1QHSA

Chloramphenicol phosphotransferase in complex with chloramphenicol from streptomyces venezuelae
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
178
structure length
178
Chain Sequence
MTTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQSAEGGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLDVLWVGVRCDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTHKESIECAWAIAAHVVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CHLORAMPHENICOL PHOSPHOTRANSFERASE)
publication title The Crystal Structures of Chloramphenicol Phosphotransferase Reveal a Novel Inactivation Mechanism
pubmed doi rcsb
molecule tags Transferase
total genus 59
structure length 178
sequence length 178
ec nomenclature ec 2.7.1.-:
pdb deposition date 1999-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07931 CPT Chloramphenicol phosphotransferase-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1qhsA00
3AF1A 3QENA 4Q9HA 1P7CA 2RB4A 1EFRD 4DSNA 1VMAA 1GTVA 2CVHA 3BBPA 3MSXA 4C2TA 1FX0A 4WZBE 1KDTA 1XPOA 3QKTA 2KB0A 4URUR 4JBWA 4NCHA 2QUZA 2ZRMA 1P9RA 1OYWA 2ZRDA 1Z47A 4II7A 5SZJA 2PT7A 5CLQA 5FOTA 1E99A 1GNRA 3W6OA 4GOJA 1KI6B 4A82A 4HB4A 2IT1A 4IFEA 2W2XA 1I4TD 1CR0A 3U3KA 2V1XA 3EIHA 2HEIA 1OIXA 3EZ6A 3ADDA 5KNBA 1Z6TA 3G0HA 2QTFA 3SEAA 2C9YA 2GK6A 2AWNA 2IBMA 3AVWA 3CLVA 1F2TA 2XTMA 1JJVA 1KIMA 3R9WA 5FUYA 1N6NA 2ZYVX 4NONA 4RZ3A 2PX3A 3BAFA 4NYIR 4DB2A 2EFCB 2QP9X 1G8YA 4ZCLA 2QSYA 5KSOA 3ZVLA 3TE6A 4FINA 3TUZC 3AVXA 1G6OA 1P4SA 2OZEA 2ZYUX 1GAJA 2BEKA 5CLLA 2WWHA 3CF6R 3H0KA 3EPKA 1ZCBA 1XTIA 3K53A 1U8AA 2XNSA 4HZIA 1US8B 4M1MA 4XOIA 3HU3A 1UFQA 3WRXC 4EFNA 1GDDA 1YHNA 3U4QB 3SI7A 2JLZA 1BS1A 4DLTA 1ZM4A 2XOKD 3CZPA 5TXGA 4RFSA 4M9XA 2BKUA 4M21A 2XOKA 3QXSA 3QKRA 4DSUA 4QXAA 1E32A 3I5YA 3RLFA 1SXJB 2CCKA 2WMOB 3V00A 2JLYA 2ZM5A 1E1QD 1SKYB 2JJ8A 4IDQA 5JS7A 3KKOA 3IHLA 1E1QA 1NLYA 2FZ4A 2RMKA 4WVFA 1AKEA 1XEXB 121PA 2WJYA 3T15A 3UG7A 3IEVA 1TQ2A 2V8OA 2W0MA 3GJXC 4RD4A 1Z28A 2REXB 4XVQA 2A5GA 1XTQA 1E2IA 1G19A 5JSZA 3K0AB 2EFEB 4DJTA 5EE9A 4YQFA 4FCWA 3VU9B 4Q1AA 4BLTA 2RGAA 2RGXA 4D2IA 1WBBA 1WBDA 1G9XA 1XD8A 4HDCA 2FSIA 2OG2A 3VX4A 4AIIA 1RC8A 3C5CA 1NVVQ 5AWFC 2FSGA 2ZPTX 4C3ZA 2ZUCA 3LX5A 2HF9A 2H17A 5FTJA 3P27A 1RRFA 4JKYA 1Q12A 3PITA 5TV2A 5KO2A 1WXQA 1YZNA 2DWQA 3RAPR 4C0KA 2G0TA 2NOAA 3AVOA 2JJ1A 3QF4B 4AYTA 2PZEA 2ZRIA 2QPTA 4NE2A 4W5JA 2G1KA 1G5TA 1WQ1R 3ZJYA 2QNRA 2YOGA 4Q7MB 1XJ0A 2V1UA 1E9RA 2GCOA 1MO4A 4ARZA 4MDEA 4W9MC 2IS1A 1F2UB 1CR2A 3AB3A 4TL7A 3ZQJA 1R2QA 2RCNA 5DIFA 4C0AC 5CIWA 2BM1A 2LWIA 1EGAA 3T06B 5C2JB 2ZYWX 2WJJA 2A5JA 1EWQA 5KPJA 1HTWA 1Z29A 1NBMD 4ZDKA 1HV8A 3EA5A 3OIWA 2EQBA 1NL3A 2ZRBA 1Z8FA 3F0TA 2V54A 3R7WA 5KU1A 1Z2CA 1B0UA 4TSFA 5JWRA 1KKLA 3IIMA 3TSZA 1NVWQ 3A37A 4PHFA 1LF0A 1DTSA 1R5OA 5GJCA 3GJ0A 1IQPA 5M04A 2RKOA 3RDPA 5B57C 3MRSA 1AGPA 4C30A 3IEUA 2GBLC 3U7HB 3LV8A 4AYWA 1YVDA 4ERNA 4BFUA 1ETUA 1XWIA 4PPFA 4TYYA 1QHNA 2JLWA 5UKDA 4ESVA 1X3SA 2OXRA 2P5SA 2PEZA 1QHSA 3GLHE 4MGZR 4Q1FA 1VPLA 3QNUA 3VR5A 2E9SA 3AVUA 3FKQA 4P0TA 1W46A 1I2DA 4NYJR 2I1QA 4XTCS 4B3GA 4DLSA 2HJGA 1XXHE 2KJQA 1I4DD 3V4FA 3HU2A 4IDHA 1CXZA 2PJZA 2GVDC 4L4UA 3HR7A 1D9XA 3B9QA 2ZJBA 4RKFA 5FOVA 2ORVA 1I4LD 1VG1A 3RHFA 3KKNA 1XEWX 4HSEA 4E5UA 6Q21A 5JZVA 3GLGA 2CLSA 4N0DA 5CJ2A 3UMFA 4Y0VA 2H57A 1L2TA 4A15A 3GCGA 2IEZA 2X1VA 4A8JC 2C04A 1LS6A 2ORIA 2B8TA 4JLJA 4TQUS 3ICQB 4DDWA 4R7ZA 4PHHA 4QG7A 5CDFA 4KVGA 2JDID 1DEKA 4Q9KA 2FEMA 2A30A 3CR7A 3BRWD 3DHWC 1Y3AA 2ODBA 3A6PC 4UQOA 3NDBB 1Z6GA 2YINC 1ZC4A 5LDDC 3TAUA 4MA4A 1RJ9B 2HXSA 2N42A 1KK3A 1PLJA 4IDPA 3PUYA 3OAAD 2IWHA 8OHMA 2W00A 3VAAA 1NKSA 1OKKA 3RS3A 3S1AB 3HYRA 2H18A 2BBTA 4URZR 5JBQA 5KDOA 1VECA 2H92A 1G1MA 4V0MA 3K9NA 2PEYA 1A5TA 4L15A 4G5QA 1KOFA 4JVNA 2K5UA 1KI9A 1D9ZA 3L82B 3REGA 1TQ4A 2VSXA 4PXAA 4BFSA 3FE2A 1MO3A 1N5KA 4UXJA 5FR2A 2RAPA 4M1SA 2QRZA 1W4AA 4HYYA 4JYBA 3TBKA 3BJIC 4KLNA 3TKLA 4D0LB 3SBDA 3K0FA 4TYNA 1UDWA 1ANKA 4G5SA 5IHPA 4JS0A 5TARA 1R7RA 3CZQA 1G3RA 1XPRA 4HZUB 2BCJQ 4MRSA 5JI2E 1UEJA 2R65A 4IVPA 3TVDA 4KV9A 2BKEA 2ZROA 1U8YA 5HE8A 2FJUA 2NQ2C 1TTTA 3EZ9A 5IT5A 3B8HA 1NVXQ 3UIEA 4KITB 2XTZA 1KTVA 1TPZA 1GOTA 3B1YA 4WXPA 2X2EA 3C16C 3D6TB 1OB2A 3H84A 1ZAKA 4M1YA 3A1WA 2JATA 3PUVA 3THOA 4EPXA 3U7FB 2O8EB 2H5EA 1T9HA 1Q0UA 4GNKA 1IJFA 1CR1A 1X8KA 2CXXA 2CVFA 2NPIA 3EZ7A 4UXIA 5AJZA 3GLFB 4MRNA 3KL4A 3HWSA 3A1TA 4B33A 4DDVA 1W5SA 1M6NA 1E2LA 3JZMA 1YZUA 1GRRA 2GBLA 3HR8A 5DE3A 5JHGB 3A1SA 2RGNC 4JVLA 2OUKA 1KDOA 2NG1A 2F43A 5AJXA 5L3RA 4BLPA 2ONKA 1E2NA 2W2TA 4Q7LA 1N6PA 1E0KA 4X8LA 1WF3A 1ZU4A 5CB8A 4EQ6B 1QHXA 2Z6VA 1G3MA 1DAHA 1WDTA 5KUTA 2R6GA 2WHXA 4O25A 2XZPA 4D0NA 1OB5A 4LJ5A 1G16A 3SC3A 2QRNA 2XZLA 1NVUQ 1JECA 2AK3A 3FMPB 3GJ4A 2KSQA 4E03A 4HUQA 5L3QB 2QP3A 4LHWA 3WYAA 2IYTA 2VIIA 4W5WA 1R5NA 2QROA 1LFDB 2FZLA 1N0UA 4BUJA 2C03A 4NL4H 2GCPA 4QHSA 4V03A 3QKSB 1YRAA 4KXFB 1MO6A 1FL9A 1UAAA 4EJSB 1NVVR 2Z0MA 3DKPA 4MUAA 3NBFA 1JBKA 3RWMB 5LPNA 5AUQA 2A2ZA 2QU8A 2WWXA 4US0R 2GAAA 2JA1A 5AJYA 2R2AA 2OXCA 3I92A 2GK7A 1QBKC 4PHTA 4KSCA 1YZQA 1N0WA 2QEQA 3DPUA 4A6XA 3OFND 4Q01A 2GXUA 3WMEA 4DWJA 2QQ0A 1YE8A 1TUEA 1TQ6A 1DE0A 5EXSA 3RS0A 3X1DA 1GITA 2HT1A 2OBMA 4DT1A 5EE1A 4PZYA 4QC2A 5B30A 2ZU6A 2GHIA 1AIPA 3LX8A 2H7VA 1QHIA 3NEJA 2C5LA 1OFTA 2DWPA 4LJ6A 4LUCA 2EW1A 3ZGXA 4CEHA 2V9PA 1Z0DA 4L5BA 5FOSA 4CEIB 3KUCA 3UMRA 4TT3D 2VL7A 2WAXA 2VA8A 4DCVA 1T3SA 4NBSA 4RZXA 1IN4A 4DVGA 4AK9A 3ONWA 3VNVA 3GJ5A 3RS4A 1G5PA 5JS8A 1W36D 1X8LA 4BE7B 3LXXA 2VSOA 1QVRA 1S2MA 1G8HA 3TIFA 3AVYA 5FOUA 1OJLA 2XEXA 4AG6A 1E2JA 2CBZA 3AKDA 3K70B 4TYPA 2ZYTX 2DFNA 2VHJA 5G40A 3X1XA 1HE8B 5KDDA 2AN9A 1XFAA 1P2SA 1TEXA 5E4FA 4NYIQ 3IBGA 2CE2X 3DEFA 2FSFA 1P6XA 4P3YA 1YZKA 1SXJE 1TQDA 5H8WA 1N5IA 1VCIA 2FGJA 2ZU0C 1ZINA 2QPOA 1WRBA 2QZ4A 4KI0A 4L8GA 2E1RA 1KK1A 1HA3A 3RS2A 2LKCA 4GP6A 1EG7A 1QDEA 4OHZA 1SVWA 5DSZA 2IW3A 4FW9A 2JEOA 4UNQA 2ZIAA 4NDZA 4W5HA 3EC2A 3W8NA 1UPTA 2XNDD 1E98A 4LHZA 1T3HA 3Q9LA 2JLSA 3UPUA 4ZCMA 3EA0A 2IL1A 3AVTA 1VIAA 1H8HD 2IK8A 3CX6A 3VHLB 4GT1A 4E09A 1EX6A 1G7RA 2VF7A 3NC1C 2PZGA 1KY2A 2VO1A 3AF0A 4DCTA 2WWFA 3Q85A 4WZAE 1G6HA 3VR2A 2QMEA 1NP6A 4RD0A 2R6FA 4FD2A 4D80A 4D25A 1CJVC 2QTVB 1Q1ZA 2RGNA 3MWYW 3B1ZA 1QG2A 4Q47A 1OH5A 3NKVA 2RGDA 4L9WA 2QAGC 3KTAB 2FWRA 3D8BA 2DPXA 1II8B 3IO3A 1VG9B 3WMGA 4F7WA 1ZIPA 2J0UB 3I5XA 5K8TA 4MITA 4PPQA 1FUUA 1E2MA 3TRFA 4G5RA 1ZMXA 4ASUD 3GLHA 3QPUA 4K8OA 1FQJA 2CDNA 2BMEA 2CCJA 2PJRA 1KI1A 1E79D 1KSHA 1QF9A 1G4AE 2IS6A 1EX7A 4C7OB 1XXHA 2MSDB 2OAP1 3QE0A 1E79A 4NTZA 2AKAB 1ODFA 4D6PA 4XWOA 3TUJC 4RKEA 2GJ9A 4RZUA 4X8MA 2ZUBA 1Q20A 4F38A 4BLSA 1QHHB 3DOEA 3FFAA 1P2UA 2JLVA 5J4VA 2VP0A 2BM0A 5SZHB 3PIRA 3B82A 3KXIA 5JJKA 5IK2D 2MMCA 1E4YA 1TMKA 1A7JA 4UNPA 1N6KA 2QENA 2WVJA 1KZGB 1AA9A 1AS3A 3QF7A 1Q44A 3K9GA 5KNCA 4DB4A 2AFIE 4D4KA 3EIQA 3QOFA 4YDHB 3E2IA 2YC2C 4QRHA 2JCSA 1LVGA 4P4SA 1XZQA 3O8BA 2VP9A 2XXAB 3IO5A 1CJMA 2R6AA 2GILA 2WIBA 4DRZA 3BOSA 3LAWA 1J90A 2ZS8A 4MGIR 4LYAA 4LSGA 4MKIA 4UNNA 1P3JA 2HT6A 4G01B 3ZIAA 4D4MA 3H2YA 1BKDR 3O8DA 4BRWA 1BYIA 4DCUA 1E1RD 3KQKA 2B7CA 4LGMA 2DHRA 5JRZA 1E1RA 4IOKA 2UZIR 3K8YA 4CEJA 1GKIA 4PTLA 1ZNWA 2IUSA 2ZRGA 3DMDA 3RS5A 1FNMA 1U0LA 1DVRA 1HT1E 1SHZA 2R6CA 2YJTD 4OI4A 1XNJA 2HXYA 3A8TA 2OSBA 2EFHB 1OW3B 3JVUA 4NYJQ 2VP4A 4FI3C 2GWHA 2PCLA 2W6IA 1JI0A 2EWVA 3VNUA 2PH1A 4M1OA 2FMXA 4TTQA 1G8FA 3RRZA 5E7IA 2OFWA 2JLQA 5TVKA 4GRAA 3PEWA 1UKEA 3E70C 3FOZA 1HE1C 1VIYA 4BFZA 2ZUDA 1M7BA 4CT5A 5J4HA 4KHZA 2P67A 4NMMA 2QGZA 2F1HA 5JWOA 1VG8A 4B76A 1NMYA 1S1CA 5LB2A 1P2TA 1KI2A 3U3MA 3SBEA 1S3SA 3U7GA 3P4YA 1JALA 3LVRE 4ACAA 2V3CC 1SXJC 2J5XA 4LHYA 3AGQA 5DI3A 1SVMA 2VP2A 3LA6A 3SN6A 1AGRA 2GZHA 4YMTA 4M8NE 4H1VA 2ZRAA 1XBTA 3MJRA 1LS1A 1N3BA 1UBCA 4BFYA 4PAMA 3W90A 2DWOA 3OEED 3W6NA 4M9QA 2WSSD 5G3YA 1UM8A 1IOZA 2IF0A 4QNMA 4EPYA 2O8BA 1GNPA 3OEEA 1ZNXA 3AKCA 3PEUA 2WPDD 4A9AA 1E9SA 2BOVA 2ZQ5A 1AN0A 4HAXA 4LYJA 4Q5IA 4DHEA 4O3MA 1LY1A 3OIVA 4QHYA 5BW8A 2WPDA 4JJKA 1S1MA 1ZM9A 1XMJA 2NO6A 2YC4C 3KJGA 1UADA 1KO1A 1GZSA 2CL0X 3GEEA 1U8ZA 3ND9A 4HI0E 4JLPA 1UKZA 3AVPA 2HUPA 2ZR0A 4LY6A 4RD1A 3U3OA 2OESA 4WW0A 3VR6A 3MWLA 2GRJA 1U94A 3PG5A 3GLIA 1KI8A 1ELOA 4B3BA 2Q0HA 5BN4A 1J70A 3A1VA 2C98A 2PL3A 1KMQA 4U02A 4CVNA 3X1ZA 1A1VA 2Z4RA 3I32A 4TYWA 2AFHE 1TNDA 5K8IA 4TYQA 1MT0A 4V0OA 4QGGA 3K0CC 2QM8A 3LD9A 4TWZA 4B3DA 4PZLA 4LV6A 4QJ4A 5E95A 2OV2A 3AH8A 1DAIA 1G3UA 3U3RA 4R98A 5AK0A 4MGYR 3A4MA 5F2EA 1CIPA 3IIJA 3B13B 3AP1A 4XH9B 5IF9A 4KLZA 2W83A 3T61A 3K0EA 1YR8A 2ZRJA 3PEYA 3PUXA 2CNWD 5B64A 3U6BA 4GL2A 3R9IA 4MYCA 3B78A 3ZVMA 3HPQA 2CNWA 2BBOA 2OBLA 3B7GA 5EZ5A 4A4DA 2QGNA 1TF2A 5FBLB 3A4LA 3ADBA 3K09A 4RFSB 4JL6A 2YHSA 4OHVA 1HUQA 1IBRA 2A5DA 3SR0A 3TVTA 1LNZA 4DLWA 2FGKA 3SQWA 2GEDA 4FXPA 2LCFA 4QGFA 3WYFA 2KE5A 2AL7A 3CH5A 1YQTA 1LF5A 1BH2A 2D4HA 3DM9B 1M7HA 2XB4A 2O0JA 4RVCA 4ZCIA 3NBYC 4RD6A 1CRQA 3U2QA 3NBXX 2J0QA 2ZJ2A 1CTQA 4FWTA 4DZZA 3AUYA 5CM8B 1QG4A 1N5JA 1P9NA 2HLDD 2XJ4A 1YR9A 3GPLA 4LBWA 4V02A 2F9LA 5FPTA 2HLDA 2ZRHA 1E2FA 2ZSDA 2HV8A 5JSZB 1FNNA 1E0JA 1G4UR 3HU1A 3X2SA 3TGPA 3RWOA 2ZR9A 2ZRLA 5KSYA 2ATXA 5FFMA 1N0VC 1W0KA 2JLXA 1ZD9A 1UEIA 1TX4B 2PBRA 3AEZA 2AK2A 3A36A 3ZZUA 4ZIRB 3MG9A 1G3QA 2CK3A 3U4QA 2WZQA 4BWYA 4MH0R 2ZREA 3RVBA 2ERYA 2IXGA 4LJ8A 1DAFA 4DIDA 3ZLJA 1H65A 5HZHA 521PA 5LD2B 4TL9A 2C9CA 4JVMA 1AK2A 3J81k 1CLUA 1SGWA 1K8RA 1SXJA 4PQFA 4KVAA 1NSFA 1P75A 2JJ1D 3MGCA 4MKFA 3QVUA 2QG6A 2IYVA 4DSTA 4DLVA 1ZUHA 3U5ZB 4ARZB 3SQXA 4HAYA 3SHFA 2NO1A 3U44A 1JPJA 1MO5A 4OI2A 1IONA 1W0JD 3QXJA 1XEXA 1P62B 3LBHA 1Y63A 2VTKA 2Q9CA 5FBQB 1BOFA 1W0JA 2NPFA 4ZI2A 4Q4JA 3PUWA 2F7SA 4GZLA 4OKSA 1P9WA 1G7SA 1OYYA 1W4CA 2FSHA 2Z4SA 3UMSA 3T1QA 2J3EA 1Q1EA 3BXZA 2IS2A 3R7WB 1G20E 2ODWA 3KUDA 4LPKA 2FFAA 3ZYCA 4NHOA 4OK5A 4WA7A 3DMNA 4EPVA 1ZCAA 3IUYA 3CPHA 1W44A 721PA 1J99A 2NTYC 4TSFD 3K0SA 2O8FA 2N46A 2F55A 2CEAA 4YXWA 3Q7QA 3Q3JB 3PXGA 2QA5A 2OLKA 1T4GA 3QF4A 1G17A 1JR3E 1JEDA 2VEDA 3SFZA 1Z3IX 2Z83A 4A6PA 2DCUA 2EFGA 5SZIA 1OFUX 4G3XA 3DDCA 5FBWB 4YMVA 4KFRA 2GJKA 2BC9A 1XZPA 3DZDA 4WXRA 1F2UA 3GFTA 2DFTA 4IRUB 3CH4B 4V0LA 3GFPA 1XB2A 2ZS7A 1F6BA 3ZD6A 3R20A 4QOSA 3WY9A 1Q57A 4B3FX 3Q5DA 2LKDA 3MCAA 4I4LA 1U0JA 4IOMA 3B1XA 2GTPA 1N6OA 1PJRA 4IHQA 1T0HB 5D3MA 1E2GA 3ETLA 5H68A 3W9YA 1YR7A 1IJEA 1NN1A 4CIDA 2O8CA 2IHYA 4Q1EA 3TNFA 2G9NA 1II9A 1FP7A 2VHQA 3SE0A 4R71A 3CRRA 2Q3FA 5TY0A 2ZSFA 3HP1A 1HQYE 3CPEA 3QKUA 1DBSA 4ABYA 2P6UA 2F9MA 4JLOA 1KSGA 4EPWA 1NJGA 5B58C 1T0JB 2H1LA 4B43A 4MGKR 5DYIA 4KSBA 1MV5A 2EYQA 2ZE5A 3NHAA 1FZQA 4Q4HB 4OL0A 5CJPA 4JMPA 1AZSC 3N2EA 3FB4A 3FYHA 4EFMA 1TF5A 1RYFA 4WAUA 1XD2B 2YWHA 3BE4A 1OV4A 1L4YA 2BEJA 1OH6A 4Q1DA 2VQSA 2C8VA 5GJWC 3BERA 4QBHA 4RZ2A 2VHCA 2P0EA 3FHCB 2FU5C 3P20A 3V9PA 2FEOA 2C2HA 2C96A 3LW8A 5KHOC 5AUNB 1NN3A 3KJEA 1OKKD 2NZJA 3RSOA 2OLJA 3DL0A 1KZ7B 4JLBA 4AURA 2P6RA 2J9RA 4XSHA 4XWAA 2L0XA 2VPPA 2SHKA 5JCZA 2ZXUA 1S3GA 1UF9A 3BFKA 2D2EA 4DLXA 5KPDA 1EESA 4OHWA 4URXR 1J8YF 3L43A 4EJSC 4PSKA 2MSCB 3CB4A 3N5CA 1DS6A 3BB1A 3KXLA 1KSFX 4PO1A 5ELXA 2OILA 1W48A 3B6EA 5AUPB 1Q21A 3MD0A 1SVOA 4OI0A 1JAIA 1KO8A 4DLYA 4A2WA 3K0FB 1N5LA 2J7KA 3CWZA 3PFIA 2UKDA 5KNDA 2WSMA 2ZJ5A 3VX3A 3IILA 3FMIA 2GJAA 1Z0AA 4OQXA 1R0ZA 3ADKA 3TW8B 4B6EA 3X1YA 2QMHA 1LW7A 4Q1BA 3REFA 1EFHA 4C0QC 3ADCA 1AS2A 1RJ9A 4I1OA 2QM7A 4GOXA 3ZS9A 1R8QA 4OHXA 2IYYA 4DCNA 1S4QA 5E7MA 1ZD1A 1ZNZA 3QVVA 4PSVA 1XTJA 2YV5A 1KSJA 3QI2A 4YLGA 1FTSA 3S1AA 2VYFA 3ZZ0A 3K9LA 1KO5A 2HYDA 3RYTC 3UK6A 5FI0B 2ODEA 3CNLA 3WHLA 1P60A 3L0IB 4ZO4A 5FOWA 1EK0A 1W47A 1P61B 4NU0A 3QG5A 3T5DA 3W6PA 2W0SA 4P33A 3UWOA 3X1WA 1GG2A 2E87A 1UKVY 3CX7A 4BQSA 5J4LA 1F5NA 4JLMA 2ZVQX 1ZUIA 1CRPA 2GAOA 2PLFA 4QBFA 4AKGA 3DVLA 4Q9JA 1SZPA 2DBYA 4HB2A 5JWHA 3NC0C 2BHRA 4UJ3A 4BFTA 1NF3A 4OHYA 1Z83A 2IXFA 3MFYA 2Q3HA 4OQFA 4F4CA 4OQMA 4ILEA 4IEIA 1HURA 1XJCA 4GPTA 1QRAA 3K70C 1ZIOA 4B3CA 3E1SA 5EE3A 1LTQA 1ONBA 1CULC 2ZAOA 5DHFA 1Q22A 5FL7A 5G3ZA 4B35A 4DXAA 1YJ5A 1ZVQA 3KZ1E 3PCRB 1R8SA 2HJVA 3IQXA 1KI7A 5EUMA 1PUIA 5DH9A 4MRVA 3OESA 4C9BA 3RC3A 1JQLB 4RFVA 2V6JA 3W3AA 2RGCA 2IYRA 3EPLA 1DAMA 1GL7A 3VR1A 3GLIE 2PMKA 5LBIA 4GP7A 4HUQB 2YWFA 4WOPA 2OEPA 4MKHA 4PC1A 2R8RA 4Q48A 3CIOA 2EFDB 4FIDA 2VHTA 1GSIA 1KMHA 2ZRNA 3FKSD 4A2QA 1G7CA 2C95A 2O8EA 4B32A 2AXPA 2XSZD 3AKYA 3IDQA 3ZZTA 1F3OA 1KY3A 3FKSA 1CU1A 1YZTA 1ZM7A 2OBNA 5CM9C 1HH4A 1KAOA 3LY5A 2XSZA 4V0NA 3RSLA 2QAJA 3AGPA 4QM7A 4A8JA 5F9FA 3C15C 3LBNA 1SULA 4GOKA 5GJBA 3GJ6A 3N2IA 3CNOA 2FN4A 3QIAA 4EPRA 1MABA 5AUOB 1SVKA 3OEHA 1VYVA 4CF7A 4F92B 1NLZA 1S96A 2O52A 3ZDQA 1R10A 3CKLA 3CONA 2NZ8A 4MYUA 3DM5A 4XIGS 5B2ZA 3KQHA 4LPSA 3C41J 4X8HA 1FMJA 1KHTA 1G3IA 3NHBA 4DT1B 2OFXA 3LDAA 4BLQA 2Z5FA 4KYIB 4TLAA 4LOAA 4EPTA 5EXXA 5L3QA 1KDRA 3WBKA 4CEHB 3SJCA 2B92A 3B85A 1H8EA 2CJWB 3C7KA 5BN5A 1ESNA 1OXSC 1R5BA 2RGEA 2WKPA 3LXRA 3GD7A 2WAYA 4PSAA 4UKDA 5E7JA 3BB4A 3KDSE 4BEJA 1MRNA 4HLQB 2ZS9A 3MWKA 3QKSA 4XD7D 1OH8A 4EJSA 2YVUA 2ATVA 4XD7A 2B7BA 3TW4A 1W36B 4AG5A 3EWSA 2GA8A 3CWQA 4Q1CA 1QHGA 4Q7KA 4DSOA 1A82A 3EG5A 2RHMA 1R4AA 3UG6A 1R0YA 3FVQA 3EARA 3KQLA 1E0AA 4E22A 1R0XA 5D3QA 1P5ZB 2B6HA 2AHOA 2D06A 4MRRA 2P5TB 1G5RA 4N0EA 3TH5A 2ZI7A 4KU4A 1DARA 1D6JA 3GFOA 3QSYA 1I2MA 4P4UA 2J59A 5JHHB 1VHLA 2CL6X 3OIUA 1FPMA 1HY3A 4UJ5A 3VKWA 1U0HC 3TR5A 4PPNA 3I62A 5E3HA 3RS7A 3L8ZA 4JLAA 1OH7A 1JB1A 5A0FA 3WMFA 1E9EA 4AC9A 3VTKA 5TB5A 2GCNA 4M2LA 4OYHA 5JFGA 1CJUC 1SKYE 4Z51A 1RRCA 2GESA 4LC0A 1GUAA 4LV8B 2OHFA 2QT1A 4I99A 1JR6A 2XAUA 3NDPA 1G7TA 3CNNA 3PEVA 5C1BA 4ZDJA 1C4OA 1IHUA 4FMDB 4D26A 3FDIA 1YZLA 1GWNA 2GJ8A 1AJEA 1JXMA 821PA 3U3JA 1TADA 1VKJA 2WICA 2Z43A 1G8PA 4JJZA 3EZFA 2A5YB 3NBZC 1XTKA 4I81A 4US2R 1WA5A 5H1YA 2CCGA 4MDFA 5DI9A 1NMZA 4O0MA 4LBYA 1JR3D 1HEIA 1N6RA 4I1SA 1DAKA 4ON9A 2HCBA 1JR3A 2QE7D 1E2EA 4NPHA 1KJYA 5ANRB 4HLUC 2BBWA 4AD8A 4DLZA 1NIJA 1SHKA 2C78A 2QE7A 2Q9AA 2WJIA 2A7QA 3M6AA 3CO5A 5FUXA 4DC9A 1XXHB 3AF4A 5L3SA 2J7PA 4BEBA 2QL6A 3WYGA 1D5CA 2DYKA 4R2IA 4N3NA 4LV5B 2ZSBA 2WV9A 3HYTA 3WP0A 1Z6YA 2JIZD 4GMXA 2F1JA 3RRNA 2HDNB 2P3SA 1T6NA 1TEVA 2JIZA 4TMKA 4TMZA 1NBME 1KDPA 2WIAA 4D4LA 1ZUNB 4HUTA 2GZAA 4TZ0A 2ZE8A 3PQCA 3FFBA 2PLRA 3NWJA 5DYGA 4Q7JB 1NG1A 4FMCB 4MYTA 4JLNA 2ZI6A 3Q8XB 4IVRA 4PQYA 3CM0A 1RKBA 4XVRA 2P65A 1ZM3A 3LO5A 4PO8A 1J7KA 3BH7A 5CYPA 3WXMA 4A0FA 4C2UA 2D2FA 1NN5A 4B73A 4TLBA 1MRSA 3KTAA 4PZZA 4G0NA 4RSGA 2JGNA 3P4XA 2W2VA 4P4SB 2R62A 1CF4A 1Z0FA 5FTMA 4DCSA 2A78A 4FWIB 5JJIA 2VBCA 1IY0A 2ZJYA 1K5DA 4JVSB 1DG1G 1E2HA 5FR1A 1WCV1 2BWJA 2QP4A 2W6JD 4AKHA 3MWJA 4K81B 1XRJA 4JL8A 621PA 2W6JA 3WNDA 3I73A 4UXHA 3ZIAD 4BZXA 2GVZC 2CMKA 4BZPA 2XTNA 4HDQB 4CEJB 1FUKA 2WJGA 3QG1A 4B2PA 3OHMA 3LVQE 5JJLA 4KO8A 1XEFA 3D3QA 5K8LA 2WKRA 2O8DB 1L4UA 4JLVA 1BMFA 1KK2A 3PV0A 1KK0A 3I72A 4PC3A 4BFWA 3OIYA 4AKIA 4ITRC 4R2HA 2A5FA 1P73A 2H16A 2QI9C 3LQRA 4AKEA 2W6ID 2YKGA 3B1WA 3W5IA 1N6LA 2OCBA 1SVLA 2DY1A 2JJ2A 2AWOA 1N6IA 2F3RA 1MR3F 2GF9A 4BLRA 4MRPA 3CR8A 1Z0JA 3W5JA 2IUTA 3HJNA 4NCJA 2HYIC 1O87A 2J1LA 3GQBA 1DO0A 4IDNA 1NIPA 2XXAA 3TAHA 1W49A 5C4MA 4DIEA 1FQKA 3UWKA 4NZYA 3M0EA 3U61B 5DISB 4QHTA 1QZXA 3LBIA 4NCNA 2AD1A 1PUJA 3KFXA 3UATA 3FTQA 2FH5B 4LRWA 3V4RA 4I1VA 5HZKA 4PHGA 3P1JA 4CRWB 3AF3A 5DI3B 3THXA 2QBYB 1OXVA 4M1WA 1KGDA 4OK6A 3VKHA 1Q3TA 4CT4B 3NIBA 5BYJA 4BFXA 1DPFA 5F3WB 1RIFA 2FX3A 1PLLA 4JYCA 1T5IA 1RW4A 3SYLA 5FI1B 4A1FA 2O8BB 1U98A 4WZ6A 5JEEA 3VR3A 1C9KA 3CF2A 3RNLA 1D2MA 5C18A 3IIKA 3CPJB 4DBLC 1AZTA 1JAHA 1IY2A 4Q4AA 3ZS8A 3QEJA 3H1TA 2ONJA 2WJVA 4HDOB 1D2EA 4MQBA 4LX0A 5A4JA 1ZJ6A 4XVUA 4A92A 2EWWA 1FX0B 4IJMA 4UNRA 1XMIA 2QAGA 3CRVA 3KFVA 1QHYA 1E4VA 2H8KA 1U90A 1NN0A 1VYUA 5C46F 5GVRA 4JSTA 1GIAA 1L8QA 2J46A 1Z06A 3FGNA 4Z1MA 4A0HA 2ZRFA 5LD2C 1NSTA 4GMDA 1E9CA 5FPHA 1X8JA 2MMGA 1W4RA 4KAXA 3IHWA 2ODNA 1Z63A 2VP5A 2N1BA 4B71A 4FCVA 2WWIA 3T12A 4TMWA 4LHXA 3L0SA 1XP8A 4OI1A 4F91B 3THWA 5DN6D 1COWA 1GILA 2RGBA 2X19A 4D0GA 2IXEA 4Q03A 5JRJA 2B8WA 2BIFA 5DN6A 3QY0A 1TU3A 5H70A 1F2TB 1SQ5A 2F3TA 3QJYA 3Q72A 4A36A 4QBIA 3THYA 1CKEA 2ZETA 1OFIA 1SKQA 4AWXA 4YMUA 4LYFA 1DOAA 4IOJA 1KNXA 1V43A 3TQFA 2I4IA 1FW6A 1OXXK 2UVQA 3GLFE 1EFRA 4OQNA 2RHDA 4KODA 4DUGD 2BBSA 2IYZA 4RJLA 1RPZA 2X2FA 3JZAA 4DUGA 3KQUA 5AJVB 3ZD7A 3FHOA 4POAA 2HCJB 5FUWA 2FPKA 1Q1QA 1X1RA 1OT3A 5EE5B 2FV8A 1AM4D 2NO0A 2Q6TA 4HAUA 5G41A 1NI3A 1TAGA 3BH0A 3BB3A 2ZAMA 4HAZA 4URYR 3LH5A 3B2EA 1Z0KA 2ZRCA 1XCGB 4P32A 2CLDX 4XTRA 4ZDWA 5CB6A 1KI6A 3PJRA 3OZXA 2AKYA 5FTNA 3NEYA 3QKRB 421PA 1S9DA 2EU8A 4XWKA 1M2OB 2KI5A 5J40A 3NH6A 4L9SA 2IS4A 1B23P 4LJ7A 3TSOA 1XF9A 3KB1A 4BFVA 1W4BA 3Q7PA 5K8UA 3TQCA 4A0RA 1CJKC 2QMUA 2YWEA 4J0QA 1PV4A 1KO7A 4JLDA 1XD9A 3GEIA 1IXRC 4AYXA 4G5GA 4LI0A 2NO9A 1CP2A 1W0KD 3EXAA 1RE0A 4JSYA 2CLCX 4OBEA 3IGFA 1BO6A 2NGRA 1J8MF 4Q00A 2VH5R 5EXPA 1US8A 2IC5A 2CK3D 3T1TA 1U9IC 3QXCA 3O8RA 1CJTC 2ZRPA 3W3ZB 2G3YA 2YWGA 4DKXA 2YOHA 2QT0A 3AP3A 2R44A 3UXMA 3ZQ6A 3U44B 1SXJD 2IYSA 4JBYA 4FCTA 1NMXA 3CX8A 4WBSA 4X8OA 1JEEA 4NKRA 4PPGA 2WWGA 2XITA 3I3SR 2WBLC 3B9PA 3CBQA 2GCOB 3SS8A 4Q4JB 3GJ8A 4JIMA 1KNQA 3TR0A 4F93B 5JCPA 2D7DA 1UJ2A 4TMVA 1EWRA 1OHHD 2DB3A 5JECA 1XX6A 3DOFA 1IXSB 2F1IA 2GEVA 5GJVC 1OHHA 4IDOA 4C0LA 2WTUA 3VR4A 3K0AA 2JLUA 1S9HA 4HAWA 1CR4A 4ZIRA 1X6VA 1KJZA 2O8FB 3SFVA 2XX3A 3KX2A 3VU9A 3KJIA 4O2RA 4AY2A 3PUZA 1R6BX 1VDZA 4M1TA 3BFVA 1M1YE 2GKSA 1OFHA 2WKQA 1SVIA 2GETA 4NP6A 4LJ4A 2ZE7A 4YXWD 2X8AA 3I8XA 1Z2AA 1GKYA 1M7GA 2FFHA 2G83A 4RY2A 2A3RA 1KI4A 3UANA 3CRMA 4DEXA 1NY6A 4BRUA 4B2LA 2I3BA 4DDTA 5HR5A 1E2KA 1E96A 2ZVPX 1YZGA 1DELA 3B1VA 4TTPA 2IHBA 2XGJA 2PCJA 1WB9A 1OPXA 5J4KA 2VLIA 1E2QA 3MJHA 1G18A 4G5OA 3K0CA 2IYQA 4F4JA 1OF1A 1GP2A 1U2RA 1J2JA 2CE7A 4S35A 1VG0B 2FNAA 1F60A 1E69A 2Q9BA 1NBMA 3A4NA 3PR1A 4HATA 4NYMR 5D3MB 3GLGB 1KJWA 4Q21A 5L3VA 2WWYA 2O8CB 1VYTA 3L0PA 3W8RA 2ANCA 3GP8A 4JT4A 2FA9A 2G88A 3VQTA 4N1AA 1NY5A 2JAQA 4TTRA 2D3WA 1E9BA 2G77B 3DKVA 2ZTSA 3I8SA 4ESHA 4Z8XA 1VHTA 1X1SA 2REBA 3BD9A 3I61A 1EFUA 1II0A 2ZJ8A 1PVOA 5HE9A 1D2NA 2GJSA 3Q5EA 1GNQA 1T3LA 4M9ZA 3BK7A 1JQJC 3QPVA 4LWZA 5TDHA 2VRWA 3OF5A 4UNSA 2WOJA 2BMDA 3AUXA 1Z07A 3SOPA 2B21A 2R6DA 5L8VA 2FOLA 5FPKA 2GEUA 3U6KA 1K5GA 4ZKEA 2P2LA 2IEYA 3WNBA 2BV3A 1U81A 5EP1A 2ZANA 5FTKA 3HPRA 1FTNA 3M4YA 3T1VA 1TF7A 1E9FA 3BFXA 2ZEJA 3AVQA 3O47A 1Z6XA 2ERXA 4YONB 1IN5A 3VHXA 2FPMA 3GEHA 1FMLA 3AM1A 4KCGA 4KFSA 3PENA 3B5JA 1NNEA 3KKPA 3MAAC 4PO9A 1E9DA 4Q19A 4LDJA 2JDIA 2VF8A 2IX3A 1HYQA 3R8CA 4P4TA 1GVNB 1ZBDA 3FHTA 4MYHA 3KKQA 1U9IA 2R9VA 5LB4A 1XMSA 1Z5ZA 4BASA 4Q4HA 3LLUA 4G1UC 5KSZA 4IW3B 1Z08A 4D81A 2I1VB 1XD2A 2TMKA 1ZC3A 2OCPA 4QNRA 3OAAA 1Q1BA 2IYUA 4OK3A 4ZI3A 4TL6A 2GXQA 3KXKA 4KBGA 2IUUA 1HQCA 2NIPA 2ZSEA 2Y8EA 4U7DA 5BXQC 3C14C 1OE0A 1AKYA 1W5TA 2ZI5A 2ZI4A 2IYXA 2VSFA 4PC7A 3AF2A 1XTRA 4L16A 5KSPA 2GNOA 3LNCA 1S0UA 3NVAA 5J5CA 4EDHA 5F9HA 1ZNYA 4TN1A 4B48A 3CW2A 3QUSA 2CL7X 2FE4A 2PX0A 1XCMA 1XU4A 2ZJAA 1VCNA 2OAQ1 3SNHA 4TMXA 4QFMA 4HLCA 4O2LA 1W36C 1FFHA 1T5LA 3P26A 2O5VA 4LJ9A 2ZSAA 1A4RA 1RRPA 3TLXA 1JPNA 5BQ5A 3GMTA 4B3XA 2CHQA 3IBYA 1XDBA 5CYOA 4D82A 1UKYA 2O0KA 2RH5A 4JBXA 1Z22A 3IKJA 2BJVA 2Q3MA 4OJKA 1MH1A 2FF7A 4ZPXA 4QM6A 4LBVA 3DZ8A 1XCPA 4MKGA 3BGWA 5FL7D 4B44A 4GDFA 5EP2A 2F43B 4FN5A 5FUVA 4HZUA 3F5FA 4KJZA 2VP6A 4XSGA 2XJ9A 4YMSA 3ND8A 3SHWA 1N2CE 2WWWA 3P32A 3O8CA 5G53C 4A0GA 3WBJA 1D8TA 3PVSA 1KMHB 4GI7A 4GFDA 2ZRKA 3CUEF 4KFTA 4CYMA 2RGGA 2V4ZA 1E2DA 4QJ5A 3KKMA 4OJQA 2WM9B 2ASEA 3RRYA 1GFIA 4JKIA 4D4JA 2GDJA 4KFUA 5HKKD 2AR7A 1PLKA 2BMJA 4A8JB 3I1FA 1NG9A 4CW7A 1CEEA 3ASYA 3ZVRA 1RVDA 1CS4C 1T91A 5FH9A 1IN8A 1MABB 3BWDD 3M1IA 1KYIA 4B6FA 5HKKA 3OE7D 4HLDA 4M53A 1FOEB 3GLFA 1UBGA 4FMDF 3EPHA 3OE7A 4FMBB 3JVVA 2D74A 3OEHD 3NXSA 2DFKB 4B75A 3ASZA 4IFBA 3ICEA 1GRQA 1E0SA 3K1JA 4M0LA 3LQQA 1GL6A 1GM5A 4A2PA 4Q9LA 2BDTA 4GZMA 4NCIA 4YC7A 5EUQB 1TU4A 2OO7A 2PZFA 5DHAA 2ZI9A 4IKEA 4Q9IA 3B60A 2REOA 3K9HA 4EQ6A 4Z54A 3A1UA 3T34A 1N6HA 3EWAA 3RC8A 2ANBA 4ZKDA 4Z8YA 1N25A 3CRW1 4JLKA 3GJ7A 5SZKB 1EFTA 1BIFA 3BIFA 3VMFA 1E6CA 4RCZA 3EZ2A 1KAGA 1T8TA 2EVWX 1H8ED 1FP6A 1UBFA 2ZITA 4BGDA 3SDZA 2A9KA 2JASA 2OCAA 1IAQA 4QBGB 1S8FA 1YR6A 1NJFA 2QMOA 5FL3A 1UBEA 2IA5A 1AQUA 221PA 1QVAA 3AQ4A 4QL3A 4LJYA 1G291 1E3MA 1IXZA 1MKYA 4Q66C 4LCBA 4Y0AA 2WOOA 1OIVA 5FOXA 2IYWA 4M4SA 5IDVA 4LYHA 3G5UA 4TQAA 1M8PA 4FMCF 4KBFA 5FBRB 3OFNA 1WE2A 3VFDA 4C0SA 4E07A 1IN6A 3FPAA 1T8UA 1DAEA 3L8YA 1GL9B 2PMDA 5CK4A 2YYZA 2ZR7A 5P21A 4PFSA 3RRMA 5GVSA 1OXTA 3WRYC 4TZ6A 5CIQA 5J4YA 3EPJA 4EIWA 2C99A 3NTUA 4TLCA 4H9GA 5JMTA 1IN7A 4PC6A 1JJ7A 3L0OA 1PZNA 5JLJA 1L7VC 2C9OA 2CJWA 3L2OB 2J41A 4XJXA 5HCNA 4TT3A 5KDLA 4HEJA 5EE0A 2UZ3A 2BCGY 1JXOA 3GJ3A 3N70A 3CRQA 4JZKA 1TUIA 4B34A 5BWMA 2KWIA 2ZE6A 3EASA 4QJ3A 4CEIA 2AD5A 3VKGA 2ECKA 3FWYA 3RABA 4IXNA 4DDUA 5HTKA 1XJQA 4PANA 4AI6A 5FTLA 5EQTA 1EFCA 2F1RA 2V6IA 5FPSA 2Q21A 2WMNB 4PAOA 1YKSA 4KYUA 5CK5A 5DNYB 3TJZA 1M74A 3K70D 3H86A 4H1UA 4HAVA 4IEEA 1E94E 3F8TA 1G8GA 2ZI3A 1SVSA 1YRBA 3UKDA 4Q02A 4QGAA 5FPYA 3MLEA 1OIWA 1WMSA 3G82C 2QY9A 1RZ3A 4BPBA 1AQYA 3WHKA 1MOZA 2GXSA 4CGZA 3KQNA 4HB0A 1K6MA 1U99A 5A5GA 5KTYA 5L3SB 4C4PA 3HDTA 1G21E 1P2VA 3LRPA 2OCYC 2X77A 2YOFA 3GLHB 4PR0A 1YU9A 3MMPA 4V0KA 3RANA 4PX9A 3EC1A 5EJEA 2J7PD 5AJWA 5DGXA 4Q18A 4BECA 2XNDA 2CHGA 4DEYA 2FFQA 3KJHA 3R8FA 4GSYA 2FDCA 1OLOA 1E2PA 3LW7A 3MUFA 3QBVA 3R9XA 5BYKA 1H8HA 3FMOB 3I4LA 3TSWA 1NRJB 4CDGA 2DFLA 1W2GA 1G64A 2QSZA 4ZV4A 4LHVA 1AS0A 2J0VA 1IM2A 3F3YA 4TLDA 2J0SA 2XB2A 2QTHA 2CHVA 3BORA 4MUBA 3EW9A 5TMPA 1NLFA 1OXUA 1ZYUA 2OFOA 2O0HA 2VHUA 3U60B 1KO4A 4TLEA 4U00A 1LV7A 2FPLA 3AP2A 2IWRA 1KKMA 1ESMA 1RFLA 4QGHA 1DG3A 3SJAA 1II8A 4GBMA 4EKDA 3DO6A 1EXMA 4ASUA 4C0BA 4HB3A 1E9AA 2J0UA 5DLQC 3IQWA 3IPYA 3LFUA 2XZOA 3C8UA 3TMKA 3QPWA 4YDSA 2ORWA 2G1JA 4M9SA 4URVR 1LB1B 5EZ6B 3WNCA 3NH9A 5EP4A 4W7SA 2GF0A 3LLMA 3A58B 4C7OA 3BS4A 4IOLA 2OE2A 3GLGE 3E5HA 2KBFA 1GKUB 2HF8A 2QPAA 5KYKA 2AXNA 3T35A 2QQEA 5J47A 3C5HA 3IPXA 3T5GA 3TK1A 4WIAA 4C0HA 1W7AA 5IK2A 1QHHA 1BMFD 2BVNA 4U5XA 1VCMA 4YMWA 1JNYA 4M22A 4P31A 3ZH9B 3ZVNA 1XMVA 4BLOA 2BMFA 5CDFE 5JI3E 1GRNA 2ZJZA 3KB2A 1Z0IA 1KI3A 1R0WA 4TMTA 4DLRA 4US1R 3EX7C 2JJ2D 1XPUA 2AX4A 3CF0A 5JEDA 2YZ2A 3K09C 4ACBA 4NYMQ 1Z6AA 2WJHA 4PAQA 3QBTA 2NMVA 4DLUA 2FG5A 2IF2A 2QN6A 2NO7A 1P72A 4S2EA 4JL5A 3D7MA 5AR1A 3THXB 1CBUA 1IY1A 2KBEA 2P6NA 4RD2A 4PQRA 4LJAA 1DO2A 3EAQA 1ZD8A 5KOYA 1UDXA 4OQLA 4IVQA 1OSNA 4LBZA 3T1OA 4EUNA 4Q4LA 2W58A 4V0ME 3WP1B 5HPYB 1DADA 3W34A 2ZJOA 3LWNA 2O8DA 2J45A 1C1YA 4C0JA 1VCOA 3SZRA 2G0NA 2GXAA 3AVVA 3TUIC 4R9UC 4RCYA 3FMFA 1X86B 2PT5A 2J87A 5BN3A 4TL8A 4URWR 1NKTA 4Q4AB 2V55B 3QQ5A 5IRCD 2QORA 3C4JA 5DO9A 5C4GB 3U7EB 1W1WA 5EXTA 2OM2A 3SYNA 4JT2A 2D62A 4LK2A 4M1KA 1Q3HA 1HT2E 1TL7C 3NG1A 4TQ9A 2QAGB 1DAGA 3EIEA 5HCIA 4F4IA 3BC1A 1ZW6A 5EP3A 2YNMA 4B2IA 3SU8A 4LC1A 3BH6A 4LZZA 4PC2A 3SJBA 3QXXA 5F98A 1A2KC 1ZRHA 4B74A 2C77A 2MSEB 4EFLA 1WP9A 1RYHA 1G41A 4RD3A 2QBYA 4Z1MD 4HLUA 2V7QD 2FFBA 3GLIB 2F6RA 3QEOA 1W2HA 1VTKA 2GZDA 3H4MA 5FBVB 3THWB 2DR3A 2V7QA 4IXMA 3SJZA 1M34E 1ZU5A 1A2BA 1F48A 4EAQA 2JLRA 5CITA 3SYKA 4NCKA 4I1UA 1V5WA 1COWD 2WSSA 4QKQA 4B47A 3THYB 1XTSA 1O3YA 2G6BA 1BYUA 3D31A 1ZP6A 4BZQA 2IYLD 2OT3B 5GADl 3ECCA 1XEWY 2EYUA 3AV0B 2D7CA 4K46A 1ZM2A 2BJWA 3AKEA 4NH0A 4CZ2A 1RRGA 3QXHA 4ZDIA
chains in the Genus database with same CATH superfamily
5H7XA 4BIMA 2O20A 2PTGA 4BVGA 3QENA 4N5HX 4Q9HA 2ZIZA 3ON5A 3PQDA 4PX2A 1DTEA 2YIMA 3AL0C 3TG8A 2CVHA 1BXZA 3MSXA 4KAJA 4C2TA 1XPOA 4ED9A 4ETWA 2UXCB 4TROA 3HVJA 2KB0A 4URUR 5LC1A 4NCHA 4BNHA 3DMRA 3HZOA 3R0JA 5I9NA 4RL6A 2ZRMA 5F7ZA 4QLOA 1OYWA 2QRMA 3N7UA 5IAAA 5JROA 1N0HA 4NJMB 1GNRA 1L9KA 3FLBA 5A2GA 4GOJA 5I7OA 3TEFA 1I7SB 2PKQP 1U7TA 1GAXA 4F8JA 1I4TD 4ENTA 1HTTA 5B7PA 5IX8A 5D6OA 1B76A 2GPSA 2ZXFA 1YDEA 2HEIA 2QM0A 3PR3A 3PT9A 3FETA 4PCLA 4WEQA 5EIOA 4ITUA 4LIPD 3WJ7A 1Q15A 1QP8A 2P3LA 3S8MA 3EVDA 3PHGA 4RHUA 4DV3B 4BTVA 5A7HA 4UTPA 1TB4A 3AVWA 1RQPA 2WP0A 5DHQA 2YJGA 4EGFA 3CLVA 1XNHA 5A5FA 2IZ0A 3M70A 4RSHA 1WU7A 4C3OB 4EHFA 2MSNA 1MNAA 3QNMA 3BWEA 2BFEA 5E2BA 2O3UA 1PJQA 3LECA 3WICA 5JARA 4OQYA 4DB2A 4B1FA 4ZCLA 2QSYA 4F60A 1N1EA 5DIZA 1GUDA 4CFYA 1N2EA 4OGFA 1BW9B 5D6NA 4BZWA 2OZEA 5LNK6 1VB5A 4ZJPA 1L4FA 1U3DA 1ZCBA 3DBVO 4X1YB 5AHOA 2YV3A 2HJ9A 1CUIA 3DWIA 2EFYA 1WSDA 1BMTA 3WRXC 1X39A 3B1JA 1CDOA 2HQ1A 2XQKA 1AGXA 3VUEA 3CLRC 3FWKA 3V2GA 3U4QB 1BS1A 4FKMA 4DLTA 2AB0A 4QU5A 4PONA 2XOKD 4RXTA 5TXGA 1U0EA 1RJGA 1V4VA 4KUHA 4M9XA 3V97A 5IS2A 1KU6A 4H4EA 1S7GA 4L8VA 4DSUA 3J81A 3MS7A 3A1EA 5JTUA 1ZGCA 3V48A 3I5YA 2CCKA 1O6GA 2JLYA 3LG2A 4XQCA 1A5ZA 1NVFA 1IUPA 1R5JA 2JJ8A 1T1GA 4R8KA 1ZLYA 4DSZA 3ZWOA 5NLLA 4IGIA 3N2ZB 3IHLA 4EA8A 4LXHA 2HLPA 4WVFA 2BTQA 3NI2A 2AX3A 4YHBA 2A86A 4EP1A 3G89A 1RCFA 1CZOA 3AUSA 3LCRA 3IEVA 2H2DA 2W0MA 4RD4A 4XVQA 1TJNA 2X4GA 4ZQGA 1E2IA 4P4LA 1V48A 1ZESA 5L45A 1DC7A 3K0AB 2V74B 3VSBA 5EE9A 4ZO6A 2NUPA 4CL8A 5TPWB 2A0WA 1ZJ4A 4XRRA 2Q3BA 4FCWA 1RWQA 2RGAA 4K9RA 2YZKA 3AEKB 4RZHA 5LYJA 4CLRA 2FSIA 2W98A 1KYXA 2OG2A 3AOEC 2OBXA 1SU4A 3L4KA 3HRKA 1XMQB 2Y67A 1M2JA 1TVEA 2DM6A 1NVVQ 3BMQA 3C5CA 3CEJA 4XSVA 4NJEA 4EYGA 1ZR2A 4FOPA 5G2OA 1EFPB 2ZUCA 3D0OA 3LX5A 2HF9A 4QYIB 1L7RA 5JDIA 3IOEA 1JDSA 1G63A 4IFTA 1RRFA 1Q12A 3PITA 5KO2A 1AKQA 4M0DA 4PPYA 2VHEA 4K9QA 3AVOA 3TL3A 1BX1A 4DILA 5EVCA 3BWMA 3QF4B 3HVRA 1Z17A 5DK6A 4RS4A 4HGRA 3QHAA 2Y71A 1MG5A 1G5TA 2WFAA 4FNAA 2WAMA 3HY4A 3OJ0A 1G21A 4PX5A 1XJ0A 5F52A 1FFXB 3NOXA 1MO4A 4UUAA 4XEUA 4RGQA 1K9VF 2HA6A 2VPTA 4W9MC 1F2UB 1CR2A 2BDUA 4R8LA 1R2QA 5DIFA 1TMOA 4DWOA 2BM1A 2LWIA 5ED0A 1QIMA 2QX8A 5A1TA 2ZYWX 2FRXA 2A5JA 4RA6A 1EWQA 4EWLA 3PTLA 1ENYA 4R1NA 4MS1B 1NBMD 1HFEL 1MQ9A 4ZDKA 3EA5A 1DBPA 1T36A 3IHTA 1M1NA 3O4RA 3OTIA 1YBVA 1QPGA 2ZRBA 4BNYA 1HYBA 3F0TA 4PLFA 4E21A 1P0PA 3GJQA 4E3WA 2AOXA 5CEFA 3HFJA 2JH3A 4QYTA 3WOVA 4I66A 2CXUA 3HJBA 1NVWQ 3A37A 3PWZA 2W2MA 4PINA 2H2HA 5JNSA 4Q4DA 1R5OA 4M87A 3UJ8A 2W4IA 4IILA 3GJ0A 4E2ZA 1IJKA 1PJLA 2PZMA 2C07A 2RKOA 4YCAA 3WK7A 3L0YA 3ZX4A 4AMZA 4Y2YA 3LV8A 2X6RA 3GMSA 4AYWA 4AY5A 3A9CA 3K3PA 4ZEXA 5GIOE 2WVGA 2ZSKA 4ZANA 3NP9A 3AZPA 3KR1A 5AP9A 4ESVA 1PZMA 1DC4A 4M9CA 2AJLI 4KXVA 4Q1FA 2XF8A 1I5OA 1SPBS 3S70A 3FKQA 4IQ8A 3SLGA 2F59A 1W46A 4XTCS 2DSTA 3QU2A 1Q5PA 4DLSA 3SQMA 1ZIYA 3TZ6A 1I4DD 1I2AA 2EZ8A 1V5FA 1CXZA 2PJZA 2GVDC 4EJ2A 1SQGA 4ENRA 3E9CA 1ZGGA 2OD7A 4IH9A 2V7UA 4NNOA 1DRVA 1MO2A 1NZFA 1RRKA 2K2QB 3IMFA 5FOVA 3VOTA 1G9TA 3RHFA 5EIXA 4JBLA 1SKMA 4M83A 2QTBA 2W48A 4GR5A 5DT2A 3STYA 4E5UA 2FPWA 3UMFA 1QHFA 3FTEA 2XNKA 3NBAA 3BKWA 4A15A 4HGNA 3TR6A 2R7AA 1AKTA 3VC2A 2DG2A 2W2KA 2RJNA 3KYCA 1L5OA 5CDGA 5K3EA 3RHSA 4ZYZA 4WWHA 4YAIA 1U5BB 3FWZA 1B2LA 4MR7B 2VSNA 4TQUS 4G85A 3A1FA 3KM0A 1WG8A 4YACA 1YJAA 1Q74A 3HB7A 4RJIA 2FQXA 1U7XA 3CR7A 5EZQA 2DUNA 4P5EA 2C3PA 2CZQA 2GM5A 2BHNA 4LI3X 4UULA 2V0CA 3DHWC 3EIFA 1HZJA 3A6PC 1THZA 3EEYA 4OU5A 2PNFA 2P9CA 3A28A 4O08A 4PG7A 4BGVA 5LUAA 1LSJA 2C1ZA 1V35A 3QI7A 1L7PA 1FRFS 2VAWA 2N42A 4IDPA 4QUKA 3PUYA 2C42A 5K3SA 3OAAD 1QX4A 3GL9A 1VSBA 1XZDA 2J31A 4I2NA 4EJFA 5CT9A 1KH3A 3H8WA 3RS3A 3Q6MA 1Y1KE 2H18A 2BBTA 3LSTA 1M33A 4KX5A 2FEPA 3FVTA 4NVRA 5D85A 3RFFA 4J4TA 5T6BA 4AUMA 5A4KA 4P22A 4B7UA 5KDOA 1USUA 1G1MA 1JTVA 2Z2KA 1I0ZA 3KOYA 4RKRA 1T5SA 4NV1A 5BVGB 3CN7A 4G5QA 3Q0TA 4DAOA 2WHEA 1YVRA 4NEGA 4CG3A 3FRHA 4CNQA 4JVNA 4DA0A 1WV1A 4PG4A 3REGA 1TQ4A 2R7KA 2PDAA 1I13A 4PXAA 5GV8A 4E2FA 3FPFA 4X95A 3KOXA 3T9AA 2ID9A 1RPTA 4ND3A 1NQWA 3GT3A 4R16A 1NVKA 1MO3A 3ETGA 1N5KA 5FR2A 3V34A 3VU0A 1FU4A 3N86A 4HDNB 1W4AA 1JYSA 1RQ2A 2GYYA 4F04A 3TKLA 3UJHA 4D0LB 4YMLA 2NUAB 5LU8A 3K0FA 1JS1X 4NG4A 3RB8A 1B8OA 2VTVA 2ZBDA 3G9TA 2HFJA 1DT5A 4CIXA 2IHZA 3CZQA 3UMCA 1G3RA 2BCJQ 4G86A 2CMFA 1HYEA 1UEJA 2XUDA 2R65A 4K9OA 4MEAA 3Q2IA 4PZCA 3FRJA 4KV9A 1Y7PA 2HB6A 3DKKA 3I0MA 4RBNA 3OFSA 1U8YA 1UFRA 4GX0A 4WTOA 3PXBA 3FHLA 2FJUA 4I1IA 1JDUA 2BMAA 3EZ9A 2ZTLA 3P94A 4Y30A 3UIEA 4EJMA 4KITB 3O2QB 2HHJA 2QRVB 1RR6A 1U2DC 3WB0A 3WWEA 1W1IA 3DE5X 4HPXB 3X2FA 1MC5A 1YC5A 2YS7A 2D2IA 3I37X 5CVJA 2JARA 4IXDA 3D6TB 1Y9JA 3H84A 2BRUA 1ZAKA 2Q6VA 5IG2A 3OCVA 4EPXA 2Z8XA 4TZ6A 1RMYA 5AVXA 3DTVD 4WESB 2O8EB 2DT8A 2H5EA 5AW0A 1V1MA 3TX6A 1YS1X 4NLLA 1CR1A 3D0RA 5AH0A 1N0IA 1X8KA 2O14A 2CVFA 3AMVA 5I8WA 4MS3A 4R9RA 1A88A 3KL4A 5BRAA 3HWSA 4FXOA 1MJFA 3EISA 3PFFA 4KO3S 3BF7A 1QQ7A 4WY8A 3EVEA 2ZUWA 4HTAA 5E4YA 4M8KA 1GGKA 2DBQA 3E3LA 1E2LA 4LXQA 1OA0A 2V6GA 3JZMA 2G40A 5F4BA 1YZUA 4HV4A 3SVZA 2Q5LA 3HR8A 4XOUA 1B16A 3RAEC 2Y1KA 4WZBA 4BX2A 5ALOA 2QTLA 4BMPB 4XFDA 9ABPA 2F43A 1W30A 4BLPA 4C7VA 4UTNA 2ZPUA 4X84A 4ZZIA 1N6PA 1Z5WA 1GNTA 3NS7A 5CB8A 5JQGB 4EQ6B 1UFVA 2Z6VA 4D9CA 1YHYA 2QTGA 4CMIA 2F8SA 1BFUA 2FDXA 2FRVA 3BXGA 3L7IA 2CN1A 1DEAA 4LJ5A 2AI2A 5BSWA 4WN9B 4HXEB 1TE2A 1JIUA 5H5JA 1XGKA 1L6IA 1XO1A 2AK3A 1O94C 4PSDA 4E03A 3A04A 2QP3A 4X64B 4LHWA 3NCHA 1OWPA 4J07A 3FROA 2H9IA 3V32A 1R5NA 2WIGA 3KU1A 1R27A 4ZQHA 3KZVA 1M73E 3LP5A 4JEMA 4RX1A 4XIFA 5GGYA 4BUJA 3HXKA 5ALPA 3V3TA 2J32A 5BNFA 1CY2A 4WKGA 1UAAA 2O0MA 3AESB 1YDMA 2Z0MA 4NBUA 4MUAA 4PW0A 2C9DA 4B4WA 3ZW9A 1CQJB 2WZCA 5LPNA 5HYVA 2A2ZA 2QU8A 1EVLA 1V1JA 3EEBA 2Q2NA 1CP3A 4FJ2A 3GVXA 2GAAA 4BDSA 2R2AA 3K92A 4RTRA 1WHSB 1JXAA 1YZQA 1IBKB 4UBIA 1Y6JA 3TOVA 2VDLB 4OXIA 5EY5B 3QEAZ 4Y9SA 2QQ0A 1KFKB 4PZAA 4BVBA 1PZEA 5LKRA 5K3CA 1I33A 2DJ5A 2F17A 2OHOA 1OBVA 3X1DA 1GITA 2R86A 3T7JA 5JADA 3OECA 3G68A 1A96A 5I01A 4DT1A 2NZYA 1Y1TA 2G9RA 4J16C 4PQGA 2XT0A 2ZU6A 4QC2A 1NI5A 1P1BA 1AIPA 4YAFA 5AVZA 3NEJA 4ZMBA 1I5EA 2DWPA 1LQTA 1LSUA 1ZSVA 2H1WA 3F3MA 3ELYA 3NGMA 4YMIA 5JMPA 3ANMA 1RM4A 3IP7A 4MR9A 3ZGXA 3BWYA 4Z9XA 2B9VA 3UMRA 1PR3A 3DL7A 2R4UA 2VL7A 2V6FA 2WAXA 4DQLA 1T3SA 3R4VA 4P3OA 3UTDA 1IN4A 2FPSA 3B9BA 5EIWA 3FKJA 3TLKA 3VNVA 5JS8A 5K5EA 1X8LA 2PQ2A 3IEPA 3MELA 1QVRA 3A4IA 1KPHA 3GGDA 1S2MA 1G8HA 5KTNA 3H5AA 3LYAA 2C61A 1N5DA 1CIVA 1PI3A 1HLFA 4DM7A 1W85B 3I0ZA 5REQA 3BHNA 4EF5A 2WKWA 1SD5A 4CMBA 3K70B 1GA1A 2WLSA 1T4MA 1A9RA 1Q92A 3FCAA 1OWNA 5JISA 3OE1A 4DV5B 1W76A 3VPHA 2P7IA 4RHCA 3NBUA 2AI3A 3LPDA 5G40A 1QTNA 1XAHA 2VXOA 1PKEA 3KHTA 1XFAA 3E8SA 2YFQA 3PIIA 4KNWA 4LWQA 3UV3A 4DBZA 1WKBA 4G9EA 1RAAA 4KYTA 4UBOA 2BF7A 2FFJA 4UC0A 1P7WA 3L7JA 3DEFA 3BSYA 4EECA 2BI7A 1YR3A 1YZKA 2RDMA 2FGJA 1VCIA 1Z39A 2OZKA 3F2IA 1YK1A 4X93A 3I1IA 3T7KA 1KQPA 3H9JA 3RS2A 2AZMA 2YYSA 4GP6A 4DOMA 1QDEA 3AFOA 4D9MA 4OHZA 4FBLA 4YUXA 2PS9A 4NSNA 4ZVKA 4BX0A 4YX9A 2ZWAA 4WOJA 2ADFA 4D5EA 3VDMA 2IXAA 2VH1A 2G8NA 3ZJ4A 4LDZA 1UM9B 3FYCA 1F9AA 4LDQA 4G0XA 4RJJA 1IZ9A 4IMIB 3MT9A 2IK8A 2HA0A 3DDNA 3UAVA 5JQWA 1EX6A 1HGXA 4UHHA 1Z4QA 4RMNA 3L9XA 5EC8A 3Q85A 1GEGA 3R75A 4DMRA 5DGCA 1G6HA 5AI6A 4XFJA 3K70C 1ZN9A 1CUWA 3AJAA 1CJVC 4H2DA 2QTVB 4QDTA 1O9HA 2RGNA 4JOSA 4WACA 4IAOA 2IBSA 1NF2A 3URKA 3B1ZA 1QG2A 3CKYA 1O95A 4LY0A 3NKVA 2RGDA 2E6KA 3HKCA 2FWRA 3D8BA 4GM1A 2NLOA 4QUBA 1D1PA 1VG9B 2G9UA 3L79A 4OAQA 4F7WA 3WWDA 3I5XA 2WINI 1ULHA 4XB2A 4Z3DA 4FBMA 3CLSD 4AXBA 1WDMA 3EQ2A 1E2MA 4OLJA 4F6LA 2BGIA 4LTDA 4BVAA 4DS3A 4OB6A 4LF7B 1USWA 3QPUA 5AW2A 1L4EA 4X91A 2CDNA 3WHIA 2FW1A 1LK5A 1QF9A 2NYAA 2CGEA 3E7XA 1NR5A 4D9KA 1XXHA 5C1PA 1GUZA 3CCCA 5KYYB 1GL3A 5F77A 1X7YB 3KXPA 4U7GA 3A4TA 1DWUA 1BJKA 1DRUA 1Z16A 1QR2A 1EG2A 1CQPA 2XHEA 3IQZA 4U3JB 2ZUBA 4RTKA 1TUBA 3LLVA 4YT5A 2CJYA 2EV9A 1EUDB 3FFAA 4JJEA 4Q82A 5C53B 2Q5CA 4CKWA 3LF1A 2A0FA 2XLBA 3SC4A 2ZUEA 3KXIA 1SQ6A 3QTTA 3G8YA 1IULA 1E4YA 3AONB 1A7JA 4RLQA 4UNPA 2QENA 2WVJA 3A6JA 3FZYA 4NU8X 1AMOA 2JHFA 1Q44A 2NU6B 4W5TA 3H1GA 4YO7A 4AMVA 1RBZA 2FW6A 4CV3A 5KU7A 3EFBA 3ASVA 5KNCA 3G49A 1CETA 2WDPA 3UHAA 4XGRA 3EIQA 1VKHA 2YC2C 3PGMA 4OA8A 1MC1A 2FCAA 4QPDA 4BWVA 5CB4B 3V8MA 2RHWA 3IO5A 1FDTA 4TPKA 1QLJA 4KQCA 3SYMA 4NK4A 4OQZA 1QYWA 3N6VA 3ED1A 3D3JA 4YVFA 1T1EA 1DJNA 4ZCSA 2ST1A 1ZJJA 3PFHA 1TM1E 2HT6A 4G01B 4UNNA 4D4MA 4M0UA 3H2YA 2ADOA 2N3ZA 4K0RA 1BYIA 1ZW1A 4LGMA 3DZCA 1LH0A 3VUFA 1TVCA 4ML3A 2VDKB 2DPYA 2OFFA 3RK4A 1E1RA 2Z04A 4MWTA 1YJBA 4PIVA 1PJ3A 3VSEA 2AEFA 1CUYA 3KQYA 1LQ2A 4LGCA 4PTLA 1YR1A 1ZNWA 2IUSA 2ZRGA 3DMDA 4ZVRA 3USZA 3GLKA 3U3DA 2YJTD 1QKKA 3KYDB 5SY4A 4OYRA 2JJQA 4HG2A 2QRGA 1VHWA 2GLXA 4NYJQ 5LOVA 3IDFA 4QVGA 1TMGE 1DLIA 3IJ5A 4OIMA 2E4ZA 4CM8A 3U13A 1UXJA 1R88A 1Y4ZA 4Y2GA 1FRVA 1T5HX 2HSDA 3V4LA 2OFWA 3LZCA 4HS9A 4X00A 2JLQA 1TOAA 1JEQA 3ABSB 3FSGD 4TRRA 5KWEA 4TKMA 3FOZA 5JNUA 1ST2A 4H31A 1W5EA 3ZU5A 2JF0A 1IFXA 4C4OA 1E1MA 4L5IA 1BKYA 3QYJA 1DUVG 4M36A 1T8SA 5HQTA 4KHZA 1CFZA 4MW9A 4BN5A 2P67A 1DKLA 3DNPA 5LXTA 1GRCA 4OTZA 4MV1A 3H3JA 4UBKA 1CYEA 4AF6A 2XE6A 4ND5A 1U2QA 3ITEA 1JALA 2PZKA 3P4YA 1ZRMA 1ZRSA 3PWTA 3PKZA 4O4HF 3OY7A 1Z45A 1SC6A 1SVMA 2VP2A 3CJTA 5DI3A 5LP6F 3RVJA 2R3SA 2TMYA 3K0BA 4XPZA 4L5JA 1LS1A 4BFYA 5BNTA 1DJOA 4I5FA 3OEED 1NXWA 4L5AA 3INTA 3CVYA 4XD2A 2YIJA 4M9QA 5HJ7A 2P78A 1XTVA 2C4TA 3FOAA 3KSMA 4A9AA 1YULA 4HAXA 2ZQ5A 4LYJA 5EL0A 4LFAB 1LY1A 2DC1A 2Y0PA 2VNJA 3CLUD 1Y48E 5BT9A 5KYTA 4UHDA 3HJFA 4HRXA 1GT6A 4ZQEA 3HDHA 2NO6A 1X9IA 4QPZA 1UADA 3H2JA 2BKAA 4HFMA 4JP2A 4ZJUA 4AO6A 2HUPA 3CR3C 3QMMA 2A4MA 4Q7QA 3DHEA 3AYXB 1ZO8A 1MTZA 4F2PA 3VR6A 2QLLA 3ET4A 1RU3A 7GPBA 2TRSB 4IIEA 3PG5A 2VZ0A 4B2YA 1DZ3A 1KI8A 4X90A 3TO5A 5DU2A 3QVOA 4IUYA 1J70A 3ZKAA 1LBEA 5BN4A 3AINA 4U02A 3GVCA 1YVUA 2GCEA 4P3XA 3I39X 2AFHE 4TYWA 1VI2A 1H05A 4MVJH 4V0OA 2D59A 1EWKA 4QGGA 1O97C 1E6UA 4R68A 4Q3BA 4B3DA 2YX1A 4CKEB 2OV2A 2VYND 4ALLA 2HEGA 2XB6A 1XU7A 1IM5A 1I10A 1PS8A 2H1HA 3F67A 4MV5A 5AK0A 1BRTA 4RH0A 3A4MA 1Y1QA 3A14A 5TVGA 3RIHA 4UFPA 4X66B 1MHTA 3IAXA 3E7FA 4ZK6A 3DP9A 1M1XB 1KA9H 1YMVA 2IELA 4NY1A 5ITVA 3B13B 4XH9B 1I1OA 2VHVA 3LF2A 4KLZA 4K6FA 1ES9A 1H66A 3K0EA 3BQMB 2IP1A 3F97A 4PLVA 2ID8A 4Y1RA 4YRTA 3BGDA 3SD7A 3SZ3A 4BN4A 2J3DA 3ZVMA 1TJ4A 2CNWA 5L6LB 2OBLA 4A4DA 1MX9A 2JFFA 1TF2A 5FBLB 3RSGA 4FJ1A 1SKBA 5ESXA 3PJEA 3PT5A 1U6KA 1I1NA 1Q2XA 3C3MA 4QDUA 4BVEA 4WBNF 3U4DA 2YHSA 4CQJA 1J5XA 4KEAA 3TVTA 3VH4A 2WYHA 3JALB 2I4MA 3SQWA 2LVBA 2GEDA 3OPQA 4FXPA 1QUFA 3WYFA 4P36A 3ETEA 1YZHA 1V95A 5KOHB 1YQTA 2JGEA 1JKMA 1HRKA 2XAAA 1C8BA 1IDN1 1M7HA 2O0JA 2NTNA 2XB4A 3NBYC 5JZOA 8GPBA 4NCAA 1CRQA 3U2QA 2G28A 1YZFA 2LGJA 2NV6A 4R3UC 5FJIA 5KHAA 2OXIA 2J0QA 3NLLA 5CM8B 1UBKS 1ZI9A 4RH3A 5L7YA 1PT5A 3FYUB 2HLDD 4NECA 2EX0A 2O2DA 2NQTA 1UC9A 2H06A 5BR4A 3P2JA 4LBWA 1QZ3A 3OU6A 5F33A 2ZRHA 4ER7A 3PXUA 4MNTA 2G25A 2ECOA 2HV8A 2QTNA 3HU1A 1MD9A 1WVGA 1WXXA 2H4WA 3LUHA 3UMYA 5DX1A 1F1BA 5JAMA 1DKMA 5FIUA 3RVKA 1UP7A 3LUGA 2VF4X 1D6MA 2PWBA 5TJHA 4BVHA 4JI0B 2PQ0A 4MW4A 4MYRA 2CSXA 4AIRA 2CHUA 1TX4B 2P3QA 5ES3A 1NTRA 1HYHA 1UK9A 2RHCA 4W5NA 3A36A 3ZZUA 3LC0A 4PYJA 4UFOA 3K1AB 1JQ3A 5TMEA 4IO1A 3U4QA 1SG9A 2WZQA 3LBFA 2ZREA 4BWYA 4E14A 9ATCA 2ERYA 2EX4A 4LJ8A 1Z5GA 1O89A 1X9HA 4DIDA 1FXWF 4B7CA 3FCYA 3WGYA 4Y1EA 4UM8B 1Y9EA 2BMWA 4LVOA 5FWYB 5LD2B 1QLHA 1BVRA 1CLUA 1SCAA 3GUVA 4N8SA 4PQFA 4KVAA 1NSFA 1P75A 3SNKA 5EMLA 3GPDG 5KBYA 2QXYA 4YAUA 4DSTA 1PD1A 1ZUHA 4M6WB 2Q7OE 3FTPA 2PZJA 1CVIA 2P69A 4I46A 4ARZB 3U5ZB 2ZTUA 1IONA 1W0JD 1EEHA 1Y1RA 1YK0A 2AJBA 5B1DA 3WLIA 2MINB 1XZGA 1KZ1A 1Y63A 2VTKA 1PHRA 2ZQZA 3EIWA 3LBHA 4FCCA 5CX4A 5B3AA 4AMGA 5F2OA 2HO4A 2NPFA 1VJGA 3TPZA 1XN1A 3ICPA 4Q4JA 4WDRA 1W35A 1XSEA 4FYXA 3ML1A 4LMRA 4N7JA 4OKSA 1WL8A 3ZDXB 2ISQA 2Z4SA 5KSWB 2J3EA 3I6BA 4V24A 3PPVA 5E1DA 1QF7A 2BDEA 5FEUA 3R7WB 2ZYSA 4C7JA 3EB9A 5JE8A 5JCOC 2XZTA 3ROEA 2GD1O 3G8BA 3A4VA 3CVWA 4OK5A 5ICSA 2A7XA 4WZAA 3M4NA 4L0MA 1CDZA 4HTFA 2YJ6A 4PVDA 2H2IA 4G0MA 1YRQA 2NTYC 4M1ZA 4RIGA 5EUBA 4JYZA 3KEOA 2CLLB 3BHMA 1EFPA 1MAUA 2DHQA 4MWDA 4YI5A 4YXWA 2WU1A 1DWPA 3OPMA 3PXGA 4RTQA 2QN2A 2OLKA 3KHSA 3WLQA 3QVGB 4EY3A 3VU1A 3QF4A 1G17A 1JR3E 2EGGA 1E0DA 4OJYA 5BSKA 4X3OA 4CM9D 4E30A 4F5DA 3L4SO 1Z3IX 1VLVA 2I66A 2BH9A 3DYBA 4WXYB 5DHTA 1CW2B 3V1YA 3UK7A 4ZO7A 3BZWA 4GWGA 1FFXA 4UCQA 5F5XA 2Y2UA 3UW3A 1UBUS 2G4LA 1U7HA 3FDZA 3KR0A 5BNZA 1XZPA 2FJPA 2FETA 1F2UA 4IRUB 2DFTA 3RVMA 4AUKA 1WVMA 5IH3A 1E3SA 2HPVA 3TW0A 3WQHA 4C5AA 1K66A 3R0XA 3RS9A 5AO9A 5DGDA 1UKBA 1TZKA 3PDUA 5DKFA 4WE3A 4BJ3A 4DLPA 1KZ6A 3HN2A 3ZU6A 4C3UA 1EP1B 4MS1A 4ZPJA 2RAVA 1U0JA 2RGRA 3LTNC 2B35A 2GTPA 4AZWA 1MNQA 3Q9NA 3VHRA 4FB5A 4OU4A 5D3MA 3VHXB 5EJ4A 1FCJA 3T7EA 1EGMB 1WXHA 5J2TA 1YR7A 4RHFA 1R8JA 2G04A 2O8CA 3VMMA 4C7XA 4TTTS 5AJHA 2QLBA 2O3SA 2WI8A 2VHQA 1K86A 1QIDA 1ZGHA 5BSUA 3SE0A 1CLEA 4R71A 4HKTA 1M8KA 2ZSFA 5TY0A 3RYHA 3CPEA 3QKUA 5BSMA 1U28C 2A1IA 1N4DA 1KSGA 1WNFA 3MBKA 3T7TA 4I4CA 1I80A 5K3DA 2VA9A 2O48X 1RIIA 5JVDF 1H93A 2JGIA 1O4WA 2OGZA 4MGKR 1MV5A 4KSBA 5DYIA 3II6X 2ZE5A 4AZ0A 4RTNA 4JP8A 1NOIA 4Q4HB 3EVTA 4GQBA 2H4HA 3FB4A 4B9EA 1USGA 5I9BA 5L3ZA 1BMDA 1L4YA 2CKMA 4QTUB 4QJIA 4QBHA 4RZ2A 2VHCA 1ZMTA 2P0EA 3A27A 3EQZA 3P20A 3IAS1 4JJIA 2ODPA 4X1KB 3V9PA 2K87A 2C96A 5A4FS 3QLVA 4RVNA 2FN7A 2BH2A 2CLEB 1HZZC 4LQCA 5TPZD 3I5MA 4XGNA 3RSOA 4BP3A 2JEZA 3GH3A 4JLBA 1XZJA 2YICA 4KE6A 3W77A 5AXBA 5HRAA 4JBGA 1JSLA 1UC4B 3BX1A 2SHKA 5K3AA 1UMCB 4IL5A 4HVCA 5JCZA 1S3GA 1UF9A 2FUKA 2QU7A 2G08A 4D97A 4EHJA 1KWGA 3RG2A 3IC5A 4OHWA 3GR6A 4KO1S 3L43A 4YV2A 4HGPA 3CB2A 1LPMA 4MR7A 3CB4A 1ZONA 4PSKA 3N3BC 4OMCA 5EJAA 4B80A 3BB1A 3ZU2A 1PBNA 3GJZA 1PGPA 5ELXA 1W48A 3B6EA 5AUPB 4HR7A 1G66A 3BA6A 3HDVA 3MD0A 3OJOA 4RKWA 4GH5A 1POXA 2A0UA 1JUDA 1N5LA 4IZHA 2XBMA 3PFIA 2UKDA 2WIJA 2WSMA 1T0PA 3NM5A 3RUCA 4AJJA 2NVUA 5AVJA 4BRSA 5NULA 4C0QC 1UDAA 3OBIA 1SUCA 3E9RA 1PX0A 2IXBA 4I1OA 3A2NA 1PAUA 1KVQA 2H5JA 4YCMA 2IYYA 5M34A 3F90A 4TS4A 1ZNZA 3EBOA 3QVVA 4I9HA 5L7TA 1KS2A 4D3ZA 1ESZA 3ZWNA 4FGJA 5MHTA 4MYSA 4WHMA 4ALMA 3D2CA 5AM4A 1M34B 3IXMA 1HDCA 4FP9A 1K7FB 3WHLA 1XKQA 2PUAA 3CN9A 4HQ6A 5EMKA 3R7AA 1EK0A 1W47A 3FNQA 5BVGA 1BFDA 3WYBA 4QDKA 3T5DA 2W0SA 3K30A 4P33A 4BO6A 4F3RA 5J4LA 2E87A 3CX7A 2I22A 5MN4A 4JLMA 1SUWA 2ZVQX 5LQMA 3EZXA 1ZUIA 3I1YA 5IJAA 3TXXA 4A5SA 1FS4A 3DTVB 1W2WB 4DV7B 4AKGA 4D43A 1OLXB 3SM9A 3HADA 5JWHA 4EFKA 1HK7A 3WADA 4BFTA 1CY4A 3LUAA 4ZOQI 4HDNA 1K88A 4OHYA 3IP6A 4OQMA 4IEIA 5ALMA 2JIOA 2A59A 2JLAA 4GPTA 5KTOA 5KX5B 4B3CA 3E1SA 5EE3A 2E4UA 1SUPA 1LTQA 2FKNA 2AG8A 2XNCA 1UZLA 3OU2A 4GMGA 5DHFA 5C5IA 1R16A 4PCUA 4DXAA 2IY9A 2QUAA 2V7BA 4GW3A 4I4NA 1X0XA 3LZ6A 3PCRB 4YRCA 1BFKA 2WB4A 3F98A 5A6SA 5EUMA 3KJZA 1PUIA 5DH9A 2YQ5A 3QHQA 1UT6A 3RQIA 3KLPX 3HN6A 1JQLB 4RFVA 2V6JA 2Q7XA 1EFVB 2ODTX 3HVIA 1X15A 1EBUA 4G1BA 5DW0A 4Z9YA 3VKFA 3G3EA 1F14A 2WW8A 3I34X 4HUQB 2YWFA 3I2KA 1E77A 2OEPA 1B14A 4UW9A 3T4PA 3SZLA 4U1RA 4FIDA 1SIOA 1UJNA 1N3LA 4I50F 5C9ZA 1OI7A 2XCIA 1KMHA 3OICA 5E4TA 16PKA 5EJFA 4BJ5A 5ALSA 2NTJA 4WESA 5CCXA 2HHAA 2O8EA 2AXPA 4RAQA 4MWGA 1F3OA 1KY3A 1V3UA 2G9QA 4G1MB 2E37A 3EUFA 1YZTA 3AJ9A 5AVSA 1HH4A 4K6GA 2HQSA 3UT5A 3X1KA 1R18A 2R68A 5K45A 3RSLA 2ZP1A 5H4GA 4N9QA 4QM7A 5H3HA 4JJ8A 3KXDA 4HQKA 1OVGA 5AM0A 5GJBA 1Z6ZA 4EPRA 1JFTA 4OJTA 5K3OA 2PXHA 4HX2A 3CZAA 3OEHA 1VYVA 3V5NA 2BTOA 2B4AA 1B41A 3CONA 1L3BA 1P2BA 1J8FA 4DV4B 1M6YA 1KE2A 2BEWB 4HD8A 4DNQA 4XIGS 5JQGA 1G8MA 4MHOA 4UMFA 3KQHA 4OUKX 1PF7E 2R85A 4DE5A 2BZ1A 2LIVA 3GB9A 3VHQA 3MA0A 2YHUA 4K9KA 4ENVA 2Z5FA 3H17A 4LOAA 4XPIA 2GI4A 1OAOC 3IOYA 4I6EA 4WN9A 4EMUA 3JRNA 4NENB 5DBEX 3TLMA 4IKOA 3VU8A 3EH2A 5DM60 3O4IA 4RK4A 1UWLA 3SJCA 3L05A 4EQZA 3B85A 3DE1X 1HORA 1E62A 2NZVG 3GD7A 1PEAA 2WAYA 1IXKA 2QJRA 4HLQB 1Q83A 5KNCH 3V80A 5BYBA 3T54A 5EJ6A 3EDMA 1E7QA 4BAZA 3KZMA 4PLZA 5ENDA 2ATVA 1K7XB 4WL0A 3OQBA 1QH1B 2R79A 4RF4A 4D56A 5KJ1A 3C6QA 4H7EA 3UCFA 3BJEA 3OIDA 3IVCA 2SNIE 2DQYA 3P97A 1WV0A 3RREA 3PNQA 2FX5A 4RA9B 4XARA 3UG6A 2GN1A 5CXXA 3HDGA 3L6BA 3QLTA 1R0YA 4U9HS 3VYUB 4FFNA 5IWAB 1M5RA 3ZHCA 4E22A 1R0XA 2WF9A 5D3QA 1GGMA 1M2VA 2AHOA 4PSUA 3SLRA 3AERA 4KQ2A 3TH5A 2X7JA 2D8MA 4UM5A 2WQZA 3KSAC 3GFOA 2H9AA 3VZBA 1E63A 1I2MA 2GRAA 2ZQYA 3DUWA 4P4UA 5JHHB 1DQPA 5JYBA 4LVUA 3OIUA 4UJ5A 1PWEA 3S29A 5A04A 3TR5A 3RPEA 3CVXA 3MJCA 3OMXA 2G09A 3I62A 2B30A 1L4MA 2J5KA 4FX5A 1JB1A 4JLAA 4GX5A 4LCEA 4RETA 5A0FA 5TT0A 1E9EA 5LZ7A 4AC9A 4DIKA 3VTKA 4KPYA 4ZEVA 3KSZO 3QFFA 5EWMA 1RAEA 6LDHA 4HADA 5SICE 3KV1A 3IFSA 1YUMA 2QUIA 4B46A 4YT4A 4QEKA 2GESA 4LC0A 4MI9A 1R4ZA 4P2GA 3ZLUA 2PUWA 4KHPB 3EXHC 5DBFA 4I99A 4ZJYA 4DY6A 1JR6A 2XAUA 2QTMA 3SPXA 1G7TA 3ENVA 3HO8A 4ZDJA 1VJDA 2PYZA 2E4YA 3OPNA 1A76A 1XDGA 1W93A 3GAAA 3HL0A 4BMDA 4DF3A 3A2KA 1E5TA 3ETNA 1GWNA 2FHPA 3NCTA 3FSJX 1U4OA 2R25B 3HCWA 3ZGVA 1BCSB 1T5OA 1SIWA 2CLIB 4HP8A 4Z3OA 5T4HA 2DT5A 3D59A 4G8DA 2PX2A 2FW7A 2BHLA 1ZJZA 2CLHB 2O3RA 2V98A 1WA5A 3DXYA 3IAM6 3ZCQA 5TGDA 2Q1XA 5GONF 4O0MA 1D03A 1JR3D 1GRVA 1HEIA 3B36A 4I1SA 3SIPA 3EEOA 1IQUA 3EGVA 2XVYA 2QV0A 1NP3A 2AI1A 2YJ3A 3NHZA 3SDBA 2HCBA 3O2JA 4RMIA 3UJDA 5JS1A 1KJYA 3JVIA 3WX0A 5A0VA 2QE7A 2Q9AA 2DP4E 5AYVA 4DC9A 4MJXA 2AJTA 4OHRA 3BRQA 4BEBA 4W9NA 1CUGA 2O7NA 1VM6A 2DYKA 3WYGA 4DLAA 2EL7A 3Q8WA 4A0QA 4N82A 3FUTA 1QRSA 1JSCA 1RYYA 4GE3A 4RF2A 3H04A 2HBRA 3R0IA 4IMRA 4NWIA 1C7RA 3A25A 2JIZA 3L1KA 1Z8DA 3GN2A 3OFJA 1V7PC 4XW2A 3V2HA 1OASA 5MFZA 1JFFB 1EUYA 2PSHA 2ODQA 3MJ4A 2DF8A 1SC1A 1Z4MA 2ZE8A 3HJUA 4GEGA 4LE0A 1XROA 2X8JA 3NWJA 4YFYA 5KTTA 1B42A 4Q7JB 3BT7A 3LDUA 2ZI6A 4IVRA 3COZA 4RM2A 4XQ0A 4G2TA 3VR6H 4YJ2F 1ZM3A 4QGBA 3BXFA 5CYPA 3W5VA 2Y1GA 1Y3DE 3SYRA 1FK8A 3UMVA 2GPAA 5KVVA 4V0RA 3K72B 1Q7GA 2PH3A 4IDDA 4XR4A 1A50B 3IB6A 2YWJA 4G0NA 4QFBA