 2X4LA 4CCAA 7ADHA 3AKZA 5HIJA 2Q4TA 4OF4A 1MDFA 4XYMA 1L7AA 1V96A 2QRJA 4CKXA 4C6HA 1PZFA 1A8IA 3ZKWA 3NXSA 2GXQA 2RH8A 3PEWA 5CJJA 4LYAA 2PO5A 4RS4A 4X3CA 3D8SA 4Q66C 3I9NA 3KU1A 1LRKA 3NHRA 4HAZA 4HT3B 4YRKA 5BN3B 1AK2A 3K0CC 3Q7RA 2G5TA 1QB8A 2RI1A 2VSXA 4OYYA 4QHYA 4MTLA 2EQBA 3FFAA 4C0SA 4HQ0A 5L3ZA 2QT0A 1NZJA 3AV0B 3QQ5A 1C50A 1R4NB 1X1CA 4ZVQA 4YH1A 2MINB 5GJVC 3HH8A 16PKA 2POQX 3KJZA 3GR6A 1NYTA 3LPLA 5FUXA 3TLGA 1I2CA 2C2WA 5BW5A 1RAIA 2IC5A 3A36A 4HLNA 3IUNA 1EXMA 1QYVA 4DBZA 5D3ZA 2E6UX 2BJVA 2HFJA 1STOA 2XA2A 5IABA 2WU4A 4NMHA 4KBYA 1ULHA 2PZLA 2ILVA 2CLMB 2X0IA 3CRW1 5T5QA 5AW4A 1JEYA 3W5AA 1N5RA 3EXFB 1AVTA 5DEOA 3H8VA 4DCCA 1K63A 4CGZA 1JL3A 2XYPA 3IQGX 3RAEC 4QPNA 1FMTA 1GPJA 4DL9A 1ML4A 4MIOA 1MGOA 1S5PA 3E22B 1GTMA 5TQJA 3K2EA 2NU6A 2QN9A 3OQJA 4O2AB 1PJ8A 4PG6A 3VSCA 4CIVA 3JWEA 3OQPA 3V48A 4C5BA 1AHIA 4S1WA 3ZCQA 1XVAA 3NGXA 1EKXA 4J2OA 4MUIA 1U2RA 4LI0A 5J1TB 1AGXA 4CQLB 5KWIA 2W6CX 1I3CA 1RRMA 4MVJE 2FOXA 3N0TA 3QJ5A 2IE8A 2ZIXA 3GNTA 3IQFA 4MP8A 5U4XA 3BE8A 3T7KA 1PQUA 3ZY2A 4W4TA 1DAGA 5EPEA 3VKGA 4FUTA 1N25A 3N7UA 3SXUA 1R2QA 3BEOA 4ARSA 5JAPA 2FFAA 2QLFA 3HU1A 4REOA 2J30A 3D6HA 3W1EA 3W8RA 5J4LA 5L9AA 1Q0RA 3VHXA 3ZJVA 2YCLA 3FNGA 4ZDJA 4DR1B 3AY0A 3AHDA 3F5SA 4MPPA 4MRNA 4GP7A 3FTEA 2HN9A 3M9WA 5I7RA 2GBLA 3U56A 3X1XA 4BJ3A 3KQLA 2J0SA 4O4IA 3BE5A 4IGAA 3M89A 1NFQA 4LJ6A 1N9ZA 4MYTA 4QE3A 2QX4A 3ZWMA 4URXR 2D5AA 1AKRA 2CD9A 3R3XA 4FLFA 1E2EA 2HCTA 1Z28A 1IHYA 1H4QA 4LZZA 3NGMA 1UWLA 2G6BA 2Y76A 2V3VA 3KB2A 1JBEA 1OX6A 2WQZA 3SPXA 4D9MA 3K4PA 4DV5B 3AHEA 4B81A 2WM3A 1K6MA 3EQ2A 4M9QA 3AY3A 3BZUA 1RYYA 1O6ZA 1YZTA 2J45A 2PH3A 3FDFA 3NDRA 3NOOA 3H7IA 2HWUA 2QE6A 4GZ3A 4NV0A 4R2JA 2HOQA 3KYCA 4UW9A 2C3YA 3F5QA 4CIDA 2D54A 4CXMA 1NJ8A 5IKMA 5K0FA 4YO7A 2IHNA 1ZHHA 2GPTA 2O3RA 2CXSA 3MJSA 4KQJA 1JG2A 2AHOA 4PZEA 3RS9A 1VE5A 3PR2B 3K0AB 4IHQA 3EVCA 3FFBA 4QJ5A 2F1IA 4BBPA 4ZYZA 2WTAA 3D02A 3QXCA 2XVMA 2ZQZA 3TLKA 3VO8A 3NBYC 4JP3A 3O8BA 4QAJA 1PBNA 3HP1A 4BQRA 1JDVA 1P3DA 5IYZB 4L9WA 4EW3A 3KOOA 3H5WA 2Y0CA 4N7BA 3LBAA 4OBXA 4ZOCA 5B1DA 3ZWPA 4OQMA 2ET6A 2X42A 1P31A 4S1TA 2R97A 4AAYA 2EKQA 3K9BA 2VG8A 2E4WA 2CVQA 2YNMA 2GILA 1L5NA 2EFHB 2Q50A 3U1TA 4EF5A 4BFVA 1UJMA 4EHNA 1EB9A 3AEXA 1WOYA 4FX2A 4RJTA 1T36A 4Z2YA 3TW8A 4R5MA 3TJZA 2ZJ7A 4MV4A 3JRWA 3HEBA 1YMUA 1XRMA 1MAVA 2VJMB 2GLUA 4QBKA 4JT9A 2GNPA 3TOVA 4U7HA 5KHOC 1BVYF 1T8SA 5EJGA 5FV4A 1N7IA 1DDOA 4NP6A 2W2KA 3GVPA 2PS9A 4DHWA 1IPHA 5ALVA 1B8NA 3MRXA 2IWRA 3U26A 4IDBA 4R8KA 3FOAA 4EHFA 2OZLB 2AMFA 3U9SA 1DKOA 2R1ZA 2ZIZA 5JVDF 5FD8A 3HB1A 4ZANA 5KNLA 1C1DA 3AVPA 2Q3HA 2RI6A 1O94D 2FF5A 1W35A 1NI3A 2JPDA 4GLOA 2NUPB 3ORSA 2A9FA 2X0EA 4JR0A 4BQOA 2OFXA 3AB3A 4RAQA 4R8MA 3D7RA 1M2VB 4CLRB 2A9QA 5JJLA 2WHPB 2P75A 2JCVA 2DR0A 3AHIA 3MOGA 4AKEA 4FB4A 3IVXA 1XROA 3A27A 3RFUA 3GZNA 1A95A 1V16B 2JFWA 3AP1A 3R9WA 1N8TA 3U37A 1O7JA 3RUDA 2ZYDA 1N9GA 2KPOA 2DGDA 3LLSA 3OLVA 5IG2A 5FHQA 1X9IA 3GJQA 1XJWA 4AQYB 4NU0A 1HH4A 4LV5B 3CVJA 4A16A 1JIIA 1ZKDA 2FLVA 4MMYB 3UJ6A 3NBQA 1G21A 1SU6A 3V3KA 4A0GA 5M34A 5A0TA 1NV8A 3S99A 1ZKMA 2IODA 4HMQA 1OJ7A 3BJEA 1ORTA 1DOZA 4QPPA 4NV1A 3TTUA 2ZU0C 3D7NA 1G291 4F7WA 2QD5A 2JCSA 1CPYA 3WMFA 3C6MA 1QS0B 2YASA 2LE0A 4PWZA 2X2PA 2WYUA 1LSOA 4LTMA 4C76A 1OZHA 1A5SB 1C7FA 1K7EB 2PGJA 3DFUA 3VNSA 5CDYA 2F3QA 1H2HA 1VYTA 3G7NA 3MC1A 4IX9A 3VZRA 1II0A 4BNUA 1IBLB 2J4DA 3ZV7A 2IF0A 5KVSA 3BG5A 4CIBA 4K9QA 2BR4A 4AULA 1KU0A 2PUCA 2XUQA 1FDTA 3IESA 4EUKA 1U8XX 3CRNA 1G59A 2P9FA 3RFXA 4KMOA 1G16A 3TPFA 2L19A 1FSGA 2DFLA 1GNQA 2G72A 3BL6A 3LCMA 4GPEA 5TX7A 1C0PA 2BH9A 3ZDZB 4D0NA 5BP7A 2QG9A 1Z7GA 3GJTA 4LDQA 3CF2A 3CUYA 3GD7A 1RI1A 3BUSA 3GO4A 4MO9A 5JT1A 3HDGA 4CMCA 4Q00A 2MWMA 1XNHA 2OV6A 3N8HA 4LGVA 2GEJA 1WETA 3MJ4A 2ZT5A 3OIDA 1QV7A 4KSYA 5IJ0A 2X2EA 4LBWA 2EXXA 1XE3A 1AA9A 3SX0A 4WNAA 2TMDA 1YU9A 5LP6B 1AKYA 4OQPA 2XB4A 2HK8A 3A7EA 4OVKA 1I6KA 2C98A 2Z8YA 4HX2A 4KU4A 5CVTA 3PDIA 5C8DA 5KOHA 3R7WA 1J90A 1EGQA 4XFDA 1A4UA 3HKBB 3MT7A 1V7CA 4FFBB 4I46A 1OAOA 1JHUA 2RGEA 2ZYRA 3EULA 3KAQA 1DKPA 1JECA 1HZZC 4J0EA 4JJGA 4MV5A 4NZYA 2EFYA 4OSPA 4KHZA 3SCZA 3JXEA 1KEUA 3C41J 3J80A 1Y4DE 4GZLA 4YJ2A 2NACA 4IOJA 5HIAA 1S8OA 3DFMA 4P4GA 4XFKA 4WOCA 4DHEA 4TWZA 4UCQA 3WDKA 5KU7A 1M2NA 3T1HB 4D9FA 4DTCA 3PNKA 4GAEA 4MYHA 4YJHA 3VC1A 5A4AA 4H31A 4NBLA 5CXSA 2CEKA 5DNEA 1FPQA 2IZ7A 3ZDDA 2F9MA 1B8PA 1S2MA 1Y1QA 2GK7A 2Z6UA 3DBLB 3H11B 1N5LA 1IOWA 1PL7A 2W6PA 4JP2A 4K05A 2PZFA 3UK2A 1T3TA 3D6JA 4OB6A 4BBJA 1ESMA 3HKCB 4I1VA 4NF2A 5A4FS 5FTLA 3HKDB 3GJ7A 3U39A 5FWXB 4AY4A 4I9HA 1J99A 3U4DA 3FCSB 4M88A 1L0BA 3EH1A 1GTL1 2I87A 2Q8QA 4DZTA 3VUEA 1COZA 3TJRA 3E2PA 3WHKA 4WBNF 3I30X 4RK4A 3WGTA 4RY8A 3WKDA 3M83A 4TTQA 4B4VA 3S8YA 1PAUA 3UT0A 1MC1A 4IAOA 2VTVA 1NL3A 1P61B 3ANMA 4TMXA 1CUBA 3DAFA 1UPBA 2CSUA 1XZQA 3BZWA 1DV2A 3FGNA 4JQOA 4MVJH 3UN1A 3DOUA 4L73A 5DULA 4ZYTA 2HSDA 3PUKA 4J4HA 3QVLA 2K4MA 1TIPA 4BWFB 4G1FA 2B5WA 2O0KA 1L7VC 3NHPA 2Y4OA 2G67A 1C1XB 1E60A 3OURA 4NY1A 4WCFC 3WP1B 1CYEA 1KEKA 3GP8A 1CJUC 5LYJB 1ZNXA 1SVIA 4H7HA 2ZREA 2R85A 1Z75A 3PRHA 4ND5A 1JIJA 4ZQIA 1OXMA 4L0CA 3W78A 4IQ0A 1HKHA 2PZBA 3LP8A 3SX2A 1NW5A 1KARA 2F8MA 5KTTA 1ZK2A 3TI7A 3ZLJA 4XQGA 4PINA 3G5TA 3TLCA 1EFUA 1L5OA 4G5XA 3O03A 4B7XA 2IOHA 2VXOA 2OXEA 2HRDA 4TYPA 2R6AA 4F9EA 1DJMA 2QW8A 3UPUA 5FF9A 2ECKA 3RTGA 5FNVB 3EASA 5HUQA 1ZUNA 1LJUA 5E7MA 1EFKA 2F90A 3W7AA 5I51A 5JBIA 5IVIA 1KORA 2YHIA 3QI7A 3RIEA 3MLAA 4RULA 2N1BA 4ZQBA 3GARA 9ATCA 1TVMA 1DTWA 1KC3A 3M3PA 3TM4A 2XQVA 1WW2A 3W3AH 3SVLA 1BVHA 1UFKA 5C34B 3I4CA 3DMDA 3RTEA 4BUJA 1R6AA 5AI4A 5IBPA 1XTKA 3M81A 3I2KA 4X63A 5K20A 2Z9DA 4UEQA 4YJGB 5JZSA 4RJLA 1FY2A 5EG5A 3OJLA 1E6WA 1U98A 1QC5A 1XVIA 2AFIA 2ID9A 4NSNA 4Y2YA 5COBA 2OXCA 3VO1A 4B45A 3IL2A 2NLOA 1UIMA 1U3CA 5I01A 2PRZA 3OZTA 4ZJZA 3AZOA 1GJRA 3G0GA 1XTBA 2I99A 1KL7A 3PDWA 4WL0A 1A97A 1XELA 3SR0A 4DUPA 1EA5A 5FBWB 4GZMA 1UBGA 1ATIA 1T2EA 4WXEA 3V4SA 4WCVA 4CR8A 5A3RA 1Z3CA 1NLMA 5JD5A 4MB2A 2XQJA 3CCCA 1CQJB 1QVZA 4R84A 1G6HA 1HDRA 1L5SA 1D1TA 1VGVA 2P4HX 3HA3A 4L4XA 5CH8A 2YY5A 3K70D 3DM5A 1P29A 2G3YA 2JLBA 3B48A 3JD0A 3ZY6A 3L7MA 3AR4A 3JYLA 3PHGA 2CNDA 1T4CB 2BFAA 3V4ZA 4MVJA 1M5TA 1AQLA 1A9PA 4PRLA 3ZX5A 1Y8ZA 3H13A 2IKQA 3S1SA 3CZPA 2B8WA 1VG0B 4HNAA 1JPJA 1WMDA 4Y1RA 1T6ZA 3FJYA 3PJGA 3VDXA 1R7RA 3W1WA 3JPWA 5KTOA 4X62B 2Q0HA 1N32B 2ILTA 4EGFA 5ICSA 3GEPA 3PLRA 2O8FB 2G5GX 1JG6A 1GTZA 1QHIA 4OFBA 1CZRA 2JFUA 2RHBA 3ITNA 3M6UA 3VR0A 4DNPA 3X1MA 4HLCA 4ARBA 3MWYW 3H5LA 5JS8A 2ZDQA 1GCGA 1YQGA 4QULA 3SSMA 4D25A 3AFNA 2XUFA 1ILWA 1CVLA 1MPXA 4PC7A 1W4ZA 1YCFA 4TTPA 1ULZA 3WR5A 2J6HA 1G1AA 1OLXA 2Y6VA 1G17A 4RHCA 1SHLA 4K87A 1YASA 2PWBA 4PQFA 3SQDA 4EPXA 4F2PA 1GGJA 4W99A 1CUDA 1Q92A 1IRIA 2H63A 3L9XA 2BFEB 5EIEA 4ZKEA 5JH7B 4S2UA 1BGVA 4TLLB 1UT5A 2GAIA 1FCJA 1MA0A 3WZMA 5EKDA 1FX0A 3BSYA 4WN9A 3QFCA 3OJXA 3ONVA 4MP6A 5FIUA 4ER6A 2FN7A 3CZQA 3H2SA 4UBOA 4BVEA 4H6PA 5AVUA 2FFQA 2GDZA 3V4OA 1BSVA 3N2LA 2V65A 1MH1A 2HJVA 3ICQB 5JFTA 3KUXA 1P5RA 5KNDH 3D1JA 1TYBE 2HWYA 3R6TA 4FKBA 5DHQA 1AMNA 3NPMA 1KI7A 1MZVA 1FUIA 3RQSA 2VFAA 1M1NA 4QNMA 2UZ3A 1XF1A 4RU1A 4X66B 3S29A 3WDSA 1F17A 2X77A 5KTRA 3KD2A 3D3WB 3Q6MA 4AN4A 4XB2A 4WERA 3D4LA 2LDBA 4DSNA 1KOGA 1TKCA 4RHYA 3L8CA 1G8KA 1KQPA 2WVAA 3LXXA 3VX4A 4ABYA 3LY9A 4QEKA 8ATCA 2DLNA 2EIHA 3IQXA 3P26A 1U9JA 3GH3A 4QJ4A 1RE0A 4YEDA 3U7EB 2P79A 4X20A 2VDRB 4JQSA 5DPMA 2GR9A 1FJHA 4Z2AA 2IEGA 4QVIA 4CKBB 1IQRA 5G02A 3TAHA 2FU5C 1NHWA 4LYHA 2QYTA 1UK6A 5CT5A 2GPBA 1LLDA 3QUSA 2OCDA 1NW8A 4HMOA 4TGLA 4TLBA 3VKVA 5BMVF 4RL6A 5C1OA 4Q9KA 1U7WA 2J59A 1ONPA 1VPTA 2Q0SA 5I9MA 4IOKA 1Z06A 3HYSA 1FLAA 3STHA 5AVTA 4B6QA 4OG2A 1NPDA 3V1KA 1UZLA 2IHBA 2SICE 3FZEA 5CW2A 5G1OA 1IHPA 4JBGA 3UGTA 1BCSA 1QTIA 3BL5A 5FLEX 4G4GA 4YHBA 3DCIA 3IX7A 1TQ8A 1U3UA 5JJIA 1YQEA 2XWJI 3PFHA 3PX2A 4KYUA 2AG6A 2UXDB 1D8AA 1GUAA 1OZFA 2Z04A 4RK0A 4Z1OA 1P72A 1EUDA 4CKWA 3HMQA 1JIUA 3WRVA 4C2BA 4RSMA 2VSQA 4H4CA 3EZXA 4H3VA 2ZAGA 4CMIA 2PJRA 4PX9A 1DQYA 1I2BA 1F0YA 1Y0BA 4LQCA 5G0SA 2OD7A 4YCAA 2JBAA 5A4JA 4EL5A 2EF1A 1L1QA 1Q22A 2O3TA 2YRWA 1PSDA 5KEIA 1JQ5A 1JSXA 1KBZA 2QLLA 4YXFA 3N59A 4NXNB 4QYMA 2A3RA 3IR5A 5DI3A 3GT3A 4W9MC 2IZZA 2V97A 4UBJA 3RADC 1JR3A 4KDRA 1CUYA 2GD1O 3TOSA 2Q5JA 1ZCJA 1KETA 3JWGA 5HF9A 3SD7A 4DUZB 3BF8A 3L7KA 1SU8A 5EYPA 1JEQA 4CHTA 5AMXA 2QLBA 2E18A 4MI9A 5KJ6A 4RLFA 5FYQA 1AS3A 3OFKA 1CC1S 3IP5A 3P9IA 4XCQA 1LV7A 4BO3A 1PS0A 2ISCA 1KYVA 1GKKA 4YCJA 3QQPA 3T5AA 5H83A 1UQTA 1T5LA 4E2XA 1M9NA 1V1RA 2XEDA 4L4UA 4OGGA 5JCPA 1GNPA 4ARIA 1HLPA 2HBZA 3FKSA 3G2LA 4UBLA 1NX9A 4X85A 2DX7A 4RF5A 3RJZA 4EB3A 4I9UA 1GPNA 4AJLA 4B79A 3K09A 4L4YA 4GI2A 5LXTF 2XD4A 2FWIA 1K7YA 3E35A 3OA2A 1X77A 1XDDA 2Y1KA 2Q2NA 3GCWA 2O5RA 1QYWA 4PFSA 4UUQA 4X91A 1IL0A 2Y05A 1BWRA 4XLTA 1QG0A 3PGVA 3Q5GA 4JHLA 4KE8A 1GPDG 2FWAA 1NJSA 1K8ZB 2NUAA 3L1HA 5EE0A 1T9KA 3ZYZA 4BP3A 9MHTA 2QL7A 2CDAA 1TJ5A 4QQ8A 4ZVOA 2NSJA 2H92A 2AG0A 4C4SA 2WKQA 1NUUA 2B69A 5TT0A 3HO6A 4XWKA 4WZBE 4X5OA 1NASA 2QN3A 3DDSA 3S2EA 3T95A 2ANBA 1GNTA 3LX5A 4LXYA 5EJ7A 1N33B 1D5WA 3VDRA 5DT2A 5BORA 3BSWA 4MKZA 1Z6QA 2EL9A 2DUMA 1M54A 4U9IS 2FMTA 1X1RA 3P2YA 1UPCA 5LA6B 3ZJ4A 1F1JA 1VJGA 3PQ5A 3RU9A 3DJYA 1L4HA 4TUYF 5EXEA 5FPQA 4YB8A 3K73O 3RAJA 3F4LA 5KYUA 4H1TA 5EJ5A 2C82A 5GTDA 1HT2E 1FFXA 3FG9A 3KX2A 3NORA 3GY0A 1Y1RA 4UEKA 1ACLA 3OJ0A 3I1JA 3QOYA 3TM5A 3LUPA 5IJ9A 4GYJA 1SUFA 5E7JA 3LIPA 1D2GA 1SUWA 1X1DA 3LG2A 4DABA 4R6XA 2ECFA 5DCUA 3REOA 5A6SA 1LVHA 4HJXA 1DJQA 4LC9A 4EDFA 5LLDA 2E5FA 1G3QA 1U4OA 1ZH0A 2A0UA 1OXVA 1VE1A 2QVBA 2WEKA 3N5CA 3NIFB 4FKMA 4V3CA 3FVVA 4WACA 4ARUA 5LNK1 2IYAA 5K8IA 4FM9A 2VN8A 3RSHA 2Q5EA 3P45A 2QVCA 3DLTA 1BN7A 3OZSA 3CRZA 1IEXA 3TVDA 4B2YA 1E79A 3QOFA 2GLTA 2O57A 2ZEJA 2E1RA 1DIRA 2MMCA 4JJFA 4HUTA 2PYDA 3I6YA 1VKOA 2GASA 4JI5B 2F8TA 4FHGA 5ITWA 3GPDG 4PLYA 3MILA 1L4BA 3H8JA 3OT1B 4YUYA 4BFWA 3TKYA 1QCZA 3U4QA 1XGKA 1Y8QB 1XNJA 2PK3A 3QW4B 3KQYA 2OXIA 1UMCA 3BCHA 3LT0A 1IQUA 3OCCA 1DEKA 4BO5A 3O8QA 2IFTA 1F0NA 4PG8A 1OF1A 3WKEA 2ADMA 3VAYA 3GT7A 3QX8A 1NSTA 3D8BA 4Q9DA 5C8VA 1U65A 3IT2A 2E87A 4KITB 4DS3A 1OFGA 1H8ED 1WQ1R 3ILHA 3OOWA 1VLVA 4N12A 1DCKA 4ROSA 5KSPA 1N2JA 3DWGA 6GPBA 1ISJA 4CIAA 2JLYA 3EGEA 2GGSA 3U3OA 1WA5A 4L6AA 3T9AA 4CVNA 3H0CA 3TRJA 2CLEB 4B85A 3CF4A 3D2AA 1WUKS 3KEOA 3HO1A 5EINA 2XQFA 1EUZA 1U2PA 2AK3A 1B1CA 1OXSC 2BGKA 3F96A 3HCPA 3RT1A 3WXBA 4URWR 1H9AA 3ZYCA 1FTGA 1XEFA 3DPSA 5F12A 3D0OA 4D74A 2V3CC 4F86A 4MB0A 2H48A 4MRVA 1VCHA 4P7KA 4W6ZA 3DKVA 2FV8A 5TQ0A 4EJSA 5AKIA 4EABA 1H69A 1L5FA 3ISVA 3CRMA 1KK2A 3DUWA 2DKFA 1E61A 1OZAA 2ZE8A 1HNNA 1PQYA 1Z3IX 4EKGA 4XWWA 2P0YA 2GXUA 5AHXA 4OAPA 1QFJA 1WJGA 4GF5A 1U8EA 1QYDA 5JZBA 5CIYA 2V0NA 4YRDA 4OAQA 3P4XA 2KE5A 4UD6A 5F64A 5FNZA 2IWHA 2R87A 3GLGB 5E9JA 4E7OA 2FEWB 3JZFA 3PUIA 4NABA 4UE2A 4X94A 4YPVA 5G0VA 2EWVA 2JLXA 2GEKA 2KBFA 1P2UA 2H06A 4QPDA 3CY6A 3D6AA 5DX0A 2F43B 4CQMD 2Q2VA 5BPHA 3IBGA 4EYGA 5C3MA 2ZBFA 4LGYA 4P35A 4IG9A 1NFFA 3IB6A 2D1FA 3RUPA 4HADA 3TRKA 1V1MB 3CKKA 1ONBA 1FFEA 3OF2A 3RSGA 1DFIA 2OCGA 4I3FA 1N3LA 3WHLA 5FQOA 4HF7A 3R9IA 2LDXA 2AFHA 4AY6A 4K9NA 2R4QA 4M9RA 3M33A 3DSRA 3Q3VA 3PJRA 3OKFA 4ZP1A 1EBBA 2AOTB 3EVGA 5REQA 4E33A 1CWUA 3K35A 3ZDYB 3GW8A 2DTDA 4FHDA 4G1VA 3S1AA 4FHFA 4C29A 2Q2OA 4P6VF 2NQTA 2VRCD 1JA1A 1MV5A 1PYDA 2X14A 5KYYB 3LS2A 4AMVA 2ORWA 1OOEA 1J8VA 1NATA 2D2FA 3A6DA 3BGOS 3ETEA 4R98A 4TMKA 5BN4A 1WZCA 5F2OA 3QKWA 1BE0A 2MT9A 2ZM6B 1D04A 4NWIA 3IVGA 5TY0A 3V55A 4D8XA 2NT4A 5JH7A 1OGIA 3QMWA 5LNK6 1KMIY 2XCUA 3DL0A 1MB3A 2X8JA 4QXQA 4KAFA 2ZSUA 4I50B 3NX4A 1E2GA 3DDWA 3W3ZB 3WNVA 3OKPA 1LBIA 1QXSA 3E5HA 4L0MA 3L4BC 1XQ1A 2XWSA 3BB1A 3NVMB 4BLPA 1SIOA 1BJTA 4DV4B 5KJCA 5E9QA 1HEIA 5G3YA 1KQOA 1WKBA 1Y7IA 2CYCA 2R7LA 3COSA 3OPYI 4DV2B 4D98A 4YT5A 2C9MA 1GQRA 1XXHA 2WFLA 3A2LA 3OPYB 3DDNA 4TQAA 5AKKA 3PFBA 1A4RA 1XCMA 1VMAA 5MHTA 2R6JA 1BS9A 1NR5A 2WZQA 2YHUA 3R7SA 4I4NA 5CXXA 2A88A 3KQVA 2YJ6A 4MLZA 1TM7E 1ZGAA 3D3WA 3W04A 4UU8A 3NH6A 5E0OA 3TTYA 3NTXA 4BO0A 5DHUA 3W05A 3MW8A 1KS2A 3OESA 1EG2A 1SGWA 4RS3A 5SZHB 2ASVA 4MPJA 4UFNA 4QUEA 4YASA 4HYTA 2H8KA 1J0AA 3IP8A 5JARA 2DOKA 1VTKA 2EZTA 2GUGA 3OX1A 2HCBA 4LYJA 1T1SA 4QQFA 4N7JA 2PXCA 3QGMA 3W6UA 4LSWA 1FDRA 3VR5D 4P80A 4HJRA 1MHPA 2OHHA 1KK3A 1VXOA 4E6PA 2E2WA 1KC1A 5AKLA 4YJ3A 2V7BA 4IQ8A 4MVXA 1IAQA 4I55F 1WX1A 2WUWE 2X3UA 2BRUC 4HEHA 1VYVA 2XX3A 3MAAC 4AQ7A 2NADA 3HP4A 3THYA 1ADCA 1KY4A 2PS1A 1I01A 4EQ6A 3LZCA 1I7NA 5CT4A 3B2NA 3BWXA 2H1VA 3IAFA 3OEED 1GZUA 4P3YA 2W83A 4DZRA 5EZSA 1EK0A 2PU5A 3M34A 4F72A 2YYAA 1Y7PA 3RIGA 1TM4E 5ECYA 4BGVA 2GF2A 1T5DX 4M0UA 3V9PA 3H5AA 4GMFA 1L7OA 1SZCA 2JIDA 3ZWVA 3IE1A 2AJBA 3WL4A 3OTOB 3ZVKA 4P0TA 4BMNA 3T06B 2JI6A 2YJ5A 3F98A 2Z5VA 1J23A 3FYUA 1ABFA 3ND9A 2P4UA 4C4ZA 4MW1A 5EWLA 3SHVA 1DGQA 3LV8A 2AIRA 4D9KA 3FPAA 2QQGA 2FEXA 2WNIA 4O4HA 1CTQA 4NBNA 1V8PA 5DXFA 1WXHA 2O8VA 2YWJA 2V0CA 3SBOA 2R7NA 4TXHA 5B1IA 4ESEA 2Q4OA 1NN5A 3GFRA 4DEVA 3LVRE 1HUQA 4QUKA 3ZGZA 4ALJA 5KTKA 3RLIA 4BFZA 5YASA 1NYRA 4WLVA 4EKNB 3PI6A 3D4BA 4G0OA 4ENUA 1I4LD 1N5IA 3LOUA 4KUGA 1E1RD 3KKQA 3A1UA 1YRLA 1OTXA 4MUEA 1NY6A 4K46A 4O4LA 2BR5A 3RDPA 1ZN8A 2ODNA 1T6YA 2JHGA 2ZANA 3EGDA 4WA7A 1B93A 3Q11A 1EVJA 4Y0VA 5JSYA 3SBXA 4AP5A 5CNMA 3BMOB 5AWFC 2VF2A 3FMGA 2XUIA 1IRXA 1J09A 3TNYA 5AW1A 2CT8A 1X39A 3COYA 1FSSA 3DLCA 1E3DA 1E3EA 1Q95A 2IUTA 2Y92A 1SUDA 4E94A 3BWDD 3HCOA 4MUBA 3MCWA 4ZIRA 3H1TA 1W52X 4MUGA 7MHTA 1E2FA 3PR1A 1WM1A 5EOVA 1F2TA 1UBSB 2GHRA 4E0BA 1E2LA 4J1TC 3C39A 5AXBA 3ZGXA 4PXSA 4CODB 3FSJX 1I4EB 1NDUA 1QQ6A 2IEAA 2RGYA 4RE6A 1J5EB 4L8WB 1ISMA 1WZEA 3BIJA 3SF8A 4EFKA 1KYXA 4OU4A 4AX8A 1ZC4A 3HGTA 5L40A 5DM2A 3QLVC 3LO8A 4HNHA 4MVJP 1HLDA 1U8TA 1H2FA 2BI7A 2HT6A 4Q3OA 4TKUB 5E3IA 3ZJUA 1NVKA 1UJ5A 5BVHB 5KREA 4MP3A 4YLGA 2XQIA 3TXAA 5B7NA 4AFNA 1N4DA 1FMLA 3IVMA 2VJLA 5IWAB 2CLHB 2R751 3OLCX 1IN7A 1V3UA 4JMPA 4LY6A 3CSUA 5ESDA 3EMKA 4AMYA 1KO5A 1DAHA 4FFVA 1PZMA 4QWMA 3C5EA 4DN6A 1Y8RB 3LDGA 3VFDA 5ALKA 5K0EA 1U3VA 2FZ4A 2YZNA 2WZBA 1YHNA 1ZVJA 3CKLA 3K1AA 4OSEA 3ROPA 3KUUA 3AKDA 2JCBA 4LSGA 3O82A 2CVOA 1Y81A 4FNGA 2MDTA 4I1IA 4KN9S 4X9XA 5J47A 5G4KB 3VM6A 1KF0A 2AQIA 3EOZA 4IX1A 4ZU3A 4BV8A 3WFZA 2PBRA 1ND6A 3PXUA 4HFNA 3UUGA 5IUJC 1V6SA 1YNOA 3CZRA 4F0JA 2ZYUX 3JX9A 1TYZA 2IOQA 2VPPA 3N3AC 1QHXA 4O2BA 2XCTB 4XM0A 3WBBA 3D2BA 1MRZA 3LGXA 3REQB 4A4DA 4BQQA 4D82A 3VOTA 2QPLA 2F8SA 1GNSA 5P8WA 3GVXA 5F23A 1W5SA 3M6MD 4OJYA 1GG2A 1FJ2A 3BBLA 3AUFA 3JATB 4BASA 2XZLA 3BKWA 1BKDR 4KXMA 2P5SA 2DVMA 4L5YA 4MUMA 1L5ZA 4ZI3A 1QP8A 5DISB 3WL5A 2OYSA 1Z4NA 4RIHA 4KOEC 3ESZA 5CLIA 3M6FA 4XSGA 4JFRA 4ARAA 2GTIA 2ZUVA 3PTAA 4LTDA 1Z15A 5B7PA 3CLRD 3F74A 3Q3EA 3X1KA 2BHNA 4QRHA 5JQWA 4CJXA 3AUKA 1T4DA 2QJWA 1TF2A 4XH9B 3EARA 3F1KA 1WEKA 1GPBA 4C0LA 5EEGA 4LKOA 2BMAA