1QHSA

Chloramphenicol phosphotransferase in complex with chloramphenicol from streptomyces venezuelae
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
178
structure length
178
Chain Sequence
b'MTTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQSAEGGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLDVLWVGVRCDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTHKESIECAWAIAAHVVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CHLORAMPHENICOL PHOSPHOTRANSFERASE)
publication title The Crystal Structures of Chloramphenicol Phosphotransferase Reveal a Novel Inactivation Mechanism
pubmed doi rcsb
molecule tags Transferase
total genus 59
structure length 178
sequence length 178
ec nomenclature ec 2.7.1.-:
pdb deposition date 1999-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07931 CPT Chloramphenicol phosphotransferase-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1qhsA00
1XTJA 3SU8A 3RS2A 2OE2A 4DRZA 3SI7A 4JLVA 2HXSA 2FV8A 1CJTC 2QN6A 2ZRBA 4M53A 2O8DA 1E2MA 2RGDA 3OFNA 3GLGE 4TL9A 4UNNA 1NVWQ 2XZLA 3QKRB 5AK0A 1ZU5A 1LF0A 2DWOA 4EPWA 2VO1A 2MSDB 1XB2A 3FHCB 1QHXA 1D6JA 1E9AA 1DO2A 4FMDF 1NMXA 1OV4A 4HLCA 4PX9A 4YMVA 1XTRA 1E96A 2FSHA 3U6BA 2JAQA 1TF7A 2RAPA 3LH5A 1R10A 2JLVA 1N6OA 5HE9A 5FFMA 1Z5ZA 4Q02A 4C3ZA 1ZIPA 4OHXA 4UNRA 3SYNA 4LHZA 1ESNA 2WIBA 1MABA 2WPDD 4AKGA 4PSAA 1Z8FA 3UANA 1NF3A 1CJUC 2VHQA 1E1QD 1GNQA 2BM1A 4TMZA 1X3SA 1NBMA 4KYUA 4B47A 1N2CE 1Q21A 3UWKA 4D4MA 3H84A 1X8JA 4A2PA 2IYYA 1H8EA 1DG1G 5DISB 1CP2A 1XD2A 1XEXB 4C2TA 3DHWC 3GQBA 3W34A 2AXPA 1IQPA 1SHKA 4FMDB 4M22A 4PR0A 3HYRA 5K8LA 1BO6A 2QAJA 4DDTA 1TADA 2FA9A 4ON9A 4XVRA 3ICEA 4LPSA 1GWNA 1ZM2A 1J70A 4MA4A 5F9HA 2XSZD 2VP5A 1YQTA 1KDPA 4HUQB 1S3GA 2R6CA 3CR7A 3CNOA 2QE7D 3K9GA 1G4AE 2C03A 4Q19A 2GCOB 4DLWA 2BMJA 4ZDKA 4PC7A 4PHFA 1U0HC 2CLSA 4P32A 1V43A 2ASEA 1W46A 2ZE7A 3BIFA 5DIFA 4A92A 4B33A 2FNAA 1N6NA 1NJGA 4K8OA 2X1VA 3U3KA 1NVVR 4EPYA 4OHVA 1Q12A 3QKTA 1CTQA 4PANA 4J0QA 3F3YA 1DAFA 4JYBA 4QNRA 4TYQA 1EWRA 2ZRNA 1RIFA 1WBBA 1SXJE 1TX4B 3QBTA 3PEWA 2C96A 4PHTA 1TTTA 2CXXA 2XTZA 1DAEA 1JJ7A 4AKHA 2ZAOA 2WJGA 3X1DA 3K8YA 2O8DB 4KLZA 3I3SR 4D4KA 2W6JD 2QTFA 1OH7A 4MYHA 3MMPA 1K6MA 1N5LA 2P0EA 3SBDA 3A1UA 1AQUA 2OHFA 4TZ6A 1U9IA 1U9IC 5DYGA 1OW3B 2D06A 2ZUCA 3J81k 4P4UA 4PHHA 2WAXA 2CDNA 4LGMA 4A0FA 2R6AA 3TAHA 3RS4A 3TLXA 1J99A 2XXAB 4KSCA 1YR8A 4TMKA 4OI0A 3NWJA 3GEHA 3VKHA 1RRFA 5E7JA 5JS7A 2VIIA 5K8TA 2GWHA 3PVSA 5CYPA 1MABB 2YWHA 3AKEA 4JKYA 2XNDD 4JVNA 1OKKD 3RC8A 1JR3E 5B58C 1A82A 2IBMA 4GZMA 4LK2A 2GTPA 2IYRA 4JT2A 2GJ9A 2KJQA 1RYFA 1Q1BA 5FL3A 1ZMXA 1X8KA 1G5RA 1MO5A 1XPRA 2BKUA 2OFXA 4PPGA 5EUQB 2V6IA 3KUDA 4MRSA 4PZYA 2GXUA 2XTMA 4BLPA 1DOAA 2Z5FA 3H4MA 2QMUA 2ZJYA 1W47A 3HU1A 4JZKA 1E0SA 4TTPA 3I5XA 2XOKA 3PXGA 1A7JA 1FL9A 4M9SA 4TWZA 5TXGA 3U3OA 2B8WA 2V3CC 1HTWA 4LI0A 1G9XA 1GDDA 5BQ5A 1AA9A 1ELOA 1P2UA 2VEDA 2GDJA 3Q7QA 2Q21A 1II8A 4IW3B 4ZDWA 2PJRA 3CPEA 3LWNA 4OK5A 1M2OB 4R2HA 3NIBA 4EJSA 1GSIA 1AQYA 3BB3A 4TL6A 2QTHA 4EJSC 4Q4AA 1NMZA 3W8NA 2R65A 5EZ6B 1G7TA 5FR1A 5FUYA 3B2EA 1XZQA 3I4LA 4FINA 5EE0A 1W5SA 4TT3D 3TW4A 4DLYA 1G7RA 4OBEA 4TZ0A 2JLZA 1SVMA 4IOKA 4JJZA 1D5CA 4KBGA 4ZPXA 3C5HA 1ZUHA 2ZJ5A 1R0ZA 2GAOA 2B7BA 5FPSA 4RZXA 4Q7JB 3NBYC 2FSIA 4V0OA 4A36A 3SDZA 3W6NA 3ZIAD 1II9A 3LLUA 4FI3C 4HYYA 2FGJA 1IHUA 3BJIC 1Z6GA 2F1HA 1Z07A 3AVQA 2ZSDA 4GNKA 4CEIA 4LHWA 2HCJB 4E07A 3A6PC 3R20A 2OFWA 3CX8A 1JECA 3EPLA 2HUPA 2R6FA 1J8MF 5JI2E 3THYA 1VCIA 2ZR7A 1Z0DA 1DPFA 4DWJA 1MO3A 5TMPA 1S2MA 1LTQA 3A1TA 3KXIA 1P9NA 3NG1A 4A8JB 4IVPA 2XJ4A 1KI3A 1A4RA 2NZJA 2F9MA 3GLHA 2G1KA 3T5DA 3X1YA 4C0SA 1UPTA 4KYIB 3RRMA 3GPLA 3BRWD 1N6IA 1YR9A 2CE2X 4CZ2A 1DO0A 5HCIA 1GAJA 2DWQA 4IOJA 1SQ5A 3KTAA 3OIWA 5CDFA 3FHTA 1F2UA 4LX0A 2SHKA 4RFVA 4D26A 1M8PA 1IJFA 1NLFA 3RSLA 2MMGA 3AVVA 4QJ3A 2G9NA 1XFAA 4IOLA 2JIZA 2ZI7A 1TEVA 1L7VC 3BORA 3I73A 5TVKA 3AF0A 1AS2A 2ZE8A 3X1WA 4II7A 4O2RA 4NCJA 3Q7PA 5CLQA 5K8IA 5BXQC 3PJRA 2HJGA 3W3ZB 4BFWA 2QM7A 5JHGB 2C78A 4PZZA 4RD0A 2KSQA 2QORA 2PX0A 4RCZA 2IXFA 3KJIA 1E9CA 4Q9KA 2VP0A 5EUMA 2QMEA 4QOSA 1RFLA 3LBIA 3FYHA 4NCIA 4G5GA 3KUCA 4PQRA 4G1UC 1UBEA 1II8B 5DN6D 4X8MA 4TLAA 1U98A 3W6OA 4JKIA 1A2KC 4E03A 1VYUA 2R6GA 4Z51A 1OFUX 2ZS9A 3GLGA 3ZVRA 4I99A 1Z6XA 5AUPB 1OLOA 1QVAA 2AD5A 2RMKA 1PZNA 1FMJA 4PO8A 2WM9B 3SS8A 3X2SA 1CF4A 1XCPA 2J0UA 3MWJA 1XMJA 3BC1A 2C8VA 3B1YA 3F5FA 3P32A 2QT1A 2X2EA 2NOAA 2G88A 3KB2A 3PFIA 4TQ9A 4F93B 4US2R 1GZSA 5DI3A 5IHPA 1DADA 4AK9A 1T6NA 5KDDA 2J46A 4HSEA 4URZR 4D0LB 5BW8A 4AY2A 3EAQA 2E87A 2EVWX 4V02A 3W9YA 2B92A 3AP2A 1WDTA 3F0TA 1X8LA 4GDFA 1Q1EA 2OSBA 4QGAA 4LWZA 1ODFA 1G5PA 4KAXA 4D81A 3BOSA 2LKCA 1IY1A 1KO8A 4JLPA 4JT4A 1KNXA 2FSFA 4KLNA 3ZVMA 2VP6A 2ZJAA 4DEYA 1XMVA 2NO6A 1OJLA 2VL7A 3GJ0A 3KL4A 5IK2D 1M74A 4Q1FA 4JVSB 3QXHA 3CONA 4JBXA 1XCGB 3AUYA 1GL6A 4RFSA 4TLCA 3PQCA 5F98A 2IYTA 1ZP6A 2A5YB 4HLDA 2W58A 3RS3A 3SQWA 3VKWA 1P3JA 2JA1A 2ZU6A 2QPOA 2JCSA 3P27A 4H1UA 4B6EA 3NHAA 4HAZA 1T5LA 3KTAB 2AKYA 1OPXA 2ZRIA 3B60A 2GF9A 4NMMA 5FUXA 3TMKA 721PA 2ZM5A 1DAIA 5GJVC 2DFLA 3K9NA 3THXB 2ZJ8A 3GFOA 2DFKB 2V9PA 2GXQA 3A58B 4BZQA 4QHSA 3PITA 2FFAA 5KYKA 4OKSA 621PA 5EE3A 4M1OA 1E2QA 2RHMA 1QDEA 3ZS8A 1F5NA 1XTKA 2ATXA 3Q9LA 3RHFA 2K5UA 4TYNA 2Q3HA 3A1SA 1KK3A 2FFQA 3WRYC 1SXJA 1SXJC 3B78A 3WY9A 5GVSA 2A2ZA 4YMWA 2ANCA 4B71A 2G3YA 3GFTA 3MJHA 4URYR 4QGGA 4CW7A 1NSTA 1R0XA 2QP4A 2A3RA 4ZIRA 1GM5A 1WA5A 3B7GA 4B75A 3GLGB 1A5TA 1UFQA 2AWNA 2YZ2A 2WJHA 3C15C 3LDAA 4KVAA 1IN5A 4QJ5A 5J40A 4QBGB 2WMOB 1TF5A 2QAGA 2QAGC 4XOIA 4QGFA 1GKYA 4HI0E 4A82A 3CRMA 2A78A 1E2GA 2OCYC 1FX0A 1WB9A 1HT1E 1JPJA 1E9BA 4HAYA 1US8A 1SVSA 1P2SA 5EP3A 4XVUA 4LV8B 1P72A 2QP3A 4M9QA 1N25A 4Q4JA 2FZLA 3Q72A 4K81B 3R8CA 3KQKA 3BAFA 3U44A 4HDOB 4GFDA 1KI1A 2BDTA 3B1VA 2XJ9A 1GL9B 8OHMA 1JQLB 2KBEA 2PEYA 3EC2A 1JR3A 1P61B 1J7KA 3C8UA 5KDOA 1L4UA 2PCLA 2JDID 3CM0A 4CEJA 3BK7A 4RFSB 1E0JA 1N6HA 1WCV1 1P60A 2CMKA 2P6UA 3EXAA 4JLAA 5JWOA 5JCPA 2R62A 3D31A 5KSOA 1UEJA 3QE0A 2ZSEA 2GJAA 4PFSA 1G20E 1Z0FA 5FBWB 3SEAA 3CR8A 1U94A 3ADKA 4C2UA 1R5BA 3TK1A 4P4SA 3RNLA 1L2TA 1S1MA 2AFIE 1R5OA 3QG1A 1GL7A 3BB1A 1W4RA 3DEFA 1JEDA 4NYIQ 2GK7A 3PUVA 5JSZB 1Q3HA 1GIAA 3SFVA 3CWQA 2G6BA 3FB4A 1BIFA 1XTQA 4ESVA 2A5DA 2ZSBA 4YXWA 3TSOA 4LPKA 1OXTA 1P2TA 1U8ZA 2WJYA 5EXXA 2YKGA 1NLZA 4X8HA 1NKTA 2ZI5A 1SXJB 2IW3A 4TN1A 4C0HA 3AF1A 4XWOA 1W0JD 4KI0A 2FF7A 5G41A 5TARA 2HLDA 1RE0A 4NCKA 2QU8A 3M4YA 3RWMB 2ZRJA 3VNVA 3T1QA 2BMDA 4DLVA 5H70A 4ZIRB 1ZUNB 4WVFA 2OCAA 2BBWA 2XTNA 2ZS8A 3DM9B 4XD7A 1KI6B 1VECA 2Q9CA 2CCKA 1AKEA 1Q0UA 2OILA 4QBIA 3BFXA 4BFXA 2QAGB 2V7QA 5CIWA 2H17A 3QF4A 4TTRA 4I1SA 1ANKA 421PA 4PO9A 1FX0B 2JLRA 5JI3E 3A1VA 5IDVA 3OIUA 1MV5A 4FCTA 1N3BA 2FMXA 4QXAA 3QIAA 4Q4JB 2VHJA 3U44B 2CNWD 2WOJA 3D7MA 3TJZA 4Z54A 4LRWA 3K0FA 1R8QA 4OQNA 2ZRFA 3SE0A 5HZKA 5JZVA 4RZUA 3ND9A 1GFIA 1LS1A 2RGNA 2RGNC 3IQXA 4ITRC 4Q66C 2YOFA 5FPYA 4L16A 1VG0B 1W4BA 2HXYA 2KBFA 4HB0A 2EWWA 1KKMA 4M1MA 2FU5C 4UXHA 4OI2A 4AWXA 4YDHB 2GHIA 2AX4A 1F6BA 2ZRGA 2JJ2A 2WICA 4EDHA 3DO6A 3FTQA 1FTNA 5FOVA 3VR1A 4DLZA 4R71A 5J4KA 4O3MA 5B2ZA 3LNCA 4RY2A 1IXRC 5JEDA 3K0SA 1OXVA 2OG2A 1EX6A 4Q01A 5KPJA 5AJYA 3ICQB 3CZQA 3QJYA 2AK2A 4HDQB 3BE4A 1QVRA 1UKEA 2ERYA 1KK0A 1TQ2A 1HEIA 1E2NA 1NIPA 1VCMA 1YZQA 4V0LA 4M0LA 3QKSB 4MRRA 3TSWA 3IUYA 5L3QB 1IM2A 2J0QA 1KY3A 2GVZC 1MH1A 1EFTA 1JXOA 3IBGA 3BB4A 1SVOA 4UXIA 2CHVA 2W2VA 2C99A 2VHCA 1L8QA 4CEHA 2C77A 4QHTA 2YHSA 4TSFA 2FX3A 2W2TA 2C98A 3TKLA 4AYWA 3EIHA 3ZS9A 2XZOA 4DVGA 4NYJR 4XH9B 3L43A 3NC1C 3MAAC 4XVQA 2ZI3A 4U5XA 2QMOA 4DB4A 1IONA 1E9FA 4WZBE 4Z1MD 5B64A 1CR4A 1Q1QA 4B76A 5FH9A 3U60B 1XJCA 2PT5A 4N3NA 3RVBA 2BM0A 3VQTA 4KXFB 5EP4A 1R0YA 4Q9JA 3TQFA 1ZD1A 4Y0VA 1D2EA 4NP6A 3QF4B 2JLWA 1T4GA 3BH7A 1FP7A 2QA5A 3CH4B 3OFND 2G83A 3TSZA 5DHFA 4DLXA 4DT1A 1NP6A 3QKUA 5TDHA 3AVWA 1IXSB 2W6IA 4C7OA 3OIYA 5TV2A 4N0EA 4RVCA 3LD9A 1XEXA 4B43A 3TGPA 4DIEA 1QHNA 2QGZA 4R7ZA 4DCTA 3EWSA 4DLUA 2EYQA 5EXPA 5GJCA 3SOPA 4F7WA 1P4SA 1XPUA 2ERXA 3DKVA 4EAQA 2YWFA 1W0KA 4GP7A 1J2JA 3IBYA 3OE7A 4HUQA 3QVUA 4KSBA 2YWEA 4Q5IA 1E9RA 5AR1A 5FTMA 4RD4A 1N5IA 1ZU4A 2QRZA 3E5HA 3NBFA 1Y3AA 1QG4A 1U0JA 4A6PA 1IY0A 3CB4A 5BYJA 3ECCA 4L4UA 1BYUA 4MYCA 3T1OA 3R9XA 4XTCS 4MITA 4PC6A 1NBMD 5AWFC 3LBNA 1E2PA 2ZJBA 3M0EA 4L9WA 2ZRAA 3Q3JB 3WMFA 1H8ED 2FSGA 2NO9A 2IHYA 1A2BA 5LB2A 1X6VA 4G5QA 2AK3A 4V03A 3OIVA 2YWGA 4W5HA 2XB4A 1T8TA 1ZM9A 4Q03A 2EFCB 2ECKA 1DEKA 1E2LA 3DMNA 3EZ9A 5E4FA 3VR6A 4XWKA 2C95A 3K09A 3K09C 3ADDA 4O2LA 2OUKA 3WP0A 2FG5A 2VP9A 2VTKA 4CEHB 1FTSA 3RANA 1XP8A 2XAUA 2WSSA 1XF9A 1E0KA 3B82A 3IILA 1Z28A 2EFEB 3RSOA 4Z8XA 2RH5A 2BEJA 2GJ8A 4PPNA 4B34A 2GBLA 2GBLC 3LAWA 3NDPA 1WF3A 1SULA 3W6PA 1XEWX 4B44A 3LY5A 1W48A 3AGPA 2XXAA 3CWZA 2GETA 2C9CA 1W1WA 3FKSD 3PG5A 4V0ME 5L3VA 1BH2A 3O8CA 1Z0AA 5ANRB 4D4JA 4BEBA 2YJTD 2D3WA 1RJ9B 2PJZA 4B74A 1MR3F 3B1XA 3CF6R 3GJXC 2J0SA 4JLBA 5AJXA 1E1RA 1G1MA 3EWAA 2PMDA 2DB3A 2OBMA 5KUTA 3V4FA 4IJMA 4LJ7A 3EZ6A 1E9DA 1QHIA 4DT1B 4H9GA 3I5YA 4G5SA 3GJ6A 1XCMA 2IT1A 3HJNA 4C7OB 3CRW1 3VMFA 1P62B 3K70D 1LB1B 2H7VA 3TUJC 5CB8A 1C9KA 5J4YA 1KO1A 4AC9A 4BZXA 2GEDA 1W36D 4I4LA 1P7CA 2OBNA 1ZNYA 4JL8A 4RD2A 2IUTA 3CO5A 4EPTA 1NSFA 1D9ZA 3OAAA 4BFSA 3UXMA 1IN6A 5IRCD 1VTKA 2GESA 4LDJA 4NHOA 2CCGA 2N46A 1BYIA 1G18A 2QNRA 3A36A 4URUR 4FD2A 1E32A 1M7BA 1CJMA 3AVOA 3HR7A 4G5OA 4BGDA 1AZSC 3IO5A 1DS6A 2ZRHA 3CRRA 5E7MA 4A0RA 2KE5A 4A6XA 1G8GA 3RDPA 2XNSA 4MKIA 1OXXK 1ZC4A 2QY9A 4Q7LA 2IC5A 1XMSA 3P4XA 1KAGA 1U0LA 1HURA 1F3OA 3TVDA 4AURA 3IEVA 1JR6A 2QQEA 2XOKD 4R2IA 1RVDA 2QP9X 2ODNA 2GK6A 2YOGA 1H8HA 5L3SB 2VA8A 3JZAA 4I1UA 1ZCAA 3MJRA 1E69A 4B3FX 1W4AA 2EFHB 1JBKA 3E2IA 1JAIA 3VHLB 4GI7A 4EFNA 1Z2CA 5FOXA 3G0HA 1FMLA 1G8PA 4GSYA 4Q1BA 3L0IB 1XD8A 2GJKA 4IEIA 4Q9LA 4QBFA 4BQSA 1CXZA 1N5JA 3Q85A 4G5RA 4GL2A 5FUVA 5D3QA 2CLDX 2WVJA 2WWWA 1AK2A 2Z4SA 4OJQA 4A8JA 4A8JC 2BCGY 2IYWA 3KXKA 1R7RA 1VG9B 1RRGA 2ZR0A 1WQ1R 2RB4A 2FN4A 2J45A 3PCRB 2J87A 2Z4RA 5HCNA 3U7GA 3K53A 1XBTA 1R8SA 1DTSA 2IUUA 5KHOC 4OQLA 1I4TD 5AJZA 3DOFA 1JALA 3VU9A 1JXMA 2WWGA 4L5BA 4TQUS 4JYCA 2P6NA 1Q1ZA 2DWPA 4M1TA 4CF7A 4PC2A 2WWIA 1RC8A 1G5TA 4IKEA 2XSZA 1PUIA 5DLQC 1ZBDA 2LKDA 4QBHA 1QZXA 2ZYUX 3TUZC 4HZIA 2IYSA 1P9RA 5B57C 1XXHE 3I8XA 4RKFA 4YC7A 4QC2A 3R7WB 1KDTA 3RRYA 3MSXA 3U4QA 5KU1A 3U3MA 2QBYB 4GOJA 2ODEA 1HE8B 1OH6A 5SZIA 4ZV4A 5EXTA 1SVIA 5ELXA 2F9LA 4TYYA 3FFBA 3TQCA 4Q7MB 4PC1A 4HZUA 2FWRA 1S0UA 2DCUA 4JIMA 4LYHA 3TVTA 2QROA 4OHWA 3CBQA 5DHAA 3VR3A 1HQYE 1BMFA 1KJYA 4WBSA 1S9DA 5KO2A 4M9XA 2CL6X 2JIZD 2REBA 4S2EA 4MH0R 4LHXA 4NDZA 4NKRA 1N6PA 2IYUA 3MRSA 1ONBA 2GZDA 2W6JA 4LC1A 2ZRPA 4ZCLA 5J47A 1DELA 2BV3A 1OHHA 2OT3B 2VP2A 3CPHA 4MRVA 5SZHB 3TBKA 5LD2C 2IYLD 3PUZA 4LCBA 5FBLB 4HAUA 2D4HA 4EUNA 4DB2A 3UWOA 3U5ZB 3FMPB 3ZQ6A 1OIVA 4M1WA 3GLIE 4DDUA 1VG8A 2I4IA 4MRPA 2O0HA 5DGXA 1Z6YA 2VYFA 3AM1A 2V55B 2JLUA 3TE6A 5IT5A 3GEEA 5GJBA 2AFHE 3KQLA 1FW6A 5DYIA 4PPFA 1G8FA 3W5JA 4Q4LA 4OK6A 1SVWA 1N0VC 1NJFA 1LW7A 1E9EA 2O52A 3ASYA 2C9OA 3IKJA 4G01B 4IVRA 3WYFA 5BYKA 4LV5B 4HEJA 3CRVA 4JL5A 2BEKA 2ZUBA 1N6LA 2TMKA 3IIMA 4X8OA 1GRNA 1M7HA 4P3YA 1D2MA 1KDRA 1XZPA 3VU9B 3QPVA 4OL0A 1C4OA 2WJJA 4RCYA 5JECA 2J41A 1G7SA 3T5GA 3QXCA 1G7CA 2G1JA 1GVNB 1E2KA 3SYLA 3EPKA 3THXA 1JEEA 3ZD7A 1CBUA 1SZPA 1Q20A 3RS5A 1M6NA 3SFZA 1XD9A 1ZUIA 4EPRA 2FJUA 5IF9A 3Q8XB 3QVVA 2X8AA 4JVLA 4B3CA 4U7DA 4AI6A 3U7EB 5TB5A 4DCSA 4HAVA 1J8YF 3U4QB 2Q3MA 3ZZUA 1TMKA 3E1SA 3WHLA 2WBLC 1P5ZB 3U3JA 5HKKA 3WNDA 4OHZA 5FUWA 1UM8A 2QPTA 3B9QA 4XSGA 2ZYWX 4WA7A 5FL7A 2D62A 1HH4A 4HZUB 4EPXA 2CCJA 5EE1A 3SQXA 3IQWA 1NRJB 1YZNA 4LJ8A 3T12A 3A37A 4D25A 4GZLA 1AKYA 2E9SA 1EK0A 1WRBA 1LS6A 2H5EA 3A4MA 2IUSA 4IDOA 4P31A 3SJAA 1HY3A 2CHGA 2DR3A 4CT5A 1LNZA 3KFXA 3I62A 5LD2B 3RRNA 4V0MA 3RC3A 3C41J 4B3GA 4P4TA 4B2LA 5D3MB 5EJEA 1XU4A 2WKRA 2V6JA 2ZEJA 4N1AA 5TY0A 1E99A 1L4YA 1XTSA 1VHTA 2H8KA 3MFYA 3QEOA 3T1VA 4P33A 1VYTA 2OXCA 3AV0B 521PA 3G82C 1K5DA 2O8CA 1YR6A 2AL7A 3NHBA 4R98A 4ZI3A 3RRZA 2V4ZA 2J7PA 1MO4A 2VLIA 2ZS7A 2LCFA 4GMDA 3A4NA 3NEYA 1OT3A 4C30A 3H86A 3I72A 3SHFA 2FFHA 1GOTA 2REXB 1S4QA 5EP2A 2RHDA 2C5LA 2GF0A 4BPBA 5G53C 3C5CA 3H1TA 4A2WA 5HPYB 4F4CA 1KMQA 3EPHA 1FFHA 3K0AA 1ZM7A 1ESMA 3PEVA 1Z0IA 2AWOA 3BFVA 3L82B 1UJ2A 5GADl 2A5GA 3E70C 4BLOA 1G21E 4QKQA 2WHXA 4IFBA 4UNPA 1CR0A 3I32A 2PEZA 4F4IA 3QXXA 1JR3D 4QFMA 2F3TA 1Z0KA 3CF0A 5UKDA 3TUIC 4B35A 4FWTA 2ZETA 3LX8A 5JSZA 3KQNA 1JAHA 4FW9A 1AZTA 2YV5A 2C04A 3ZH9B 3DL0A 4B2IA 4AYTA 3GLFB 3EARA 2PBRA 3MWYW 2DY1A 5DSZA 3SC3A 3T1TA 3FMIA 2WZQA 3HPQA 4IDQA 4UNSA 1U90A 3V4RA 5C4GB 3NBZC 3ZVLA 4TMVA 2WV9A 4HAWA 4WXPA 2PLFA 4DSUA 1FZQA 3CX6A 3ONWA 1CKEA 1KI6A 3WRXC 4LJ4A 3ASZA 3FFAA 4W7SA 1IXZA 4BLSA 1KK1A 1GUAA 1W49A 2HYIC 1KSGA 3AGQA 2ONKA 1VIAA 4B3XA 1MRSA 2A7QA 4DSNA 3K9LA 1HE1C 2IYXA 3AP1A 4PXAA 4DLTA 3BWDD 4LYAA 1OIXA 3FHOA 3UATA 3RS0A 4N0DA 4PSKA 1GG2A 3FPAA 4YONB 1LF5A 3JVUA 2CLCX 1IBRA 1Q22A 4RSGA 3TR0A 3QEJA 5JS8A 2EFDB 1ZAKA 2JLYA 2HLDD 2ZRCA 4JLDA 4Q1AA 4NCHA 5EXSA 3QPUA 5IK2A 2IA5A 3VHXA 2O8CB 2B8TA 4ZCIA 4CIDA 4M2LA 2FH5B 1KI9A 1AJEA 4XD7D 4KO8A 2QUZA 3F8TA 4LV6A 1OYWA 2HYDA 4LUCA 4BE7B 2V7QD 4Z8YA 4ASUA 4C9BA 1JI0A 4ZCMA 1MOZA 3KKNA 1VIYA 2CVHA 2EFGA 5CIQA 1OF1A 1X1SA 3K0AB 5AJWA 3ZD6A 1FNMA 2Z43A 1XXHA 1W7AA 4K46A 1KKLA 2H1LA 3REGA 1HV8A 4D6PA 3NH6A 2JJ1D 3NH9A 5KOYA 3FMOB 3B1WA 4H1VA 2CE7A 5L3QA 3QKSA 3DZDA 4Q1CA 4L15A 2W0SA 3KKOA 2V1XA 2ORIA 1TPZA 5K8UA 1PVOA 1W2HA 2OCBA 3OESA 1W44A 5KNBA 4Q00A 2JJ2D 3GP8A 1FUUA 1E6CA 2GJSA 2Q0HA 3I61A 1G3IA 1PLJA 2ORWA 2W00A 2WJIA 1ZRHA 3FE2A 3LQQA 3ZZTA 1G3RA 1TL7C 1UBCA 4LJAA 2FEOA 4XJXA 3PUXA 4B73A 2KI5A 2UKDA 4JLNA 4OJKA 3T34A 4IRUB 1ZD9A 3R9IA 3B13B 1UDXA 1F2TA 2QSYA 1SVKA 2FPMA 4IDPA 2GXSA 5E7IA 1TNDA 4XWAA 3SN6A 3BH0A 1KYIA 4DBLC 2J59A 2ZTSA 3QSYA 2QSZA 3EC1A 3QPWA 1JQJC 1W5TA 3GLIA 1TUEA 5FTKA 1YHNA 2PLRA 1VHLA 5CK4A 1VPLA 3A1WA 1IAQA 2O8BB 1E2DA 4I1OA 3C16C 2WKPA 2AD1A 3LXXA 2R6DA 1KIMA 1MKYA 4NYMQ 4TSFD 4MDFA 5P21A 3HU3A 2F1IA 4C0AC 1XWIA 4U00A 1FQJA 3L2OB 3EA5A 1HYQA 4NU0A 5EE5B 2F43A 1S3SA 4QJ4A 2JDIA 2OV2A 4ZKEA 2WMNB 2FZ4A 2AKAB 2RGBA 3AEZA 4URWR 3I1FA 1KSHA 2B21A 4YQFA 4X8LA 4LC0A 4Q9IA 2ZSFA 1NN3A 5F3WB 1N0UA 3MWKA 4V0NA 3S1AB 2MSEB 2O8FB 2I3BA 1KI4A 2IF0A 1DAKA 1LVGA 3OEEA 2IX3A 3NXSA 3UIEA 2DFTA 4HB2A 2D2EA 2Z6VA 3L8ZA 4BLRA 4IXNA 1FQKA 1K8RA 2VRWA 3PR1A 2Q6TA 1CJVC 2G0NA 1ZNXA 1OB2A 1QBKC 1U8YA 3W3AA 1XXHB 1NMYA 3IPYA 1KK2A 1WMSA 1AS0A 5E3HA 4CRWB 1T5IA 4MKGA 2W6ID 1S9HA 2DFNA 3THWB 3CF2A 4F91B 3TAUA 1XDBA 1E2JA 2IXGA 5GJWC 2BMEA 4W5JA 1E79A 2WWHA 3KKQA 1B23P 5LDDC 3VTKA 1W0KD 2GILA 3OE7D 5H68A 5C46F 1VYVA 1QHYA 5CB6A 4A15A 3TH5A 2HCBA 5JHHB 3CH5A 1T3SA 5JJKA 1VMAA 1HT2E 4YLGA 1NLYA 3KQUA 4UKDA 4TL7A 4NH0A 3LRPA 4L9SA 3B9PA 2JLQA 3LA6A 4EIWA 5KTYA 1VCNA 2GVDC 2WKQA 5JLJA 4BASA 4PQYA 5J4HA 1F2TB 2Z83A 1NVVQ 4NTZA 2HEIA 1R5NA 2V54A 3QQ5A 1EESA 4FXPA 3CKLA 5A5GA 3GLIB 1RJ9A 3N70A 2BHRA 2JGNA 3SHWA 1EFRA 4URVR 4B32A 4IFEA 5G3ZA 2VBCA 1NNEA 2HJVA 5JFGA 3M1IA 3M6AA 5FI0B 1KJZA 4DIDA 2WSSD 4GRAA 4D4LA 3ZJYA 2IYQA 2PX3A 5HZHA 3ZVNA 1NN1A 2F1JA 2GEUA 4D2IA 4WXRA 1W2GA 4TMTA 2F7SA 4BRUA 3KKMA 4KU4A 4W5WA 4FWIB 2F43B 1EGAA 2CK3A 2OEPA 2VSFA 1NG1A 3VX4A 2NZ8A 2VSXA 1JPNA 1S8FA 2JATA 2B7CA 2P6RA 2Q9BA 3N2IA 1PLKA 1BOFA 2OCPA 4KV9A 2NO7A 2ODBA 4DEXA 2YINC 3D6TB 3EASA 1UKZA 2VQSA 3OHMA 2R2AA 4M8NE 4C0QC 4CDGA 3OEHA 4LBVA 4EKDA 4G0NA 2V8OA 3TNFA 3DKPA 3T61A 4A2QA 5G40A 2OAP1 4PZLA 5FOWA 1E3MA 4YMUA 3IIKA 1A1VA 1Z22A 1UF9A 1SKQA 3CNLA 3GLHE 4JSTA 5BN3A 3VX3A 1CULC 1DVRA 3PENA 1AN0A 4JL6A 4Y0AA 3VR5A 4CT4B 4EFLA 4FN5A 3KFVA 3K1JA 1AIPA 1DARA 2J0VA 2J5XA 2REOA 2OLJA 1G3MA 2VH5R 3D8BA 4MKHA 2GCPA 1Z6TA 4NYIR 4AIIA 3BXZA 1EG7A 4GOKA 2W0MA 5KNCA 3GLFE 1ZIOA 4LJ6A 1R0WA 2D74A 5J5CA 5CDFE 2IEYA 1ZINA 3SYKA 3AF4A 4UJ5A 2KB0A 4QM7A 3NC0C 4DHEA 2GEVA 1ZC3A 4DUGA 5L3SA 2O0KA 2F55A 1UBGA 1TEXA 1KHTA 3OAAD 2GXAA 3VFDA 1KO7A 1Z06A 5FOTA 4LBYA 1NN0A 3SR0A 1COWA 3FOZA 121PA 3B1ZA 4V0KA 1IN8A 1YJ5A 3L0OA 3DMDA 5HR5A 2J9RA 1XX6A 4BRWA 2AHOA 1E4YA 2NIPA 1FP6A 3EIQA 1S96A 4B48A 1XJQA 1G41A 3C14C 5L8VA 1KGDA 5KNDA 4TYPA 4NYMR 2BOVA 5EQTA 3WP1B 4DCVA 1NG9A 2UVQA 3GJ7A 1E2HA 2CBZA 4FMCF 3KDSE 4XTRA 2X2FA 4UNQA 4WOPA 3QG5A 1Z63A 2BWJA 2IYZA 1H8HD 1BKDR 1R2QA 4NL4H 1OFHA 2HF9A 3DOEA 2WWFA 2ZJZA 3QOFA 1UAAA 2DHRA 2N1BA 3QUSA 5AUNB 5H1YA 2XGJA 2YVUA 1DE0A 2NO1A 3QBVA 4E09A 4OQFA 3PIRA 1G6OA 2Z0MA 4L8GA 4ACAA 1CEEA 1UBFA 2CJWB 1JB1A 4PC3A 2A5JA 2F1RA 4LBWA 4TMWA 1KJWA 1OXUA 3EZFA 1AGRA 2GRJA 1U81A 4KFTA 3R7WA 5G3YA 3RABA 3WMGA 4BLQA 2VPPA 1TUIA 3WBKA 4JMPA 4HUTA 2VF7A 4DDWA 2QBYA 3GJ3A 2W83A 4BWYA 2YOHA 4GOXA 1D2NA 1G4UR 4A4DA 3BD9A 3EG5A 4FMCB 2QG6A 1OSNA 1I2MA 2ZU0C 1YZKA 4UXJA 5DO9A 3ETLA 3NDBB 2XITA 3BH6A 1VG1A 3SJZA 5EZ5A 2DYKA 3FDIA 3QNUA 1YZGA 1ZNZA 4HATA 1AS3A 3EIEA 4Q4HB 5JBQA 1YR7A 1AM4D 1ZD8A 3L0PA 2P67A 3K0EA 4Q9HA 4A1FA 3BS4A 3IIJA 4TLEA 1WXQA 4Q1EA 4OQXA 4PAQA 2ONJA 2ZREA 2ZVPX 3FMFA 4ARZA 2O0JA 4B6FA 2FDCA 2ZRLA 2BVNA 2YYZA 1UKYA 1W4CA 4LYJA 4C0LA 2IS1A 2H16A 5CLLA 1K5GA 2YNMA 3SBEA 1II0A 3FKQA 3CZPA 4B3DA 3RS7A 1QHSA 3CUEF 3D3QA 5FPHA 2GCNA 2WJVA 3AF3A 3FKSA 4LJYA 4LY6A 2PZFA 4RZ2A 5JWHA 4WIAA 3PV0A 2O8EA 3T35A 2ZROA 1U2RA 4MGIR 4DC9A 1BMFD 3GEIA 1QF9A 2WPDA 1NL3A 4BECA 1XJ0A 1Z08A 5KSYA 1E1QA 3ZLJA 1BS1A 5FTNA 3WYAA 3AVXA 2N42A 1PJRA 2FEMA 2YC2C 5FBVB 2P5TB 3LW8A 1KI8A 4PQFA 2X77A 3ZGXA 2BCJQ 1OHHD 1VDZA 3ZYCA 3U7FB 3P1JA 3K70C 1OH8A 2OAQ1 2JLXA 2IEZA 1UADA 1OB5A 3IDQA 4IXMA 2C2HA 1G16A 1W36C 4M1KA 4AKIA 2E1RA 5FOSA 4GBMA 1CR2A 1Z6AA 1NN5A 3ADCA 3AUXA 4EQ6A 2NG1A 5A4JA 2XB2A 2QE7A 3UG7A 3DZ8A 4M1YA 5A0FA 1ZYUA 3MCAA 4FIDA 3KQHA 1NKSA 2QZ4A 4WAUA 4C4PA 3UMFA 5BN5A 2R44A 2F6RA 4ZI2A 4PO1A 1GRQA 3REFA 2PZEA 2D7DA 4QL3A 3P26A 2GA8A 3QXJA 1DAGA 3DVLA 4M1SA 2Q9AA 1TQ4A 4MGZR 3IGFA 3ADBA 3NEJA 5BN4A 4E5UA 4MRNA 1J90A 1XD2B 2ORVA 3A4LA 2PH1A 6Q21A 3L0SA 2ZXUA 4MUAA 4US1R 1D8TA 3U6KA 2HT6A 4LHYA 2PZGA 1Q3TA 5CJ2A 3EPJA 2ZUDA 4BFVA 3ZZ0A 1GILA 4TQAA 4ARZB 3R8FA 2XZPA 1PUJA 3MGCA 1QG2A 4E22A 1ZM3A 2VF8A 2J1LA 1M7GA 1UKVY 3FGNA 3BGWA 5M04A 821PA 4RZ3A 4KFSA 3IO3A 4QNMA 1V5WA 5D3MA 5HKKD 3U7HB 4IDNA 3IEUA 2QI9C 1Z2AA 1Z83A 1N6RA 3AKYA 3KB1A 4ZDIA 4XIGS 3NBXX 4ZDJA 4PAOA 3MD0A 4KODA 4QGHA 3X1XA 2WWYA 2BMFA 5FL7D 5LB4A 4KHZA 2W2XA 1PLLA 2AN9A 3VNUA 1C1YA 1KAOA 1OIWA 3KX2A 2WWXA 4ESHA 2D7CA 2O8EB 3C4JA 1FPMA 1YZUA 4MUBA 2IS6A 3U2QA 3CLVA 2NMVA 2XNDA 3THOA 1OKKA 3PUWA 4EPVA 1D9XA 4KITB 2FE4A 3PUYA 2UZIR 1YRAA 2FPKA 2OM2A 2P65A 2IS2A 1ZW6A 3GJ4A 1E94E 1H65A 4TTQA 2A9KA 1CU1A 3LXRA 4RD1A 3K70B 3QY0A 4JBYA 1DG3A 1TQDA 3AP3A 4KJZA 2NPFA 4D80A 2ZR9A 3IHLA 1EFHA 1W36B 3B5JA 3B8HA 1EX7A 2ZANA 4IVQA 2DPXA 4O0MA 5DNYB 3RLFA 2FFBA 4AD8A 1SKYE 2OLKA 3ZDQA 4EQ6B 2BBTA 1G19A 2J7PD 1N0WA 2MMCA 2C9YA 3AKDA 3QI2A 4LJ5A 2ODWA 1E2EA 2R9VA 1GKUB 1XNJA 3WHKA 5JCZA 1EWQA 3P20A 2IWHA 4BZPA 3GLFA 2ZPTX 3W90A 4PAMA 1XEFA 4RD3A 4PTLA 5FBRB 4US0R 5FR2A 2CEAA 4TT3A 2GKSA 2JASA 3TIFA 4LZZA 1KY2A 1HUQA 4DSOA 1ZCBA 4XSHA 3K0CA 1LFDB 3K0CC 4GMXA 4QG7A 3GD7A 4RKEA 4C0KA 1XPOA 1UDWA 4KFRA 4ZKDA 5JEEA 1G8YA 2RKOA 5C18A 2ZYVX 4BUJA 3U3RA 2NPIA 2WIAA 1UEIA 3LVRE 1EXMA 4IDHA 2P2LA 3ZIAA 1QRAA 1R6BX 4NCNA 1G3QA 2X19A 2LWIA 1KI7A 1G64A 2ZI6A 4YDSA 3QF7A 5SZKB 4F4JA 1F60A 2D2FA 1RZ3A 2QMHA 4BFZA 3ZQJA 3MLEA 2WOOA 1SXJD 4EJSB 2QGNA 4Q4AB 3B85A 2ZI4A 5CYOA 2OBLA 2VSOA 2ZITA 4GT1A 3B6EA 2WSMA 4UQOA 3N5CA 4HB4A 5CITA 2BC9A 1OXSC 1RW4A 3KZ1E 4G3XA 3V9PA 1RRPA 1CLUA 2ZE5A 3LQRA 4C0BA 4MYTA 4YMTA 1OH5A 3V00A 4MYUA 4OQMA 5GVRA 2BJVA 4S35A 4BFYA 1PV4A 1LY1A 4JVMA 3VR4A 4QRHA 4DSTA 1Q44A 3OF5A 3I8SA 3LW7A 3JZMA 4I1VA 5KPDA 5JMTA 1QHHA 2CL0X 5JJLA 5AUOB 4CEIB 2P5SA 2EU8A 3A8TA 5HE8A 4QM6A 4NZYA 2JLSA 4HLQB 4A9AA 1FUKA 5EP1A 2L0XA 5C2JB 2CVFA 3UMRA 3NVAA 3THYB 1T8UA 3LBHA 2RGCA 3LFUA 4BEJA 1DAHA 1E4VA 4MGKR 1X1RA 1T91A 3G5UA 1DBSA 2HDNB 3CRQA 1YRBA 5FPTA 1N5KA 2QM8A 4JSYA 3AQ4A 1E98A 3LLMA 4MKFA 3AKCA 5CJPA 3VR2A 3GLHB 1KOFA 3TW8B 2QQ0A 2RGAA 3MUFA 1CS4C 4DLRA 5HTKA 2YC4C 1B0UA 1NY5A 1OFIA 2UZ3A 5DN6A 1FNNA 3PEYA 4CGZA 5JJIA 4ASUD 2HF8A 1TU4A 1G8HA 1F2UB 2CL7X 5AJVB 2G77B 2ATVA 2I1VB 3I92A 4LOAA 5CM8B 1WE2A 1MT0A 2BBSA 4B3BA 4TMXA 4PSVA 4JJKA 4F38A 3MG9A 2V1UA 4AYXA 4AG5A 5LPNA 2ZRDA 5BWMA 2AR7A 4FCWA 4LSGA 3N2EA 3L8YA 2ZYTX 2JJ8A 2NTYC 4A0GA 2VHTA 3WNCA 2EWVA 1U99A 4OYHA 3AVYA 4DCNA 2O8BA 4LBZA 1M34E 4Q48A 3HR8A 1OYYA 4YXWD 1CRPA 3LX5A 4WW0A 4EFMA 3UG6A 1RKBA 3Q5EA 3EZ2A 2BKEA 3QXSA 1GP2A 2A30A 4URXR 1TQ6A 5J4LA 2H18A 4M21A 4NYJQ 5C4MA 3H0KA 3EA0A 5DI9A 3CIOA 4BFTA 1M1YE 3RAPR 1T9HA 2HT1A 1QHGA 1IY2A 2J0UB 4LYFA 2F3RA 5KSPA 1YKSA 4RJLA 4JLMA 5L3RA 4GPTA 3T15A 3S1AA 2O8FA 1IN4A 2RGXA 2QEQA 4TYWA 1S1CA 5DI3B 2OFOA 4RD6A 2OO7A 2ZRKA 3CX7A 3DPUA 4JLKA 5JWRA 4KVGA 1O3YA 3UMSA 2ZJ2A 1VKJA 3BFKA 3OZXA 1QHHB 5KDLA 4D0GA 221PA 2IL1A 3KKPA 4MQBA 2A5FA 1IN7A 2OZEA 3ND8A 4ACBA 2EW1A 3GJ8A 3R9WA 2ZVQX 1RYHA 5FOUA 3THWA 4D0NA 4NPHA 5FTLA 2FGKA 1GKIA 3H2YA 2BIFA 4JS0A 1NBME 4KBFA 5FPKA 3EX7C 2WTUA 1GNRA 1T0JB 4WZAE 1F48A 2O5VA 4UJ3A 1P9WA 3HWSA 2JEOA 2KWIA 1G291 2BJWA 4R9UC 5FTJA 3LVQE 2OXRA 3OEED 3SJCA 4DXAA 2HV8A 2ZE6A 4WZ6A 1T3HA 4P0TA 1NIJA 3VAAA 2NQ2C 2EQBA 5CK5A 1RPZA 4IOMA 1EFCA 3AF2A 1E0AA 4DZZA 1U8AA 2ZJOA 3HP1A 3IPXA 3O8DA 4OK3A 4M4SA 3BBPA 1E9SA 1E79D 3FWYA 1GTVA 2IS4A 1P73A 2VP4A 2ZSAA 2ZRMA 2RCNA 2R8RA 4C0JA 3WXMA 2IK8A 1CRQA 1SVLA 3SJBA 3EW9A 4ABYA 1NVUQ 4W9MC 5F2EA 4TLDA 5SZJA 1N6KA 3HPRA 1KMHA 5E95A 1Z0JA 1I2DA 5FI1B 4IEEA 3EZ7A 2QENA 4ZO4A 4CYMA 4Q1DA 2OESA 2G0TA 3KJEA 1ZM4A 4KFUA 2PCJA 3BERA 4BFUA 4DKXA 3O8RA 1YZTA 3K9HA 1CIPA 2I1QA 4HB3A 3C7KA 4O25A 4Q21A 1T0HB 1ZNWA 2FOLA 4F92B 1XRJA 2XX3A 1YZLA 3QENA 1GITA 4PHGA 3NKVA 4MGYR 4YMSA 3WYGA 2NGRA 1US8B 3VKGA 3CNNA 1KO4A 3GJ5A 1EFRD 2ZAMA 2AXNA 2QT0A 2EYUA 3CW2A 1DAMA 1JJVA 2JJ1A 1IJEA 2J7KA 3W5IA 3DDCA 1CJKC 2H57A 2NO0A 2IYVA 3KXLA 4LHVA 2GNOA 4KCGA 2CK3D 4POAA 1MO6A 4OI4A 5EE9A 4D82A 3KJHA 5DH9A 3RWOA 4CEJB 2PL3A 2BBOA 2QTVB 4JLOA 1KSFX 1GRRA 2ZI9A 2QL6A 3KJGA 3OEHD 4Q18A 1W0JA 1EFUA 2Y8EA 1MRNA 3P4YA 4TLBA 4OHYA 3TR5A 2ANBA 2VHUA 1JNYA 1CR1A 5LBIA 3SZRA 5JRJA 1AGPA 4JBWA 4DJTA 1GNPA 2ZQ5A 1ZVQA 3NTUA 4FMBB 5H8WA 4CVNA 4I81A 4P4SB 2WAYA 5CM9C 4ILEA 4U02A 3UPUA 4OI1A 4MDEA 4AKEA 3PEUA 4GP6A 1OFTA 1TF2A 5DE3A 5C1BA 3HDTA 2IHBA 2GAAA 4HDCA 2PMKA 1I4LD 1X86B 1XTIA 3LO5A 2B6HA 1YU9A 1SHZA 5AUQA 4NBSA 1KDOA 3QKRA 1ETUA 3W8RA 4IHQA 1KI2A 2CNWA 4JLJA 4BLTA 4DUGD 1KO5A 3WNBA 1T3LA 1HA3A 1KMHB 2GZHA 2RGGA 1Z29A 1NY6A 1G6HA 2Q3FA 5B30A 1COWD 1KSJA 1NVXQ 3GCGA 3LV8A 3RYTC 3O8BA 2IWRA 1WP9A 1Z3IX 2CJWA 1Y63A 3CPJB 4DLSA 3AVPA 4TL8A 3O47A 3X1ZA 2IXEA 1IOZA 1E2FA 1VCOA 1ZJ6A 2CHQA 3HU2A 1P75A 3UKDA 1KZGB 1XEWY 1HQCA 2QPAA 2QRNA 1LV7A 4Q7KA 1KNQA 2XEXA 1E2IA 1WBDA 2P3SA 3AB3A 1TAGA 3FVQA 3JVVA 2MSCB 2RGEA 1E1RD 1SKYB 4FCVA 3SNHA 1NI3A 4A0HA 3K0FB 1OE0A 1RRCA 2PT7A 4M9ZA 2ZIAA 3HYTA 4B2PA 1G17A 2GZAA 1SGWA 3MWLA 4QHYA 3UK6A 2FPLA 1Q57A 4Q4HA 3TRFA 3GMTA 3WMEA 4NE2A 3AH8A 2J3EA 1R4AA 4HLUC 4HLUA 5J4VA 4DDVA 3DM5A 5JRZA 3GFPA 5KSZA 4AG6A 2GCOA 4HAXA 4DCUA 3Q5DA 1YE8A 4Q47A 3AVUA 3U61B 1YVDA 4NONA 3AVTA 2DBYA 1KTVA 2IF2A 1Z47A 3IHWA 1G3UA 3T06B 1TU3A 5F9FA 3WBJA 1O87A 4ERNA 1P2VA 1KZ7B 1P6XA 1XMIA 4LJ9A 5FBQB 4Z1MA 1FOEB 2H92A 1I4DD 4PPQA
chains in the Genus database with same CATH superfamily
1XTJA 3EGDB 3SU8A 1U0BB 2P0AA 1MJGA 4TLMB 5C80A 3SI7A 4P7KA 4JLVA 4Z9YA 2CFIA 2W6OA 4OV6B 5AW0A 5EHZA 1IQRA 4IDBA 4G2NA 1CJTC 3LFHA 2AEJA 4EA9A 3BAZA 4TN5A 3EOAI 1PJQA 1E2MA 2QSUA 5KKAA 2HRCA 3BWBA 2C8LA 2PH3A 1NVWQ 1VGVA 3PB3A 4UNNA 4X1KB 3QWIA 3RROA 4DMMA 1SOVA 4EPWA 3FUTA 1HL7A 4MV3A 2AUMA 2QLNA 4EA7A 1YNSA 5AJUA 1D6JA 1F1JA 3WLNA 3HCEA 4CM3A 3RVKA 5JYBA 2ZQZA 3QITA 4FMDF 1X19A 4O4HF 4B4DA 4DXHA 4EY3A 3L40A 4OP2A 4PGGA 1LDMA 4M98A 5BRAA 3WLKX 2NSJA 4FKBA 3ZHZA 2WWTA 1PFKA 1ZCJA 1TFUA 3QIVA 2RHTA 3WHPA 4PLPA 5HIAA 1E8MA 3MUOA 3LUFA 5JMOA 2RAPA 2PKXA 2JLVA 4JJ7A 4D9NA 1Z5ZA 1ZIPA 4OHXA 4TMYA 4UNRA 2PZLA 3RUDA 3IVCA 1Q16A 2D5IA 4AO6A 5DHUA 5E9QA 1E1QD 2BM1A 4XAQA 4DSZA 1H5QA 3D5TA 3I45A 4KYUA 4B47A 1Q21A 3OPXA 1H22A 5CBPA 1DFGA 3H84A 3QXGA 2P9GA 3D7NA 1XD2A 2UYYA 1FFWA 3C6YA 2LZ0A 1IQPA 1NFFA 1SHKA 4M22A 1P7YA 2X0NA 3HYRA 3U81A 2FA9A 4DDTA 4ON9A 1X87A 4Z4GA 3F8SA 1GWNA 1SPBS 2EGUA 2ZSUA 3IR6A 2OHGA 4H3KB 4MA4A 5KC9A 5DLPA 2D1YA 1T9KA 4RTNA 1WR8A 4U2CA 1A96A 1TJPB 3MJEA 1R6XA 3SZGA 4Q19A 2NU7A 4YP0A 5AVZA 1K9SA 4Q6WA 3PC6A 3E2PA 3RHSA 4ZDKA 4LDNA 1H2XA 2XWBF 4K6GA 4KQEA 1W46A 1L7DA 3B20A 5DIFA 4A92A 4B0OA 4CM7A 2Y1KA 2CGEA 2FNAA 1N6NA 1NJGA 3E15A 5B7PA 4DILA 5K3FA 4X91A 1PZMA 1GFSA 1YB2A 2HPVA 4OHVA 4PGFA 4PANA 4LE1A 1HFEL 4TYQA 3VM6A 3I9V6 4PG5A 1M2HA 3SYRA 3TTWA 3E84A 4BXOA 4A8PA 3QBTA 1Q91A 5J2TF 5AM5A 5F52A 3W2TA 3SNKA 2EKZA 5H4GA 3PEWA 4PHTA 3UNXA 1Y3BE 1LSJA 3R8XA 2DY0A 3I2HA 5I9MA 3FOCA 1PNRA 1KFKB 4FGUA 1WM1A 4G6ZA 3T3EA 3N8NA 2O8DB 2Y1GA 4PZDA 3MJ4A 2RK4A 3EPRA 1D4ZA 1PJ3A 2QTFA 1BMDA 1WVIA 2EBUA 4KTTE 4PG6A 4X54A 1C0IA 2ESRA 1N5LA 1QXSA 3MMPA 4OBWA 1AQUA 1CUAA 1PJCA 1XLWA 3GYGA 4C06A 1SHJA 3DMTA 3DMTC 4TZ6A 1SKUA 3DE7X 3WQHA 4C2BA 2V7UA 5F51A 3FPEA 3VR0A 4DA7A 4YJHA 3J81k 2WAXA 1P39A 3GPIA 2GYUA 3TLXA 3ZU6A 5EQJB 2WTBA 4TMKA 3UOGA 1MX5A 1A4UA 2D1TA 3VKHA 1BD4A 3MOGA 1LVHA 5CT9A 2CDRA 3GVPA 2FW9A 2YN0A 5ALPA 3UYKA 1T5TA 4EG7A 3TOCA 1O96A 3P5BA 1G63A 2UZ4A 2I99A 5CYPA 3VYTB 1MABB 2YWHA 3AR4A 2BM9A 3PJGA 1KVSA 1OKKD 5CCDA 3RC8A 4MR7A 3PS9A 2G9RA 3EEIA 1SNYA 1WW3A 4HWTA 4LK2A 2IYRA 1P1KA 2YX1A 4JT2A 2Q7OE 2GJ9A 4XWWA 2KJQA 1DU4A 1L5KA 2O8NA 3V1YA 1WZ2A 4I36A 1ZMXA 1NI4A 4ZYWA 2DUWA 1R9MA 2H0AA 3JWPA 3K4PA 3DPSA 4JC0A 1XPRA 3UMJA 3V1UA 4LOIA 3H8WA 2V7VA 1M8FA 3KUDA 4MRSA 4PZYA 4YRFA 1U3CA 1RE1A 4G5FA 1U7PA 4B9EA 3ANSA 5C35A 1ND5A 3P0EA 2JH3A 3GDWA 3KAPA 1YFLA 3K6SA 4TTPA 2OV4A 1UQUA 1VZ2A 3B38A 3GFGA 4RVOA 1KQOA 3STXA 5J2UA 2A35A 2Q5OA 1HTWA 4LI0A 4UEOA 1GDDA 2QHXA 3HA2A 5EAIA 2HBZA 1P2UA 5H81A 1UXOA 2X76A 3EEFA 2VHXA 2HU5A 2Q21A 2F00A 3COPA 2C4UA 5E6UB 1EFKA 2A9RA 3DWGA 5BSEA 1NW3A 2P2ZA 4BB5A 2YCLA 1NX9A 2QTHA 2CLMB 3AM4A 1NMZA 4QXQA 3W8NA 1CDZA 5EZ6B 4KE9A 3I4LA 1XZQA 4FINA 5EE0A 2PL5A 4QD3A 3FOEC 4B7CA 4ZRNA 2H5JA 1L7NA 3CZ4A 2BP7A 3ZE8A 2OHJA 2GYYA 3HM9A 4QGBA 3FR8A 3R76A 3RVJA 4LKRA 3AC0A 3R7SA 1TKCA 3DQQA 3AHJA 1IVYA 1DQNA 4GM1A 4PM4A 3RB8A 4U7TB 4ZPXA 4EG0A 3LBFA 1R0ZA 2CLHB 1D1PA 1M2VA 1U8FO 3O3MB 3V3TA 4Q7JB 4YAKA 3C48A 3NBYC 1IM8A 5M34A 2YRFA 3PFWO 4IQ0A 1PV2A 4LYGA 4JC4A 3KP1A 1TVKA 4MVYA 3LLUA 4ZQEA 4HYYA 3W6NA 3WB9A 4ER3A 3DFKA 3BJIC 1YWGO 1Z6GA 1Z07A 3AVQA 3U4GA 3A6PC 3NBKA 4E07A 1P91A 3Q3HA 3QLTA 3WWZA 3CX8A 5IVKA 4BLUA 2NSHA 2VDWB 3WAKA 1BDIA 5JOQA 2R6FA 4J3NA 3FCAA 1XK7A 1T10A 4G09A 4YO8A 3W4JA 1VCIA 4BNTA 4F8JA 3FSGD 1P1CA 1X8XA 4MAFA 1DPFA 1DKRA 1MO3A 3CSDA 6REQB 4K05A 3WRWA 2SBTA 3HYLA 4RDCA 2MSKA 3EGIA 2P3OA 3TOXA 4HGQA 4IJWA 3VR6H 4WECA 4JCCA 5LQAA 1NC3A 3IAUA 5A03A 2NZJA 2F9MA 3WQQA 3T7JA 3BL8A 3T5MA 3FROA 4ETWA 2Q3BA 5EUCA 3IESA 1J97A 4GH5A 4KYIB 4B6JA 3ED1A 4XDHA 5HDBB 1QO0A 2QV7A 3PHJA 4CZ2A 1DO0A 5HCIA 1EP9A 3SFTA 2FW6A 5L6MB 3KTAA 3HN7A 3HUUA 1N0IA 5CDFA 5HUHA 4WCVA 1ADBA 2P8SA 2I80A 3VU8A 1NLFA 5ES3A 4EVSA 3AVVA 4YBRA 2G9NA 1J8FA 3EVFA 4BRZA 4YHBA 2X42A 3KE8A 4R8RA 3WQBA 2ZE8A 5CLQA 4RQUA 3RPEA 1U8UA 3I0NA 1KVQA 3W3ZB 3IL2A 2XT0A 5JHGB 2C78A 3RC9A 4XX1A 3E35A 3ILXA 2PX0A 2WM2A 2HWXA 4RCZA 3VR2D 3DLBA 1NJ5A 4FI3F 4Q9KA 1U28A 1U28C 1XDGA 3KK0A 4JEIA 5AHKA 5EUMA 5IJWA 1L5YA 1YRHA 4QOSA 5JADA 4BDSA 3ST7A 3K1TA 3BILA 4CN8A 5BVHB 1SCKA 3HTXA 1XA4A 3GT3A 1C7IA 4G5GA 4PQRA 3THRA 1QYWA 1UBEA 1YS9A 1IEXA 4TLAA 4AJ1A 5K3EA 5DOZA 2DTEA 4QXPA 4BEWA 4IJQA 4E03A 3HBLA 3I6MA 2EFYA 3FNQA 1OFUX 1V25A 1GGHA 4KUGA 4RLHA 2XCUA 5IUJC 3GPBA 4XPIB 2X0FA 1MN6A 3QV1A 4H4DA 3MWJA 4JFRA 1ADYA 2JLBA 4X6XA 1BWRA 1EFVB 4L7VA 4DR7B 1MX9A 3P32A 3IERA 1GZSA 2OP0A 4QUJA 5IHPA 1TIBA 4KQHA 3I5AA 3D4OA 1JG6A 1YCHA 3OIGA 4YCDA 1Q7RA 1WPXA 4AY2A 1VGRA 1WXIA 4LQCA 3W9YA 2B92A 1OT5A 4KN8A 1ZXLA 4MHSA 5EINA 1H2AS 2WKWA 2DQKA 4WGFA 1PNQA 4D81A 4HDKA 1ONNA 1IY1A 1H0KA 1WSDA 2O2HA 1Y9AA 4OM7A 4D44A 4RQAA 3NIDB 3O8QA 3UCXA 1QPBA 4I2VA 3WWYA 4CN9A 3KL4A 2QW8A 4Q1FA 4CMBA 4YLYA 1H2HA 2Z8YA 4Z53A 2Z1DA 2Y2UA 4LZNA 4KOAA 4TS9A 3AUYA 1AQJA 3E9DA 1KC3A 1PBNA 4A23A 3NHSA 3RS3A 1GYRA 3IDAA 1JZSA 2JA1A 3M9XA 4L0DA 1DKOA 4RMJA 5KTPA 2QPOA 2YVKA 3DV0A 2FDXA 3BSSA 3P27A 4H1UA 4JEHA 4L08A 4QULA 4B6EA 1M0EA 3O8LA 1YI1A 4QU8A 2VPZA 4BFCA 2IP2A 2AKYA 4ZYZA 5T7BA 1DIGA 3D7LA 5SYAA 1N5MA 4KXWA 3ZNNA 4NMMA 5E9AA 5AKLA 1K6EA 4RV4A 4ZT4A 721PA 1J0XO 3THXB 1V5GA 2ZJ8A 1L1EA 1QB8A 2DFKB 1NHGA 2AFRA 1TZBA 2V9PA 3S2UA 4XB6B 5DM0A 1O6ZA 1C4XA 1U0RA 1UJ4A 2GF2A 2FFAA 3RU9A 1LDNA 1KWKA 4R2LA 1N8KA 2JA2A 2BHSA 4P3NA 3RCBA 1C7ZA 3EJ6A 1IZYA 4XYEA 2ATXA 3RHFA 1PGQA 3HKCA 3M2TA 2Q3HA 1U2QA 3ZTTA 2XOXA 3LZ6A 2V96A 5EZYA 3FNFA 4Z4FA 4BYMA 2MSWA 3WY9A 2X8JA 5C4IA 1QFZA 4IL5A 2HD4A 2NNLD 4URYR 3A9TA 3QMWA 2R5FA 3GUCA 2W8ZA 1G2PA 1P8AA 1U9ZA 1R0XA 1U0OC 2QP4A 1SXQA 1IULA 3K6RA 2OMEA 1TW2A 2X2OA 3PLAE 3OPQA 3B8EA 4J2HA 4JI6B 2PGOA 4FT4A 5D6OA 2P79A 3NM6B 3LHIA 3RIHA 4JGIA 4KVAA 2PZAA 3A9WA 4LXTA 4W99A 3B6KA 2WMOB 5EHQA 1TF5A 2QAGA 2QAGC 2VQFB 4JT9A 1QO7A 2VSYA 1KP2A 1E20A 4HI0E 3OWHA 2R5WA 2FW8A 1FX0A 1WB9A 1RRKA 3OHPA 4ZCTA 4BV9A 4TXJA 4HAYA 2C8KA 2ECOA 4XVUA 3KETA 2O2CA 3R8CA 2DSNA 1OQAA 4D3ZA 4GEGA 5B7NA 2BFBA 2XUOA 3KQKA 2IUFA 1XRRA 9ABPA 3B1VA 4P7FA 2IHVA 5ALUA 1FFCA 1FPQA 4GLFA 4ND2A 2II6A 2MSLA 2OGUA 2PEYA 4BO0A 4D8TA 2CJYA 2B3TA 2Y05A 4A27A 1B73A 5K6TA 2AJTA 4KN5A 4W82A 1RI1A 4WK4B 2A86A 3NOQA 3ZE1B 1O94D 2JZCA 2YCBA 2XDWA 5E38A 3C87A 5GONB 1HR0B 4NICA 2B2NA 1Q83A 2QQ5A 1HQKA 2VDOB 3M6LA 4HDRA 3BK7A 3K4QA 1E0JA 1HK7A 1RPJA 4RLQA 4TT8A 5DF1A 2CMKA 5AHXA 5FRDA 3UZUA 1QKJA 3OCXA 3BKXA 5DU2A 4ES6A 4A8TA 5BMVB 5ITVA 1Y6GA 4Q1VA 3OCVA 4IINA 4PFSA 3B1FA 1CB7A 5FBWB 3SEAA 5HQ3B 1UCFA 1K7CA 2ZT5A 4GDMA 3NAMA 1GSAA 3EIFA 1AHNA 4ZCQA 3ZHRA 1RM0A 1Z45A 1L2TA 3EEBA 4ZCPA 4ZZ1A 6NULA 5I9TA 2WHQA 1R5OA 1SPXA 3DEFA 3BB1A 3ILHA 1JEDA 2HC9A 3G2MA 2GK7A 3ZE7A 1EDDA 1X13A 3DW3X 4RPHA 4HAOA 5F1OA 3O82A 4EFKA 3MJDA 3JD0A 4QA9A 5GQSA 1XTQA 2A5DA 2CF5A 2GBCA 3HS3A 3INNA 4L78A 4MI9A 3T5TA 5DYYA 4CUJA 5G02A 4GP9A 2ZI5A 3HRKA 4RF3A 1DHTA 2IW3A 2EKDA 2RG7A 2X3FA 2IODA 4U7GA 4DIOA 1UP7A 1W0JD 1GPNA 2QX9A 2QU8A 2ZRJA 2AMYA 3VNVA 1XLUA 5B3KA 1CUCA 1QBGA 2OCIA 1DMSA 2I5PO 3DBHA 3R3ZA 4L2IB 3TM4A 2BBWA 3DJYA 2ZS8A 3W77A 2CV2A 3DEKA 5BW5A 1KI6B 3N58A 3SC4A 2CCKA 5JH7F 1SCJA 1RLUA 5T67A 4BFXA 1TQHA 4MI1A 2IOFK 2VCYA 4CLRB 1J7JA 1E7RA 3EVTA 4UBOA 5DOVA 5KTRA 4PO9A 1NXPA 2SECE 2XE7A 1KJQA 3Q9UA 4JX9A 5JI3E 2I4NA 1M66A 1MV5A 4V0RA 4L4ZA 1PJBA 2B7LA 2CNOA 3LPMA 1H23A 4K7JA 4ILKA 1KPIA 3R2JA 3DLHA 4PQEA 3D7MA 1YB6A 2HLNA 1R8QA 4LRWA 1GR0A 5HKBA 5LU8A 3TWOA 1VP3A 5HZKA 3JQBA 3JQBC 1JWLA 1O97C 1GFIA 5I01A 4EMBA 5HQTA 1LS1A 3DGEC 2GBFA 3B7WA 3QKWA 1H1TA 1JLMA 4OH1A 2YOFA 4M54A 4CCSA 3UHOA 3TZBA 3TQTA 1KKMA 3M3DA 5HP4A 4EA6A 3I5MA 3VJRA 2JGKA 1VLZA 3L7JA 4BRSA 3GEGA 3JV7A 5CURA 4EB6A 1HORA 4EDHA 4GG1A 5FOVA 3VR1A 5LP1A 2ORED 1N7IA 1XQ1A 3I30X 4OBBA 4R2XA 5JEDA 1EINA 3UAGA 1G8AA 1X9IA 2QNBA 2WLTA 2YRXA 1AKNA 3LY7A 3TTYA 3S8YA 4X5OA 3VDNB 1O1YA 2OG2A 1KRWA 3FWKA 2H7XA 2AS0A 2FN9A 5HUQA 1YA4A 4RCVA 3CZQA 3O6VA 2AK2A 4PXYA 1QVRA 1WCWA 2ERYA 5FADA 4V0LA 1E5VA 1NIPA 4FE7A 5CR9A 1OBHA 1YB1A 2VRNA 4M0LA 5L3QB 1Z39A 2J0QA 3D0OA 3KM0A 5GIOE 1Q77A 2NP6A 1EFTA 1JXOA 2AC7A 3BB4A 1JHAA 1TJ4A 1SVOA 3BREA 3EQZA 3IBGA 4UXIA 3VUEA 4EW3A 2C99A 3SVTA 2BY4A 3T41A 1VHWA 1CVLA 4FDLA 3UPDA 4CEHA 1V26A 5BUQA 2W2TA 1OUMA 2C98A 5ESXA 3TKLA 5JYCA 3KOXA 3EIHA 3OE1A 4EY4A 4YMGA 1XYYA 2C31A 1RLOA 1U1GA 1YGPA 2ZBGA 5KTSA 4NBWA 3MAAC 3ZDAA 3U9TA 2FEKA 4DC0A 5FQNA 1NZFA 1QNFA 1R37A 3I6YA 1EEHA 1EX1A 2F3SA 1IONA 1TKAA 1BXRA 1E9FA 3HNPA 4WZBE 5AW5A 1D1QA 1T4BA 5BNTA 4GM4A 4MQ4A 4A3SA 1QMPA 2VNAA 3FJYA 1XJCA 1BDMA 1KMCA 3NRCA 3RVBA 3UHAA 4TWRA 1ZA1A 1O58A 4YDRA 3DP9A 5CX1A 3VQTA 2D5LA 5HVNA 1SIBE 1D2EA 2ZDGA 3BXFA 3OD5A 3SPXA 4Z4EA 2WINI 1ODLA 1WCIB 1D4FA 4Y9UA 5IFLA 3L0ZA 5DX8A 2IEIA 1FP7A 2RI0A 2R1ZA 5ICGA 3H5AA 3C24A 4R51A 2G83A 1JEQB 3LXUX 5K3SA 1T26A 1ADCA 5C5CA 4FGLA 5TDHA 1IXSB 1GV1A 5DWVA 1CF2O 3OX4A 5I9LA 4EYGA 4RVCA 4B43A 1J21A 5D85A 2QGZA 2PL1A 1M6VA 4DLUA 5EXPA 3SOPA 3S2YA 4AMZA 3AM5A 2MINA 5AOBA 5FBHA 1W0KA 2ZBUA 5KS2A 3P0JA 3L18A 3MEQA 4HUQA 2CNDA 2QZJA 4Q5IA 1IEWA 3R3JA 3H42B 4K6OA 5K6AA 5K6AC 1F5SA 3O7WA 2QRZA 3FLBA 5ALZA 1SRRA 2DPMA 4OKNA 1XZAA 2H1RA 2H59A 4UUMA 3U7QA 2O5EA 1Y3AA 1U0JA 4A6PA 3R9XA 5KTMA 5BYJA 3T1OA 1VE3A 4XTCS 1Z4KA 2DBVO 2FB9A 2YN4A 4MITA 4X6UA 1NBMD 1GYPA 1I36A 3ZWXA 4E5YA 5C1OA 1WABA 4BATA 1E2PA 1JEOA 4HDMB 3WX0A 5KVCA 2OMKA 2VDNB 1VJ5A 3PPXA 3Q3JB 1GTZA 1R9JA 5JAMA 3QLEA 5TF0A 1G42A 1A2BA 1GADO 4DZRA 1Y4AE 2ICAA 1OILA 2AK3A 1AF7A 3STUA 2YWGA 1H4VB 3F6PA 3NORA 5JTTA 4PFJA 4Q03A 2ECKA 1E2LA 3EZ9A 3VR6A 4XWKA 2VYNA 3IQDB 1U65A 4HZGA 2VPYA 2YW2A 4BMPB 1BC5A 1W25A 3RANA 2NADA 1NDQA 1XP8A 2OOKA 2RBEA 2WSSA 2XAUA 3B82A 4Q12A 3IILA 3U49A 3GMDA 3K20A 3RSOA 2WU1A 3WDKA 5B55A 2BEJA 3JQAD 3GZNB 3ND5A 2ABWA 2OY0A 1QQ6A 2SCUA 5BR8B 1X7HA 1QS0B 2YNMD 2C4MA 3DCYA 2YYAA 3TQOA 5DP2A 1ZGGA 1RRMA 1RBYA 4I08A 4A8HA 2XXAA 3Q7IA 4EARA 1W1WA 1E18A 1U3VA 3L4BA 4NEHB 3LF2A 3ZHXA 1BH2A 3W4KA 5L3VA 4YALA 3O8CA 5LZ8A 3TVYA 1KFBB 2XA9A 3M34A 1LI4A 4JYPA 4CU2A 3V7YA 2H0RA 3TG2A 3IOEA 5EFOA 4B74A 1BE1A 3TLAA 4M6WB 2W2NA 3QFRA 4D5GA 2PMDA 4W6QA 2UUPA 3QVMA 4B3SB 3DYBA 3KZXA 5K01A 4UEKA 1RABA 3O1JC 4IKOA 3EZ6A 1TPYA 4BEVA 3KEQA 4MS4B 4ZOAA 2H1FA 3RVDA 1QHIA 1ZUWA 1QYVA 1VL2A 3P2JA 2F9FA 4DT1B 3I5YA 3LC2O 1QU2A 2R11A 4EBBA 3ERCA 4CQJA 3MRXA 3NS7A 2D8MA 2Y1EA 3C3BA 4KAJA 5T8KA 2Y71A 5T8KC 2R48A 3VMFA 4AFNA 3RG8A 3DMPA 1RQRA 4P4NA 1XRNA 1EVIA 5ADVA 2DJIA 1KH2A 2YYYA 1C9KA 2HQOA 2GBPA 2XKAA 1EH5A 1HM5A 2OO3A 1VJCA 4O59O 5FFFA 1DTEA 1DTWB 3E22A 4S1TA 4AC9A 2VXYA 2OBNA 3N8HA 2J3DA 1XDZA 5JJ5A 1PWYE 5J1SB 3CO5A 1NSFA 2PSHA 1D9ZA 1U4SA 1TRKA 3UQYS 1EMDA 3EY4A 2G71A 3T94A 1IN6A 3AZPA 3UXMA 3WIDA 3WLMA 3B2NA 1E1CA 1OZGA 3NBUA 3DDWA 2PNFA 4QVGA 1U5CA 2YQ5A 4U2KA 4TUYB 3W5SA 4O4IF 1BYIA 4R1MA 2QNRA 3M6UA 1EZZA 1T3TA 3A36A 3P9XA 4GVXA 5I45A 1QGED 3NO4A 2CXOA 4J2TA 1M7BA 1OROA 2RBKA 3AVOA 3UT5B 3LDUA 3WKDA 3GQVA 3O2JA 1TUBA 3S40A 3UWPA 1BWSA 3IP3A 1AZSC 3IO5A 3CRRA 3L1JA 5CRIA 5F5LA 2ADFA 4YR9A 3CKMA 3SEFA 2PFKA 4N8SA 4RHXA 2PUCA 1PR9A 1XZNA 1XMSA 2JIMA 3OLZA 1KAGA 1U0LA 2JGDA 4NULA 5F1PA 4G0WA 1NRXA 3G17A 3HJRA 3OCUA 3R23A 4ZDIA 3IEVA 5DK4A 2O19A 1SUWA 5LNK6 5TPZA 4YUXA 2Z9DA 2PUAA 1BVYF 5CW1A 1JQ3A 3R74A 5HJ7A 1E6UA 2HMWA 4LTDA 1LPNA 1V7CA 5L3SB 4O4JB 2AC2A 2VHWA 3JZAA 3G02A 1ZCAA 2LXNA 1E69A 3M6MD 2W2KA 3MJRA 4MWGA 2EZTA 2GASA 4IGIA 4UBIA 4MW5A 3KWJA 3P71T 4YT4A 4GI7A 1EFPB 5CXUA 1Y7PA 2Y2VA 4GPBA 2XBLA 3AHEA 2OHHA 1YL7A 3N0XA 2XBUA 1NQXA 4LDRA 4BN4A 2WYHA 4Q9LA 2VS1A 2C9BA 3K2EA 5DM70 3L8FA 3P9NA 3EUWA 1L8AA 3UJ9A 1GZHB 3R3UA 2Z4SA 5AVJA 1AK2A 2VK2A 3NPMA 1M3SA 1JZTA 3PQ5A 2BF7A 4CIXA 1THMA 2VAXA 2BCGY 4XDGA 1NC1A 2UZ1B 1V11A 3KXKA 4IIFA 1F51E 1VG9B 5TQ0A 3SP1A 4P6VF 3EQ9A 1WQ1R 3OETA 2V8BA 2EEZA 4QTUB 3FFWA 2J45A 2RH8A 4JROA 5HCNA 4FD3A 1DTSA 5J5VA 3N0RA 3BXOA 4X44A 1PR5A 3DOFA 1JALA 1U8TA 3AEKA 2WWGA 3GNQA 2IU3A 1T34A 2HCFA 3F4BA 4C43A 4KHPB 3WSVA 2DG2A 4JYCA 1XAHA 4N48A 1Y89A 3NT2A 5COQA 1DDIA 3RSCA 2WWIA 3G6WA 4IKEA 5DLQC 2ZWPA 3DL7A 1E6WA 3MRTA 2EDCA 3UB2A 4X00A 3KBOA 5HFJA 5LA6B 2CZCA 1FYWA 5K3CA 2IYSA 3KXDA 4NU5A 2DFVA 1PWEA 2YY5A 4RUKA 4J1QA 5IC6A 3I8XA 4YC7A 3VVLA 3IAS1 3ESDA 4J7UA 4Y6OA 1PT9A 3U4QA 1F2DA 4WHMA 4FZVA 1V7QA 2E6KA 3G89A 5D51S 5K3AA 2ODEA 3VKFA 4F71A 3P5SA 1EVEA 2DT8A 5KC8A 1LLFA 4YQFA 4JLWA 4I6JA 4MVJM 2AFIB 4FHZA 3OFVA 3DT8A 3BJZA 1CW2B 4P0PB 2AXQA 4HZUA 1JR4A 2M1XA 3A31A 4R8MA 4JIMA 3TVTA 1VFNA 5DHAA 4Z0NA 1W8DA 3ICPA 1GN8A 4JASB 1RP7A 5KO2A 4M9XA 2XPCA 3HL4A 2JIZD 2R8ZA 4JOSA 5JSYA 4X24A 1QK3A 2REBA 4S2EA 3VU0A 5EJ9A 1EI9A 1N2OA 4NDZA 1V8BA 3HRHA 1FP4A 1N6PA 1P8JA 2J08A 2PPLA 4UC0A 2IITA 4XM2A 4YRAA 3A25A 1LCIA 2BPOA 3BTSA 5A4MS 2BV3A 2BZ0A 1OHHA 3CPHA 4JBLA 5SZHB 3TBKA 3UHFA 4BO1A 5LD2C 1OLSA 1RAFA 2W5UA 3JS5A 1B14A 5EWJB 5KOJA 1K88A 2IYLD 3AFMA 1H6AA 3UXHA 2CNBA 4DB2A 4EYEA 3QX8A 4MVXA 3FMPB 4DQ0A 1ORVA 1ZG3A 1VG8A 2BI8A 1C30B 2FRXA 2K7ZA 2QMQA 2Y99A 3F6YA 3H5NA 4IR7A 4OQQA 1QF7A 3DUWA 2JGLA 4I6GA 4BKQA 3DE3X 3AM1A 1P80A 1M0TA 2W93A 1KQNA 3RUFA 1PQPA 4DV3B 1K66A 3QI7A 3SS9X 4GLBA 2CN1A 4FHCA 3V4ZA 4ANFA 3KCNA 1KEKA 5GJBA 5K2OA 3CA8A 3ESZA 1RXEA 5DYIA 1TCUA 3CKYA 2QLJA 3GRRA 4RPGA 3VO9A 3ROXA 3DOUA 3HG7A 3ZV5A 4DAEA 4NESA 1LW7A 4IVRA 4G01B 1JLLA 2C9OA 3JTEA 4G63A 4MW1A 3EVGA 3URMA 5KCMA 1T0BA 1AURA 1UMCB 1Z82A 1GPAA 1WB4A 4J7CA 1QAQA 1N6LA 2P9JA 3IIIA 3PNSA 4PRKA 1EBBA 3IH5A 1KDRA 4B0PA 1XZPA 3ESBA 4YK7A 5FP0A 5JECA 3M1YA 4RCYA 2J41A 1G7SA 3QVTA 4MEAA 3T5GA 2FP3A 2NX2A 2ZGVA 3ANLA 1NVMB 1YIAA 2VNSA 2CHFA 3MTGA 1FDIA 4O02B 3F7NA 1R4ZA 1JEEA 4B79A 3V1TC 1CBUA 1MV8A 5ADHA 3ZD7A 3MCVA 1ISSA 1EUCB 1A77A 1XD9A 3FIUA 3I6ZA 5DT9A 2YS6A 4IH4A 2E5LB 1SIOA 3QVVA 4CODB 5IF9A 4U3JB 4U7DA 4ZN6A 4PLFA 5DYWA 3NTOA 5TB5A 1EWKA 3PLNA 1J8YF 4DCSA 4DRXA 2IQ5A 1LWNA 2HIHA 4BUCA 2PSDA 4EGFA 2QK4A 3JQDA 1HLPA 1I2ZA 2F8LA 1JS1X 5EIBD 2QPTA 5AH0A 4OX9B 1N0HA 1TZKA 2J5RA 1N4AA 2OV3A 2D62A 1DHRA 3BYZA 4Z99A 3GEMA 1HH4A 3ZPXA 4EPXA 2OXEA 2CCJA 1BX0A 3SQXA 5BORA 3OMLA 4G0OA 4F5YA 4D25A 4Y30A 4YRLA 1XAIA 2PVPA 1NVEA 3BL5A 3K8QA 2FPGA 3QVGB 1PU2A 4KNWA 4DXDA 1WRBA 1WW8A 1LQUA 4P31A 1K3UB 2H5EA 3A4MA 3CSUA 4IWXA 1XTPA 1F6WA 5E3JA 1ZVVA 4Z9AA 1TEHA 4OLBA 3I62A 1AV6A 4NAUA 2ZB4A 1ZSVA 4EFDA 4RIEA 1ML4A 4C08A 5KVSA 2D5AA 2A1UA 3RC3A 3HGTA 4B3GA 5EJEA 5MHTA 3SF8B 4JELA 1XU4A 4G8CA 1XWWA 4QGSA 3ZYZA 2Q0QA 1E99A 2I2AA 1DDOA 1ECCA 1EM8A 1VHTA 3GNSA 3I53A 3E1GA 3T1VA 1QYDA 4P33A 2OXCA 5ARDA 521PA 4C7BA 3OJFA 1MOQA 1YUMA 1K5DA 4M9CA 2QXUA 5HUJA 1DXYA 1IQ0A 3NHBA 4R98A 1PAUA 4EEKA 2XCTB 3ACBA 1ZH0A 2DPHA 2PNJA 5I6DA 4RGBA 1PL6A 2FZEA 3FMGA 3R6TA 3E0QA 4YJ3A 5BSUA 3S70A 3BM5A 2I3GA 2GPBA 4QEKA 4CIYA 4RTJA 16PKA 3H86A 1BQ3A 3I72A 3PC4A 1MDBA 4UUNA 3SHVA 5EP2A 1H1LB 1LLQA 3I9FA 1S8OA 2GF0A 5G53C 3H1TA 4A2WA 5HPYB 4FEAA 5DGCA 1WQ3A 1OGIA 4HQNA 3AUSA 4IUYA 2Q5EA 3PEVA 2AWOA 4ZT3A 5EHIA 1Z7YA 3L82B 5GADl 5REQA 2A5GA 3E70C 4AICA 4QKQA 3UJPA 4IFBA 1GD1O 1QNLA 1M0WA 2HRQA 3FGOA 2WY2D 1Q50A 2PEZA 2WE7A 4XQ9A 4BTVA 5KB3A 2XYGA 2X22A 1RQPA 2NAPA 3OD1A 4FWTA 3VJLA 2YJNA 2YXEA 4Y9DA 1TOAA 3G9XA 4MR8A 1JAHA 1RT9A 3EFEA 4L4YA 5K0TA 3K73O 1AZTA 2PRZA 4JHLA 2C00A 4N82A 2YV5A 2C04A 2E4VA 3HN6A 4L5JA 3ZH9B 2NV6A 4WFQA 1Q7BA 4U2DA 7MDHA 3MCTA 4AQDA 1I4OA 3V2IA 3FMIA 5JU6A 1WUTA 1R88A 3I52A 4OLHA 4UNSA 1U90A 3AONB 2BZSA 3NBZC 3SQLA 3UGQA 1BX3A 3ZVLA 1PFVA 1KPHA 1LEHA 2PX8A 2WV9A 4G56A 4D92A 3NNSA 4N6NA 1BRMA 4TROA 4V24A 2G70A 1V47A 1V8FA 1FZQA 4K6CA 4LZAA 1XDDA 2CUZA 3ONWA 1W1IA 1CKEA 4EY6A 1NF9A 5GONF 4M9UA 3ASZA 4YUYA 1WB5A 4W7SA 1QTRA 4FE4A 1GUAA 2YWDA 2DRIA 2HYIC 2BISA 3UV3A 2UVPB 2OZLB 4B3XA 5C7YA 4DSNA 3HJBA 2QRMA 3G5TA 3V2HA 2IYXA 3RYFB 5HNKA 1F14A 4PXAA 4H4CA 4QQFA 1D1TA 3GVHA 3FHOA 4K88A 3NCHA 4PNZA 2GPJA 2Q5CA 1M2KA 4PSKA 2CZGA 3L7YA 5CNKA 4YONB 1K7XB 1U1EA 3DW1X 2D6FA 1MMFB 3H18A 2BAGA 4BO9A 4Q7EA 5JS8A 3D5QA 1H69A 2DULA 2ZRCA 3CXRA 4NCHA 4Q1AA 5IK2A 3ZU3A 1P9OA 5KOIA 3ZDBA 4F3NA 5CA0F 3HJTA 3PXUA 2O8CB 1CZHA 1DEOA 3C3EA 4N0PA 2BMWA 4KMSA 3ZWKA 2VDVE 3I2GA 5I9NA 4M2LA 3M6FA 3UUFA 4BLVA 1PSWA 2XMCA 4ZYTA 2H00A 1KYWA 4LFAB 2IP4A 1M6YA 4LUCA 1QE3A 1RXWA 2AE1A 3HEBA 5EGSA 3TRHA 4R3WA 1P9LA 1XN1A 1JI0A 1MOZA 1WOMA 1SUFA 2QR3A 2Y9PB 3OKCA 1NAIA 1ZMTA 1VIYA 4JU9A 2FUG6 1RHJA 3W6UA 5AJWA 3H0EA 3K0AB 3S5UA 2I2FA 2OBFA 2AEMA 2GLXA 4HRYA 3REGA 2X14A 1SD2A 1JLRA 1A8QA 1BE0A 1UM9B 4REMA 1PYDA 2G80A 2OLEA 3N7AA 3NH9A 3FYUB 3E27A 3N7TA 1GLGA 3B1WA 4FYJA 4CR8A 2CE7A 4B3MB 4FOOA 1JW9B 4J1TC 3CX3A 4J1TA 1KEWA 3MFQA 4GPAA 4R1LA 3VVCA 4XSVA 3JQ8B 1GTJ1 2B5VA 5BQFA 3PQ4A 5H3LA 5I47A 1PVOA 3I0ZA 1W2HA 1WMFA 3CEMA 4I8IA 4JP1A 2GZ2A 3OESA 3A6HA 3FYDA 5KNBA 3N6RA 2VWGA 2JJ2D 5I5EA 3GP8A 1IPHA 1F0NA 1E6CA 3K0HA 2O6HA 5K1ZA 1R64A 1XTZA 2LGJA 1LPBB 3A6FA 3J81A 4LS3A 3I61A 2W00A 1I80A 1ZRHA 1O7JA 2VHVA 3AZQA 1G3RA 3ZZTA 3CVOA 4XR4A 1MFZA 1SVNA 3FYCA 3N3AC 4LJAA 1PX0A 3BGVA 4B73A 1M2GA 3BF8A 2WYVA 4HTFA 4JLNA 2GTIA 2X13A 4FIZA 5ERYA 3T34A 3VDQA 3OZWA 5DTMA 3DDNA 3B13B 4WCDA 1SVKA 3HB1A 3OLWA 4IDPA 5FD8A 4ARVA 2VAWA 1QGDA 2IZ0A 1E5QA 2G8NA 3P97A 1FUEA 5EPUA 3WL3A 4HH1A 4E4YA 2G9ZA 2AKEA 2P6PA 1S02A 3HO8A 4Q05A 4LOJA 3GLIA 4FFOA 4IZOA 2HZ7A 4ZOBA 2PLRA 2G72A 1X7YB 5CK4A 1YFZA 1VPLA 1WHTA 1Z4JA 1IAQA 1ZNQO 3A1WA 5G4KB 5KCZA 2O8BB 3PGJA 3F1KA 2R6DA 1I13A 1KIMA 3C5WP 2NYRA 4Y2RA 5JIBA 1ZLXA 4ZO7A 5A7HA 3OMWA 1Y5IA 1LLCA 2FVYA 2VP3A 3MINA 3NUGA 4TSFD 2ZT6A 5P21A 1B3BA 1YL6A 3E4CA 1RWWA 4G2TA 5JPIA 4IBOA 3U56A 2XIQA 1FFGA 3DP7A 4H3VA 3COVA 2EW2A 1V96A 4CFSA 3USZA 4L5CA 3GGJA 1RD4A 4WK6A 2VTVA 1I9CA 2JI6A 4Y2TA 4AJNA 3NAQA 4ZKEA 4WNCA 4BAZA 1PT6A 3AEZA 1MNAA 2OFPA 3ROMA 2ZSFA 1NN3A 5AK5A 1N0UA 2O8FB 2B2XA 3N2GB 1KI4A 5B1DA 5LQDA 1DAKA 1NUPA 2IX3A 5LU9A 1RQ2A 2J3MA 4RACA 1MAHA 3A4VA 3L8ZA 2F67A 3H9JA 4U7HA 3HDGA 4TRRA 1CJVC 2J5QA 1DWPA 5AW8A 3LX6A 1M8GA 1GGKA 1FYXA 1YRYE 4PX5A 3W3AA 1XXHB 1YT5A 5DNCA 1QCZA 1N9ZA 1T5IA 1NF8A