1QHSA

Chloramphenicol phosphotransferase in complex with chloramphenicol from streptomyces venezuelae
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
178
structure length
178
Chain Sequence
MTTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQSAEGGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLDVLWVGVRCDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTHKESIECAWAIAAHVVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structures of Chloramphenicol Phosphotransferase Reveal a Novel Inactivation Mechanism
pubmed doi rcsb
molecule tags Transferase
molecule keywords PROTEIN (CHLORAMPHENICOL PHOSPHOTRANSFERASE)
total genus 59
structure length 178
sequence length 178
ec nomenclature ec 2.7.1.-:
pdb deposition date 1999-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07931 CPT Chloramphenicol phosphotransferase-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1qhsA00
1SXJC 1HE8B 2F43A 1XTQA 2P0EA 4ZDKA 3U3OA 5JBQA 3DL0A 4M0LA 1KDPA 4JL6A 1A2KC 2HLDD 3RC3A 4BECA 3SOPA 4AKEA 5FOSA 2C78A 1HURA 4ABYA 1SVIA 3CRMA 2WBLC 2O8EA 3W8RA 1ZD1A 1OFIA 3SQXA 2ZQ5A 5FI1B 3UMFA 2NZ8A 4PR0A 1ZM2A 2NPIA 1VG8A 2UZ3A 4IFEA 4PO9A 5JWHA 4A0HA 4NBSA 4PSKA 1D2NA 4DSNA 1NVVQ 4HLQB 3CWQA 4M53A 2GAAA 1QDEA 2PEZA 4UNNA 3SYNA 4DXAA 1I4DD 4RD4A 1VYTA 1Q1BA 3AF2A 4E09A 2GEUA 1N5KA 2P3SA 2FGKA 3KQKA 2DFNA 4DIDA 1F3OA 4DRZA 1GRRA 1FQJA 2PMKA 3EZ2A 1N0WA 4BLRA 8OHMA 3SQWA 3SYKA 3TIFA 4HLDA 1FTSA 4XD7A 4QOSA 2AKYA 1P5ZB 3FDIA 3IQWA 3NKVA 2Z43A 3G0HA 1UPTA 3RRMA 2D7CA 2ZR7A 1R0YA 1Z0JA 3CRQA 2NZJA 3VR4A 3WMFA 4M9ZA 1E79D 2RHMA 2A2ZA 2EWWA 3L0OA 1KY3A 1QG2A 2WAYA 1RYFA 3H2YA 3AVOA 2JDID 5J4YA 2ZI3A 1E2IA 2JJ2D 1EX7A 2ONJA 1KDOA 1KGDA 1I2MA 4PAQA 2X19A 3F5FA 4BFYA 1BKDR 1QHNA 4W5WA 1XJ0A 1NKTA 1II8B 2HCBA 1U9IC 3BWDD 3H0KA 3NXSA 4OHWA 2DWPA 4XTRA 5GVSA 4LBYA 4QHTA 1ZCAA 5JFGA 4Q9KA 2CK3D 1OW3B 3KXIA 1GL9B 3QG1A 4ZPXA 4AWXA 2REXB 1RE0A 4DZZA 3CRRA 1KSHA 4WZBE 1ZM3A 3IIMA 3IBGA 2IUTA 4JLDA 2ZUCA 1QF9A 2QNRA 4C9BA 2RMKA 1LS1A 2W6JA 4Q9IA 1BIFA 2R65A 2HT6A 1N6NA 4C2TA 5FTLA 2GVDC 1VTKA 1VECA 5KNCA 1ZD8A 3EIEA 2AK2A 5CDFE 1DADA 4AYTA 1M34E 3PXGA 2J0UB 1Z83A 3Q85A 4TTQA 4GRAA 2F55A 4LGMA 2F1JA 4NCJA 3BH0A 1XFAA 2XXAB 1Z07A 2CL6X 2FA9A 5FBLB 3AP2A 2RGBA 4IDNA 2DWQA 4MRVA 4CT5A 1PVOA 1SXJE 4FW9A 3LW8A 5KOYA 1IAQA 1MABB 4Q4AA 5EXXA 1GVNB 1ZIPA 1Q1ZA 4QKQA 2QM8A 1P3JA 2P65A 2VHCA 2AXPA 4TLDA 3CW2A 1E4YA 2E1RA 5H8WA 2OO7A 2OAP1 1E98A 2J3EA 2ZE6A 3UK6A 5A0FA 3A1VA 3X1YA 1ZW6A 2ATXA 3AB3A 4DCTA 1FNNA 1TADA 4XIGS 4EQ6B 1EFCA 2Q9AA 4JBXA 3RRNA 1GL6A 1XXHA 2AKAB 3B7GA 4OK6A 2GBLA 5DH9A 3ZH9B 1OXVA 2DFLA 1OXSC 3TBKA 1E0SA 3KJIA 2CHGA 2QUZA 4D80A 1CP2A 3WHKA 4V0MA 2AXNA 3C15C 1AZTA 1LVGA 3NDBB 2XJ9A 2NO9A 4HZUB 4M1SA 1JNYA 1QVAA 1EFHA 1DOAA 3R20A 4QGGA 4YMTA 4AY2A 4FMBB 4QJ4A 3LVQE 4M9SA 1I4LD 3C4JA 5FBVB 4GZLA 3BS4A 5J4HA 4E22A 2OCYC 1X1RA 1M2OB 4RD6A 4DJTA 1GWNA 1I2DA 1GOTA 4RSGA 3EXAA 2F7SA 1BYIA 3GJ8A 4QGHA 4A2QA 4WOPA 2ZETA 1E6CA 1AS0A 3NVAA 1XD9A 3GPLA 2P6RA 3HP1A 1UKYA 1XTRA 3MWKA 4HAWA 1VG1A 2JLRA 4A2PA 1M1YE 2VP2A 2HYDA 3P4XA 4GP6A 1E79A 5FBWB 4ZCIA 2C9OA 3MCAA 2JLQA 3MRSA 4A6XA 2CNWA 4JLMA 3THYA 3U61B 3DKVA 4KYUA 3TW4A 1XBTA 3C16C 3EG5A 4LRWA 5FBQB 2FWRA 4XOIA 4RFSB 4QBFA 2ZRDA 2OCBA 1K8RA 3EPKA 4Q1BA 1KI8A 2ZRGA 2IBMA 2RB4A 5TV2A 3QKSB 1W0JD 1NMZA 2EQBA 1Z6YA 2ECKA 3AVPA 4OQMA 1XEXB 1RRGA 3GJ4A 2ZROA 2CK3A 1P9NA 3EC2A 3IO3A 4QGFA 3TAHA 4TMTA 4L5BA 3ZJYA 3EPLA 1ELOA 1XEWX 1XJCA 1T3LA 1YR6A 1CR4A 2NO6A 2UZIR 5L3SB 5A4JA 3IQXA 1UM8A 5HE8A 1MR3F 3W34A 2GF0A 4QC2A 4E07A 4CF7A 3O8CA 2OLKA 4NYIQ 1RJ9A 3AGPA 3VFDA 1G291 1W5TA 1G5PA 2ZXUA 4XVQA 1FOEB 3CX7A 1Z2AA 3BFVA 5IDVA 3A1SA 4EAQA 3QPVA 1DG3A 3EC1A 4ESHA 3UATA 2WTUA 2GWHA 1AK2A 2QPAA 3NBXX 2Y8EA 4LYJA 4ACBA 1FZQA 4EPVA 1TU4A 2HLDA 2C77A 4RFVA 4I4LA 4D0NA 4C7OA 4JL8A 2IEZA 1VCNA 2VL7A 3B85A 2FPMA 3AF0A 5G3YA 2CE2X 2IXEA 2IYQA 5JS7A 2CHVA 4HDQB 5E95A 1N3BA 2WSMA 4WZAE 4V03A 4LYAA 2AN9A 3A4LA 3G5UA 1LV7A 2IYVA 1KSJA 1E2JA 1NY5A 2FFAA 1MH1A 3FMOB 3K0AB 4JT2A 5EE0A 4B75A 2PCJA 4M1OA 3JZMA 2BHRA 5FOUA 1M7HA 3BIFA 1OKKD 4KAXA 4TSFA 4DDUA 1A5TA 5AJWA 2WKQA 2NG1A 1TQ4A 1II0A 2O8CA 1TNDA 2ZRAA 1ZNWA 3EARA 2DFKB 5CM9C 2ZSAA 4MRNA 1J90A 4P4UA 3ZS8A 3V00A 3PIRA 2OFOA 1RPZA 1N5JA 4L9WA 3VR3A 4A9AA 1VIYA 1M6NA 4Z1MD 1E1QA 1NSFA 3SC3A 1G7RA 2FE4A 4AURA 3ADDA 1R6BX 3QNUA 1ZNXA 4Q4JB 1Z0KA 3GMTA 3KB2A 1XD2A 4TT3D 2QE7A 3QXHA 4IXMA 4OQFA 5HCIA 3BBPA 5SZJA 5TARA 4F4IA 1IQPA 4X8HA 2W0SA 6Q21A 2GK7A 3DM9B 2KI5A 3PUZA 2Q3MA 2F3RA 4U5XA 5FI0B 1MRSA 2NPFA 1XRJA 1FTNA 3QENA 4JVLA 4EPRA 1VCOA 2G88A 1ZP6A 2DCUA 2WWHA 3GLHB 1NLFA 4Q66C 4G5GA 5EP1A 4C30A 5UKDA 3RS7A 2GCPA 3BFXA 1ONBA 3KQNA 2OSBA 1WP9A 4BLQA 2ANCA 1QBKC 3VR5A 2BCGY 3NTUA 1UDWA 4JLPA 2YWGA 1Q1EA 1YR7A 1TL7C 3EZ7A 3SZRA 2XOKD 3TUJC 1JI0A 2JJ1A 2QMUA 4UQOA 1QZXA 3C5HA 4JLKA 1U0JA 2V8OA 4N3NA 2V1XA 4YXWA 1X1SA 5BXQC 5AUNB 1JPJA 3A8TA 3TQCA 4XJXA 5FL7A 2RGEA 1G8YA 1U8YA 4IOLA 4NH0A 1ZU4A 3NEJA 4PHFA 4B6FA 1VMAA 2O0KA 1S3SA 2GTPA 1KI6B 1ZUNB 5B64A 1KJZA 5FR2A 1XP8A 3VTKA 2ZREA 3CRVA 4UNRA 4X8OA 4CEHB 4QFMA 2BCJQ 1XJQA 3P20A 1HA3A 3LO5A 3PQCA 5LD2B 4MGKR 4EPXA 1ZUIA 5C4GB 1W4RA 2N42A 3FB4A 1YRBA 721PA 3P1JA 3GLGA 1E9CA 2N46A 2ZIAA 1KI9A 4KLNA 5CYPA 3RRYA 2SHKA 5F3WB 1FMLA 2HEIA 5KNBA 1KI6A 4AKGA 3K0CC 4LCBA 1KMQA 2XEXA 5FFMA 5J47A 2OBMA 1ZMXA 4TTPA 3GFTA 2REOA 4B43A 5FOVA 3PUXA 4KXFB 3QXJA 2XNDD 3NEYA 1EX6A 2O8BB 2J7PD 2AWNA 3X1WA 1TUIA 1DARA 2AX4A 2EVWX 5EXTA 2IYRA 3VKHA 4PC3A 4D81A 2GBLC 4MITA 4IDOA 4P4TA 5AUOB 3PG5A 3U4QB 3GLHA 4CVNA 2WJYA 2B7BA 4LJ7A 1RC8A 1U2RA 2QPOA 3U7HB 4LJ9A 5GJBA 4ON9A 1RYHA 3DOFA 2RGGA 1JBKA 1T91A 3MWJA 4I1UA 2GXAA 1G16A 2GJ8A 2ZVQX 4MKHA 5DSZA 3VKGA 3KTAA 5SZKB 3OEEA 1HEIA 1GAJA 1SHKA 2REBA 2BJVA 2FSGA 3EASA 4GOJA 1FP6A 1E1RD 1KY2A 1OLOA 1AIPA 4IDPA 1S96A 3NC0C 1UADA 1G7SA 3E5HA 1G19A 4QRHA 1UFQA 2IYXA 3H84A 1GDDA 4LHXA 2D3WA 3BAFA 3NG1A 3SFZA 5CIQA 1FUKA 2J7KA 2EW1A 3GCGA 5IK2A 3U3KA 3BD9A 3F0TA 2G0NA 1KI2A 4S2EA 2HJVA 3K70C 1JB1A 1WB9A 3OE7A 4E03A 3RYTC 4BFUA 1IHUA 4ZI2A 1P62B 3P32A 2IUSA 2B6HA 4LDJA 3TJZA 3KKQA 2JLWA 4FCWA 5FR1A 5FUYA 1W36D 2DYKA 2BBSA 3FWYA 3QG5A 1X8LA 2ZYWX 3NH9A 1NJFA 4O2LA 2R9VA 2FN4A 1COWA 3B60A 5KNDA 3A6PC 2VP5A 3RSLA 1SQ5A 4HAVA 2Q21A 3AP3A 3D31A 3A37A 1OH7A 4DLRA 1RRCA 4HB4A 4G5SA 4C0BA 3EZ9A 4URZR 3FFAA 3R8FA 5ELXA 1YZLA 4F7WA 5EZ5A 5AUQA 1PJRA 4G5RA 1NG1A 1QHXA 1W2GA 3ZQ6A 4C4PA 1AKYA 1ZINA 2OBNA 4FD2A 5K8LA 1JJ7A 5L3SA 2IX3A 1IY0A 3ZD6A 5BYJA 3I92A 4TZ6A 1SVWA 1X8KA 3REGA 1J99A 2H8KA 2ERXA 3IDQA 3TR0A 3GP8A 1YKSA 2J7PA 1YZKA 4KFTA 1G5TA 2KWIA 3LNCA 1OH6A 1IM2A 2CEAA 3MSXA 4EQ6A 3EZFA 3IBYA 3K9HA 1DO0A 5KPDA 2L0XA 1XMVA 3AV0B 1VCIA 3AKCA 3TVTA 2C8VA 3WYAA 2FEMA 1G18A 1QG4A 2V7QD 3ZIAD 3R7WB 3THWA 2IS2A 1Z0AA 2D74A 1RFLA 3SR0A 1FX0A 2ZAOA 3I62A 1XEWY 3OEED 1R7RA 1D9XA 2AFIE 5L8VA 1FL9A 1SVMA 3R9XA 1XNJA 4MYTA 1W4AA 4L9SA 5AJXA 3QY0A 4G5QA 3WNDA 4TQ9A 2GEVA 5KSPA 2QQEA 4I1SA 2IF0A 3B5JA 1KMHB 1OIXA 5JZVA 2EFDB 4B3CA 2A3RA 1LTQA 2JAQA 4PPQA 4B48A 3FVQA 3L0SA 3GLIB 4ZDWA 1LF0A 1UDXA 2IA5A 1N6LA 4GDFA 3MUFA 1GP2A 2H92A 4M9QA 4AI6A 1RW4A 4MA4A 2ZU0C 4UNSA 3UANA 1E1QD 1ZM4A 1KHTA 3B1YA 2WSSD 3PENA 4RCYA 3KXLA 2C99A 3QI2A 4M4SA 3AKDA 2JASA 3MJRA 4TMXA 4Z8XA 1G64A 5IHPA 4QXAA 3A58B 1CTQA 2YZ2A 4NCIA 4BEBA 3KKOA 4M1WA 5EE5B 3U6KA 1OSNA 2J87A 2VPPA 4PHTA 3AVTA 4KYIB 5CJPA 1OH8A 4W7SA 2GZAA 1KDRA 3ASZA 1VG0B 1R2QA 3OAAA 4P0TA 2XGJA 1GZSA 3R9IA 3QKSA 2IS1A 4XSGA 1SVKA 4OI0A 4ERNA 2CL0X 1NG9A 1N6RA 4NKRA 4JVNA 4FMDF 5CJ2A 1Y3AA 1OPXA 2BIFA 4QBIA 4YMUA 3TW8B 3FMFA 2P5SA 4PQRA 4P33A 4L8GA 4WIAA 2W6JD 3SBEA 1Z22A 1CJMA 2D4HA 4NE2A 5FL7D 2QROA 4IOJA 1R0ZA 2HF9A 5DYGA 4BZQA 5JLJA 4YQFA 1W36C 2GJKA 1GILA 3QOFA 4UJ3A 5JMTA 3K0EA 1R8SA 1U8ZA 2IXFA 4ARZB 5C46F 5CITA 2WICA 1JAHA 2WWIA 5CDFA 2W2XA 4BFTA 2OESA 2Z4RA 4JSTA 4H9GA 4WXPA 2FF7A 3HPRA 2FSHA 3UKDA 4PO8A 1XPUA 3I72A 2GRJA 4OHZA 4UKDA 3I73A 4OHXA 3D6TB 2IS4A 4BE7B 4Q7KA 4YONB 3K09A 4F38A 1Z6XA 2XSZA 3KKNA 1AKEA 4DDTA 1KZ7B 1S4QA 4WA7A 5AJVB 4EPTA 2IUUA 3K0FB 3LQRA 3IKJA 5EP4A 1JXMA 3I4LA 4BFWA 3MGCA 4OI2A 4KSBA 421PA 4ZDIA 2ZYVX 1P72A 3Q7PA 3OESA 4OL0A 4XTCS 3GLIE 2V4ZA 2O0JA 1Q22A 1Q57A 1TQDA 2AR7A 2V6IA 1E4VA 4PZYA 3IUYA 1MO4A 4CGZA 3K0FA 1DAFA 2WJVA 1N25A 2QSYA 1W49A 2Q3HA 2XZPA 3ASYA 4C0QC 5SZIA 4BZPA 1OXXK 5AK0A 1NJGA 1XMSA 3SFVA 4FCTA 2WZQA 5C18A 1ZNZA 3LBIA 1WCV1 3RS3A 1OIWA 1HH4A 4M22A 3GJXC 1OE0A 3WMEA 1P9RA 3KFVA 2R62A 1ODFA 4BASA 1JR3A 2VSOA 2WAXA 3V4FA 2BDTA 2WKRA 4Q9JA 3WYFA 2XTNA 1G21E 4B2PA 4W5JA 2JLXA 1KK0A 4KITB 3P4YA 1EXMA 2VP9A 2MMCA 1L4YA 4B3DA 4DLUA 1E96A 3ETLA 4KFSA 4NYJQ 4TTRA 3GEEA 2DY1A 3IILA 4TQUS 1E9DA 3ZVRA 2CMKA 4WW0A 4PX9A 3PEUA 1T4GA 4I1VA 3EWAA 2CCJA 3BK7A 4PQFA 5JSZA 3THWB 2AL7A 1HYQA 3CUEF 4NYJR 4M1KA 3BH7A 1GKUB 1DELA 4ITRC 1ZBDA 1M8PA 2IHYA 4XVRA 4TWZA 2FJUA 3AQ4A 3THXB 4HAUA 1SKQA 3CO5A 1MO6A 1TU3A 4KVAA 5J40A 2E9SA 5DI3B 3GLFA 2VO1A 2O8EB 4PHHA 1U81A 2O8DB 1AZSC 1W4BA 1Z08A 5L3RA 4GBMA 5KTYA 4ZDJA 4XWAA 4JBYA 3OFND 1AGRA 5DIFA 1KK2A 2G6BA 1LF5A 2ATVA 2KE5A 2OZEA 1NN5A 2QL6A 3LV8A 4RZ3A 2P5TB 1AJEA 1G3QA 1BO6A 5AJZA 2C95A 1ZC3A 3K09C 1QHSA 2QY9A 1KMHA 3T5DA 3BRWD 3TH5A 5EXSA 1SZPA 4NCHA 4GOXA 1EG7A 1VPLA 4OHVA 3LX5A 4X8LA 5FTKA 4ARZA 1G3RA 3FKSD 4CRWB 1LB1B 4P4SA 4OJQA 1DAEA 4JVMA 2GKSA 4CEJA 3M0EA 3WBJA 1US8A 2QU8A 2QMEA 4QHSA 2PJZA 5FOXA 4LPSA 3FOZA 1FW6A 3RABA 1EFTA 2QM7A 3B1WA 2DBYA 2PBRA 2QGZA 3NBYC 2V7QA 4WVFA 2MSDB 5SZHB 3R7WA 5EUQB 2XZLA 1LW7A 1GNQA 1X6VA 3TVDA 2PLRA 4TL6A 3OE7D 4RCZA 1YRAA 3LAWA 1P75A 3UWKA 3E70C 4Q02A 3V9PA 4QJ3A 3LLMA 1SVOA 4HUQA 5FL3A 5EJEA 4R2HA 2GNOA 5E4FA 3JVVA 1YZNA 3AVQA 1IOZA 2GCOA 4QHYA 2C03A 3AF4A 5JRZA 1XCPA 4Q00A 1R4AA 3OEHA 1UBFA 2ANBA 3FPAA 1YR8A 4RD0A 1MT0A 2BOVA 1F5NA 1DTSA 4K8OA 3DMNA 3CF6R 3DEFA 2ODNA 3GJ6A 3MMPA 3QEOA 3ZZ0A 2QEQA 1E9FA 2C5LA 5J5CA 3QVUA 1VKJA 5EXPA 2R6DA 4A8JC 2QTFA 4EIWA 1RIFA 3LLUA 4ZIRB 2X2EA 1IY1A 1CULC 1KSFX 1XXHE 5CK4A 3TSOA 2IL1A 1Z8FA 3U7EB 2MMGA 2Q9CA 3EAQA 1NBME 2EYUA 3P26A 1ZU5A 2BEJA 5BQ5A 1U0HC 3NHBA 2BMDA 4JLOA 2EFCB 4IJMA 1NMYA 3N70A 3RAPR 3WRXC 1E2NA 4IVRA 4BLPA 4OHYA 4NYMR 3K9LA 3PUWA 1H8HD 4V0KA 3QXSA 3QJYA 4Q9LA 2W6IA 4B34A 3LQQA 4HSEA 4L16A 3K9GA 4HB3A 2JLVA 1S0UA 4DT1B 1NLZA 1P73A 2ZE5A 4TMVA 3PR1A 2IYUA 2NTYC 1P9WA 1P6XA 4JIMA 2PJRA 1X8JA 3FFBA 2QT1A 4MYUA 5JSZB 1G8PA 2JJ1D 2QP4A 3CKLA 3OHMA 2FSIA 2XTZA 4B3FX 4RJLA 2W0MA 2GJSA 3R8CA 1F2UA 4L15A 5B30A 1S3GA 5FBRB 5K8TA 3T1TA 2ZRHA 3MJHA 3H86A 3VR2A 1ZM7A 2QTHA 1O87A 3TAUA 3MFYA 4ZKEA 2LCFA 1KO1A 1VG9B 2OUKA 3K0CA 5LPNA 5KDLA 5IF9A 1GM5A 4UXJA 4LHWA 3CPEA 3K8YA 4JYBA 1KO8A 3TLXA 1D8TA 2V6JA 2FH5B 1E2MA 3VKWA 4JBWA 4MH0R 4OQLA 2BMFA 4R2IA 5KPJA 3SHFA 3ADBA 3RLFA 3A4NA 3GFOA 4NCNA 2O52A 1EFRA 2I4IA 3TE6A 1U8AA 4IDQA 3U4QA 3PEYA 1N5LA 3UWOA 5CK5A 3WY9A 2NGRA 1XEFA 1PUIA 2ODWA 4Q4LA 2CLCX 3SJBA 1M74A 2ZSDA 3W6OA 4FXPA 3BB1A 4X8MA 4PPGA 1E9EA 2K5UA 3K1JA 1VDZA 1T5IA 3R9WA 3GEHA 1IBRA 1E2GA 5HZHA 1HT2E 4DDVA 1HUQA 1D2EA 3BB4A 2VHQA 1N6PA 5F2EA 2ZRJA 4YMVA 1KKMA 5LBIA 3O8DA 3LX8A 4RZ2A 4DB4A 2QGNA 4DSUA 2ZJBA 4HLUA 3GLGB 4KHZA 5HTKA 5H68A 3H4MA 3WHLA 4BLSA 3J81k 1CEEA 3HU3A 3KKPA 4EUNA 4UXHA 5GJWC 2H17A 5DN6D 1A1VA 5E7IA 4B2LA 4EJSA 1W5SA 1MRNA 2Z5FA 3LY5A 1EESA 2KBEA 1C4OA 1G6OA 1NVXQ 5FUWA 4DKXA 4EFNA 4DLTA 1QHYA 2WIBA 3RS5A 3PITA 3X2SA 3BORA 1D2MA 3CF0A 1ZCBA 4DVGA 1ZIOA 5JEEA 5AJYA 1WMSA 4G3XA 4HLCA 1U9IA 2GJ9A 3KJEA 2PX0A 4DCVA 3KTAB 1RKBA 1S2MA 5TXGA 1H8ED 2W6ID 4DLVA 3ZD7A 2XAUA 1G17A 1P61B 2ZI7A 4PPFA 2JIZA 4Q1CA 4CYMA 1N6KA 2NO7A 2ZYTX 4FCVA 1UEJA 5CB8A 3VNVA 2YOHA 1KO4A 3HU2A 5TY0A 4YDHB 1EWRA 4K81B 5KU1A 5F98A 5JHGB 4D6PA 5H1YA 1CXZA 1QHIA 3U44B 3VU9A 1Z5ZA 4CDGA 4QM7A 3EPJA 2V3CC 4BPBA 3SEAA 1GNRA 4GT1A 1IJFA 1J70A 3NWJA 5JCZA 2J0QA 1N5IA 2HV8A 4O3MA 1KI4A 3DOEA 4GPTA 2G9NA 1Z0FA 1CKEA 1KZGB 1N2CE 1SXJA 3CH4B 4R7ZA 2X77A 4N0DA 1AGPA 1W44A 4B71A 4CEIB 3U44A 4I1OA 4XSHA 3BB3A 2C9YA 2ZSFA 3TRFA 2J0VA 1FNMA 4DB2A 4A82A 3DDCA 3NC1C 2H16A 1SULA 4LV5B 4PO1A 2CJWA 3B1VA 3T12A 2BWJA 4HAYA 4TT3A 3S1AA 3V4RA 1CF4A 1JQLB 4NHOA 4P3YA 1Z29A 1TUEA 1Z0IA 1XU4A 2GESA 3I8XA 3LW7A 4C0AC 2JCSA 3B6EA 4O0MA 3X1XA 1C1YA 3LFUA 3A36A 4Q1FA 3JZAA 3I32A 2W58A 5B57C 4A0RA 2OLJA 4US1R 1Z2CA 1PUJA 3RS0A 1BMFD 4BFSA 4C0LA 3BXZA 4XWOA 2IS6A 2J1LA 2IW3A 1MOZA 4KJZA 5DN6A 3NHAA 1WE2A 1G5RA 2VHJA 3KKMA 1OIVA 1J8MF 4DIEA 2XOKA 4FMCF 4BRWA 4NZYA 3TNFA 3ZVLA 2JLYA 3ICQB 4N0EA 1E0AA 5DE3A 2B7CA 3QBVA 2Q3FA 2IHBA 4W9MC 1DEKA 1S1MA 4MDEA 2XTMA 4EKDA 3OZXA 4JS0A 4P31A 5JECA 2EYQA 3THOA 4Q1AA 2WV9A 2N1BA 4LSGA 4OBEA 1S8FA 4D0LB 1W7AA 1OYYA 4NMMA 3KFXA 1LS6A 3ADCA 2QRZA 5GADl 2H57A 2YWEA 2YWHA 4WBSA 4UXIA 1OB5A 4URYR 4F93B 2WOJA 3B1ZA 3PVSA 4LHYA 3FMIA 5JJKA 3BOSA 3QBTA 2WJJA 4PZZA 1CRQA 2GJAA 3FE2A 2RGAA 3CF2A 2JA1A 2PLFA 1OFUX 2YINC 3SDZA 3CR7A 4PPNA 3L82B 4NPHA 3I8SA 1OT3A 2B8WA 5JI3E 3C8UA 4AYWA 1GRQA 4FMDB 1G8HA 1T0JB 4AK9A 1TQ6A 1XEXA 3KDSE 1W47A 2BJWA 2NQ2C 2QSZA 4KFUA 4QNMA 5BN3A 1EWQA 2I1QA 4JL5A 3CNNA 3T1OA 2DFTA 4ILEA 3ZQJA 2A7QA 4CEIA 1W0JA 2D7DA 3VHXA 1E94E 3BGWA 3QXCA 2XB2A 2ZS9A 1FUUA 2ZI6A 4FWTA 1ESMA 3VX4A 2O8CB 2A5DA 3JVUA 3N2EA 3GLHE 1IXRC 4Q5IA 3IHWA 4OK5A 2OBLA 4JKYA 2YV5A 3TMKA 2J9RA 4BWYA 4MQBA 4TYWA 2CNWD 2IEYA 1V5WA 3QIAA 4FWIB 2PL3A 2FG5A 4KODA 1XB2A 2FPLA 3LBHA 4XD7D 2V54A 3WRYC 5KDDA 4I81A 2XITA 2ZI4A 2WWFA 2YWFA 2QMOA 4S35A 1T8UA 4MGZR 2OFXA 2DB3A 4OQXA 3TK1A 1NNEA 1XMJA 2HDNB 2YJTD 1BH2A 2ASEA 2OT3B 2Q0HA 2VRWA 3CRW1 2ZRKA 2KJQA 3HPQA 4ZO4A 4JJKA 4KO8A 3QSYA 2PMDA 5HKKD 2AFHE 4NYIR 3ZZUA 3VR1A 4NYMQ 1KNQA 1OF1A 4QNRA 2HYIC 1MO3A 2A5FA 4LBVA 2A9KA 3B82A 1GG2A 4HZUA 5FPTA 4KSCA 4QJ5A 5G53C 5F9FA 3KQHA 4Q21A 3C41J 3U6BA 4A4DA 4B2IA 1MKYA 4LV8B 1GKIA 2VBCA 2CHQA 2H5EA 2WPDA 4WXRA 3Q5DA 4V0NA 4HUQB 1V43A 2GXQA 1IN6A 1G20E 3B2EA 5AR1A 4B3BA 3W3ZB 1ZD9A 3AF3A 1F60A 2QAGC 3QF7A 4PC6A 5HR5A 4MDFA 3P27A 4Q03A 1GKYA 5A5GA 4A2WA 1E32A 3LXRA 1H65A 2IK8A 2QAGB 3T1QA 3U3MA 3A4MA 5IK2D 3TGPA 2IYSA 4K46A 4AIIA 1E99A 3AVUA 2ZUBA 3MG9A 2VTKA 2ZRNA 4EFLA 3PFIA 1COWD 2GZDA 1GUAA 1L8QA 3KL4A 4D82A 3SJZA 221PA 2EWVA 2ZS8A 4LHVA 4TLCA 3VMFA 5JEDA 1E9RA 2QBYA 1XWIA 2Q9BA 1G6HA 1VYVA 1R5BA 2OHFA 3ONWA 4TYPA 4HEJA 1QVRA 3HJNA 5EUMA 1KAGA 2ZJ2A 2XXAA 1G3MA 1NN3A 2PEYA 4AKIA 2HXSA 2NMVA 5E7JA 2YNMA 1U94A 3AF1A 2ZPTX 3SBDA 5BYKA 5KHOC 2FZLA 3VQTA 4B47A 4ASUA 3REFA 3FHTA 1J8YF 1T0HB 3GLGE 1E2PA 3L2OB 4CW7A 1TAGA 5FTNA 3WP0A 4RZXA 3GJ3A 3NDPA 3D8BA 5EE3A 1KDTA 2I1VB 4Q1DA 2IYYA 2Z6VA 4Q48A 621PA 1E2FA 3G82C 2OG2A 3U7FB 2RAPA 2XX3A 4IVPA 3EPHA 2BM1A 1R10A 2BKEA 2G0TA 121PA 3RDPA 1AA9A 1YJ5A 4GFDA 4PFSA 2FSFA 3IIJA 4LJYA 1UF9A 3CWZA 3VX3A 1SGWA 1CU1A 4OI4A 1D5CA 1YZQA 3FYHA 2FV8A 1HT1E 4D2IA 2FPKA 4DUGD 3AEZA 1Z6TA 2RCNA 4TMZA 1II8A 3I5XA 4KCGA 2BBOA 2JGNA 3QQ5A 3ZDQA 4A92A 4GI7A 5J4LA 3PEWA 2WHXA 1U0LA 3CONA 3MLEA 2F43B 5ANRB 5L3QB 2QQ0A 1JEEA 4IEIA 3QKUA 4R98A 4WZ6A 4HAXA 1JQJC 1TPZA 4B33A 2X8AA 4ZV4A 1QHGA 4DC9A 3O8RA 3L8ZA 2AD5A 2ZJOA 1Z6GA 4PSVA 4QBGB 3GJ0A 3KQLA 1P2SA 4HAZA 4TL9A 1NRJB 4ESVA 2BC9A 3C7KA 1UKVY 4QGAA 1CS4C 1E2KA 2VEDA 1LNZA 4MRPA 1MV5A 2VF8A 4LI0A 3CNLA 4LBWA 2F6RA 1AM4D 3X1ZA 1XDBA 3FGNA 4DLZA 4H1VA 3U7GA 1RZ3A 1CJVC 2ZRPA 4FIDA 4URVR 4Z51A 5AUPB 2KSQA 5HKKA 5CYOA 5K8IA 4JZKA 1E0JA 4LX0A 5B58C 4AYXA 4CZ2A 4DSOA 1U90A 4I99A 4AKHA 3HR7A 4YLGA 1E1RA 5DI9A 2GF9A 1YZTA 3T06B 3QVVA 3W90A 1PZNA 2C9CA 5JWOA 5KSZA 4DCSA 4CT4B 2D62A 3FHCB 1ZNYA 4Q7JB 4BLOA 4Z54A 4A6PA 3CPHA 1RRFA 2ZYUX 3MWLA 5LD2C 4BGDA 1SVSA 3Q9LA 3QUSA 2FU5C 1QHHA 2HXYA 4J0QA 2BKUA 2YYZA 1XTSA 2P2LA 3EZ6A 3ZYCA 1CLUA 4QL3A 3Q7QA 4PZLA 4BLTA 1CIPA 1SKYE 1US8B 1Z47A 1UBGA 1WBDA 4IHQA 2ZI9A 4E5UA 3IHLA 5H70A 2WM9B 4ZCMA 3BE4A 2QAJA 1BS1A 1E2EA 3LBNA 5CB6A 1CJKC 3TKLA 3CX8A 4EPWA 4GSYA 1G7TA 4EJSC 2ORVA 2XNDA 1IN7A 2O8FA 4GP7A 1KI3A 1ZJ6A 1VCMA 4M1YA 1HQCA 3HYRA 3UG6A 4V0ME 3KXKA 2C04A 2MSEB 2GDJA 3H1TA 2J45A 521PA 1RVDA 5P21A 1UAAA 1GITA 2O8FB 4LOAA 3VAAA 3T35A 5BW8A 1C9KA 1W4CA 3EWSA 5LB4A 2ZJAA 3T1VA 4A0GA 4D25A 1A4RA 1F48A 2JDIA 5CLLA 3SNHA 4GL2A 2QPTA 3ECCA 2W00A 5DISB 3KJHA 3B8HA 4TYNA 1E0KA 4TYYA 2DR3A 4IXNA 1IONA 4JYCA 2GCOB 2OXCA 2FOLA 2HUPA 1KTVA 1XX6A 2BBTA 1NLYA 1FX0B 1OJLA 4ASUD 1ZUHA 2EFEB 3O47A 4Y0VA 2HT1A 5JWRA 2VA8A 4DSTA 3CIOA 3FKQA 2DWOA 2GEDA 3C5CA 3GFPA 4URUR 3F3YA 2UKDA 4YC7A 5EP3A 3A1UA 3GJ5A 3W5JA 2ZE7A 4IRUB 5TVKA 1I4TD 1Q3HA 2CVHA 3BC1A 5GVRA 1D9ZA 2QZ4A 4JJZA 1DAHA 5D3MA 1DVRA 2ODEA 2VIIA 3ZLJA 1D6JA 1NVVR 4ZI3A 2WWWA 4P4SB 3M4YA 4GNKA 1Q0UA 3UXMA 3B13B 3DVLA 3PUVA 1WDTA 3U2QA 2P67A 1HTWA 3K53A 3AH8A 1R5OA 2JJ2A 5CLQA 1G4UR 3Q8XB 1OXTA 2OEPA 2ONKA 4RKEA 3PJRA 4BUJA 1E3MA 2ZR0A 4ZKDA 1NF3A 3UPUA 1FQKA 4TL7A 1GNPA 3SHWA 2C98A 1EFUA 3SYLA 2G3YA 5LDDC 1YQTA 1K5GA 1O3YA 1S9DA 2FFQA 3OF5A 1Z63A 4Q4HB 3CH5A 4IOMA 2VLIA 4M9XA 4TMWA 4RKFA 4OI1A 1P2UA 1IY2A 4MKFA 4LBZA 1OYWA 1W48A 1WF3A 2A5GA 3B9PA 2ZJYA 2CLDX 2ZEJA 4QBHA 2QRNA 3W5IA 2ZRBA 4B6EA 2JATA 3W6PA 1IXZA 1NIJA 1R0WA 2JEOA 4DWJA 5GJVC 1UBEA 5TB5A 4PQYA 2V55B 4JLNA 4BRUA 2NIPA 3L0PA 1AN0A 1R5NA 2VYFA 4PXAA 1W0KA 1E2DA 1GIAA 2RH5A 3AP1A 3WNCA 1W1WA 1PV4A 1L4UA 3DM5A 4FMCB 1NY6A 1BOFA 4Q4AB 3HYTA 1N6IA 1XMIA 1WA5A 2D2EA 3EX7C 4EDHA 4TL8A 2PZFA 4V02A 2LKDA 3AVWA 4LJAA 4LWZA 4XWKA 2J5XA 2HCJB 2OILA 5L3VA 2AD1A 2VHTA 2GK6A 4GZMA 1JALA 4JLJA 4PTLA 2R6GA 2ZS7A 2J0UA 2ZE8A 4JLVA 3CR8A 3M6AA 2YVUA 5TDHA 4KU4A 2OM2A 4KV9A 3AKEA 3OFNA 3RVBA 4TMKA 1KO5A 1ESNA 3FTQA 3A1TA 1NN1A 4B44A 2QN6A 3HR8A 5AWFC 1F2TA 4BQSA 3CLVA 1IN4A 1M7GA 1BMFA 3C14C 2RGCA 2CLSA 3KUCA 3UMSA 3SI7A 4US2R 1OB2A 2GVZC 4MGIR 4XVUA 2QAGA 1XD8A 1ZAKA 1G3IA 3PEVA 2O8BA 4TLEA 2RGXA 3OIYA 3PCRB 4OJKA 5FPSA 4Z8YA 4TLBA 5HCNA 3QF4A 1FFHA 2ZRFA 2CVFA 1EGAA 2WKPA 2WSSA 3GJ7A 3MAAC 5EP2A 3Q72A 1KK1A 2PZGA 2WPDD 1TQ2A 1XZPA 1CR0A 1YR9A 2OAQ1 2CBZA 3B9QA 4F4JA 4U00A 4Q18A 4KBFA 2WJHA 1OXUA 3SU8A 2IYTA 2ORIA 3WBKA 1TX4B 4URXR 3ZVMA 3TUIC 3Q3JB 1AS3A 1CR1A 1W46A 2IT1A 3MD0A 3EIHA 4O25A 4PSAA 1QHHB 3DHWC 4LJ6A 3EA5A 2BMEA 5GJCA 2XSZD 4HI0E 2XNSA 2EU8A 1KAOA 4EFMA 4CEHA 4II7A 3UIEA 2HJGA 1Q3TA 4IDHA 4D0GA 2H7VA 3ND8A 1TEXA 1NVUQ 2YC2C 1P7CA 2RGNA 4LPKA 2NOAA 2W2TA 1DAGA 4PAMA 1TF5A 2F9LA 3QKRB 5DYIA 2LKCA 3T34A 3IEUA 1SKYB 2QI9C 4LJ5A 2GHIA 1IN5A 5DGXA 3E2IA 1NL3A 1YZGA 3WYGA 5D3QA 1XZQA 4AD8A 4Q9HA 3AUYA 4Q01A 4HUTA 2ZSBA 2QA5A 2IF2A 4HZIA 5K8UA 4U7DA 2PX3A 3KZ1E 1FP7A 1WBBA 2A30A 2FX3A 1KSGA 2AWOA 1JAIA 1XTKA 2CE7A 3E1SA 1WRBA 2PT7A 4LHZA 4M8NE 4TLAA 3SJCA 4Q1EA 4B74A 1JR6A 4KI0A 3WP1B 1A7JA 3BERA 1W0KD 3Q5EA 5FTJA 4IEEA 1VHLA 5JI2E 3BH6A 1Q12A 1Q44A 4C0HA 4HLUC 5DNYB 3NIBA 5L3QA 1EFRD 1G9XA 3HDTA 1YE8A 1KKLA 1VHTA 3FHOA 4B76A 2CDNA 2BM0A 2B21A 1AQUA 4BFVA 4DUGA 4US0R 5C1BA 5G41A 1LY1A 3W8NA 2R2AA 1NBMA 2ZRLA 1GTVA 5TMPA 2R6AA 2Q6TA 2YOFA 4NONA 1F2UB 1YU9A 1Z06A 3T5GA 5JS8A 5KSOA 4NDZA 1JJVA 5FUXA 3M1IA 1E2LA 3GEIA 4MKIA 4DCNA 3T15A 3ZIAA 2ZRIA 3TUZC 1B23P 2BV3A 1KYIA 4MYCA 1M7BA 2FMXA 1JPNA 1NIPA 2QT0A 5J4VA 3CPJB 1Q21A 2ZITA 4TZ0A 5BWMA 4Z1MA 1EK0A 4OKSA 3TQFA 3GLIA 1GFIA 5CIWA 1UKZA 1ZM9A 4BFXA 4N1AA 2J41A 1Q1QA 4LYFA 3K0SA 2RGDA 4IOKA 3W9YA 1G8FA 4A8JB 1G4AE 5HZKA 2CCKA 2ZTSA 3EW9A 2BMJA 4LZZA 4MRSA 2GETA 1LFDB 2H18A 2XJ4A 4PANA 4YXWD 1KJWA 2NO0A 4TSFD 2QBYB 4NL4H 1XTIA 3D7MA 1T3SA 4A8JA 3O8BA 4B73A 5KDOA 1UEIA 2G1JA 5JJLA 4G01B 4W5HA 2FNAA 2FFBA 1T3HA 3CZQA 4KLZA 5F9HA 2R44A 2QG6A 2ZRMA 1BYUA 3CX6A 1JEDA 4AG5A 3B78A 1L2TA 4L4UA 5FH9A 1W36B 4PC2A 2ODBA 1E9BA 2GA8A 3W6NA 1RJ9B 5JHHB 2ZANA 1WQ1R 5JCPA 1MO5A 2VQSA 2FEOA 5HE9A 3RSOA 5FPYA 5JJIA 4UNPA 1TTTA 1F6BA 2QE7D 2X1VA 3FMPB 4KFRA 2FFHA 5G3ZA 2JIZD 4RY2A 3KUDA 1AS2A 1TEVA 2VSFA 3EA0A 2IYWA 3OEHD 1CBUA 5EQTA 3D3QA 2G77B 4POAA 1GSIA 2OCAA 3L0IB 4GMDA 2D06A 2WWXA 3U3JA 5IRCD 5FPHA 2R6FA 3I3SR 1HE1C 3ND9A 4DHEA 1NKSA 1NVWQ 2FGJA 3DPUA 2FDCA 3BJIC 4KVGA 1P2VA 1PLLA 4GOKA 4LYHA 2ZI5A 2ZM5A 3HWSA 3LXXA 4JVSB 5KO2A 1SXJD 2ZJZA 1JR3E 1ZRHA 1Y63A 2JLZA 2PT5A 2UVQA 1NI3A 2BVNA 3VNUA 2IXGA 4HATA 1T6NA 3AVVA 4Q47A 4R9UC 1L7VC 3VU9B 1QRAA 4MUBA 4MUAA 3K0AA 5IT5A 1SHZA 3IO5A 4NU0A 2IWRA 1NN0A 2ORWA 2JLUA 1E69A 1KI1A 2GZHA 4IW3B 1G8GA 1GL7A 2D2FA 4ZCLA 4P32A 2FZ4A 2ZRCA 2CL7X 3U3RA 4C7OB 3QKRA 3ZS9A 1ETUA 3A1WA 3LRPA 4DDWA 1B0UA 3QEJA 3RWMB 2J59A 1A82A 4Q19A 1KOFA 1II9A 1YZUA 1X3SA 4JKIA 4DCUA 3WNBA 1UBCA 4C0SA 4LJ8A 4DEYA 1J7KA 3LVRE 1JR3D 5JRJA 2GCNA 3WXMA 2VH5R 1FPMA 3ADKA 2O8DA 4IVQA 1OHHA 4LC0A 3LD9A 4B32A 4O2RA 5KYKA 1T9HA 1YVDA 1IXSB 1ZVQA 3NH6A 4HYYA 4B35A 3ZVNA 1NBMD 1Z0DA 3GD7A 2V9PA 5DHFA 3S1AB 4A1FA 2GXUA 4FI3C 4PC1A 3THXA 1IN8A 3SJAA 2G83A 2BEKA 2VP4A 4JMPA 3L8YA 1S1CA 2IWHA 4C0JA 4LUCA 5FPKA 4UJ5A 1KO7A 3RRZA 4A15A 2WMNB 1KI7A 1TMKA 2XB4A 4DEXA 1DE0A 3QPUA 4FN5A 2QP9X 4C2UA 1E9AA 2F1HA 3VHLB 1P4SA 2GAOA 3TSZA 1F2TB 4ACAA 4DLXA 2RKOA 4HDCA 1CRPA 4D4KA 2RHDA 4Y0AA 3T61A 3AVYA 2WIAA 4D4MA 1OFTA 2WJIA 3IPXA 2KBFA 3NBFA 4OQNA 3AM1A 1OV4A 2A5YB 2QTVB 2ZU6A 3LWNA 4Q4JA 2ZSEA 3MWYW 4LY6A 2HF8A 3HU1A 1CJTC 4URWR 3RHFA 5FOTA 4YMSA 1SVLA 1DBSA 2CCGA 4MGYR 1S9HA 1G1MA 3RS2A 3K70D 3KX2A 4BEJA 3RNLA 4DLWA 1WXQA 4DBLC 2OCPA 5C4MA 3CZPA 3UG7A 3AGQA 3OIVA 4DLYA 5EE9A 2B92A 2GXSA 1DAIA 4EJSB 1GRNA 5E7MA 1RRPA 4TN1A 1XCMA 2QORA 4M1TA 1Q20A 3RC8A 4M1MA 2PH1A 2F1IA 3DZDA 1R0XA 2VP0A 3OIWA 5BN5A 2QMHA 5EZ6B 2R8RA 2OXRA 3RANA 3GLFB 1VYUA 4TQAA 2OV2A 1CJUC 1G3UA 1H8HA 2CJWB 3U60B 5KSYA 3SE0A 3AVXA 3L43A 4IKEA 1DG1G 4BZXA 3QF4B 4HB0A 4HDOB 1N6HA 2VSXA 5G40A 2GILA 2YHSA 1SXJB 2WMOB 2ZJ8A 2PZEA 3ZGXA 2W83A 2A78A 2P6NA 2QP3A 2VP6A 3IGFA 3QKTA 3LH5A 4HB2A 4ZIRA 2J0SA 4PC7A 1T5LA 2O0HA 2TMKA 3AUXA 4G0NA 3KJGA 1MABA 1HQYE 2G1KA 3CNOA 3KB1A 2OFWA 3F8TA 3I5YA 1NMXA 2YC4C 4CIDA 2LWIA 3DO6A 1XTJA 3KQUA 1R8QA 3B1XA 2ZJ5A 2WOOA 3N2IA 5J4KA 1H8EA 1XD2B 1UJ2A 4NCKA 5KUTA 5D3MB 2MSCB 1IJEA 1DAMA 4OYHA 3DMDA 3FKSA 3GQBA 1PLJA 2Z4SA 4G1UC 4A0FA 1DPFA 4XH9B 2WWYA 3QPWA 1N6OA 1P2TA 4QG7A 4G5OA 1JECA 1DO2A 3LDAA 4B3XA 4DLSA 4F92B 4RD2A 1HV8A 2WVJA 5B2ZA 2W2VA 2ERYA 4JT4A 4LC1A 1XPOA 2QENA 4M21A 4F91B 1G7CA 2IC5A 3OAAD 1XPRA 3K9NA 4JLBA 1DS6A 4Q7LA 4OK3A 2AHOA 1Z3IX 5FTMA 1W2HA 3W3AA 5BN4A 2IYLD 3CM0A 5LB2A 3CBQA 2ZAMA 4JLAA 3THYB 1CR2A 1FMJA 1KNXA 1KJYA 5DO9A 3DKPA 4WAUA 4PHGA 3SS8A 2JLSA 4UNQA 2I3BA 4BFZA 4Q4HA 3PUYA 4LJ4A 1E2HA 2IYZA 1E2QA 1E9SA 2JJ8A 3QE0A 4D26A 4D4LA 2H1LA 821PA 3VR6A 4AC9A 2KB0A 4C0KA 4B3GA 2C2HA 3UMRA 2EFHB 1VIAA 2RGNC 1ZC4A 4MYHA 1U98A 2EFGA 5C2JB 4R71A 4M2LA 1DAKA 4IFBA 4RD1A 3U5ZB 3LA6A 1KK3A 2C96A 3ICEA 4LV6A 4KBGA 4NTZA 2CXXA 2VF7A 1KIMA 2PCLA 3OIUA 3GLFE 1N0UA 4EPYA 1TF7A 3RWOA 3TSWA 5CM8B 1A2BA 2ZR9A 3CB4A 4RVCA 4RD3A 4V0OA 2P6UA 1X86B 1NSTA 1NP6A 5FOWA 2R6CA 2F9MA 1Z28A 2F3TA 2Z0MA 1U99A 3WMGA 4U02A 3I61A 3AKYA 1AQYA 4Q7MB 5DI3A 4GMXA 1OKKA 2V1UA 4QM6A 2B8TA 1G41A 1HY3A 1XXHB 1K6MA 2DHRA 4MRRA 4AG6A 5E3HA 4F4CA 3IEVA 3EIQA 1ANKA 2X2FA 1N0VC 3X1DA 4C3ZA 3TR5A 2WWGA 2YOGA 4D4JA 2NO1A 4PAOA 4V0LA 1YHNA 1JXOA 2ZVPX 1UKEA 1K5DA 1OFHA 3SN6A 4DT1A 3BFKA 4YMWA 3RS4A 4RFSA 1J2JA 1Z6AA 1TF2A 3QXXA 4H1UA 4MKGA 3IIKA 5DLQC 4TYQA 3DZ8A 2YKGA 1XCGB 3IPYA 2BBWA 4CEJB 4LK2A 2ZUDA 4RZUA 4FINA 4YDSA 3ZZTA 4NP6A 4JSYA 1XF9A 2O5VA 1ZYUA 3I1FA 2DPXA 1PLKA 1OH5A 2A5JA 2F1RA 5EE1A 2OE2A 5FUVA 1P60A 1T8TA 5M04A 4A36A 3K70B 3N5CA 2Z83A 5HPYB 2E87A 2AK3A 2WJGA 3NBZC 3PV0A 2XZOA 2J46A 5DHAA 2VHUA 1OHHD
chains in the Genus database with same CATH superfamily
1XKTA 1XIVA 1ECLA 1SXJC 3G88A 4GRDA 1HE8B 2FR0A 3NVMB 5JTTA 1T4BA 1HFEL 1OI3A 4BJ3A 3GPDG 4M0LA 1KDPA 3AIIA 3FNEA 5AVRA 5K3FA 1OREA 1P7PA 2W8ZA 5ARDA 4X92A 3SOPA 2FQYA 1A2OA 4NY1A 4L74A 2OM6A 3CRMA 2G7MC 2WBLC 2BMWA 1YUNA 1YVUA 1FK8A 1OFIA 2PX8A 3VR4D 3JYLA 4MJXA 3UMFA 5JALA 3Q7RA 3ZE8A 1VP3A 3QWFA 4MWSA 1R64A 3GY0A 4A0HA 4NBSA 1PZMA 1D2NA 4PSKA 5A3VA 4OCZA 3KJFA 4GBJA 1JIJA 3CWQA 3PX2A 2GAAA 1GTG1 1L4GA 5AR1A 2PEZA 4UNNA 3MMNA 1FY2A 4XGKA 1CUXA 1GGJA 4GUDA 1I7PA 4BB0A 4BBAA 3PIDA 1DCMA 1QPBA 1WJGA 4MQEB 4NX2A 3NWBA 3SCZA 3JTMA 2HV9A 2GEUA 3WLSA 2EL9A 4E09A 5HP4A 3W79A 4QD3A 3KSUA 4AUMA 2IP4A 8ABPA 4V1CB 3FCSB 1XYVA 4OXQA 4DRZA 2CJXA 3W06A 1PAUA 2PWBA 3LF1A 5EY5B 3LCUA 5EYPA 2NZXA 5T4BA 3SQWA 3TIFA 1KS2A 4GLOA 4ENPA 1Z0SA 1M6VB 2DETA 1EFDN 5I9LA 1NFQA 1U65A 5FAKA 4XD7A 3ZIUA 4QOSA 4EI2A 2I99A 2AKYA 2PN1A 2PMWB 4QARA 2IYFA 5I7AA 1X1BA 4YRKA 1Q7CA 1WOYA 2D7CA 1R0YA 3FDJA 3NANA 2NZJA 3P94A 5LCXA 4BX0A 3IDOA 1T15A 1BHJA 2YZMA 3Q6NA 3L0OA 2PX2A 4POOA 2PUDA 4LE2A 1JLLA 2VF2A 3AVOA 3SXUB 3C70A 5ALRA 1PW5A 2ZI3A 5J4YA 3UB2A 2JJ2D 3O3CA 3Q1KA 1L5NA 2NSYA 2VR1A 2ONJA 1KDYA 3MWGA 4UAJA 1HNXB 4ZXFA 2D2XA 4E3ZA 2B4KA 1C1XA 3F5FA 2PXHA 3MSCA 4FC6A 1BKDR 4MV6A 4QRIA 5FI5A 1NKTA 4FYPA 1II8B 4TXHA 4CIBA 3I3OA 1YRQA 4CKBA 4OHWA 4XLZA 5ESDA 4DLKA 1Q17A 2AH5A 5GVSA 4QHTA 5BN4B 3ZV7A 1DFGA 1EVJA 5JFGA 5FUMA 3KXIA 1ADBA 3ANLA 3RG2A 5K1ZA 3GYBA 4IQ4A 1RE0A 3OX1A 4LZLA 1IATA 1KSHA 1ZCJA 4Q3AA 3Q8KA 2JAWA 3IBGA 4R2XA 5F77A 5L51A 3JQFA 4JLDA 1M2WA 4YTEA 5DHSA 1QF9A 2QNRA 3TRJA 2ZVJA 5DWQA 2IE8A 4C9BA 4XQEA 4Q9IA 3EAFA 4HXGA 1BIFA 2E5FA 2R65A 5BY2A 4U2EA 4DQLA 5FORA 1NQXA 4KC0A 3NVKI 5TLSA 5BOVA 1KH2A 2O2EA 4OY3A 4D6XA 5KNCA 1ZD8A 2VCHA 4TVOA 2AK2A 3NM6B 4YJHA 5KJ6A 3MAJA 3WL5A 4AYTA 1Y4AE 4ARCA 4RLSA 4NE9A 2P69A 1UP4A 4HGNA 4YAGA 4N5NA 4Y1RA 1CY2A 3TPZA 2EBWA 1GPJA 4LGMA 3BH0A 1I7LA 1XFAA 4YJGA 1Z07A 5FBLB 1QYVA 4CL8A 2JNWA 2JGMA 2RGBA 4CT5A 2DWQA 1G98A 1PJ3A 3E1GA 1SXJE 5MDHA 1PVOA 2HREA 5IUJC 4OLBA 1GVNB 1CLEA 2XOEA 1SKAA 2B8EA 2P65A 2Q5CA 3SE7A 3D2LA 3HCEA 3CW2A 1WZEA 2OO7A 4RW0A 4D56A 5FV7A 2R00A 1E98A 5JOQA 3TTWA 2J3EA 1ZGJA 3UK6A 2FQXA 1H42A 3A1VA 4B6PA 5FV4A 1XLVA 2ATXA 1ULBA 3L7JA 4R3WA 1O97D 3FCAA 2VA9A 1EFCA 2VRBA 2PH5A 2H0RA 4NPCA 4NPAA 3NAGA 3B7GA 4OK6A 3UPTA 1J49A 4OKNA 1OXVA 3JD1A 4Q3KA 1QRSA 2DFLA 1FDIA 2IZOA 2OKCA 3AHGA 2P9TA 4GBGA 1E0SA 2CHGA 2QUZA 4J6FA 4LRSB 3KYCB 1J06A 4NABA 5ITSA 1UJBA 2HA6A 4V0MA 2G9QA 2AB0A 2ENUA 4UM5A 2HU2A 1JTEA 3HKBB 4MQ6A 1NXOA 1PNQA 4YROA 3JVEA 1WMEA 2QYSA 1QVAA 1Y9EA 1EFHA 1DOAA 2HC9A 4MR7B 4QGGA 4AY2A 4I5FA 1M2GA 4WK0B 4HDNB 2AW5A 3HG7A 5HILA 4CQJA 5ILQA 4PZUA 1LBTA 1PJSA 3NTRA 4GZLA 5JG7A 5FBVB 1X1RA 1V4BA 4KGDA 3ZGVA 4A2CA 1I2DA 2ZCJA 1GOTA 2APJA 4RSGA 2YYSA 5KYUA 4HEA1 2F7SA 1M8GA 4DCMA 4WOPA 2ZETA 3ESQA 3I6QA 4K3VA 1ZUNA 3ETHA 3PLRA 3GIDA 5F12A 4CKYA 5HMMA 3T9CA 3NS7A 1UKYA 2Z9CA 3H0CA 2A0KA 3FPSA 4FYYA 4IXDA 5T7BA 4FCCA 3HKCB 4MXDA 4DANA 1QGOA 2JLRA 3DE5X 3TTSA 3SF8B 2I0FA 2HYDA 4GP6A 2R8PA 4ZCIA 1NA5A 1WEHA 1MQ9A 3TLYA 2QYHA 4A6XA 2CNWA 4JLMA 2QN3A 4BKPA 3WMRA 3LBAA 3ICWA 3FWPA 3LT5A 4MS4B 3RFTA 2B34A 2HDOA 3P8ZA 2IOFA 3C16C 3R2JA 1JAYA 3CLSC 3IPLA 3H2HA 4XJTA 1ISSA 4QBFA 4HBZA 5LXTF 2OCBA 5K0BA 3BVPA 4PEVA 4LWPA 1WNFA 4FKZA 4Y2GA 3G0IA 1S89A 5LLTA 4X6UA 1F8XA 4BS9A 2WU3A 4LXYA 4LMRA 3TTYA 2HUNA 3ZGLA 4CKEB 1K27A 2RB4A 4EB0A 1NMZA 5M7EA 2ZZMA 1Y6JA 2GYVA 2YJ5A 3AF5A 3LWZA 4RCVA 1F0YA 2X40A 3JYHA 3AHIA 2CK3A 3EC2A 4G5XA 4OB7A 5TJ9A 2ZYGA 1HK7A 3NDJA 4GBED 1D6SA 3ZJYA 3CY6A 1YOBA 4O8CA 1HO3A 5AVOA 2BFAA 1XJCA 2CUNA 4FSXA 1YJQA 2DHQA 1Q2UA 1T3LA 4NFSA 2VTBA 3H04A 3D8NA 2B5OA 4PFJA 3Q9SA 1UM8A 2VJCA 4QC2A 2EZ8A 3TVYA 5IAGA 3AGPA 2E4WA 3TOSA 4DM3A 3CTMA 4BV3A 1IQ0A 1Z8HA 3FWKA 3BAZA 2CY0A 1G63A 2IHZA 4I6GA 3EQ7A 1FMTA 1Z2AA 2QU7A 1L7XA 2VUHB 3A1SA 4HRXA 2MU1A 2ZIWB 1C0EA 3OQJA 3U17A 2WTUA 1QG0A 4NZNA 2OXFA 2Y8EA 1WKBA 3TE7A 1Z6ZA 2AJLI 2CHFA 5PGMA 1NBOA 2HLDA 2HR1A 1OU0A 3OKAA 4I4LA 4D0NA 2IEZA 4IJUA 5EMHA 3FSGA 2FPMA 5G3YA 5ES4B 2E0IA 5JS7A 2CHVA 2Z2XA 3C6QA 2B7LA 4WZAE 1MJGM 4LWQA 3EPPA 4ZAXA 5KEIA 2DR2A 1V25A 5FEUA 3QUTA 3ORSA 2FZGA 3A4LA 3A9SA 4QRDA 3TZQA 2IYVA 1KSJA 3M33A 2ZT5A 4QE3A 3UENA 5LYYA 4BNHA 3K0AB 3JD3A 3PYLA 4MWGA 2PCJA 3CZMA 5EE0A 5TRTA 3UMJA 1GV1A 4UM7A 4WNIA 3VPCA 4X20B 4AUKA 4CM9A 4EF5A 1XVAA 1SWWA 4KAXA 4QGSA 3ICCA 4IYRA 4TSFA 1QG6A 1KH3A 1MJ5A 2NG1A 1TQ4A 2ZT8A 2E6UX 3KKEA 3MCWA 4F46A 4JXZA 1P8AA 2PVCA 2I8LA 2I2DA 2ZZKA 1XCBA 2DFKB 2C58A 4FMPA 2X8LA 5CM9C 4B7ZA 5MHTA 1J90A 2CGEA 3PNLA 4P4UA 3S2YA 5CB0A 5K6AA 4LXHA 1PGPA 3NIFB 1VPWA 4GECA 1VZ2A 4Q3BA 1R66A 3VR3A 1SC4A 4A9AA 3WLMA 3HCPA 1X38A 1G5QA 5NULA 4D02A 1YH3A 2BPOA 3Q3VA 4Z4GA 1CZOA 4AURA 1C7EA 1WCIA 1ZITA 4N9WA 4NMXB 4TWAA 3QNUA 5DZSA 5JD3A 3AESA 1ZNXA 3JSXA 3B89A 3R75A 2Q1SA 4A03A 4B5LA 1XJ5A 1Z0KA 4PWZA 3GMTA 2GDZA 4F86A 4TT3D 2QE7A 3QXHA 4IXMA 4XCQA 5AVKA 3BBPA 2E49A 4KQ6A 4F4IA 3AIKA 1IQPA 3LFTA 1EK6A 1RAAA 4XGRA 4N5LA 4MPRA 1L7QA 2KI5A 4MB2A 4UBNA 1Y3CE 1P7ZA 2Q3MA 5I9BA 1MRSA 1XLUA 1Z6PA 3V4SA 2OB1A 4ND1A 4JVLA 4CM8A 1EUZA 3A70A 3EGXA 1VDMA 2DCUA 3DVAB 3RIYA 3GLHB 4WBNF 1PNTA 1PJLA 4QLAA 5FD8A 5UKDA 2GCPA 3RS7A 3VDQA 5G4KA 1WP9A 1YGPA 1DINA 1DKOA 2NU9A 2ANCA 3G85A 4QQKA 3VR5A 3CZCA 3NTUA 1CK4A 3IMGA 1G5FA 4YQZA 5IAJA 4OUDB 4K9PA 4REMA 2YZGA 1GQFA 1JI0A 1P0MA 2JJ1A 3A9RA 2V97A 3MBOA 2XQJA 4URFA 4N3NA 2V1XA 3BDAA 1NR7A 1AU9A 4RXUA 5IJAA 5FA5A 3SY8A 1JPJA 3I1YA 2Z8XA 1U2TA 3ZXSA 1D04A 1ZXXA 1U8YA 4RDIA 1V2GA 1ZU4A 3NEJA 4FFPA 3FVVA 4B6FA 1MXFA 1HLDA 1A50B 2GTPA 1KZ4A 4NOMA 1LRLA 5FR2A 1YMVA 1XP8A 5EJGA 2WY2D 2P30A 4IFIA 2FK7A 1T3ZA 2YHBA 2MJLA 2R6HA 3N8HA 1I9CA 4R7GA 4QFMA 4M6WA 1XRNA 3IERA 3FWNA 5SYAA 4L0CA 1NZDA 3O82A 1JQAA 1E59A 2EJUA 4EPXA 2JB9A 3D6JA 1W4RA 3F78A 3LM8A 5D51S 5C4GB 4K0RA 1J25A 1YRBA 3MMSA 1L9XA 5D5PA 721PA 4OHFA 5TNXA 4E5PA 1IBSA 3ELBA 1TZBA 4HN4B 4M0DA 3X1KA 5TEWA 5EKSA 1IBMB 5F3WB 4KLNA 1KI9A 2AOWA 2HB6A 5BSFA 3O8QA 3JCZA 2WR8A 2HM7A 2C5SA 4HZGA 1UKCA 1GQ2A 1QGED 2GB4A 3TQHA 3MGBA 3EEIA 4IGAA 4KDCA 5GGXA 5J47A 2OBMA 1HE3A 4XR4A 2OMKA 4E15A 1JE0A 4I1IA 2Y6VA 2A6PA 4GHWA 3GFTA 3WFZA 3RTBA 5FOVA 5EMMA 2D2IA 1HZZC 2HCRA 2XNDD 3NEYA 3JASA 2O8BB 1J2EA 4F96A 1MIOA 3C87A 4D4IA 1PL6A 5TVGA 2AWNA 1ZK4A 2WJZB 3PC6A 3W77A 1OFVA 3UBMA 4ENWA 4BVLA 2EKBA 4GPZA 2FR8A 4V3BA 2RK3A 4MITA 4IDOA 2ROQA 4IJVA 3U4QB 4CVNA 4E4YA 3EGXB 1ACMA 3DC7A 3IT0A 1JMKC 1PR5A 4ZCSA 3MGKA 3VV2A 3HVIA 5BT8A 3KWFA 1Y81A 3A28A 3NHSA 3DHYA 2TMDA 4TXJA 4QYIA 4JT9A 1V8ZA 1AGYA 3LGSA 3OQVA 3VNVA 3WISA 4PY2A 1REQB 3MWJA 4IIJA 3E4DA 2JCBA 4I1UA 4WLOA 3WGOA 2L18A 3TNJA 1H4SA 3KV1A 2B2NA 3ENZA 2PBFA 3L7DA 3P71T 4E4RA 2G5PA 1X7XB 5DSZA 5EKUA 4Z1OA 3NJ4A 1O0SA 3KTAA 3LLVA 1AZLA 2EAUA 3VKGA 3C98A 3HHEA 4BVGA 2FSGA 4UMEA 4EH1A 2AMJA 1QQ6A 2UUOA 4IDPA 4YVFA 5AM4A 2FXIA 4QRHA 3DHVA 5CGQB 1G19A 1XWWA 2IYXA 3PL1A 3TLCA 1GDDA 5A7HA 1ZK3A 3BZUA 4M9RA 3RK4A 4HVLA 1VJCA 3ONFA 2GN1A 3C1TA 5COQA 1I3CA 3ENWA 4LDAA 1ECGA 2J7KA 3Q3EA 4LRTB 5H3CA 2AEMA 5HIAA 3M4JA 1MUUA 3F0TA 3OZAA 3HJTA 3SX2A 5BSVA 4S2EA 2HJVA 4CM7A 5I7RA 1Z8NA 1JB1A 4HDAA 4X6YA 3RYTC 4RGQA 4DYHA 2P41A 5JO0A 2I4NA 4JJGA 3UV3A 4DF3A 2FSVC 1PK8A 2B6HA 2IUSA 2OPHA 3ROXA 4DJFC 1HXHA 3WFIA 3KKQA 1C9DB 4FCWA 4IUDS 2IODA 5FR1A 3SNKA 4CQNA 2XDQB 4D9NA 3QU2A 3UAYA 4UU7A 2DYKA 2H6EA 2R4TA 5B1IA 3FWYA 3L01A 1ZJ5A 4C14A 4YACA 2I9KA 1CZRA 1EJ6A 1OXBB 3VR5D 3NH9A 3IUJA 1KPHA 3A3YA 1U8EA 1QVWA 3NUGA 2XUJA 4F3YA 3HN6A 3A6PC 2WSIA 2FUCA 3GCXA 3RSLA 3T7SA 4AAYA 5KVVA 3VU0A 5K0GA 1U7HA 2YIMA 3ANXA 4KXLA 5JCOC 5T3YA 4QNNA 2ZWPA 4JEIA 1GDHA 1I3LA 3B12A 3PDCA 2AI2A 5DNAA 3V1UA 1KEEA 5LMZA 3R8FA 4Y9TA 3BRWA 4YRIA 4NG4A 1Y4SA 2L2QA 4F7WA 4L08A 5J2UA 5CEJA 4D9CA 1E6LA 4LECA 3W9BA 2QUBA 1ZJYA 2D8MA 1X7ZB 1Y98A 2BUBA 2DY0A 3OJEA 3K5WA 1UJNA 3ZQKA 3JAWB 4G1BA 1E1DA 2FWAA 3WV5A 5BYJA 5JXHA 5LR6A 3UUFA 1X8KA 3REGA 1J99A 3BXPA 4PAGA 1Y6QA 4DCJA 1MJFA 2BD0A 3FKJA 4OLJA 4OXIA 1W52X 5B6PA 3STUA 3TR0A 1YKSA 3PD1A 1YZKA 2BE7A 3HB5X 3Q4GA 4J76A 4MUKA 4X1KB 3T5CA 2KWIA 3PXBA 2O19A 3LNCA 4L95C 3T99A 3UXEA 4EQ6A 2A0FA 3EXHB 1YHYA 4CF3A 1JLHA 2HPVA 1K3FA 3PGXA 3ZNNA 1IIBA 1X14A 2RGWA 5ABPA 1I2ZA 5KTSA 2EJBA 3WYAA 4OX9B 4CLOB 4BUZA 4BWVA 4D45A 4TLLB 2IS2A 2HKIA 3ZBTA 1XQ6A 1HOXA 3IX7A 3F6BX 4Q7EA 1G2PA 1EB8A 1FX0A 2HFKA 4R54A 4UHCA 3G2HA 3TIVA 1R7RA 1O03A 1POXA 5L8VA 1S2IA 2AVDA 1SU4A 2OZLB 4UZFA 1EE2A 1SR8A 1W4AA 3PDJA 5IJ0B 1W9MA 1P0QA 2O05A 5J5AA 5BURA 1Z18A 1DSSG 1UWLA 2ZTHA 4JB3A 5DNWA 5KSPA 3RC1A 4I1SA 2IF0A 3B5JA 2R0QC 1DCKA 1F2VA 2G9RA 1A9ZA 1STOA 3NKFA 4DA4A 3P45A 1LTQA 2DQKA 1VMKA 2Y92A 4CR6A 4K2AA 1A9SA 4B48A 3L0SA 1YRHA 3EX7C 4Y9UA 3GLIB 1BJKA 2UUPA 3VC1A 3M1AA 5AM1A 2ZULA 3D43A 2JJYA 3HWRA 3COZA 5C1IA 3GDFA 4AI6A 3WYBA 1JYSA 1K68A 2FQWA 2KX7A 4DQXA 1NPYA 1AXGA 2YBDA 4G8BA 1XXLA 2FN8A 1XRSB 3G49A 1B1AA 1KHTA 1NW3A 3B1YA 4XARA 5IAEA 5AIBA 4RTSA 4IPTA 1YS1X 2JASA 3WA7A 4P36A 2O48X 4Z8XA 1V3TA 1KOGA 3PHIA 4DXDA 1P2BA 4QXAA 1Q1NA 5LN1A 4NCIA 2GYUA 3WKEA 4PONA 2JKYA 3PXXA 4RPLA 2H3HA 4J7AA 4PHTA 4RHCA 3RSQA 3TQOA 3COYA 1ACLA 3TW0A 4YA6A 2XMDA 5AW1A 1HFKA 2ZBFA 2R8XA 5B2EA 4WLFA 4LJKA 1RADA 2ATCA 1N2CB 3N6XA 4AZSA 3FNBA 3ASZA 1VG0B 1R2QA 4P0TA 4CJXA 4KAAA 1TKRA 1VE3A 3KEMA 5C3MA 1YACA 3EFHA 4C7VA 4DRYA 2X8JA 4U2DA 4OI0A 3TD9A 1OR8A 1W5FA 3IQZA 1GR0A 3TM5A 1HTTA 5CFZA 2RH9B 1LDEA 5E0OA 1ODIA 3MOIA 2ZG6A 3DFIA 4RDHA 4H77A 2GRUA 3TW8B 1E3WA 4PQRA 2XB9A 4ENTA 1WUHS 4J90A 1JG7A 4WIAA 3SBEA 2BYTA 1CJMA 1BXKA 1CUDA 1R0ZA 3BXOA 1O5TA 3NEPX 2CLKB 3O2NA 5FJIA 3ZHQA 1W36C 1GILA 2O3JA 4UATA 3RWBA 5JMTA 2CV1A 1R8SA 3EB9A 3PNYA 3EN0A 3PT5A 1D09A 1ZD4A 3ZY2A 4IR7A 4BFTA 3G2NA 4JSTA 3D8TA 3QV1A 2H8GA 4HR7A 4O4LB 2FF7A 5EGNA 2C2OA 2BM8A 3KBOA 1PQ4A 4TKLA 5JSYA 4IH1A 4DTCA 1EDOA 4QWMA 2YW9A 4X7MA 3I72A 2GRJA 3ZE7A 4CLEA 1J0CA 3QEBZ 1Q11A 1QHFA 2EX4A 4OHXA 5BW6B 3D6TB 3NP9A 1FUEA 1K2WA 2JPDA 1GSOA 3EDOA 2H7CA 4YONB 1ZR2A 4PLYA 4AZ3B 4JV5B 1WB5A 2ZBVA 3I1IA 1PZFA 4FGLA 4YRTA 1T2FA 1S4QA 1MZVA 2KW5A 3THSA 4E1BA 5JISA 5EP4A 1JXMA 3W6ZA 4BFWA 3BYZA 4OI2A 4PZ0A 2G08A 1CT9A 1PJTA 1QM5A 2C5EA 4ZDIA 1Z2PX 3K96A 3MT9A 4OQQA 5FNVA 2V4ZA 1ZD2P 2O0JA 1OBHA 1TQDA 3CNHA 3ZTWA 1BGWA 3IUYA 1MO4A 3QA9A 4DZRA 3Q6MA 1DU4A 2P9YA 4HGZA 1N25A 1Y82A 3KNZA 3OIFA 2X3FA 1W49A 4INAA 3EH1A 4IHJA 2FUNB 5SZIA 1YQXA 2FPUA 5JBIA 4L0MA 5EUBA 4MQ4A 1XMSA 4QTTB 3SIRA 2ORED 4OMUA 4P4GA 1WQ4A 2Z8ZA 3CS3A 4ZQHA 2WZQA 4AZWA 3CVWA 2HF7A 3L8MA 2LGJA 3EWIA 1GPNA 5F1OA 4D97A 1WCV1 1DJOA 1HH4A 1M1NB 1T1SA 4TSRA 5CT9A 3AR9A 2BEUA 3K0KA 5HS6A 3WV4A 4KGZA 4AXXA 3V4FA 1U5CA 4ZGBA 1NFRA 3GAFA 1E6UA 3OLZA 1FDVA 2XTNA 1G21E 4F8EA 4F4DA 5HWSA 1NRWA 1RTTA 2BFOA 4UVHA 3NGMA 4W5JA 3IR7A 4AECA 4IP0A 4LG1A 4KITB 5AVQA 2MMCA 1FVFA 1L8LA 1KEUA 1PIWA 4U9HS 1K8ZB 3ZLVA 3UJNA 3JRWA 1B14A 4FZRA 3F4BA 5LQNA 4I0WB 3IJPA 3E81A 1WV0A 2DY1A 3GEEA 1ZSYA 4A73A 4DMKA 5JFTA 4ZTBA 1E9DA 5AICA 4WW0A 4PX9A 5LYJA 2FP3A 4LA4A 4HAOA 3OEWA 4I1VA 3UPDA 3S1SA 2CCJA 1PR1A 2J32A 4PQFA 5JSZA 4DJAA 4B4KA 2ID4A 3TBFA 5H3LA 1N0IA 3BH7A 4AWBA 2WJ4A 3B9BA 3C4QA 3X44A 4ZZ3A 3KQOA 5DFAA 1MA0A 2VFAA 4XVRA 5FA6A 3ZHUA 1DB3A 2GCEA 3UK2A 4M0MA 4Z4HA 2FJUA 2PNFA 1KEPA 1VP9A 3V33A 3CO5A 1R4ZA 1GKLA 1GUFA 4RAQA 4CKBB 3NOXA 5DTJA 1ORWA 3DBOB 1XZFA 4GYJA 1QE5A 3KHTA 1NXXA 3DOUA 4REQB 1Y6ZA 4ZHQA 3MOGA 4PHHA 4X9XA 4PO3X 4QDJA 3K1ZA 3G7UA 5G0SA 3AUAA 2G4CA 3RHZA 1X7WA 5JAMA 3V1KA 1FW8A 2GNPA 2QTGA 1RAGA 3IP3A 4ZQCB 3OFND 3PC8A 4XPIB 1HLPA 5KREA 1X9GA 2YRXA 1UMCB 5AW5A 2PO5A 3SEFA 1QK5A 1LF5A 1SQFA 3MC1A 3H5LA 4CQMB 2ATVA 1NN5A 3TGWA 2WYOA 1EK2A 1RYDA 3T6KA 2P0YA 1G3QA 2EKQA 1WXDA 1FS4A 2JKVA 2O2XA 2NUPA 3PLNA 3RTEA 5ILOA 3GFBA 5EINA 4RF5A 5IC4A 2PD6A 1K66A 3K09C 3P9RA 2QY9A 3RO7A 5FI3A 4FR5A 1SZPA 2WIJA 2C5AA 4NCHA 3OH8A 3LX5A 4L9AA 4U2FA 4FHGA 1C0LA 4Q12A 3C2QA 2QD1A 4X8LA 3ENKA 4ARZA 3LP6A 5JO9A 2AEJA 4JHLA 3SZMA 4WZZA 5CBKA 2J9GA 1SBQA 1PL7A 5IUNC 2YCLA 2H00A 4MJ3A 1US8A 1T3TA 4YEDA 2W2PA 3GJTA 1F4PA 4LPSA 5K7SA 1FW6A 3DHNA 2O0MA 4IMJB 2DBYA 4AP9A 3OQHA 5L7TA 3IXMA 4RLFA 1CRZA 4E1VA 1Z73A 2VDWB 5JD4A 4M9CA 1Y80A 4CLOA 3EDQA 1YMQA 4NI5A 2CLMB 3R5TA 1MW8X 3OE5A 5DMHA 4ZOLB 3KUXA 1B26A 3KOMA 1J20A 1FTQA 5IFKA 4NEQA 3QYJA 1GARA 1YRAA 3BWVA 1P75A 3CT6A 1R9MA 3GLSA 3KLOA 1XQWA 4RCZA 1I3OA 3U26A 3L7IA 4MPPA 5D8DA 1SIBE 5FL3A 5EJEA 1JX6A 3JQAB 4ZQGA 4ZI7F 2IU0A 5F23A 4QHYA 3OQPA 2VF5X 4ZHSA 5CDHA 2HW8A 3L1UA 1UBFA 1RQ2A 1MMFB 4DYDA 1FNDA 2BEWA 2Q0QA 3ON5A 2BOVA 1A5SB 2JGLA 1DTSA 5EJ6A 2HQRA 4MQFA 4RLHA 3CSUA 3MMPA 4LXTA 1GCUA 1Q91A 3ZZ0A 1XE3A 3IEXA 1K88A 3ACBA 4M0FA 5EXPA 4NHEA 3QE9Y 1IVNA 3MXTA 2Q3CA 2XXJA 2W6QA 4ZVMA 5IXYA 4X24A 4EIWA 3WWPA 4F1JA 2XQGA 3PXCX 3OTIA 5EEGA 4HNSA 3RIGA 3TSOA 3ZDZB 3RTGA 3DDHA 4CCYB 5IH3A 2VWHA 3EAQA 3EXG2 2IV7A 4BNZA 5U4XA 5ADWA 1EUCB 2BEJA 2QLLA 4M99A 1JSRA 2YDXA 4CDMA 2R6R1 5BSMA 3GFRA 1GZHB 4JLOA 4KQCA 1TLFA 2BI7A 1NMYA 2EZTA 4PSCA 3A6LA 4BLPA 2H4FA 3N58A 3K8OE 2XMPA 3PUWA 4OHYA 3HH8A 1G0NA 4V0KA 4YRSA 1ZPDA 3IP5A 3QV2A 5M29A 4UPDA 5E9JA 2VJMB 2HSZA 4YALA 4GOMD 3C6ZA 1JG2A 2Z08A 1P1FA 5KNCH 4X1YA 2P5UA 2ZE5A 3H5TA 5A6VA 3PR1A 2IYUA 4TN5A 3OX4A 4K9NA 1HETA 3SQOA 3A6HA 3ODGA 2BE9A 5IFLA 3CGGA 1X8JA 3S2FA 3FTDA 3ZNPA 1E6WA 4CI0B 5BQFA 4LZWA 1E9VA 5JSZB 1I4OA 3OZIA 1M2FA 2YNMC 3WK8A 3WL3A 3OSZA 2HJ9A 2REQA 4Z4IA 5B30A 5K8TA 3ZHVA 3RSGA 3ED1A 3VR2A 1ZM7A 1GPAA 1GN8A 1XDGA 2QTHA 5CCEA 2LCFA 4UE2A 4AJOA 2O1WA 1VG9B 2JAPA 5BNFA 3UMMA 3K0CA 2B1JA 3DT6A 3QOWA 1NR1A 3D1JA 4HEQA 5K0LA 5LPNA 3ZUGA 4FQ5A 1OY1A 3ELWA 4P8RA 1EWTA 5HYVA 1YT5A 4QUHA 5IF9A 3OZGA 1GM5A 3NUQA 2OVBA 3L93A 4RNCA 3HZHA 3FUCA 2H52A 4MH0R 3QVWA 1KBQA 2AN3A 1RP7A 3GA5A 3U0VA 4F2HA 3SVLA 3ENNA 1QVVA 5DYTA 3RLFA 3TRIA 1EFRA 3PEYA 1DJNA 1U8AA 4IDQA 4OGWA 3TE6A 1N2ZA 1N5LA 2JI7A 5KOJB 2JEYA 5EHQA 1NQTA 2R97A 2VHXA 5ITVA 3CWCA 4QUIA 4YJFA 4R8KA 5KWEA 1MX1A 1VSQA 1XZKA 3WY9A 2DLCX 2NGRA 5M3BA 5IG2A 4Q4LA 3I09A 4ZQEA 2QUIA 4IWNA 2AN4A 4GEKA 4S2UA 3NQ41 1M74A 5DNEA 1FS6A 1ZEMA 4JBHA 3MB8A 1A5ZA 5ILGA 3ZTYA 4X8MA 2Z2KA 4PPGA 1E9EA 4NXNB 1FSSA 1SN7A 2O57A 1QU2A 4DIKA 3R9WA 1RPNA 2IP2A 2HU7A 1F0PA 1IBRA 3HFJA 3IAXA 3LIIA 5CR9A 1H3NA 3M9XA 3OY7A 3FRHA 2DQSA 4ARVA 4I5IA 3HXQA 2JBAA 3O8DA 3LX8A 2WIFA 4H35A 3SHQA 4B7UA 4DB4A 1BHO1 2BI8A 3GFSA 5KJ1A 4KHZA 5HTKA 3H4MA 1U7XA 1ZY2A 3J81k 5B4VA 2QT9A 4EA8A 2QN7A 3PRKE 1P6QA 2H17A 5DN6D 3SZUA 4EJSA 2F8MA 1W5SA 3IJRA 1G6OA 1NVXQ 3GJQA 2RI0A 2GK4A 4UEOA 3QW2A 3L5KA 4DLTA 4J3NA 2VRCA 3EBPA 3GMIA 1QQAA 1QAQA 2AXQA 4YAUA 1YBVA 4RLQA 1P5RA 1PVDA 1JKJB 3CF0A 2XMGA 1ZIOA 4P4LA 5CNMA 1U3VA 1T2AA 1K63A 3MT7A 3IMKA 4XWTA 4JC0A 4HLCA 1U9IA 3ILHA 3FYUC 3E18A 4C5AA 1E7WA 1I1OA 3VH4A 1R8YA 3E9RA 3U9SA 1P61B 2CBGA 1ADCA 4ZGWA 2JIZA 2JH9A 4I6EA 2BGNA 2GPTA 1UEJA 5CB8A 4UE6A 2YOHA 3BXHA 3HU2A 1QFZA 5TY0A 3OLQA 1N2XA 1EWRA 2BSXA 3GEPA 4YI5A 5DP1A 1BS9A 4Z9FA 4D6PA 5F98A 1NDHA 1TFRA 2GF2A 2JGAA 2PGXA 3VU9A 2H1OA 4GMHA 2PGDA 2V3CC 3BRSA 2QRMA 1QUEA 1RI5A 2HK6A 1R00A 4GT1A 3NOOA 4XKJA 2GAFA 4B81A 2DR0A 2X42A 3OF3A 1KI4A 5KJCA 3SDSA 2GBFA 1XRQA 4TMYA 1R0LA 3PJFA 1LDGA 1TXGA 2AMFA 3JZFA 4ID9A 3ONNA 4WFQA 4XSHA 3ZDYB 4B71A 1TEZA 2ZSFA 1DUSA 2WUDA 4TWJA 5BN3B 1I10A 4HX5A 4LV5B 2P1DA 1GFZA 4J91A 5EWJB 5DSXA 2FRDA 4I55F 4MS1B 3T12A 4RK6A 2BWJA 3NTQA 3S1AA 3OZCA 1YS4A 3V4RA 2Z3ZA 2ZBDA 3DE0X 3HGTA 3S2EA 5KTTA 2WQ6A 2Q8NA 4BYGA 4KP7A 1XU4A 2JCSA 3KEFA 2FPPA 2Q2QA 3MEQA 2OQVA 4O0MA 5KTPA 4YUVA 3OSUA 1I5OA 3X1XA 3LFUA 1VGVA 4Q1FA 1YE5A 3IJEB 2Q3BA 3GGJA 2XRFA 2B82A 13PKA 2YICA 3AWDA 4MUGA 3DNFA 5LDGA 3RU9A 2QRGA 4FUTA 5L9AA 1PUJA 6ADHA 3DGFC 1BMFD 1ECFA 4BFSA 4ZT7A 4HS9A 2IS6A 1G9SA 1O4VA 5DN6A 1Z3CA 5EQJB 1M1ZA 4W7HA 1L4LA 1WE2A 2VHJA 3HY4A 4L4XA 1YDEA 4UZSA 4IJKA 3VUEA 1EIZA 1TYAE 4NZYA 2FPGA 1YONA 3TNFA 3ZVLA 1UFKA 3EVAA 2YV1A 2AR0A 3FCEA 1NONA 2ZDQA 4AU1A 3NHYA 1NW7A 2WP8J 3WO1A 2RHGB 3IBCA 5B7NA 4ZU6X 4LY3A 4M8LA 1DEKA 1V6SA 4MDEA 1GA4A 4KIUA 4C88A 4C7XA 3OZXA 4P31A 1V4VA 1VL6A 3QFHA 4W63A 2EYQA 1QB7A 2WV9A 4RV5A 1LI5A 4PXYA 4P7FA 2P9BA 5JS1A 1OYYA 3OZRA 4PM4A 4E22A 3UJ7A 5AKHA 1YFKA 4C0WA 4FQ8A 2H57A 4FC7A 1G5IA 4YI3A 1NI4A 5JRDS 2CNOA 3CJTA 4URYR 3ZV4A 1A8QA 1CS0A 4NXMB 2PRYA 4ZI5A 2C0PA 1W96A 2I7DA 2XHEA 3LECA 4BVJA 3FMIA 3DDWA 2EKLA 1TM3E 2R5NA 4UDNA 5DEOA 1W75A 3ZU2A 1UBUS 2CVQA 2E2WA 4WXYB 1R5JA 2IITA 1CRQA 3PHBE 4PNHA 4JWTA 1B8PA 1W5BA 3CF2A 2POCA 2JA1A 4FYIA 4ABTA 2BEWB 4EHLA 3C6BA 3CR7A 4JUFA 3COVA 3L82B 4PPNA 5K4GA 1U9JA 3EH2A 4NPHA 5FOQA 1ZVKA 2FMUA 5JBNA 4FMDB 1K3TA 1G8HA 2WZBA 2NVBA 3FVWA 1TQ6A 1XEXA 2HCFA 3L1VA 1W47A 2ILVA 3G2OA 4HDRB 4FGJA 1ZW1A 1J2UA 3T1OA 3FOWA 4TMFA 4CEIA 3TO5A 1QP4A 2D7DA 2V9ZA 3BGWA 1C50A 3QXCA 1SOMA 2IEIA 3GZNA 3PNSA 1FUUA 4KXQA 4B46A 5C35A 1XAIA 4FWTA 3VX4A 2C7PA 1HL7A 3GG2A 2A5DA 2ILTA 3N2EA 4MUHA 4RF4A 4Q5IA 5FWYB 3MXOA 4DSZA 3W5BA 3SX0A 3PUJA 4O2BA 1WETA 2QLJA 2VHVA 3HO1A 3ZW9A 3TMKA 2F90A 3H4VA 4G23A 1ZOIA 3D3JA 5KSWB 4LZJA 2CNWD 5BQ3A 1J6UA 3A2MA 4PYMA 2FG5A 4XXHA 4YP6A 3WRYC 4QLBA 3D7KA 1P0FA 2WWFA 1P19A 1PSDA 1Z75A 1SBIA 1T8UA 1XN1A 1V0JA 2BDEA 3ZE1B 1BS2A 4R9VA 2VP3A 4RHEA 5GONF 3VPSA 2PM8A 1IRXA 5HTOA 2WTEA 4S0ZA 1JG1A 4XYGA 3B1FA 3ANNA 1PYOA 3KWJA 3GR6A 4KSYA 4NDNE 4RY0A 1JDZA 5IKOA 2YJTD 2ASEA 1DIHA 4FHDA 5CVCA 2VJLA 3GRPA 1QBGA 4QU9A 3I4CA 3OJWA 1GHTA 1QX3A 2PMDA 2AFHE 3UM9A 4MAFA 3WQHA 2JZCA 5LMUB 4N39A 4GZ5A 5MN5A 1ORIA 2Q5QA 3ZZUA 1V1RA 1CD5A 1X80A 3A3PA 1BW9A 1DFIA 2IIVA 2JFGA 4QNRA 4F6LA 3OQBA 1M2NA 4LBVA 2IV3A 4JEMA 1GG2A 2Q3DA 4X6LA 4IIHA 5JCXA 5F9FA 5U9CA 3KQHA 4N7BA 3C41J 2VXYA 3U6BA 4L5AA 5ICMA 1QH0A 4CU5A 3JQ7B 3G2PA 1X9IA 2VBCA 3EHDA 2R11A 3KYDB 4AF8A 5HSGA 2OV4A 4MPTA 3SMVA 2XE8A 4JP5A 1GZDA 4WOJA 4HUQB 2UUAB 2GXQA 1IN6A 1J00A 4WFKA 3W3ZB 1ZD9A 2BEVB 1F60A 1G66A 4KRXA 4BMXA 4C4SA 5JVDF 1U8UA 3P27A 1PEAA 1QO7A 1USIA 1Z45A 3IRVA 3DLIA 4Q03A 1U0TA 2EBHX 4J0IA 2YV3A 5FLYA 4ZVUA 1H65A 3T1QA 4A2WA 5FWNA 3A4MA 5IK2D 3AVUA