1QHSA

Chloramphenicol phosphotransferase in complex with chloramphenicol from streptomyces venezuelae
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
178
structure length
178
Chain Sequence
b'MTTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQSAEGGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLDVLWVGVRCDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTHKESIECAWAIAAHVVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CHLORAMPHENICOL PHOSPHOTRANSFERASE)
publication title The Crystal Structures of Chloramphenicol Phosphotransferase Reveal a Novel Inactivation Mechanism
pubmed doi rcsb
molecule tags Transferase
total genus 59
structure length 178
sequence length 178
ec nomenclature ec 2.7.1.-:
pdb deposition date 1999-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07931 CPT Chloramphenicol phosphotransferase-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1qhsA00
3VU9A 3QPVA 2JAQA 1L4UA 2J9RA 2JLXA 3WRXC 2AK2A 4M1TA 2ECKA 5G41A 5FPTA 3VHXA 5FI1B 4NP6A 4KXFB 3BGWA 2ZRGA 2G77B 3UK6A 2EVWX 1UJ2A 3RABA 4BZQA 2YYZA 3NHAA 2BCGY 1A5TA 3QJYA 1W47A 3BFKA 1R4AA 5FL7A 2XAUA 1XD2B 4NHOA 4B6FA 1E32A 2P6RA 2O8DA 4U7DA 1KAOA 4I4LA 4FMBB 3AF2A 2G0TA 4OK5A 1GL6A 5F2EA 3TSZA 1BMFD 1N3BA 1OH6A 1E2GA 1LFDB 2ZRJA 1P2VA 4DVGA 3K70C 3QG1A 4V02A 4JT2A 2QY9A 5C2JB 2AWOA 1P2UA 1R8QA 1YZUA 4PHHA 1XF9A 2RAPA 4ACBA 4PC3A 3GMTA 1G3IA 4JJKA 2O5VA 5AWFC 4RD2A 1E2JA 4AG6A 2CLSA 1SXJD 4OHWA 3K0CA 1YQTA 4DLRA 4KBFA 4US2R 2D7DA 3KQKA 3TAUA 1NP6A 3BFXA 2GXSA 2QL6A 4HUQB 4BLSA 4EPTA 3GLIA 4O2LA 3RS5A 3FHOA 2C5LA 3FPAA 4QHTA 1P60A 2W0SA 4E22A 1BOFA 3OESA 2F1HA 2P6UA 4V03A 5LB2A 3H0KA 4NCIA 2GAOA 1ODFA 3B78A 5AJWA 1DARA 4PPGA 1P72A 4BFWA 1HE8B 4PPQA 2WKPA 5KUTA 3V4RA 3I1FA 3RAPR 2QRZA 3KB2A 1TU3A 4DB2A 1Z6XA 4WVFA 1DADA 2RCNA 3U2QA 2WTUA 1X8LA 3LXRA 2AKAB 1KIMA 2VYFA 4L15A 4LYHA 3W6PA 3WRYC 4DSTA 621PA 2ZSFA 5J4HA 1T8UA 2IUTA 3B1XA 1MO5A 4TYQA 3EASA 1ESMA 2WSMA 4OK3A 2PLFA 5EXXA 2DPXA 4IFBA 1KI2A 3KKMA 4OBEA 1EX7A 4Q1AA 821PA 2PZGA 4QNMA 1N5JA 1PV4A 1G291 4QOSA 4R98A 2OFWA 3LDAA 1XZQA 4K8OA 4FN5A 4HDCA 1G64A 2CCKA 2N46A 1RVDA 4TL9A 1FP6A 1SVMA 2GVZC 4R7ZA 2ZYTX 1PUIA 2CE2X 4WAUA 4MKIA 5EE0A 1GUAA 2YWEA 3ONWA 3QPUA 2BHRA 3PR1A 2VIIA 2OAQ1 2FA9A 4TQUS 4DC9A 2CBZA 4IEIA 4ZDKA 4XSGA 2HXSA 2JLRA 2CCJA 2V1UA 4JLVA 2PMKA 2FFHA 1RRGA 5DO9A 4BLQA 4C3ZA 4X8MA 3QF4B 1IAQA 1G7SA 5EE3A 3D3QA 5IDVA 1G6OA 5J4KA 2QN6A 1KO8A 1UM8A 2ERXA 3PJRA 1JI0A 5FBWB 4PQFA 2GXUA 4MQBA 4D4LA 5DN6D 2Z6VA 1AQYA 1N5IA 4F4IA 1IXZA 4UNNA 2ZI3A 1KGDA 2ZU6A 3K0EA 4ZDWA 5L8VA 1CF4A 1PUJA 1RRPA 1UKVY 1WDTA 2OAP1 1P9RA 2GF0A 2QAGA 1Q57A 5DYIA 2FGKA 2JA1A 2OZEA 4M1SA 3WP0A 3CRQA 1HV8A 2OO7A 2P6NA 2GRJA 1NNEA 1E2IA 2WZQA 2ZRPA 3OEHA 2XTMA 1VMAA 1TF2A 4WOPA 5CB6A 2IYUA 3SQWA 1DS6A 2BC9A 4DLSA 1YKSA 1Z22A 3LLUA 1GP2A 2VSOA 2J46A 3ECCA 5FUWA 4GDFA 1UBEA 1T4GA 3T1QA 2WBLC 1TPZA 3CX8A 4IEEA 2HXYA 4HATA 1TF5A 4LYFA 1KZ7B 3VX3A 1QHNA 2FOLA 2ODWA 3PQCA 1U9IA 3NHBA 1KSGA 3ZQJA 1RC8A 3GJ5A 3J81k 2DCUA 1VDZA 2WV9A 3LW7A 2DFTA 1IN8A 4Q02A 1E98A 3VKGA 2B21A 2XEXA 5AUPB 2WIBA 2WWYA 2J0QA 2OSBA 1KDRA 1S8FA 4KBGA 3KQHA 2PCJA 4O25A 3EIQA 4JSYA 1NLYA 1YU9A 2W2XA 3I8XA 2WPDD 2HT6A 3LH5A 4CEJA 2GJAA 4FMCF 4IKEA 1KI7A 2YC4C 4QC2A 2YJTD 4O3MA 2OCYC 1KMQA 1U98A 1FFHA 2IHBA 1N6LA 1Q44A 1XZPA 3AV0B 4IXNA 5F98A 1YE8A 4Q9JA 5JHHB 4XVUA 3EA0A 4C4PA 1D2EA 1ZW6A 1IOZA 2QGNA 2ZUCA 3IHLA 3IQXA 1EFRA 3EZ6A 3THYA 1IXSB 4JVNA 2J1LA 3H4MA 1UADA 5UKDA 3AVQA 4LHYA 5J47A 1U0LA 2O8BB 4HSEA 1GOTA 2OG2A 5KDDA 2NG1A 5HR5A 5JS8A 1GIAA 5KNBA 3RS7A 1UDXA 4PO9A 3LAWA 4A15A 5SZKB 3HWSA 1F5NA 5AUOB 5IT5A 2J0UB 1COWD 1P4SA 4L4UA 3CZQA 4PZLA 3NBZC 4DJTA 2QBYB 221PA 3KTAA 5CIQA 1J70A 3FMIA 4IFEA 4B48A 2O8EB 2JIZA 3QEJA 5DH9A 1G7TA 4B44A 4KI0A 4RVCA 4E07A 1DTSA 4TLBA 1KO7A 1R7RA 1G17A 1IONA 1CULC 5G3ZA 3IO5A 1G18A 4B3CA 4AYWA 1GRRA 1R0ZA 1YRAA 1II0A 4MYCA 2AD5A 5DISB 3FFBA 5FI0B 4BQSA 2PEYA 2C03A 1Z8FA 2ZYVX 2VP0A 2P0EA 4Q00A 2MMCA 3E70C 1CTQA 2WPDA 3PG5A 1G5PA 2CMKA 2BBSA 4JL5A 3F8TA 1CR0A 2NO9A 3VKHA 3K0AA 3K9LA 4D80A 4RZ2A 3VR5A 2BVNA 3KXKA 4L9SA 2ZRBA 3WMGA 4DHEA 1KJYA 4LZZA 3CF2A 3V4FA 5AJZA 2H1LA 1KK2A 1R5OA 2YWHA 4LBVA 2GJSA 1VYVA 4MGZR 3S1AB 3LBHA 4E03A 2QMOA 1TX4B 4QGGA 1R5NA 4HLCA 4B3BA 4TLAA 2JLSA 3AF1A 3CKLA 3HU2A 2RHDA 4LJ6A 4ARZB 2RHMA 1KI1A 1W4BA 2IBMA 4M2LA 2OCBA 1N6OA 2HLDD 3A37A 2GK7A 4DDTA 4JZKA 4OJQA 4GFDA 5CB8A 2ZVQX 2ZE6A 3CNOA 3MJRA 1QVRA 4MKHA 2QQ0A 1OXSC 1Z0FA 1G8PA 3ETLA 5HPYB 4DDWA 2PLRA 2CXXA 1J2JA 4RKFA 5BXQC 3VFDA 2REBA 1Z29A 2NPFA 3DZ8A 2O8CA 1E0SA 2VLIA 2NZ8A 5FPYA 4OI2A 1M2OB 4YMSA 3K70D 3DO6A 2ZTSA 4JL8A 4GI7A 1HA3A 1IN4A 4LBZA 5LD2C 2ZI6A 1SHZA 4PO8A 3UWKA 4TQ9A 1G4AE 2GJKA 3AP3A 2CJWB 3AF4A 4L9WA 3SHWA 2F9LA 3R9WA 2IXEA 2WMNB 1U90A 3FB4A 1VCNA 1TADA 1SGWA 1YVDA 4C0JA 3PEYA 2ZRDA 5BQ5A 4IHQA 1SKYB 3HPQA 4C0SA 5KNCA 4XH9B 2A2ZA 4UQOA 1NN5A 3CO5A 3FKQA 2R44A 3RDPA 1GL7A 1V43A 2ORVA 4PHTA 5J4YA 2OXRA 2WHXA 2JJ8A 1CIPA 2VHQA 3CNLA 1OXUA 2Q3HA 1P3JA 4B34A 1Z3IX 2ZQ5A 4Q9LA 2HLDA 1JBKA 1II8B 1G9XA 4OHVA 3AP1A 2V1XA 2OLJA 2DY1A 4Q19A 3FDIA 3K0CC 2X19A 2NMVA 1KMHA 4E09A 3SYKA 2NOAA 4J0QA 1GM5A 1ZNZA 2B7BA 3QXJA 3GFTA 5LBIA 2G9NA 2ZJZA 1CXZA 1D2MA 4US1R 1X86B 4PX9A 2BDTA 1CJVC 2VPPA 4RFVA 5DLQC 1OHHD 3O8BA 2J41A 3CH5A 4GP6A 2L0XA 2O0KA 4QBGB 1IY1A 4LK2A 1T3LA 1E2MA 1QHHA 4EQ6B 5D3MA 4FINA 4O0MA 1WB9A 2IX3A 2IUSA 4RCZA 5SZJA 1ZC4A 4PFSA 1YZLA 5JI3E 5JHGB 5GJWC 4PTLA 5IK2D 3KL4A 2GHIA 2EQBA 4OI1A 4DEXA 1ZRHA 3LX8A 3E2IA 4RJLA 2DWOA 1JQJC 2BKUA 1KI6A 3HU3A 1P75A 1TQ6A 2ZRAA 2YWGA 4GOJA 1NY5A 4V0ME 3SR0A 5C4MA 2WWIA 3KZ1E 1WF3A 1ZIOA 3DDCA 1Z0IA 1KI4A 1N6HA 2QM8A 1ZD9A 4C0AC 2ANCA 4C7OA 3SJCA 3C16C 3GLHA 4DLXA 3REFA 1IJEA 4LHVA 2GZDA 3SYLA 3OHMA 2D3WA 3CRW1 3VR3A 4U5XA 5P21A 1R8SA 1X1RA 3OIUA 1A82A 2QMUA 3B7GA 3ND9A 5CYOA 3M1IA 2Q6TA 4IVQA 1W0KD 4OK6A 2ZAMA 3UWOA 4II7A 1E69A 4LHXA 4YMVA 2WWHA 5CDFE 1AZTA 4Q9HA 3VAAA 1FPMA 1OHHA 3DZDA 5HZHA 1NVVQ 2ZANA 4AG5A 3C5CA 3U7EB 4HUTA 1XMIA 3CF0A 2QAGC 1GDDA 2SHKA 4TTQA 5KSYA 3EPJA 3OZXA 4LJ9A 1RJ9B 5JI2E 1YZTA 1NF3A 4IDHA 3VR2A 1D2NA 4RD1A 1G8HA 3MWKA 2J5XA 4URYR 3ADBA 2MSEB 2BM1A 1Z28A 4LX0A 4E5UA 3QKSB 3QKUA 1FL9A 3RS4A 3W90A 1N5KA 1G4UR 1GKIA 2VSXA 3SE0A 4G0NA 2FMXA 1E9RA 1A2KC 3C41J 1E9DA 1KJWA 2JLVA 1KNQA 3AKYA 4W7SA 1U9IC 2FG5A 2ZEJA 4HDQB 2GCNA 2REOA 2ZR7A 4DCUA 4KSBA 3TAHA 4DKXA 5E3HA 4WXPA 4K81B 4BFVA 1G20E 4QG7A 3FYHA 1JR3E 3I73A 4MGYR 1GTVA 3X1YA 4ZCIA 3RHFA 4PQRA 4BFXA 3SJZA 4YONB 5IF9A 1KO5A 4PHFA 3BH0A 4MYUA 4TYYA 1Z6AA 4NZYA 1E0KA 1X8JA 2P65A 2QUZA 3W5IA 3C4JA 3RS3A 1Z0DA 4JT4A 1SKYE 1JXMA 3UIEA 1EK0A 3DMDA 1EGAA 2QNRA 4IXMA 4D6PA 3L0PA 5JEDA 4RFSA 3ZZ0A 4OI0A 4Q4HB 5AUQA 1KO1A 3L8YA 1P9WA 3U7HB 4JVLA 1OFIA 5FOUA 4EKDA 2AX4A 3I72A 1NLFA 2BEJA 4N1AA 4B3DA 5HKKD 4FXPA 5CK4A 1E96A 3BB3A 4YXWD 1CRPA 2JDIA 4Q66C 2WWFA 5C4GB 1E3MA 1IY2A 1ZM4A 1W36B 3FKSA 3A58B 2FZ4A 2GTPA 1KK0A 3CRVA 2NTYC 4TYNA 4ZCLA 5TY0A 1H8HA 2Q3MA 2BJVA 5D3QA 2OUKA 4KFSA 2G1JA 2IYZA 5CYPA 1XTIA 1FNNA 2NGRA 4BZPA 4PC6A 2Z43A 4FCTA 3REGA 2D74A 3GEIA 1BYUA 4UNQA 5G40A 3B82A 3W5JA 3ICQB 4LC0A 2Z4RA 4P33A 2ZIAA 3IIJA 4QBHA 1DELA 2RH5A 3GFOA 1O3YA 3T1TA 2X77A 1KI9A 3KFXA 1KAGA 2FSFA 1PJRA 1BS1A 2PH1A 4L16A 5DNYB 3HJNA 3PENA 3TJZA 1P6XA 2DYKA 4KU4A 1OXTA 4D25A 2QP9X 2G3YA 1AJEA 2R62A 2V54A 4TMVA 2ZI9A 4Q4AA 1XFAA 3OAAD 2IS4A 3LQQA 4EFMA 2VP6A 3NKVA 4EPRA 2F43B 3WNCA 4ITRC 5M04A 2RB4A 1K6MA 3SFZA 1UBCA 4LJ7A 2IYYA 2YC2C 3BB1A 3KX2A 1K8RA 3RSOA 3M0EA 3VX4A 3MG9A 5IHPA 3N2IA 1HE1C 3RC3A 4KLZA 3SS8A 3C15C 3KQLA 4LSGA 1IN6A 4TTRA 3MFYA 3SBDA 3T5GA 2ZUBA 2VTKA 1FQKA 2QM7A 1AGRA 2QROA 2AK3A 2JLZA 2GXAA 4FI3C 2R6GA 1DEKA 3KXIA 4TMWA 2PT5A 5BN3A 3GEHA 4UNSA 5GJBA 1EFTA 1OH5A 3KKNA 2F1JA 3VR6A 2QEQA 3ZVLA 2FWRA 2R2AA 3FOZA 4DCNA 3ZZUA 3P27A 4QGFA 1CJTC 1SVSA 2KBFA 5H68A 1CJMA 1QHIA 2ZSAA 3B13B 2BMEA 2WJGA 3QEOA 4DB4A 1OB2A 4BFYA 1G16A 2RGGA 3Q7QA 3Q8XB 4RY2A 4DDUA 2UZIR 521PA 3EXAA 1TU4A 2GXQA 5EQTA 4CF7A 3K53A 2YINC 1N6NA 1ZVQA 1LW7A 5JEEA 4Z51A 3PIRA 4TYWA 2OCPA 1XTKA 4JSTA 1KO4A 4B32A 2ZRIA 2HCJB 5FOTA 5H8WA 2CNWD 3CRMA 3I62A 2LWIA 2XB4A 1U8ZA 1MABA 1FX0A 4JKIA 2WKRA 3B85A 3DOFA 4LRWA 3B6EA 1A4RA 2ZSDA 2W6JA 2GZHA 2NO6A 3SZRA 3GJ3A 3MUFA 4ERNA 4OQFA 1WRBA 1ZC3A 2Z5FA 1KKMA 5JRZA 3SU8A 2DBYA 4G01B 4M4SA 3EIEA 3U60B 2KSQA 4QJ5A 1ZNWA 3U7GA 1FW6A 3KUCA 4HUQA 4KVGA 1LS6A 2IK8A 2P3SA 4I1OA 3W3ZB 3K0SA 1X6VA 1N6KA 1HQCA 1WMSA 3O8RA 3L0OA 1NMZA 3NH6A 2NIPA 5CLQA 2A5GA 4LJAA 2RMKA 1OV4A 2Z0MA 4UXJA 5A4JA 1NRJB 1E1RD 1P5ZB 1Q20A 3WBKA 2B8WA 4QKQA 4AKHA 1T5IA 2ZI5A 3AH8A 1JJVA 4A0FA 3TNFA 1O87A 1G7RA 2ZJ8A 3CF6R 1B0UA 4Y0AA 3T35A 1S1MA 3RS0A 2ANBA 4M21A 4EAQA 3B9PA 1ZUHA 1CEEA 5TARA 1XWIA 3OF5A 4XD7D 3FVQA 1NJFA 2KWIA 4X8HA 4ZIRB 3CRRA 4EIWA 3E5HA 4AKIA 1D9XA 2IF2A 4TL7A 3ZH9B 4JLNA 4BWYA 2IYWA 2QAJA 5DI3B 2CNWA 2PZEA 1E9FA 2PCLA 4GZMA 4C0KA 1HYQA 1Q0UA 3F5FA 4LC1A 2IS2A 2IWRA 5BN5A 1RZ3A 1RRFA 4QHSA 3TGPA 3EPKA 3AVPA 2QA5A 5BYKA 1DAHA 4QJ4A 1M7GA 3Q9LA 2ASEA 3BWDD 4G5RA 4QGAA 3VU9B 3ZVRA 4BPBA 4JBXA 1B23P 1N6PA 1GKYA 2WJYA 5L3VA 3SDZA 3SJAA 5KSOA 3PUYA 1WA5A 3OEHD 1W2HA 1XP8A 3IEUA 1VG9B 2GEDA 4H9GA 2ZRMA 1Q1EA 2ZI4A 5KHOC 5GJVC 2FF7A 3TMKA 2J87A 3UANA 3CLVA 4AY2A 2MMGA 4NYIQ 3ADDA 4BRWA 4QM6A 4DUGD 4QRHA 1E1RA 4PPNA 2O8DB 4CIDA 2I1VB 1E2PA 2H17A 2HUPA 3WYGA 1IN7A 1LV7A 3LY5A 2QRNA 4KFTA 3TBKA 2R6DA 3AM1A 3UMFA 1IY0A 5FTLA 4N0EA 1L8QA 4TN1A 5CJPA 3L82B 2OM2A 2H18A 1JJ7A 4XD7A 1M34E 1DE0A 4JL6A 4ABYA 1E9EA 4QGHA 3K0FA 1UDWA 4AYTA 1E2FA 4I1SA 1GKUB 5HCIA 3A1SA 2ZRNA 1FTSA 2C8VA 4M1KA 6Q21A 1Z06A 1T0JB 1OXXK 2BMDA 3CH4B 2F3RA 1SVKA 1XJCA 5AJXA 2JCSA 5AK0A 4AYXA 1HURA 2HDNB 3WNDA 4C9BA 3GLIB 1Q12A 1MKYA 3QQ5A 1N0VC 2AXNA 1H8ED 3IHWA 4NPHA 4WZAE 1D5CA 1X8KA 4DRZA 4Q48A 3K9HA 1G8GA 2UVQA 1P2TA 2Q3FA 1ZCAA 2YHSA 5TXGA 1EFRD 1E0AA 4OL0A 1JECA 2ZRFA 4F91B 1DVRA 3X2SA 4KITB 4JBWA 2GVDC 4X8OA 5TVKA 5KDOA 2C9OA 3LQRA 3ZD6A 1FOEB 2F1IA 2WJHA 4HAWA 1XJQA 1CJUC 5FBLB 2ZR0A 4Z8XA 2DFKB 4UNRA 5L3QA 4DUGA 1R0XA 1DAMA 4G5QA 4GZLA 5KO2A 5FPKA 3DEFA 4QBIA 2JIZD 4XVQA 1E2QA 3TRFA 3ZYCA 5HE8A 4R2IA 4NYMR 2AFHE 2I1QA 3B1YA 3UPUA 3U4QA 2ZE7A 3WHLA 4RD0A 3MCAA 3B1WA 3BORA 4LPSA 4I1VA 2J0UA 3FE2A 4Q4JA 2ZI7A 4ZO4A 4XWOA 2GAAA 2REXB 2Q9BA 1BYIA 4Q47A 5JSZA 1GFIA 4A0GA 1CR1A 2ZYUX 2ZM5A 3WY9A 1HT2E 1SXJB 2VO1A 5LDDC 1BO6A 1DAKA 4LJ4A 3B1ZA 5FFMA 1DAEA 4Q1FA 2JJ2A 1GITA 4M1YA 4ZI3A 1H8EA 4RKEA 1PVOA 1UEIA 4V0MA 2FJUA 3BBPA 4PAMA 4A8JC 4NH0A 3NXSA 3PUZA 1G8FA 1MO4A 2BV3A 1H65A 1G7CA 2WAYA 2DWQA 1GILA 1OFUX 3G5UA 4AIIA 5EP1A 3T1OA 5FH9A 2D2EA 2VSFA 1KJZA 1XEXA 2ERYA 3GCGA 2ZPTX 4CGZA 3ZS9A 2WOOA 1Z0JA 1OJLA 3H86A 2QPOA 421PA 2ONKA 4OYHA 1NIPA 1W4RA 1G1MA 4JBYA 4O2RA 1CR2A 3C8UA 3NIBA 1KSHA 5EP4A 1BIFA 4M22A 2D06A 1E94E 3DPUA 3ZD7A 1AQUA 3LX5A 4TLCA 3NBFA 1F2UB 3EX7C 3NC0C 2EFEB 2MSCB 1L7VC 4BRUA 1YR7A 3AUXA 2CDNA 2P67A 3LA6A 4LJ5A 1TUIA 4A6PA 5FTNA 5BN4A 1KZGB 2TMKA 1N5LA 4D2IA 2ZS9A 1XXHA 3BXZA 5JLJA 4AURA 4LJYA 4QL3A 1F2TA 2VHCA 4UJ5A 4Q1DA 3WMFA 3FWYA 4A0HA 2OFOA 2H57A 1R0WA 3MRSA 4HEJA 1ZINA 1XNJA 4P3YA 2QPTA 1E2LA 2G0NA 4ZKEA 5TB5A 1ZP6A 3P32A 3CZPA 2QE7A 4B76A 1Z5ZA 2RGNC 4IJMA 3RWOA 5CITA 4S2EA 4FCVA 4M8NE 2OLKA 2J7PA 2P5SA 1GAJA 2IXGA 1M8PA 3PVSA 1OXVA 1Q1QA 3AVYA 4ESHA 2FSGA 4NCNA 4HAZA 2EFCB 2WWGA 2NZJA 5FTMA 3V9PA 2J0SA 1E6CA 5E4FA 2R65A 4FD2A 2F1RA 4LV6A 3THYB 4MYTA 1JR3A 4IRUB 1SHKA 2ORIA 4MH0R 5GVSA 4M1MA 4Q01A 2NPIA 2CJWA 1LS1A 3E1SA 1LF0A 1LTQA 1QHGA 3TQFA 5KNDA 1NY6A 1P7CA 1XU4A 1E79A 3LBNA 3QXSA 4LJ8A 1Z08A 4A2QA 3P26A 4BLTA 5H1YA 3RWMB 3GLIE 3IDQA 1GG2A 1P2SA 3QNUA 4TLDA 4AK9A 1SVIA 1YR9A 4HAVA 5FPHA 1VG0B 2WOJA 1NVVR 5KSPA 3I5YA 4KJZA 3THWA 2YNMA 2LKDA 3BAFA 1RYHA 2AD1A 2NO1A 2ZS8A 4LHWA 1II8A 1NVXQ 4CT5A 1BH2A 1NVUQ 4NYMQ 2XGJA 4UXIA 1S9HA 1ESNA 5KU1A 1U2RA 4Q21A 2W6IA 1X3SA 1NBMD 1EXMA 4F93B 2GBLA 2R6AA 4TT3D 3W6NA 3BOSA 3ASZA 2O52A 3CX6A 3R9IA 4C2UA 4D0GA 1IQPA 2FU5C 2LCFA 3KUDA 2I3BA 4EQ6A 2ZROA 1YR8A 3PEVA 1N6IA 2JLYA 3O8DA 4TL6A 1U8AA 3AGPA 4TSFD 2JJ1D 1NLZA 2XB2A 4YLGA 1HTWA 4XVRA 3TQCA 4V0KA 3B5JA 3GJ8A 4JYBA 5B30A 1VECA 4DSNA 4BFSA 1SXJE 5DGXA 4JKYA 3RRMA 4MA4A 3DL0A 1XEWX 3U44A 2ZSEA 2X2FA 4AKGA 4BFUA 3W8NA 3K8YA 5BWMA 4B2PA 3H2YA 4V0OA 3BFVA 1Z63A 5KPJA 3VNUA 4QHYA 2VHJA 4F7WA 5LPNA 2WWXA 1RRCA 3AQ4A 4LWZA 5EXPA 2OXCA 3UMSA 3BC1A 3VQTA 2OCAA 1W49A 1S96A 3TIFA 1AS0A 4G5OA 4H1UA 1UPTA 1W48A 4DWJA 1S3GA 2A7QA 5B57C 2O8CB 4W5JA 1P62B 2ZJ2A 2Y8EA 3DM9B 3TE6A 2B92A 3EC2A 2DFLA 1ZUIA 2YZ2A 3EPLA 1E1QD 2DFNA 2BOVA 4MRNA 3TH5A 3U3KA 3VR1A 4K46A 4R2HA 2X1VA 1NBMA 1DAGA 3QIAA 4Q7KA 2EU8A 4QFMA 1KOFA 4HZUA 4TT3A 4HLUA 3Q5EA 3GLGB 4EFLA 3EC1A 3G0HA 4BLOA 3QPWA 1Q21A 1FUUA 3LFUA 2ZXUA 2HEIA 3NBXX 3SI7A 1W0JD 5EE5B 4DT1A 2Q9CA 1QHSA 1K5GA 4HAXA 3LRPA 1QG2A 2WJVA 4UXHA 1KSFX 1OIXA 3BH6A 2HV8A 3GLFB 2FZLA 4EJSB 5CM9C 1NSTA 5EE1A 1EG7A 2EW1A 4LGMA 4PANA 5G53C 3T06B 1G21E 1QHYA 2R6CA 1N2CE 5KSZA 2YKGA 4TSFA 2JJ1A 1ZU5A 2BKEA 4JVSB 1Z47A 4JYCA 1ZM7A 3SC3A 5JJIA 3KFVA 1II9A 1NN0A 2ZRLA 1Z6TA 2CLDX 2QP3A 3LW8A 3QSYA 2XOKD 1WQ1R 2FN4A 3QKSA 3FMPB 2IHYA 1T8TA 3GEEA 4KFUA 4OHZA 2BBTA 3WHKA 4Q7JB 1E0JA 2FV8A 5LB4A 4A0RA 2AWNA 4B2LA 3BIFA 2R9VA 1SKQA 2KJQA 4D4MA 1PLLA 4GPTA 5JCZA 3HYTA 3PV0A 1MRSA 1CBUA 2HJVA 4A82A 1HH4A 2ZVPX 1IBRA 3IPYA 3X1DA 4EUNA 3WP1B 1KDPA 3ADCA 5GADl 2A5FA 4OKSA 2A3RA 1ANKA 4B6EA 4WW0A 5K8LA 4FW9A 5A0FA 2FSIA 5C18A 1T3SA 4LOAA 1ETUA 4Q1CA 4B74A 3ZVMA 4KCGA 2OEPA 4NL4H 1E1QA 4P4SA 3K70B 2B8TA 3OFND 3T12A 4XJXA 2HF9A 1QHHB 4FWTA 2JDID 3QF7A 4WZ6A 2PX0A 2ZSBA 3CUEF 1VHLA 4G5SA 1NKSA 2C95A 1DOAA 1Z0AA 2WSSA 3FKSD 2RGXA 2RKOA 1VCMA 3HR8A 4M9QA 3A36A 3AVUA 4TTPA 5FUXA 3OEEA 1G6HA 1W0JA 4LYAA 1J90A 1H8HD 3PCRB 4C30A 3PEWA 4Q4HA 4F4CA 4LYJA 2NO7A 121PA 1W2GA 1A2BA 2ODNA 3OE7A 4PQYA 5AR1A 2VH5R 3VTKA 4URXR 1OYYA 2BIFA 4MKFA 1XX6A 4U02A 2GCOA 2W00A 2XNSA 5KOYA 1KYIA 721PA 3SOPA 4NBSA 1E4VA 4M1OA 2XSZA 2V4ZA 1U0HC 2QGZA 1RYFA 2N42A 4MITA 1AGPA 3MWLA 2XOKA 2ZRHA 3FMOB 5AJVB 4JLAA 5L3SB 4C7OB 4A4DA 3AKEA 1OIVA 2H7VA 4BLRA 3BRWD 2B6HA 3JZMA 3D7MA 3K1JA 3EA5A 1XMVA 3P1JA 1EFCA 1LY1A 4L5BA 3O8CA 4YC7A 4NU0A 3U61B 4QJ3A 3AGQA 2ONJA 5SZIA 3UG6A 4FWIB 1NI3A 4ZI2A 1QDEA 4TL8A 2BBWA 2OE2A 3LLMA 1MRNA 1W5SA 1MT0A 5K8UA 4AD8A 2CK3D 4XWAA 4OI4A 1M1YE 3OFNA 4URZR 2VL7A 3KKOA 4IOKA 4OJKA 4M9SA 4F4JA 4GMDA 5HTKA 3ZIAA 3DKPA 4ESVA 3CR8A 3IKJA 1TEXA 3KKQA 2F43A 5IRCD 4DSOA 3TUZC 2XXAB 3OIWA 4GL2A 1ZM9A 4TMTA 4YDSA 4IDQA 3AVOA 1XJ0A 2XJ4A 2V6IA 3ZS8A 5DYGA 3GJ7A 3MAAC 4A8JA 2QP4A 2R8RA 3PITA 1UKYA 3DHWC 4RZXA 2FFQA 2W58A 1I4LD 2C04A 2ATVA 1C1YA 1GNPA 4HDOB 4PZZA 3ZDQA 3A4NA 1XPOA 3T34A 3GLGE 2EYQA 3THXB 2OBNA 2IT1A 2D62A 4N3NA 3C14C 2UKDA 2VRWA 2IYXA 3WBJA 1E2DA 4GBMA 1AS2A 3QUSA 1ZM3A 3KDSE 4LUCA 1UBGA 3GLFE 2C9CA 3EW9A 3I4LA 3SBEA 1OF1A 3C5HA 3UXMA 1T5LA 3JZAA 4RZUA 4W9MC 1E2EA 1QBKC 1YJ5A 4HB3A 2W6JD 4G3XA 4IVPA 3AUYA 1T9HA 4KV9A 4XIGS 4A36A 4RFSB 5JMTA 2IS1A 1FMJA 3ASYA 4PXAA 4Q18A 1MOZA 1QVAA 2CK3A 4N0DA 4B73A 4I81A 5DIFA 1F60A 1W5TA 1CP2A 4YMTA 2PJZA 1F6BA 3QE0A 4LY6A 4BFZA 4CDGA 2FEMA 2GJ8A 1LVGA 2O8FB 2J7KA 4MGIR 2BEKA 4A6XA 5A5GA 3QXCA 2C78A 5GVRA 3GJ4A 4A2PA 2D4HA 1Z2AA 4NYIR 2RGNA 4WA7A 2IL1A 3HYRA 4OQNA 3TSOA 3CX7A 4YDHB 1J8MF 4ACAA 1KDOA 1M74A 4BASA 3MGCA 4R9UC 1F3OA 1RFLA 1OPXA 2IXFA 2IYQA 5K8TA 4CEIA 3HPRA 3AF0A 4FMCB 4KODA 1HUQA 1T91A 1S1CA 1US8B 1G3MA 1XPRA 1NN3A 3MMPA 4WIAA 3R8CA 3EIHA 5B64A 5ANRB 1M6NA 3O47A 4W5WA 4PSVA 3GPLA 1NKTA 4NE2A 4R71A 2QENA 3R8FA 4EPWA 4DEYA 1NSFA 3Q3JB 3CB4A 2F55A 1QRAA 2FPLA 2QTHA 4PC7A 1G3QA 5JCPA 5JS7A 4ZV4A 4P4UA 4A2WA 1XBTA 3W6OA 5K8IA 1XD2A 3SQXA 2GBLC 3CWQA 4C0BA 4FMDF 4NONA 5J4LA 2C98A 3BH7A 4HLQB 1U81A 1XTQA 3AVVA 4D82A 4TMXA 5EP2A 1R6BX 1S0UA 2AR7A 3QKRB 2HF8A 3VR4A 1WP9A 4M9XA 3GJXC 3U3JA 3BB4A 1E9BA 1Z2CA 3CR7A 4B47A 4MGKR 3CWZA 1ZBDA 2PL3A 3A4LA 1UF9A 4GSYA 4V0LA 4ZIRA 1YRBA 4MKGA 1OB5A 2GNOA 4BGDA 3RRYA 2YWFA 3QENA 4ZDIA 2ODBA 2Q9AA 3R7WB 3JVUA 2CHQA 5BYJA 1M7BA 3JVVA 2RGBA 1IN5A 4B43A 2CVHA 2W2TA 2WAXA 2J0VA 2HYDA 3TW4A 3W8RA 1W1WA 1RPZA 4XOIA 2AXPA 2P5TB 2GILA 4CEHB 1DG3A 1JR6A 1JEDA 4RSGA 1WCV1 2BMJA 2FX3A 1DBSA 3IEVA 4QNRA 3THOA 5F9FA 3CW2A 3NVAA 1Q1BA 3VKWA 5L3RA 2N1BA 3ZJYA 1AZSC 3A4MA 4MRSA 4KSCA 1F48A 2PZFA 3I3SR 3UMRA 2GZAA 1MR3F 1UKZA 5FOSA 3RRZA 2H16A 2XX3A 2YOGA 4LV5B 1WE2A 2A5JA 2FNAA 1XD8A 2EWVA 4GOKA 4HZIA 3EZ7A 2DWPA 3KJIA 1Z6YA 1J8YF 2FGJA 3NDPA 4HLUC 4DZZA 1CKEA 4A92A 3MJHA 3PXGA 4YQFA 4MRPA 1JPNA 4Y0VA 3N70A 3NDBB 4KAXA 1XMJA 1KY3A 2PMDA 2FPKA 1MABB 1FX0B 4Q1EA 4B3XA 2PX3A 1ZYUA 3D6TB 1I4DD 4Q5IA 4KLNA 4OQLA 4KHZA 4HB0A 3KQNA 2VA8A 1U99A 5FBVB 4GRAA 4P31A 4DLZA 5DHAA 3QF4A 1NG9A 1OSNA 5SZHB 1ZCBA 4RD4A 5LD2B 2XZPA 3AVXA 3Q5DA 3ZZTA 1OKKD 1UKEA 1S9DA 2H5EA 4JLKA 1NMYA 1U94A 2FEOA 1OYWA 5E7IA 1IM2A 2RGDA 4B71A 2P2LA 3BJIC 3NEJA 4C2TA 3H84A 1YZGA 1TEVA 2GESA 5FR1A 5FOVA 1XTJA 4I99A 1IJFA 2VP5A 4PHGA 5JBQA 2A9KA 3EARA 3K9NA 2GK6A 2WKQA 4QBFA 1D9ZA 1Q22A 2VQSA 4MYHA 3MWYW 2GJ9A 4ILEA 1V5WA 1OLOA 4AKEA 1G8YA 4Q7LA 2FE4A 4C0HA 3QXXA 3VHLB 3TR5A 1JB1A 1OFTA 2HJGA 3G82C 3M6AA 1C9KA 4GOXA 1D8TA 3U7FB 2CL7X 2WM9B 3LVQE 1NVWQ 4DLUA 2BCJQ 2Q21A 1BMFA 2JJ2D 2YVUA 3LBIA 2QMEA 3NWJA 1JPJA 2ZS7A 3U6KA 3B8HA 4B33A 3KQUA 2C77A 2CEAA 4RCYA 2CL0X 3SHFA 4OQMA 1TQ2A 3BERA 4U00A 1W36C 2HT1A 2CLCX 1R2QA 1QHXA 1SXJA 5J5CA 1PLKA 3MWJA 1XEFA 2KB0A 5CJ2A 4A1FA 3U5ZB 1HY3A 1SVOA 3GQBA 5DI9A 4BEJA 1Z0KA 5KPDA 1OKKA 4JLOA 1P73A 3LNCA 4UNPA 1TL7C 5KTYA 3TSWA 5C46F 2E87A 4KYIB 2VHTA 1FQJA 1WXQA 4KFRA 4UKDA 2F9MA 1RE0A 1ONBA 3I61A 1XDBA 2O8BA 2QZ4A 1XRJA 4TZ0A 1TF7A 3GD7A 2C96A 3KKPA 3I92A 5EXTA 4D0NA 4GP7A 2JATA 2ZRKA 4BLPA 4Q9IA 1W4CA 4URVR 1DO0A 3QY0A 3CPHA 3LD9A 5FTKA 5HE9A 4Z8YA 2QBYA 1F2UA 4CYMA 4XSHA 3MLEA 3K0FB 4Q1BA 1EWRA 2JLQA 4AC9A 3R20A 4MRRA 2QE7D 1I2MA 1T0HB 2O8EA 3EZ9A 5TV2A 1HEIA 2GEVA 3ZQ6A 4TQAA 3EAQA 5JWOA 2D7CA 3TW8B 1W44A 3SYNA 1AS3A 2J7PD 3PFIA 3WXMA 4EFNA 4P32A 3PEUA 1AIPA 1FMLA 3WYAA 4LBWA 5GJCA 3KJHA 2QMHA 4PAOA 4ON9A 4AWXA 3L43A 1DO2A 3EWAA 1JAHA 3EZ2A 4PSKA 2OHFA 2GCPA 4P0TA 1AA9A 3QKTA 4W5HA 1JR3D 3B2EA 5EE9A 4BEBA 4DLYA 5E7JA 1ZJ6A 5EUMA 2W83A 2QAGB 3MSXA 2BWJA 4GNKA 5TMPA 4ZPXA 2GEUA 1TAGA 1E79D 4PAQA 5FR2A 5DN6A 2H92A 3T1VA 1R10A 1NL3A 3S1AA 2QPAA 5CDFA 4M0LA 3B1VA 4M9ZA 5L3QB 4LI0A 2A5YB 4CW7A 5BW8A 3AB3A 5EZ5A 3IILA 2A78A 4ARZA 1Z83A 2XTNA 4PPFA 1TQ4A 4PZYA 3SJBA 2EFGA 3U4QB 3B60A 3TK1A 4XWKA 2YOFA 4LDJA 1AM4D 3AKCA 2IEYA 3DKVA 4M1WA 4Q4JB 5FL3A 2W6ID 3A1VA 1EFUA 4TMKA 1FP7A 1RW4A 2EWWA 2FPMA 5JSZB 1YZQA 2OILA 2J3EA 4IDPA 2YOHA 1GSIA 1GZSA 3K9GA 2DR3A 4CEJB 3A8TA 4RD6A 2ZR9A 4WXRA 1IXRC 4JLBA 2H8KA 2ATXA 3K09C 2V7QD 3TUJC 4B2IA 3RYTC 4URUR 2ZETA 3A1WA 1JEEA 4F38A 3IBGA 3RS2A 1FUKA 1U8YA 4XTRA 4D26A 3UKDA 2DB3A 1ZNYA 1XMSA 1Q3TA 3HP1A 1BKDR 1XEXB 1VHTA 1XTRA 3DMNA 1TQDA 1KDTA 1TMKA 3KJGA 5FTJA 3T5DA 4B75A 4CVNA 2CL6X 4DIEA 5J4VA 1WBBA 1E2NA 5CM8B 2ZUDA 2WMOB 1S3SA 3AEZA 2WWWA 2ZJAA 3HU1A 5B2ZA 2IA5A 3KJEA 3RVBA 1TTTA 2JEOA 4NYJR 1G5TA 1YZNA 3SFVA 3RNLA 2MSDB 1ZM2A 2PT7A 2VP9A 3KTAB 3CBQA 4PC1A 3EPHA 1CRQA 2ZAOA 1KK3A 2XTZA 1E2HA 3IIKA 2WJJA 4OHXA 5C1BA 1EESA 2D2FA 2XITA 4FCWA 2FDCA 3VMFA 1XXHB 2QT1A 1CLUA 3T61A 2GKSA 3DVLA 3IBYA 4TMZA 4LBYA 1F2TB 5FBRB 3QVVA 2EFHB 4US0R 3L8ZA 1COWA 1G3RA 1T6NA 4TYPA 4B3FX 5B58C 5JZVA 4HYYA 1XCGB 1QZXA 1ZAKA 3SEAA 2IEZA 2CCGA 4MUBA 1MO3A 1MH1A 2CE7A 5F9HA 1KI3A 2C2HA 1S2MA 1SZPA 3NG1A 5FBQB 1R5BA 3I32A 1AKEA 2J59A 4HLDA 3K0AB 1TNDA 4IVRA 2ZJYA 3ND8A 4C0LA 4EPYA 4RZ3A 2G6BA 3LO5A 4POAA 3RC8A 3DOEA 2V7QA 3PUXA 2G83A 3CPEA 1OH8A 3VNVA 2V55B 4DCVA 2XNDD 1N0UA 1ZD1A 4C0QC 3FMFA 2NQ2C 4ZDJA 2ZITA 2KI5A 3CNNA 4KO8A 3FGNA 2C9YA 1XB2A 4MUAA 4NDZA 3LWNA 1EFHA 1GRQA 3KB1A 3GLGA 2F3TA 2OBLA 2QG6A 2QTVB 4RD3A 3W9YA 1G41A 1VYTA 3IO3A 4V0NA 4JJZA 3X1WA 1T3HA 1FZQA 4IDNA 4AI6A 2UZ3A 3NTUA 1R0YA 5CLLA 3EZFA 2F7SA 3TVDA 3IGFA 3SN6A 1PZNA 3GLFA 4EJSA 1E4YA 3U3OA 2B7CA 1ZUNB 1NN1A 1YZKA 3V00A 1VYUA 4NKRA 1Q1ZA 2CHGA 3NEYA 3PUWA 1CU1A 2V8OA 3P20A 2I4IA 2IYLD 4HB2A 3WMEA 1G5RA 1KTVA 3THWB 1Z07A 1E2KA 4IDOA 4BZXA 2LKCA 1E9SA 1MO6A 1E99A 3LXXA 2K5UA 5FOWA 3ZLJA 1JAIA 4DDVA 2FSHA 4NCJA 1CJKC 4I1UA 3BS4A 3FFAA 3Q85A 3AVWA 2WSSD 3W3AA 1XEWY 1KI8A 1YHNA 3AP2A 3OEED 1QF9A 4FMDB 3ICEA 3QG5A 3QXHA 3D8BA 3RRNA 1N0WA 2GWHA 2QI9C 3FHTA 1UBFA 3HDTA 3OE7D 4MDFA 3W34A 2OV2A 2XNDA 2R6FA 1RKBA 1L4YA 2E1RA 4LHZA 1UFQA 1RJ9A 4MDEA 3HR7A 1SVWA 1W36D 2C99A 2XSZD 1VTKA 3RSLA 4Z54A 3A1UA 2CVFA 3BK7A 3A6PC 2ZYWX 3FTQA 2GETA 1C4OA 2O0HA 4Q9KA 4F92B 2JLUA 1W46A 3F3YA 4HB4A 1NJGA 4YMWA 5HCNA 3NH9A 2F6RA 4HAUA 4PR0A 3U44B 2VEDA 5JJLA 2JGNA 2V6JA 3CM0A 4HI0E 2VHUA 4HAYA 1U0JA 4Q7MB 2VF7A 1KMHB 5EUQB 3U3MA 1CR4A 4JVMA 1VPLA 2IYSA 5G3YA 1TUEA 4JS0A 4A9AA 5KDLA 1LB1B 4Z1MD 4NYJQ 4OHYA 4BECA 1L2TA 4CZ2A 5L3SA 1YR6A 1FTNA 3IQWA 4JLMA 5KYKA 3EWSA 4TWZA 4B35A 4DLVA 4D4JA 2QSZA 2JASA 4JMPA 3GFPA 1SXJC 5F3WB 3GP8A 5D3MB 4DBLC 2EFDB 5EZ6B 2EYUA 4MRVA 1JALA 4EDHA 8OHMA 5EXSA 2IUUA 3AF3A 4IOLA 5JECA 3ZIAD 1KK1A 2J45A 3B9QA 2V3CC 2RGCA 4HZUB 3RANA 5DSZA 5E95A 3P4XA 1GVNB 1D6JA 1UEJA 3L0SA 2Z83A 2W2VA 4DT1B 1N6RA 4BFTA 2ZREA 2GF9A 1VCOA 1Q3HA 3AKDA 1KI6B 5E7MA 1XXHE 1Z6GA 5CIWA 2IF0A 2VF8A 3C7KA 3Q7PA 1SULA 2W0MA 4CRWB 2IYTA 1A1VA 4EPVA 2JLWA 2O0JA 3U6BA 1AN0A 3TVTA 3F0TA 1S4QA 2BMFA 1SQ5A 4PSAA 2IYRA 3GLHB 5IK2A 4WZBE 2ZRCA 2XXAA 3H1TA 2FFAA 3I8SA 5JWRA 2ZU0C 2IWHA 1WBDA 2PBRA 3T15A 4ASUD 1EX6A 4JLPA 4DIDA 2ORWA 1JNYA 2ODEA 1E9AA 5DE3A 2ZJ5A 1JXOA 1OE0A 4BE7B 2HYIC 1HT1E 1KKLA 4BUJA 4IOJA 4Z1MA 3GJ0A 3X1XA 1ZD8A 5JFGA 1KSJA 4ZKDA 1ZU4A 4TLEA 4GMXA 3WNBA 2QU8A 1DAIA 2NO0A 3THXA 1DG1G 1P9NA 1NIJA 1ZIPA 2QTFA 1G3UA 1VKJA 4JIMA 1K5DA 2BM0A 4URWR 2XZLA 2BJWA 4P4SB 3LVRE 3WYFA 1EWQA 3ADKA 2OT3B 5J40A 1W0KA 1XCMA 4H1VA 1PLJA 1VG8A 2WJIA 5JRJA 1ZMXA 3TUIC 2KBEA 3CPJB 4NMMA 2ZJOA 5FPSA 3QVUA 5FUVA 1G19A 4Q03A 2RGAA 2VP4A 2FH5B 2O8FA 2GCOB 4IOMA 4NCHA 3UG7A 3RLFA 3D31A 2XZOA 2XJ9A 4DLTA 2E9SA 3ZVNA 2QSYA 4G5GA 5ELXA 4DXAA 3TR0A 4WBSA 1GRNA 4X8LA 5AUNB 1KY2A 4KVAA 2V9PA 3QBTA 1OIWA 4GT1A 1CS4C 1IHUA 2AL7A 3NBYC 1US8A 4ASUA 4EPXA 2KE5A 4D81A 2CHVA 2AN9A 1I2DA 1J7KA 1M7HA 1X1SA 2GA8A 4NCKA 3EG5A 2HCBA 1DPFA 2IYVA 1UAAA 3L0IB 1DAFA 1I4TD 4OQXA 3MD0A 3SNHA 2QQEA 4LCBA 3LV8A 4YMUA 4FIDA 3R9XA 1OW3B 2IC5A 3BD9A 1W7AA 1ELOA 3PUVA 3TLXA 1XCPA 1N25A 2A5DA 2PEZA 3NC1C 4CT4B 3OIVA 4S35A 4PC2A 3ZGXA 3Q72A 4JLDA 1GNRA 2VP2A 3QKRA 4QXAA 1FNMA 4QM7A 2X8AA 2G88A 1JQLB 5FUYA 3KXLA 4DCSA 1NG1A 3I5XA 4M53A 5JJKA 2AKYA 1AKYA 1NMXA 4IW3B 1OT3A 3A1TA 1RIFA 3K09A 3N2EA 4DSUA 2ZE5A 3QBVA 3AVTA 3CONA 4ZCMA 2OFXA 5HKKA 3R7WA 1VCIA 4YXWA 4A8JB 1W4AA 5FOXA 2WIAA 4Q4LA 5TDHA 5AJYA 1Y3AA 2OESA 2FFBA 3GJ6A 5EP3A 4JLJA 3IPXA 1VG1A 4D4KA 4CEHA 1NBME 4PO1A 1OFHA 1VIAA 5CK5A 1Y63A 2ZE8A 2G1KA 2A30A 1GNQA 1GL9B 3TKLA 2PJRA 2AHOA 5HZKA 1AK2A 5FL7D 2GDJA 1ZNXA 2OBMA 1XPUA 2ZJBA 4L8GA 1A7JA 3QI2A 1LF5A 4XTCS 5DHFA 3OIYA 2IW3A 4UJ3A 4Q4AB 2Q0HA 1QG4A 3QOFA 2BBOA 5EJEA 2RGEA 2IS6A 2QT0A 3N5CA 3P4YA 2AFIE 3L2OB 3FHCB 4G1UC 4D0LB 4LPKA 5H70A 3GLHE 5JWHA 1P61B 2DHRA 3CIOA 1VIYA 2QORA 4B3GA 3IIMA 5DI3A 4DCTA 3IUYA 1J99A 2VBCA 1E9CA 4NTZA 2WVJA 4LV8B 3OAAA 2Z4SA 3X1ZA 1XTSA 1GWNA 1MV5A 4EJSC 3DM5A 4KYUA 1SVLA 1HQYE 2WICA 1LNZA 1XD9A 2YV5A 3U3RA 1KHTA 1KNXA 4P4TA 4DLWA 3BE4A 4CEIB 1OH7A 4TZ6A 3M4YA 3UATA 2X2EA
chains in the Genus database with same CATH superfamily
1LD3A 2NO4A 3EVEA 3EDQA 4Y18A 3FR8A 4EA9A 3S70A 4YO8A 3UGQA 4GX0A 3GL9A 1OFVA 5FPTA 4RL6A 1BXRA 4KXFB 5C4IA 1VIVA 4P3PA 4DPKA 3UK6A 1KAEA 5A0TA 1O9BA 4BZQA 1CUJA 3WWZA 1UPCA 1Y8QA 2WMDA 2BCGY 4UVDA 3QJYA 3WG9A 2FDXA 2YV1A 3DQPA 4UAJA 1U1IA 1UIRA 2O8DA 1E32A 2CUNA 3IP8A 4C2AA 3NI2A 4U7DA 1ECBA 4RVSA 4CKWB 1MXFA 2CUKA 4JJEA 4DABA 3O4FA 2PH3A 3R0VA 1WY7A 1M8FA 1UJ4A 3QVXA 4AX4A 4BVKA 3UC9A 4EM6A 1OV6A 2IZ5A 2G0TA 1GL6A 3QHAA 2XBMA 1B73A 1BMFD 4NV3A 1OH6A 1LFDB 5CVVA 4DVGA 4CETA 3NBQA 3QG1A 1ZOPA 3OSUA 4MPTA 1XZKA 4X1KA 1QO9A 2AWOA 1P2UA 2RHOA 2WIFA 2XUQA 2Y05A 3LL7A 4LGYA 1SOAA 4PC3A 3GMTA 3OX3A 1J8FA 3LQ4A 4L5JA 2O5VA 1CUEA 5AWFC 3KE8A 1LDYA 3LBYA 4N47A 4RD2A 4XDZA 3FNEA 4AG6A 4GR9A 3EAGA 3K0CA 2XB6A 4Z9YA 3VYRB 3LZCA 2DQZA 3GVCA 2NNWB 2M2IA 5JJ5A 3GLIA 4O2LA 1U0NA 2ZBQA 2QLLA 4X1OA 4AY4A 1DU4A 2C5LA 4CLEA 1ZMTA 2ECPA 1NI4A 1P60A 3FPAA 4E22A 4EENA 1BOFA 4F6RB 5ES3A 5LB2A 2P6UA 5H4GA 5FRDA 3G7UA 3JQFA 4K03A 4EYKA 2GAOA 1ODFA 1A9TA 1G0OA 3PGXA 4IXDA 4QFDA 4PPGA 1WB4A 1HE8B 4PPQA 3HJBA 4IIUA 4HJXA 1OASA 2ZGVA 3GZJA 2QRZA 3I1FA 1D1PA 4MWZA 3M3DA 3RAPR 1Z6XA 2IZOA 4DB2A 2ZWVA 1RYZA 3T0FA 2MYTA 1AMNA 3WLTA 3CRNA 2AKAB 2O20A 4AMZA 621PA 2ASVA 3KAKA 4DSTA 2BP7A 2IUTA 5T6MA 2WY2D 1ESMA 3AHCA 2CFIA 5EXXA 3CYFA 3WKEA 3NNDA 5EEHA 4OBEA 2QJRA 1EX7A 5JO9A 3VBEA 3AR9A 2EATA 1NATA 3GEBA 4H16A 2HNBA 1JIVA 1BMTA 5L6MB 4QOSA 4R98A 1E9VA 4XFDA 3VSEA 3ORFA 1JIQA 2YCLA 4ZYXA 4OM8A 4O1HA 1XROA 5THQA 2WTMA 3RHTA 4QT4A 4X71A 1G64A 1UJMA 2GEBA 5B1DA 4Y2TA 2IBTA 3EVGA 1FP6A 5KBYA 1JG4A 1VIDA 2CE2X 1VBMA 1K68A 5CBPB 5EE0A 1E58A 4TTIA 5LXTB 3QPUA 2JA2A 4KN6A 3PR1A 2VIIA 4AUKA 4CM4A 1M8KA 3WMXA 2Y2VA 3AUSA 3K9WA 1AK1A 4FSXA 1E5DA 1Z25A 5KAMA 1H3EA 2B4AA 1XQVA 1C7JA 4XSGA 3OJXA 4MP8A 2CCJA 3D43A 1H5QA 4COKA 2PMKA 2FFHA 3EIFA 3Q10A 3VPXA 3VR4H 1NLUA 1LPAB 1TT5A 4FHCA 3D3QA 4GSLA 5ITWA 3CUYA 3IVAA 3GMSA 2ERXA 5I9LA 1AV7A 4HVCA 2EKZA 5ALQA 3ICOA 1M2KA 2ETXA 2Q1UA 4F60A 3CCCA 4GECA 4K40A 4KUGA 2YJ3A 4HAIA 2ZU6A 2FEWB 3CT4A 4ZI7B 3FJOA 4XVHA 3WB0A 1W5BA 1GTJ1 3NYIA 4M0MA 5I4CA 3EUFA 4NCXA 3OM8A 1QGZA 2IJGX 4MI6A 1EJ0A 1Q57A 4LMRA 1NVTA 2JA1A 2OZEA 1TO1E 1YZVA 3X44A 5LP6A 3RVPA 3G3EA 1HNZB 1XRPA 2P6NA 1F0YA 3BKXA 2ZRPA 3TAXA 2IIBA 1S4MA 1PFWA 3A10A 1VMAA 1G8KA 1X1DA 3IC5A 5CB6A 1DS6A 4JQSA 3LLUA 3H4VA 1FS6A 4H4CA 1F17A 3RTGA 1W8IA 2WF5A 3LUJA 4FYHA 3IBFA 1YBFA 3AB7A 4G4JA 4GVPA 3CX8A 2WU3A 2HXYA 1T1EA 1TF5A 2HJHA 3TX6A 2DT8A 1LLQA 2ODWA 3PQCA 1WCWA 1RAAA 2DR2A 3M3PA 4MQEB 2WT8A 3GJ5A 1LU9A 2DCUA 4Q02A 1GD1O 1G21A 4CMEA 3T4XA 4EELA 2XUOA 1H6BA 1YB4A 2PUCA 1RJGA 4H60A 4HWKA 2NVWA 2WTXA 1NDHA 1RAEA 3VPCA 5AUPB 2D1FA 4MA0A 4XDGA 4R9NA 1KDRA 2HIAA 4QD3A 4QYIB 3HM9A 1FE8A 1JVSA 1WVIA 2KQUA 3E5RA 1VHQA 3OE1A 4KBGA 4QASA 3S55A 3DMTC 4MP3A 4O25A 2FQWA 4BAZA 2MYNA 4YQYA 1B14A 3O03A 4LZLA 1NLYA 3I8XA 2CHFA 5I01A 4Z6KA 4H0NA 3DWFA 2BFFB 3ICCA 3T7AA 3GRPA 3GRVA 4G4IA 4IKEA 1HNNA 2YC4C 4PQGA 4WCFC 5EJMA 1CUAA 2XYPA 3G8YA 3MQFA 4CUJA 1U98A 1Q44A 3AV0B 2D5LA 2O4UX 5E7QA 4Q9JA 4KWCA 4XVUA 3EA0A 1DKQA 1Q0HA 3T1HB 4RF3A 3TZKA 4O1IA 2AIRA 3IQXA 3EZ6A 3UTDA 2BRUC 4R05A 5LWQA 4W99A 2XXAB 3H4MA 1UADA 3RNOA 3C5EA 3T54A 2O8BB 1U0LA 2FR8A 4ZYUA 1MB4A 4DUYB 1T6BY 1UT5A 4KPYA 5KDDA 4KHPB 3V2IA 4FYKA 5JS8A 2VHEA 2AEJA 1A9XB 3IP1A 2BKVA 2RGYA 2ADFA 3LAWA 4FFPA 4PO9A 5K3AA 3ZY5A 5AIBA 5BV8A 1Q2XA 4OXQA 2QLNA 4HGRA 1TM2A 2R86A 3OU6A 1YBHA 5IAJA 2DP4E 3VPFA 2BFBB 1SC1A 3PNSA 1HYBA 4ZOQI 4DJTA 5IM4A 5DK4A 3G5MA 3TCNA 1M0SA 4HFMA 3KE9A 1K4YA 5B2FA 3WL3A 3R3XA 5K4GA 4B3MB 2J09A 4NV1A 1DTSA 5D3ZA 5HF8A 2H3EA 2HFKA 5T64A 3ROKA 4CCYA 3HA7A 3HB5X 5E6SB 1CULC 3CEJA 5G3ZA 1KJQA 1ZXBA 4IJQA 4L3OA 1RXYA 3ZJUA 1DAOA 2EAUA 2NTEA 2W2QA 3N6XA 2YQ4A 2WEKA 5DISB 2DC1A 1FFCA 4BQSA 2JIDA 2VP0A 2X6QA 5FORA 1WTAA 2DUNA 3DBHA 3G49A 1TCBA 2QJWA 4JL5A 4WZBA 2CMKA 2BBSA 3R3ZA 4PZEA 1CR0A 2Y68A 3KUKA 4LS3A 1T29A 2W6MA 4NZNA 3K9LA 4WNCA 3EVFA 5E2IA 4D80A 3UH1A 1V71A 4Q24A 4ETMA 4RZ2A 3UCXA 1LI5A 4L72A 2BVNA 3FVVA 3D7SA 3BTSA 1N33B 2CJXA 3CF2A 2QE6A 2JF0A 2B6NA 3DDSA 4MR7B 4UCWA 5AJZA 2WNHA 1UMBB 3M6MD 4ENWA 4BJ6A 1QQTA 1U3FA 1GHTA 2Z9BA 3VO2A 1T9DA 3RF7A 5LZ9A 1TX4B 1WMEA 2CGEA 3MILA 1RZRD 1E1KA 1I24A 3DZGA 1FVHA 3D8RA 2C2XA 4TLAA 2B1JA 3GIDA 3REOA 2E49A 2FW8A 4R81A 2RHDA 2QTGA 1KI1A 2RHMA 4MR9B 1C8LA 4K6GA 1EDOA 1R0LA 3S2GA 2F48A 3AY7A 5LC1A 1R9NA 2B8EA 4AZ3A 1BJTA 3A05A 3NW9A 4X90A 2D54A 2H4YA 3BJZA 3GUCA 4K9LA 4AF7A 2IHJA 3WGUA 1CJBA 3LNTA 1J2UA 1Z4MA 3INTA 4ED9A 5KJ6A 3CGGA 3CNOA 4W8OA 3MJRA 3I34X 4MKHA 2XOEA 3IALA 1OXSC 1W94A 4KH0A 1D0IA 2JI8A 4J1NA 5F35A 1D1SA 3Q11A 5AKXA 4A6EA 4DCGA 1GUYA 2C2ZA 1TE2A 4KC0A 3DZ8A 2XA9A 4WBNA 1V25A 5A3SA 1YMVA 1OFUA 1VJ0A 4OI2A 2OQRA 1JBQA 1PFQA 4EHBA 4XUCA 4CLRB 4X24A 2AQ8A 3EQ9A 4CHTA 3HUFA 5CB4B 2GPJA 3E82A 3QOXA 4IIFA 2D8MA 3HYNA 4MTLA 4GMGA 4RVOA 4GI7A 3DR3A 5FIUA 2QNBA 4Y2GA 3ROPA 3NUGA 1SHZA 4I0WB 4PE5B 5LD2C 3JYLA 3AL0C 1IK4A 1H3NA 2VJKA 4UHCA 3EDYA 1FRZA 1G4AE 3KLNA 3WGOA 1XZIA 4NAVA 2W2OA 3R7DA 5JQWA 2QVXX 1PTKA 2CJWB 3SHWA 5CG1A 2F9LA 1NQOA 5HQ3B 1D4ZA 2R25B 1E5VA 3BXPA 2OHHA 1IXKA 1OJ7A 2XWBF 4WLEA 1YVDA 1NVMB 1SGWA 1YC5A 1GUDA 1Q84A 1XJ5A 2YZ7A 2ZRDA 2OQIA 1Y9ZA 4NX2A 5BQ5A 2O2IA 1L0BA 2Q2QA 4K6HA 4V0SA 3OWHA 3ZEIA 3E6AA 2Z98A 5M29A 3SP1A 4RQUA 1WP4A 3NC4A 3QLJA 4D9NA 2R44A 3TE6A 4I55B 5LVAA 3AETB 2TS1A 2ORVA 2H2FA 3QIVA 4IHJB 2OXRA 2ID9A 1CIPA 1OXUA 3LXMA 3GN1A 1P3JA 3WL7A 1JGTA 3RAGA 3T5PA 1M54A 4B34A 2J67A 2ZQ5A 3DC2A 1V48A 3F6RA 5FADA 4UASA 4Y9TA 3LI2A 1RS0A 2IV3A 3KZCA 1JBKA 4CLHA 1NFRA 3AP1A 3KVOA 2DY1A 1NULA 4RA6A 4YRNA 3FDIA 4LY3A 1VGQA 1KMHA 4LAFA 3E4DA 3PQ3A 1ZHOA 3QELB 5C53B 1RYDA 4ZU3A 1MDFA 1GM5A 3I12A 5ESXA 3GFTA 2O5EA 3KT3A 4L7VA 3VH2A 4MWBA 3W7VA 1U4SA 2ZB7A 3UJPA 1AJEA 1H9CA 3VOBA 5FLKA 1X86B 2QI9F 4H3SA 4R8LA 2IQIA 3A4IA 4U9HS 1Z5WA 4YT4A 2VPPA 4RUKA 2D0OB 5D1HA 4ZVOA 4D8UA 5IMSA 3LCRA 3PUHA 3IE1A 2VWGA 4KWIA 1DIOB 5JNWA 3IMFA 4FINA 5D3MA 5HQJA 1LC0A 2AHRA 2B4TO 4RCZA 4KIFA 2JFQA 1XA0A 5JI3E 1Y7HA 2KS6A 3JYOA 5JHGB 3A2KA 4FKBA 1I3OA 4V38A 1TQHA 3ETEA 2PRIA 4PTLA 3C3DA 1PV2A 3NYWA 3G02A 1FMTA 2AVNA 2R0QC 4RSHA 3K6JA 2ZCUA 3E2IA 4TOIA 1IFXA 3PQ8A 1C30A 4RQBA 4U3JB 5L3ZA 4OSEA 1VGVA 3WYBA 2VNHA 1SVUA 2PANA 2PPVA 3CZ9A 4NFSA 1PP4A 1BMQA 2Q2VA 1MAAA 2CLIB 5EEGA 2YWGA 1E61A 2GMWA 3ZBUA 2QQGA 3DMRA 2WWIA 3KZ1E 3LGXA 1WF3A 1ZIOA 4EECA 4M3NA 3A7DA 3N2GA 2AFIA 3FZEA 1CB7A 2J3MA 4G89A 1UIMA 2ANCA 5LQCA 1TD1A 1X19A 4KMRA 1XWFA 3C16C 1U2DA 4RU1A 3U0VA 3AEUB 3CNQS 3WS7A 1CZLA 2OD7A 2GZDA 3OHMA 4AJ2A 10MHA 1DRKA 5CVEA 5HEKA 3RB8A 1J0DA 3OETA 2D3WA 3QEMA 2WFMA 4U5XA 2R2GA 3CZMA 2C9MA 2B5OA 4X94A 3GRKA 1USKA 3UCFA 4ZO7A 3RSFA 1A82A 1GUBA 1JHAA 4UEWA 3N05A 4ZI5A 2R6HA 4IQFA 2HQOA 3C97A 5DNDA 3H5OA 4EB6B 2ENUA 2ZAMA 5DIZA 4II7A 1E69A 4LHXA 3SF8A 1SCDA 5CDFE 1L5GB 5BW5A 1YNOA 2X5NA 4Q9HA 5C8YF 4H17A 1ZJ5A 1WCXA 4E4RA 3JASB 3P2EA 4G9EA 2WE7A 3GRAA 1EIZA 1I4EB 4RMNA 3L4KA 2WA2A 3T95A 1K86A 2IOYA 4PLPA 3S0JA 2QAGC 3AM5A 8AT1A 5JV5A 5AHWA 4LJ9A 1JYSA 1SCBA 3LUBA 1JA9A 5JI2E 1CQJB 3NLLA 4UBKA 4YHHB 2OTCA 3DV0B 4QZVA 3MOGA 1D2NA 5HMMA 1ZW1A 1K75A 1T4CA 2R4UA 5E9QA 4GM4A 3Q3HA 3ZZNA 1PEYA 5BV7A 1Z28A 4EWLA 4NBKA 3NBUA 4DQKA 2NVUA 2WU1A 3O74A 4E5UA 4C7XA 5A4AA 1E5XA 4KIJA 4Q39A 3TYXA 3RS4A 4KLCA 5CA0B 4NZOA 2ZJ1A 3P2JA 5K3BA 1GKIA 3R3UA 5LYJB 2DEUA 2FVXA 4FYJA 1JUDA 1OLUA 1KJWA 2VJLA 2EP7A 2JLVA 1KNQA 2V4UA 5FNVB 3AKYA 1MAWA 1VL6A 1YK1A 1NRIA 2QXUA 4HDQB 3H8VA 1ZL0A 2GCNA 2VPYA 3BHMA 1O96A 3G2PA 4PFQA 3IT2A 3OVMA 4BVHA 4YAJA 5BOVA 3NM4A 4WXPA 5ADHA 2TMYA 2RI1A 2Y1WA 4FKZA 2CMGA 4NNOA 4UPVA 1ADBA 1UKBA 3DLAA 1CUZA 1VBFA 1XMXA 4MGYR 1GTVA 2HLPA 2XDWA 3AR3A 3LM8A 3RHFA 3TIGA 4RHTA 4BFXA 4R9RA 5TGZA 4ZCIA 3SJZA 4KOEC 4OFXA 3F1LA 3ZWWA 3V1UA 1PGNA 5IMBA 4HDKA 5IF9A 2GO1A 4TYYA 1UPAA 1Z6AA 4AU1A 1Q17A 1E0KA 4K6KA 3W5IA 1D1TA 4R2KA 1Z0DA 4HG2A 3OCXA 4P4GA 2J6IA 5EI5A 1MVNA 4CGYA 1T43A 2D59A 3KQVA 3RS8A 5BMVA 1YDWA 3LOPA 1TKRA 3DMDA 1EFDN 1GTMA 1XDGA 5DHRA 4IXMA 5ALOA 4CKZA 4D6PA 3L0PA 3ZZ0A 1VJDA 3DVRX 4BQNA 3L05A 3LIPA 1DFHA 3HJCA 1KO1A 5B55A 1GA6A 1UMCB 2ZBRA 2EARA 3MXOA 3N2KB 3P9ZA 3P96A 4P7KA 6REQA 2BEJA 4EKGA 5BQXA 4FXPA 5C4GB 2C4UA 4KE8A 1E3MA 2VUUA 3EOZA 3RO7A 3UT5A 1W36B 3U3ZA 2PMBA 4I6GA 1IK6A 4E5VA 3CRVA 3FBWA 2NTYC 3B70A 2X9QA 1YAJA 4RIFA 5TY0A 1N7GA 1T5TA 1Z4IA 5CURA 1QLWA 1PNOA 3C8HA 1Z35A 5CHEA 3G2IA 4KFSA 2H65A 3GPDG 4ME6A 3I05A 2NGRA 2Z43A 3M8KA 3WB1A 3T9DA 3JSAA 4FCTA 4CM9D 4GBED 4ZZIA 6PFKA 3U16A 1DEHA 5JNUA 3M70A 4MWOA 3WIOA 3B82A 2BRUA 4ZT6A 5LSAA 1ZS9A 2Y0EA 2VXCA 4OYYA 3A4VA 2GHTA 5CX4A 2QRKA 2RH5A 4YR7A 3WGIA 3RSGA 3UKJA 3F1KA 3ZCPA 3DP9A 4H3VA 2FSFA 4E5YA 4YRIA 1GSHA 3DCYA 4J43A 3F5MA 3PENA 4I9UA 1NUAA 1P6XA 3E9CA 3TLMA 3FNGA 3AR2A 4F3RA 3BFJA 5JNSA 1OXTA 4MVJI 2QP9X 3GC6A 5CGQB 3HNOA 3GRCA 1GNTA 1ULHA 2HN9A 4KXUA 2YDXA 3D4NA 3KK0A 1C1DB 1QCZA 3LHFA 4Z9FA 3ZHTA 4BWVA 1EFLA 1DBRA 2IS4A 3DWEX 3LQQA 3L7YA 1YZ3A 3E7XA 1V16A 3NKVA 2VJAA 4HEQA 5CR9A 1FS5A 2QNIA 2V96A 4ND2A 3RREA 3U26A 1LJ8A 1NU8A 1QXSA 3BREA 4MCHA 1BH6A 4FT4A 2IYYA 4BNDA 3IB6A 4N3GA 3TTUA 1XN1A 3GY0A 2XWSA 3F4LA 3HCPA 4IIVA 2WIJA 1XMPA 1TMGE 4A15A 2VHVA 5SY6A 3I1JA 1O6CA 4JJAA 5IM5A 1D5WA 3JQ8B 5EERA 5EJ8A 3DVQX 4JR0A 5KYWA 3DVAB 1IN6A 5HJEA 4JCCA 1JKXA 1JAXA 2F90A 2QM7A 2QROA 1TLTA 1WVGA 2BD0A 3OG9A 3WQHA 5HKOA 4FI3C 4TKUA 3V8RA 4JJGA 2XT0A 1ZEMA 1JLSA 3L3BA 3GEHA 1EFTA 1H66A 3Q3GE 4HNAB 2GN8A 3TI9A 7MHTA 3E2MA 1T9GS 2ZLBA 3K16A 1J06A 2FWRA 2JNWA 3FOZA 2PM8A 2RGRA 1GN9A 1ZQ1A 2HL6A 1VJ1A 1HTBA 3OZUA 3NBKA 1YVPA 3OJEA 1O9GA 3QEOA 4WZAB 2OG1A 4L51A 3ZKAA 4CKYA 4EY4A 5LJIA 3CEPB 2JLUA 3IT3A 3BXEA 1LQUA 1OB2A 1JLKA 1PEAA 3FFWA 4RY2A 2WU0A 1DJLA 1MV8A 5BWNA 2BZ0A 2JRCA 1TU4A 3UUEA 4X64B 3UW3A 4G5FA 3HLYA 4EB3A 1DC8A 2NXJA 3H9QA 5GONB 3PIRA 4MP6A 3PD7A 4R8SA 4JI3B 2OCPA 4LDQA 4I3FA 4F46A 2NU8A 3QVKA 4X6LA 1KO4A 4B32A 4DN6A 2HCJB 1O5OA 3O6VA 2MYPA 3NHYA 5ENZA 2PMCA 2IYAA 5FOTA 3LQKA 2WHPA 3I62A 1U8ZA 2G7ZA 2HK7A 4JKIA 4QAJA 4LRWA 3B6EA 3ADBA 1X77A 4P0QB 5AXCA 4DR6B 1LK7A 1W5EA 2X23A 4O4IA 4JKOA 2ZIWB 1BFDA 3AIMA 1XU7A 3ZWBA 1ZC3A 1AXEA 3SHQA 2TRSB 1RMTA 4FEAA 4P3OA 4QNNA 4ZQHA 1B3BA 2XGOA 4KR0A 3MHTA 1Q0TA 2IEAA 3AO0B 3OCZA 3EIEA 4JA2A 2KSQA 3HKEB 4JOCA 1JIJA 1ZNWA 3W9SA 4CMGA 1V39A 3KUCA 3A1FA 4HTFA 2GARA 3O1JC 3PLNA 4HUQA 4E2ZA 1CW2B 3O9MA 1MG5A 3ZU4A 4EBBA 1LS6A 3KOXA 1D6NA 2HF2A 1P7VA 3ZWQA 3CXUA 4DQVA 5EG5A 1K66A 2JLAA 2YTZA 2CNNA 2QTBA 2VG8A 4FPXA 4D43A 2NIPA 3NCTA 5CLQA 4LJAA 1J6UA 3FNRA 3GAZA 2WKWA 3HB4X 4Y3UA 1NRJB 2ONZA 2Y1DA 4UCQA 1P5ZB 1Q20A 1XAGA 2CFCA 4NS4A 4B3TB 5DASA 2JGDB 4QKQA 5A7HA 1Y9JA 2QW0X 4JC4A 1JJVA 1U8FO 4TZTA 2E0IA 1G7RA 2ZJ8A 4Y1EA 3WGNA 2BI7A 1NRWA 1S1MA 2JFZA 2WUWE 1ACMA 3I76A 4CIWA 4WKNA 5KI6A 1PNRA 1NHWA 3FPEA 4UMFA 5E0OA 4I50B 1NJFA 4KPUA 4DKJA 3BM5A 4CKEA 3CRRA 4AKIA 1D9XA 3A9VA 4F04A 5DNWA 5IBCA 3TTYA 1QRTA 5AW1A 4JLNA 1GPWB 4FFDA 3LPNA 3OZBA 1QFXA 5DI3B 3QM1A 5B1HA 1QCDA 2X7XA 6GPBA 1E18A 1FRFS 1UBKS 1Z4PX 1CERA 1X7XA 3NQ41 3R09A 1E9FA 1UAGA 1CYDA 2PCLA 5H16A 4CMIB 1HYQA 4NBTA 1N9GA 1ULBA 2EDCA 3A9RA 3K1ZA 4LC1A 4C4OA 4NXNB 2IS2A 2WJ4A 4JEIA 2EJBA 4HQOA 2I7DA 4D9CA 1T2NA 1D2HA 5L4LA 2OWDA 3IAM6 3KOWA 1VPEA 2QA5A 2AEFA 2ZDHA 3AEQA 3QP9A 4M98A 4MYSA 4NEQA 4ZFNA 3Q9LA 2VTVA 4CQMB 2HUNA 5AVXA 3VU9B 3NEAA 1M0WA 4KUEA 3HXKA 3VO1A 1U1EA 4L73A 4X7MA 2X3UA 3N2YA 2WJYA 1PQ4A 2I7VA 3FZNA 4IWNA 4WMLA 1AO0A 3SVLA 1QGED 3B2NA 3HQ4O 3QLEA 1RRKA 3IEUA 3K20A 4I9FA 2NW6A 1VG9B 3WGJA 4PFKA 5LWHA 4OGFA 2A9PA 2ZRMA 4YLEA 4X65B 2WT9A 1F4VA 3KQOA 3PR2B 3M5PA 3HNRA 2J87A 2MR6A 3ETHA 3O8NA 4LTNA 4E15A 3G0DA 5LQMA 2IH2A 3OPYB 2VWPA 3RT1A 5K3CA 1RWWA 2I1VB 5CPFA 2ZIVB 1J9ZA 3TTXA 1AN9A 2H5JA 1QCCA 4D3XA 5HIKA 2QRNA 5REQA 5AFSA 4RZSA 4PF1A 1VMDA 2CT8A 4L95C 1PVVA 5FTLA 3FWPA 5IHXA 3M5DA 2E37A 4TN1A 4ALMA 1AG9A 1JBEA 2GM5A 3GOHA 2ADMA 2Z30A 3HA3A 4NU6A 2Q4RA 1DE0A 3LP5A 4GI1A 4JL6A 1YRYE 3GEGA 4ALJA 4J91A 1E9EA 4ABYA 4V0RA 3EXHC 4YCSA 2DX7A 2Q8QA 1ORVA 2QR3A 1E2FA 4I1SA 4IP0A 4MMZB 4GKJB 3DUFA 1GKUB 1YMQA 2FPPB 1P31A 2JGJA 4GH5A 4X7RA 4MUFA 1Z06A 5AM4A 1J21A 2XUFA 4C14A 4F9TA 3CH4B 2I4RA 3NAGA 3Q4GA 4BP8A 4IKOA 1ZXXA 3PDIA 4LDRA 5AJXA 1AKWA 3U19A 5AK0A 1S7GA 3ZGVA 5DFAA 1MUUA 5A04A 4N49A 1MKYA 3SKVA 3SOZA 1SHTX 1X8KA 1FFDA 1RP1A 2WVGA 3EIWA 3QTTA 4JNKA 3K9HA 3W9UA 4C08A 1G8GA 3WRVA 2UVQA 4MQLA 5E1MA 5AQEA 2KW5A 2Q3FA 5BT8A 5B5SA 1EFRD 1I7NA 1TK3A 1E0AA 1WEHA 1JECA 1HKHA 4Q15A 1CNEA 4H0CA 1DVRA 4UE2A 5ALZA 1QTIA 4KITB 3IOMA 2PUBA 4R84A 4C4RA 2XRMA 3A2NA 3LQRA 5JZOA 3D0QA 4MK4A 2IOQA 3ZD6A 1JYEA 3FDZB 4EGSA 1J25A 4DR4B 2FUCA 4Q3DA 3V4SA 5EJAA 4FTWA 3P19A 4PYJA 1PFUA 3N8IA 3SZUA 5I9NA 4DILA 2HRCA 3ESZA 4RTPA 2H1RA 2YRXA 3QW2A 3I5UA 4UNRA 3KRTA 5JC8A 1J42A 4D46A 2NVBA 4YACA 4UZFA 5FPKA 2Y6VA 1V95A 3DEFA 3O4GA 3QYPA 4KZKA 3K9FC 3TRFA 1E2QA 1I80A 3ZYCA 4JP5A 4ZC8A 3KQTA 1SUAA 4R2IA 1OD6A 3B1YA 3U4QA 5I3CA 2ZE7A 2IYPA 4C03A 5B4UA 2WQ6A 1JQKA 1TO2E 4BQEA 2G67A 4RY9A 4LPSA 1WD7A 1U2EA 2J0UA 2ZI7A 1QFSA 4XWOA 2GAAA 2J5KA 2ZJ7A 4JBNA 4LXIA 4BYMA 1B0AA 2Q9BA 3ZDDA 2BTQA 4LOHA 1CR1A 2QKYA 3AESA 3HGMA 4PZ0A 2LRHA 3TOSA 1BJKA 4FSHA 3VNQA 2ZJ6A 2Z2ZA 2UDPA 3PC6A 3DTYA 2ZDGA 4RTLA 4LIPD 1MC5A 5FFMA 1CV2A 1RHKA 2N9UA 3Q0TA 4Q1FA 5AYVA 4E6PA 3VR5D 3UMMA 4O8CA 3V32A 1FU8A 4JB8A 5KMGA 4FFSA 1AGYA 1JHRA 4BQOA 3HBAA 4DMLA 2FJUA 3BBPA 1Z4JA 4NH0A 3NXSA 2I8AA 3ELWA 3TTTA 4B17A 2X76A 3LPAA 4H6WA 1EDDA 1G7CA 2DWQA 1GILA 4JI6B 4YJ2F 2NP6A 2PH7A 3L7CA 3UHOA 2VSFA 1XEXA 1KFBB 1NYTA 4BMDA 5JAOA 5ALXA 2D1RA 1WXEA 3GCGA 3H2GA 1DX4A 2ZPTX 4JK3A 4OHFA 5H9VA 1R9GA 5H02A 3CNEA 1RYYA 4M9RA 5I8ZA 2WOOA 1FDIA 3ZOZA 3ZS9A 5EESA 3BHIA 4JI5B 1L1FA 421PA 4M6WA 4BTEA 3UNXA 1TVCA 1XV5A 2OMEA 1CR2A 4QWWA 3R6TA 3NIBA 5EP4A 1BIFA 4INAA 4M22A 4KQEA 4UQPA 3GGDA 1E94E 2V65A 4LECA 3VPAA 3LX5A 4TLCA 4YV7A 4KREA 1F2UB 2ZZMA 4PRKA 3VTZA 4LYYA 5K03A 2EFEB 5IAOA 1CQWA 1L7VC 1P6UA 4J90A 2OD2A 2JS7A 4BRUA 3M6LA 3AUXA 5BN4A 1PRYA 3EF0A 4A6PA 1DKNA 3PQ4A 2TMKA 2YJ5A 4TS4A 1N5LA 3REQB 2ZS9A 4D2IA 1N7HA 5FYDA 2DWCA 1HO3A 5JLJA 3KV1A 4LJYA 1NJSA 5G0TA 1G5QA 1V8PA 4UJ5A 3WMFA 5JTTA 4EY6A 5I8PA 3T0IA 2QX6A 3MRSA 4C6TB 1ZINA 4KMSA 1YF3A 2C5SA 4P3YA 3NASA 1B8PA 4N5LA 3IEXA 4A8HA 1PJCA 3H05A 1T4DA 5TB5A 1ZP6A 4X20B 2XVXA 1ECFA 3GWGA 1K5PA 2QE7A 5BR7A 3TTSA 4YH1A 4D9BA 2RGNC 1G63A 1GCAA 4ZO8A 1Y4ZA 1Y8RB 3NTRA 4S2EA 5BSWA 1R3DA 5HRAA 4MW1A 4QUAA 2P5SA 1LNSA 3M2PA 1C1XA 2EGHA 1R6VA 2HCFA 3PVSA 4TWAA 5ALRA 4KDRA 1QIKA 3AVYA 2PUWA 4FZJA 2GI4A 4HAZA 4XGQA 2NZJA 3ZLUA 4HDRB 3T0GA 3V9PA 4ZEXA 1IEQA 1ZJ4A 5E4FA 3ONVA 4A8PA 4D92A 1ZNQO 4UM5A 5IYZF 3QMWA 4LV6A 3H11B 5JE8A 3THYB 1SC3A 1JR3A 4IRUB 4QQKA 3MYYA 1ZFNA 2GK4A 2ZYGA 5GWXA 2BDUA 1TTQB 1M2FA 2AT1A 2NPIA 2BUCA 1PU2A 3E1SA 2HSJA 4IICA 4LQLA 4BUCA 4G2NA 1YSCA 3B3AA 1H2FA 1LTQA 1BN6A 3EWNA 4GQAA 1WBDA 1IN1A 4OSPA 3U5TA 2OQ2A 4K26A 3V6LA 1DP4A 4G2TA 3L02A 3E8SA 4NU5A 5K3FB 4EQZA 2O19A 2H5IA 2YR0A 3RWMB 3GLIE 3R7NA 2NTVA 4QXMA 5K6TA 1A1SA 3AHDA 3TD9A 4HAVA 1U3GA 5FQNA 2ODPA 5FPHA 1CUXA 5KSPA 3WL8A 1SB8A 2FDRA 1N2ZA 2VN8A 1R4NA 3LL4A 4NATA 5HKBA 2YNMA 4BB9A 3PJDA 3FBTA 4G0XA 1X0VA 1B2RA 1UT6A 1GXSA 2NO1A 3I0NA 4LHWA 1VL8A 1G2IA 5M7EA 4CT5A 1NW5A 1N2OA 1NVUQ 5AHKA 5JZSA 4E2WA 1DBQA 1H23A 3OF3A 4UXIA 2BR3A 3B38A 4PAWA 2XVZA 4S0ZA 3EGDB 5HGJA 3HI4A 2GUGA 4J0EA 1XRNA 3I6MA 3TECE 4TT3D 5IKXA 3GCDA 2VJBA 1PG2A 3ASZA 3PL1A 3T7SA 4WV3A 2FPSA 3PEFA 4CU2A 3OLYA 1OUMA 4F96A 3FN4A 1YVUA 4HNVA 1P0MA 3HBMA 4JUDX 5B1EA 3KYIB 1HF3A 3FCUB 3KUDA 2AMLA 1N34B 4B6PA 3P9IA 1YR8A 3EVNA 4H7JA 4N40A 2G28A 1OLSA 5GZ3A 2I66A 2ZIGA 4TL6A 1K7YA 2XB2A 4QSHA 1HTWA 1YJXA 4Q4DA 1NQUA 2B9VA 3COYA 3I9KA 4HFRA 4E2XA 4YV2A 2RAFA 1FTYA 4PV7A 1FDRA 2C7BA 3N3AC 1EM6A 1M1YB 2LPMA 1BJRE 1PN3A 4M0CA 4PY2A 2E5FA 3HDQA 1UJBA 4AKGA 3A7EA 3BSSA 3W8NA 3NDJA 5KZMB 2F62A 5BWMA 2F00A 2RHHA 5DRYA 4V0OA 1Z63A 4V2UA 2ZAYA 3VNUA 1LRJA 1VSTA 2C4HA 1RRCA 3VZDA 1I6MA 2VJYA 2ZDQA 4N03A 2JANA 1W49A 4TROA 3RUEA 3TIFA 4B81A 3BD8A 1PT7A 2IGBA 2DOKA 1W48A 2GCEA 2O8CB 4G41A 2I91A 2RJ3A 4ND8A 4UD6A 1WUTA 3GFQA 3UXYA 1DHRA 1RKVA 1ZUIA 3C5WP 5E4TA 1E1QD 4RJIA 5CCBA 3GYBA 3VSCA 1R6TA 1U0RA 2N0SA 3OLVA 2RE8A 3BTUA 1A2QA 1S2IA 3QNWA 2OXTA 2B69A 4L22A 4Y6PA 2AEEA 4EUSA 4BX8A 2PS0A 4UE6A 1B93A 2GX6A 2AMVA 2GPBA 4TT3A 3Q5EA 2NUAB 3MJCA 3QPWA 4Y30A 3NBXX 1KJ8A 1P1RA 5LOVF 3S2EA 1P91A 4HAXA 3DV2A 4N4AA 1H2HA 2WJVA 4CR8A 1ESZA 2IFTA 1ZJWA 2XE6A 3GLFB 1LZKA 4AZ0B 5E1OA 2GM4A 2PX4A 1P80A 2O23A 1G21E 1GU1A 4TXNA 2WIKA 3W9BA 5KSZA 1SFRA 1ZD2P 2YKGA 4YT8A 1SBNE 1ZMRA 1ADGA 2IELA 2Z8XA 4JYCA 3X2FA 4M99A 1UM9A 1JDPA 1NN0A 2PMEA 4RTSA 2QRGA 3LY7A 4FZ3A 2CLDX 2QP3A 3EUAA 4GF5A 1FRVA 1QV7A 4HMQA 1ZX1A 3KPUA 4PLCA 3QSYA 2FN4A 1PL7A 4O4LB 3K30A 4KFUA 2BBTA 2DQYA 5D01A 4WY2A 4CV3A 3QMMA 2FV8A 4GOLD 4A0RA 2XVMA 1ZHHA 2DTEA 1ISMA 2NSDA 4D4MA 1SIWA 4LJSA 4PYQA 5EHNA 5JCZA 4GPTA 5DSXA 7GPBA 1DQNA 2DFPA 3HCAA 2N1MA 1MRSA 2HSDA 2W6QA 4K5QA 3MGBA 4GLLA 1CBUA 5TQ0A 4A82A 3ROGA 1OY1A 2ZVPX 3PC2A 3V4ZA 3X1DA 5ITZB 2AZDA 1KDPA 1LLFA 2A5FA 3P71T 1U02A 3NALA 2YFYA 3GVIA 5MFPA 1GPYA 3F7NA 4FW9A 4W1PA 1YJAA 2LVBA 4K05A 1T3SA 1FDTA 4LOAA 3EQ7A 4MS4A 4Q1CA 4B1FA 4P4SA 3K70B 1E1QA 1OBFO 2VF2A 3R24A 5LQUA 4H1WA 2Y92A 3HVUA 4XW2A 3OFND 3T12A 2HF9A 1L4GA 2FHPA 2R7KA 3SNKA 4B7CA 4PXYA 2PX0A 2ZSBA 2XWPA 3FH0A 4QUJA 1NXXA 2VDWA 2QWXA 5BP7A 2WSSA 1Z0AA 2RGXA 1P6QA 2NVOA 3LQFA 1SK9A 4BTVA 4EJ6A 3OZ7A 4I7EA 3RCBA 4FNMA 1U2TA 4I2VA 4LYAA 1J90A 4NXMB 4WLFA 1CX9B 3AR8A 3I6YA 2NO7A 1PD0A 2VDKB 1QG6A 2DHQA 3FI9A 3GUZA 3I30X 1X1EA 2ZT5A 3BGIA 3KWJA 3ROZA 4XIIA 3CEHA 3O31A 2VH5R 1TVMA 3VTKA 3JD3A 4CM7A 1EXWA 4URXR 1P0CA 2J3DA 3ZWVA 3U1BA 4ZT3A 1QGDA 1XX6A 2QR5A 3KB8A 2XNSA 5KOYA 1LX7A 3SOPA 4NBSA 4R3UC 1W25A 4HNHA 3TPZA 3ZN2A 3NEPX 4WLNA 4JOBA 4MITA 4WFKA 1MB2A 3GFBA 3FMOB 3FIJA 4LSZA 3NAMA 3LOQA 4UD2A 3RFTA 2ZYAA 4B7ZA 2CMFA 3T1NA 4ZTUB 2CZQA 2HO5A 2P40A 5D8DA