1QHXA

Chloramphenicol phosphotransferase in complex with atp from streptomyces venezuelae
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
178
structure length
178
Chain Sequence
MTTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQSAEGGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLDVLWVGVRCDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTHKESIECAWAIAAHVVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CHLORAMPHENICOL PHOSPHOTRANSFERASE)
publication title The Crystal Structures of Chloramphenicol Phosphotransferase Reveal a Novel Inactivation Mechanism
pubmed doi rcsb
molecule tags Transferase
total genus 61
structure length 178
sequence length 178
ec nomenclature ec 2.7.1.-:
pdb deposition date 1999-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07931 CPT Chloramphenicol phosphotransferase-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1qhxA00
1W0KA 4WXPA 1N5IA 5L3RA 4OI2A 4TN1A 1KKMA 5KDLA 3Q72A 3SS8A 1XJQA 1G3MA 3FWYA 1SKQA 3CLVA 1XEWX 1P2TA 3DO6A 2IS2A 5B57C 2AK3A 2XZOA 1NLFA 1KO4A 4G3XA 5J5CA 3D6TB 5AWFC 3M1IA 2RB4A 4QM7A 1OV4A 4CRWB 4D0LB 2VP5A 2QAGA 4TLDA 3SU8A 1EFUA 1SXJE 2WKRA 4Q1FA 1KO8A 1VECA 2BKUA 4D26A 621PA 5KO2A 1JAIA 1A2BA 3PG5A 1DAHA 4HSEA 4BE7B 4EPRA 1COWD 1FTNA 2W2XA 1DS6A 1UBCA 4MYTA 2JJ8A 1KIMA 3IPXA 5E7MA 3LWNA 5EXSA 2QG6A 4W9MC 1E79D 4KFSA 4M22A 5FPHA 4A0FA 5B58C 5KNDA 3BFKA 2JLZA 1OH5A 2QBYA 4C2UA 3MUFA 4HZUB 2RGDA 3A36A 5KNCA 4C0KA 3IGFA 4HAYA 1UADA 4PQYA 4Q1BA 4JYCA 2QMEA 3TVDA 4WXRA 1ZW6A 4TT3D 1GL9B 3WHKA 1E9FA 2YZ2A 5F2EA 3LLUA 1EXMA 2B92A 5AUOB 5J4HA 2BOVA 3ZS9A 2A30A 1YVDA 2WAYA 5AJVB 5G40A 1EESA 3EIEA 3GEEA 4U00A 1NI3A 2WMOB 3QY0A 5EE9A 2VHQA 1G3UA 4B6FA 4C30A 1T3HA 1HYQA 3MLEA 4EQ6B 3PR1A 1KI4A 2QGZA 3BWDD 3NC0C 1WDTA 3AF4A 4ESVA 2GHIA 3UATA 3SQWA 4AI6A 1FNNA 1KDRA 2WZQA 3CKLA 5A0FA 4B3DA 5AJXA 5JFGA 2FX3A 1AA9A 1O3YA 5LB4A 5FBQB 1XTRA 1HE8B 4HB4A 4AWXA 2ONKA 4PC1A 2IXEA 1KMHB 2NO0A 1JQJC 1SVOA 3C5HA 3MGCA 3AVWA 1P61B 1SVSA 2DY1A 1AZSC 1DEKA 1KSHA 2GNOA 3I8SA 1GWNA 1NY6A 4MKFA 4RY2A 3VHXA 3AP2A 4MYCA 2VQSA 1Z2CA 1NVWQ 1Z47A 2A2ZA 2CXXA 2E1RA 3I72A 3MCAA 1NSFA 5F9FA 1G16A 2GEVA 5L8VA 1KO5A 2O8CB 2FFHA 2ECKA 3CUEF 4R7ZA 4Q02A 4N3NA 4ZCIA 2BCJQ 2IYZA 2JJ1A 1KNQA 4Q4HB 4DVGA 1X1RA 3FFBA 4XSHA 2I4IA 3QKUA 3O8RA 2BBWA 1EG7A 4GL2A 2JLSA 4OHYA 4DT1B 3CH4B 2NG1A 2XITA 1WXQA 2PCLA 4MRRA 3LNCA 1KO1A 1XFAA 5JJIA 2BMFA 4DSUA 2GJ8A 4JVNA 2A5JA 3HDTA 1OIWA 4OJQA 3GJ4A 2OCPA 3MFYA 2O5VA 3G5UA 4FWIB 3BS4A 4RCZA 2GZDA 1EWQA 3SI7A 4AC9A 2QY9A 3DM5A 1CJMA 4Q1CA 1W36B 4MRPA 2VSOA 4NZYA 4JJKA 3KL4A 3L0IB 3THOA 4BWYA 3GPLA 4M9XA 721PA 5KNBA 3T1VA 1GIAA 4R98A 2BDTA 3EG5A 1N6PA 1XMVA 3AKCA 1XDBA 3WY9A 2A3RA 3IBYA 4QGGA 3CM0A 3EA5A 2CHQA 1A7JA 2NQ2C 3LVRE 4NYMQ 3TR5A 3R8FA 2JASA 5J4LA 3QKRA 3IO5A 1E2KA 4OHZA 3ADKA 2RCNA 2RHDA 1GDDA 2D7DA 2AN9A 3NBXX 1AGPA 5G41A 2IS1A 4Q4AB 3F3YA 3DPUA 1N6LA 1XD2A 5AK0A 4HB0A 2FU5C 2ZE7A 4B2IA 4US1R 1GRRA 4EPTA 4PANA 1R5BA 3R8CA 2DYKA 1E9EA 2ZRKA 1XEXA 4KI0A 1XPOA 5D3MB 4PPQA 1AQUA 3QSYA 1KI8A 2Z43A 2RHMA 1F2TB 1IBRA 1T0JB 2REXB 3CRMA 1XXHA 3EWSA 1JNYA 2KBFA 4OK6A 5CM8B 1TL7C 1CU1A 1U2RA 2O0HA 3KTAA 1ESMA 4GI7A 1X86B 3A4LA 4JVSB 3TKLA 1ZM9A 4BZQA 1GG2A 5HE9A 2DFLA 4B47A 1IXZA 1RJ9B 3K0CC 4O25A 1J7KA 4IXMA 2OG2A 4OBEA 2UKDA 4FN5A 3A1SA 3U7HB 2ZI4A 4AG6A 4EUNA 3GFPA 4IEEA 3RRMA 4DJTA 3CONA 3SDZA 1IXRC 2QTVB 1VG8A 3I62A 3SFZA 4IVQA 5GJBA 2IC5A 5CLLA 3AGQA 1XXHE 1KK1A 4UNPA 3VR6A 2JLXA 5P21A 3NWJA 2XB4A 3Q5DA 2HYDA 1SXJB 2CL6X 3CNNA 1E1RA 1U8ZA 1N5LA 3JZAA 2GF9A 2DHRA 3FDIA 5E7JA 1YR8A 2OLJA 1AS2A 1T4GA 4Q7JB 4Q9JA 1SVKA 1Z0JA 2Q3MA 2WJYA 5DYIA 4OI4A 3DKVA 3O47A 1GNRA 3PITA 4KODA 4ZKEA 1HH4A 2LKCA 1ANKA 1FMLA 2NPIA 4BRUA 4F7WA 2GAAA 3B7GA 2ZREA 4PPFA 1OXSC 4JBWA 5FTMA 4N0DA 3OEHD 3EPHA 3PEVA 1K6MA 2VF7A 3AV0B 3P20A 1KAOA 2YJTD 1MH1A 2FFQA 1ZCBA 2WJGA 3KXIA 5KDOA 2YC2C 3ZIAD 1KY2A 3PCRB 1TF7A 2QN6A 4B32A 1FPMA 3RS5A 1T3LA 1EFTA 1I4LD 1U0JA 3UWOA 3TVTA 2IS4A 1ONBA 3LW7A 3T1OA 3UANA 4NYJR 4QHSA 1GL6A 2J9RA 5GVSA 2OAQ1 2G6BA 3NTUA 2YYZA 2Q21A 4DLSA 3O8CA 2RGAA 4JLVA 1S2MA 1TAGA 5AUQA 3DMDA 3IHWA 1OT3A 2VRWA 2CNWD 3DVLA 5CYPA 4Z8YA 2Q9BA 2N42A 3P27A 3I61A 2QBYB 1ZUHA 2QP3A 2YKGA 2ZE8A 1S0UA 2W6JD 2I1QA 4RKFA 4LPSA 4URUR 2PZFA 2IYUA 3A58B 1UKEA 2JEOA 1FQJA 2NTYC 3RS0A 221PA 2MMGA 1GM5A 1L4UA 3NC1C 4F4CA 1F6BA 3AF3A 4DLYA 3K0SA 4QM6A 1M8PA 2FZLA 1EFHA 4LBVA 3QNUA 2ZQ5A 1I4TD 4YC7A 4EFLA 4PQFA 821PA 1XMIA 1ZYUA 2IXGA 2ZS8A 2D62A 3Q85A 3BORA 4LRWA 2O0KA 4XOIA 1FUUA 1LTQA 3Q5EA 2AD1A 1KYIA 3I3SR 1KI6B 3W8NA 4LHXA 4JVLA 4M53A 3EASA 4Q66C 3VKWA 4QKQA 3DDCA 2R6GA 1GKUB 3FMPB 3K0CA 4C0QC 4KSCA 1TADA 4ZDIA 3B13B 2PMDA 3LDAA 3K0EA 2WIBA 1S8FA 3BB4A 4NH0A 4LC0A 3RSOA 4MGZR 3V00A 4Z1MD 2IYLD 2W0MA 5IRCD 2NO1A 1M7BA 2J7KA 2H18A 5AJYA 3VR4A 4OQFA 4V0KA 4US0R 4DDWA 2DWPA 1CR1A 2GK7A 2IYWA 2WJIA 4I4LA 4KBFA 4P33A 4IOLA 1DBSA 4JIMA 3CRQA 4L15A 2ORWA 2W6IA 4Y0AA 1KOFA 1HTWA 3NHBA 4Q1DA 4XVQA 5DHAA 4IDHA 5DI3A 3X1DA 4P31A 1QHIA 1US8A 2EWVA 4IHQA 2XOKD 3SN6A 4ZIRA 4DXAA 3QPWA 3B1ZA 3WNDA 3B85A 4X8MA 2OT3B 1VPLA 2XNSA 2PLFA 5FOSA 3ICQB 521PA 1Z06A 1GNPA 3BFVA 1UJ2A 4FCWA 4D0GA 1QVAA 3H86A 3QF7A 1C4OA 3D7MA 3B9QA 2GKSA 2NO7A 4M9ZA 4TSFD 3ND9A 1QG4A 4PAOA 1DPFA 1CR2A 3C41J 1G4AE 2ZJ5A 4G01B 2VYFA 5DIFA 1Q0UA 4LHYA 4QBGB 4DZZA 3IIKA 3KKNA 2OFXA 1PV4A 3BB3A 2VP2A 3DHWC 4PC2A 4D80A 1QHYA 1N5JA 1XD9A 4TTRA 1JR3D 3U3OA 3P26A 4I1OA 1FOEB 2WJVA 3UIEA 1MO4A 4JKIA 5DO9A 2O8FA 1TTTA 4B76A 5GJVC 2QMUA 3ONWA 1XRJA 4KFUA 1JB1A 3NH9A 3Q3JB 1OH7A 2OEPA 3RDPA 2Z0MA 2A5YB 5H8WA 3DOEA 4LCBA 4TLBA 5B64A 1QHHB 4OL0A 3ZS8A 4ZV4A 5K8LA 1YRAA 3C15C 5HKKD 2VP0A 3BE4A 1MV5A 1XD2B 2EFHB 1XCPA 4GFDA 2RGEA 3AP3A 1Z29A 2ASEA 1E3MA 1HEIA 3U6BA 2WJJA 2B7BA 5KHOC 1KK2A 3IUYA 4WIAA 3PXGA 1Z5ZA 2CBZA 2DPXA 2GRJA 2ZR7A 2ZITA 3MJHA 1PLKA 1JJVA 4Q01A 3GLFA 2J0QA 1JPJA 2HT1A 1OXTA 1E9DA 4JLDA 1WMSA 1XXHB 3KJIA 2ZI6A 4HUTA 4ILEA 5FBWB 5IK2D 4HZUA 1P9NA 3T34A 4HDQB 4CVNA 2IT1A 3KTAB 1AQYA 1LVGA 2OE2A 1TU4A 3CWZA 4MKHA 2JDIA 1KMQA 2ZJAA 5GJCA 1G6HA 3MWKA 5HCNA 3B82A 2F55A 2GZAA 2FNAA 4U5XA 4AK9A 5HZKA 3QF4A 4IRUB 3B1WA 3ZGXA 4KITB 2AWOA 4PHTA 3PUZA 2H92A 3PEWA 1Z83A 3GLFE 1ZU5A 4ACBA 1WRBA 1ZINA 3CX6A 4TL8A 5JJLA 1N6IA 1CTQA 3OIUA 3P1JA 5KSZA 1IN4A 2OCBA 3KB2A 3EZ9A 3WXMA 4M1KA 2B21A 3CH5A 4ITRC 3PEUA 1W2HA 2PBRA 1KNXA 1KMHA 3WYGA 2ZI3A 3OAAA 1Z3IX 4DSNA 2D2FA 1YE8A 3VQTA 4AKGA 1EX6A 3NDBB 3LO5A 3VMFA 4YQFA 2R6CA 4TZ6A 3VU9B 2D74A 4ABYA 3IQWA 4YDSA 2EFCB 3AVQA 2WVJA 4IXNA 1LF0A 2YINC 1DAFA 5DN6A 3GLGB 4K46A 3VX3A 3GMTA 4LZZA 3THXA 3C16C 5GVRA 2J87A 1NRJB 1Z6TA 4G0NA 4V0NA 3K70D 3I5XA 4K8OA 2AX4A 4Q4HA 1EFRA 2H5EA 1LW7A 4IW3B 2BMEA 2IF0A 5FL7D 1VCMA 2WSSA 1CKEA 3U7FB 4IFBA 4DT1A 1W36D 1NBMD 1UBEA 3IPYA 3VFDA 3K9NA 3LBHA 2E9SA 2L0XA 2ZI9A 3TW4A 4J0QA 4GOJA 3DZ8A 1WCV1 2JLQA 1S9DA 1ZP6A 2BJVA 2BV3A 2VHTA 4KHZA 4PC3A 2HF9A 4QFMA 4QHYA 1R0YA 5LPNA 1DADA 1OHHD 5IT5A 4A4DA 2JJ2A 1LY1A 3AF2A 3RHFA 2V1UA 4B3XA 4XIGS 1W4CA 2J0SA 4JLMA 4LV8B 4HATA 4XWKA 1II0A 2ATVA 4M4SA 1W2GA 3WP1B 3I1FA 2Q3FA 4DCTA 2I1VB 4B35A 2OSBA 2C96A 3T61A 5JHHB 2QAJA 4BLOA 1D5CA 4OHWA 3KDSE 1IOZA 1ZM3A 2BBTA 2R6AA 1W46A 5E3HA 2XTMA 4LJ8A 4E03A 3Q7QA 4G1UC 2EW1A 3L0SA 4DUGA 4MRSA 5FBVB 2NPFA 2HYIC 5JI3E 3GJ6A 2CVFA 2IUSA 3RAPR 2IEYA 4Q4AA 1HV8A 4X8HA 3TSWA 4BEBA 3ADCA 2XTZA 3QXHA 2V7QD 5CJ2A 2ZM5A 1WB9A 5FTLA 3AVVA 4AURA 1TEVA 1Q44A 1QHNA 3CF0A 2C78A 2J7PD 4FIDA 4LC1A 3GFTA 2KBEA 3B1XA 5D3MA 4ZPXA 5L3VA 1U0LA 1H8HD 5DI3B 2AWNA 1F2TA 2JIZD 4OQXA 3HP1A 1C9KA 4DKXA 1E2IA 1FTSA 1EFCA 1AS0A 1NL3A 1RE0A 3W6OA 2PX3A 3GLHE 3RSLA 3ZDQA 3LQQA 1KSGA 5LD2C 3OHMA 2ZPTX 3V9PA 2GDJA 2WPDD 1RJ9A 1OE0A 4RD0A 1II8B 2ZJZA 1II9A 5C1BA 3ZQ6A 4M9QA 2J46A 1L4YA 1W0JA 2ZRIA 4LV5B 4YMSA 4M9SA 4B6EA 5AJWA 3T5GA 3U7GA 2RGGA 3IO3A 4MA4A 1GTVA 3THWB 2ZSBA 2ZS9A 2QENA 2REOA 5SZJA 4JS0A 5A5GA 4TL7A 1Z6XA 1W0KD 2Z83A 3BERA 5B2ZA 4C9BA 3FYHA 2ZE5A 3KQLA 2CCKA 4D25A 3VR1A 3WMFA 1F60A 2C5LA 2PEZA 1G8FA 2V55B 5FI0B 1P4SA 1AIPA 4Z8XA 1D9XA 1JAHA 1G7CA 1WQ1R 4NE2A 3AUXA 4PHFA 1VYTA 2F9LA 3KX2A 4HDOB 3GJXC 3KQKA 1Z0KA 2FH5B 4M1WA 5JS7A 4FINA 3TUJC 3AQ4A 5FL3A 1UFQA 2Q3HA 4BZPA 1G19A 5DISB 1NNEA 4IDQA 2NO9A 2JGNA 5EZ5A 4HAVA 4TQAA 4U7DA 1AKEA 1U81A 2VBCA 4OYHA 1NMXA 3KKPA 2WWXA 3NG1A 3UMSA 3SE0A 2QE7A 5TVKA 1T8TA 2O0JA 4TMVA 3LD9A 4C0SA 3CNLA 1XPRA 4TTQA 4JL8A 3EPJA 1CRPA 5G3ZA 2QUZA 5IF9A 4RVCA 1BO6A 2WWGA 1YZUA 5EXPA 1XZQA 1GP2A 3TIFA 3TMKA 1T91A 3GLFB 4XD7D 2A5GA 1G7RA 1Q1BA 5KYKA 3VR2A 1IJEA 1DARA 1GZSA 4I1VA 2HLDA 4LV6A 3CRW1 1TMKA 2ZRFA 1G5PA 1OIVA 2QMOA 4XSGA 4B34A 1KI3A 1P5ZB 1Q22A 3SQXA 1YZTA 4BFVA 4DDUA 3T35A 1E99A 4LWZA 4V03A 5DNYB 2VHUA 4Q1EA 4MDFA 1L8QA 1J8YF 3ICEA 3GJ7A 2CLCX 1XPUA 1D2EA 3B1YA 3L43A 4TL9A 2F6RA 4ZDJA 3RVBA 4GP6A 2ZVPX 4KBGA 2VSXA 4MKIA 1AJEA 4A2WA 3QF4B 3LXXA 1GRQA 4MYHA 2ZTSA 1XCGB 5AJZA 1GSIA 1PZNA 2JLRA 2ZSFA 3I8XA 4BRWA 3V4RA 1LF5A 2MSDB 4QJ4A 1XTKA 2PX0A 2GETA 1OXVA 2OO7A 2XSZD 1KI6A 2QRNA 3QIAA 1ZUNB 3K9LA 5JEDA 3AVYA 4BFYA 3P4YA 2CE2X 2B6HA 2HEIA 2XTNA 3LRPA 4PR0A 5KU1A 1MO3A 1E0KA 1ZMXA 2C9CA 2OFWA 3K53A 3UMFA 1XTSA 4FMCF 2ZS7A 5EXXA 3L8YA 2IWHA 5JCZA 4C2TA 3AH8A 3W3AA 4TZ0A 4JLPA 1RW4A 4UQOA 1R5OA 2JJ1D 2OXCA 3LAWA 5FOXA 1OIXA 4AYTA 2C8VA 3A8TA 4Q21A 5CK4A 3RWMB 2V3CC 121PA 2R62A 4DEXA 4EIWA 2WTUA 3H2YA 1EWRA 3OIYA 4DSTA 2ZEJA 3OEEA 4D0NA 1KAGA 3LW8A 1NIPA 2VHJA 1LB1B 3QKTA 2HJGA 3GLIA 4RZUA 4DWJA 1G4UR 3UMRA 1OKKA 3THXB 4V0OA 4EAQA 3N5CA 3K8YA 4HZIA 2OCYC 2NIPA 5J4KA 1JPNA 1J99A 1YZLA 4JBXA 2Z4SA 4LGMA 2XZLA 2X77A 4IOMA 1SVMA 3LV8A 4FMDF 1VIYA 1Q57A 1ZC3A 3NVAA 4JLKA 1GFIA 4HAWA 4AG5A 4Q1AA 5EP2A 4ZO4A 4GZLA 4JT2A 2P2LA 2XNDD 3IKJA 1QZXA 3EIQA 4QOSA 3EA0A 4G5RA 1XP8A 2OAP1 4GSYA 1KSFX 1KI7A 5JCPA 2C95A 2WJHA 2ZROA 3GLIE 5M04A 3GJ3A 1DAEA 3UKDA 3NH6A 1KI9A 2RGXA 1EX7A 3WMEA 4PHGA 1SVWA 3LY5A 2V6JA 4Q7MB 5TY0A 1NJFA 5KSPA 1YKSA 2QT0A 2JLWA 1E2EA 2Y8EA 5DE3A 2ZVQX 1CJKC 1KZGB 3T12A 3HU2A 3CZQA 4NCHA 4KU4A 1KKLA 1A2KC 1Z6AA 4L5BA 5E95A 2QM7A 2QROA 4CW7A 1AK2A 1AS3A 1P60A 4XWAA 1UF9A 1FUKA 1JBKA 2BM1A 3GLHB 1G7SA 3OE7D 4LDJA 1Q21A 1QHHA 4GOKA 4JL5A 2WWHA 5CIWA 4AKIA 4QG7A 4QXAA 1EGAA 2F1JA 1M7GA 1WE2A 4L8GA 2YOFA 3THYB 1TUEA 2GVZC 4HAUA 2EFGA 2MMCA 2WAXA 1S4QA 1KK3A 1G6OA 1H65A 4DDVA 4HI0E 3WBKA 4X8OA 3QOFA 2IS6A 3QENA 1NN5A 4A2QA 2ZRJA 3EZ7A 3GEHA 2DFKB 1G5RA 1G8YA 3QEOA 1BS1A 1M1YE 4QGAA 2J5XA 4B44A 4TYNA 4M2LA 2YVUA 5J40A 2OESA 2PT7A 2QTFA 3FB4A 4EFNA 1S1CA 2B8TA 3EPKA 2F43B 4R2HA 4S35A 5KPDA 2HXYA 1SQ5A 4KXFB 3TBKA 1QRAA 3Q7PA 1E1RD 3UG6A 1G17A 3SFVA 3WYFA 2R65A 2IYQA 1GKIA 1JALA 2VLIA 4QBFA 5G3YA 1GL7A 2WKQA 4YXWA 2Z4RA 1GKYA 4RZXA 3S1AB 1E9CA 2D2EA 5CITA 1CULC 4XVUA 1XJ0A 1YZNA 5DSZA 4HDCA 4LHZA 3LLMA 3HWSA 4PO1A 4JZKA 5FPYA 2DWQA 4IDNA 4LJ7A 3A4NA 4K81B 4Q19A 2D06A 1YZGA 1RFLA 2KI5A 2WOOA 3IQXA 4MH0R 2ZJ8A 3FVQA 4Q7LA 4B2PA 2D7CA 1U90A 1W4AA 3KQUA 3RRNA 4Q4LA 2GTPA 3PQCA 4JSTA 5BN3A 2UVQA 2YOGA 3HR8A 1IN7A 2H17A 1JQLB 3FHOA 3QXSA 3VU9A 3WBJA 1BMFA 3SYNA 3UG7A 1NMZA 2FSGA 1RVDA 1R2QA 1QVRA 4PPGA 1PLLA 1ZBDA 3VKHA 4C4PA 3O8BA 4HB2A 3X1YA 3GLGA 4Z51A 1PLJA 4FMCB 3U4QA 1SULA 3SHFA 1EK0A 1VCOA 4OKSA 3AEZA 2P5SA 3EWAA 1IM2A 1NIJA 1E2GA 4QBHA 1XBTA 4R71A 2N46A 2J3EA 2YV5A 5EUMA 5JEEA 3REGA 2ODWA 5AR1A 1N6HA 2G3YA 3NXSA 2V9PA 3KXLA 2GAOA 4DLRA 1UDXA 1P62B 3AVXA 4CYMA 2HDNB 4RSGA 4ASUD 1Z8FA 2QPOA 1R10A 2ZAOA 4D81A 1RYFA 2QP9X 4D82A 2C2HA 4B3GA 5DHFA 1OF1A 1FFHA 4JJZA 4CEHB 2C9OA 1W4BA 2O8BB 1ZAKA 2G77B 2N1BA 4DBLC 2P65A 2ANCA 2GZHA 3WRYC 4MGYR 2OZEA 3GLGE 3WNBA 1MR3F 4B71A 4BEJA 2GILA 1OSNA 1QHXA 1CJTC 2AXPA 1UM8A 2IW3A 1Z6YA 4FMDB 5FR1A 1YR7A 1W47A 2R44A 2C77A 4PZLA 2YOHA 4QJ5A 1E2HA 4V02A 3OEHA 1DG1G 4B33A 2F7SA 1YZQA 2FWRA 2OBLA 4P4UA 4FI3C 3ZIAA 1U94A 1JR6A 2QMHA 3CR7A 4MKGA 3OIVA 5BQ5A 1IY0A 3LX5A 3CRVA 2NGRA 4M1TA 1PUJA 3FOZA 2W6ID 3P32A 5LD2B 5FPSA 1VIAA 4PC7A 2ZYWX 2HUPA 2JA1A 5C46F 3BIFA 4GP7A 4NL4H 1E9RA 1HT1E 3FPAA 1ELOA 1Y3AA 4DB2A 2RKOA 4R2IA 2H1LA 4JVMA 5CK5A 1F48A 1CRQA 2A7QA 2KJQA 1TQDA 4GZMA 1XTJA 3AF1A 3GJ5A 1VDZA 4EFMA 3ETLA 5IDVA 2GXQA 1NKSA 1W1WA 2V8OA 2VPPA 4I1UA 4MITA 2B8WA 1UEJA 3MRSA 5SZKB 1E1QA 3OESA 4O3MA 1NMYA 4Q9LA 1MT0A 1N2CE 3IBGA 3IIMA 3K0AA 3GLIB 3JVVA 1JEDA 1TPZA 3D31A 1TEXA 2FPLA 4ON9A 2CLSA 2W2VA 5HE8A 1IHUA 5JECA 3EC1A 3LXRA 4P3YA 3WMGA 4JLAA 3G82C 4LBZA 1VYVA 4LJAA 5E7IA 2DBYA 3TSZA 1Q12A 3NDPA 1UKZA 4BLPA 1II8A 3A4MA 3FE2A 4KYIB 1OLOA 2QNRA 1NF3A 2A9KA 1GRNA 5CDFA 4HLDA 4UXJA 2EU8A 5TDHA 3B60A 2ZRHA 4M1YA 1KHTA 3W3ZB 4A0GA 2WIAA 5CB6A 3THWA 1X8LA 4URWR 5HZHA 2RGNC 1XCMA 2W0SA 2IHBA 5C4GB 1YRBA 2CL0X 3SJAA 3R20A 1VG0B 4Z1MA 1DTSA 1TQ6A 2H57A 1R7RA 2GCNA 4DEYA 3ZZ0A 4D4JA 2LKDA 2GA8A 1ZRHA 1QBKC 4H1VA 2ZSDA 3GD7A 3FHCB 4QC2A 2XJ4A 4KFRA 3TQCA 1VMAA 2FEMA 1Z07A 1XNJA 1XF9A 3RWOA 5BN5A 1E32A 1CLUA 5HCIA 4XVRA 3DZDA 3TAHA 1K5DA 2ZUCA 3ASZA 2XOKA 2JAQA 3C4JA 2BWJA 4OHVA 2VP4A 1E0SA 3UK6A 3SNHA 5CDFE 4D2IA 5JWOA 4NYJQ 3ADDA 1KI2A 1XEFA 4WOPA 4QBIA 1DE0A 1F2UA 1GILA 2W83A 2I3BA 3K0FB 3RS2A 4PZZA 2P6UA 1G21E 5F98A 3QVUA 2G83A 4LPKA 1E96A 3ADBA 5CLQA 1R0XA 1CJUC 2VO1A 3ND8A 2LWIA 1E98A 2BVNA 1CR0A 3W5IA 5H68A 1OFUX 2AR7A 3OF5A 2C04A 3RANA 1VG1A 4DSOA 3ZVNA 1UBGA 1D9ZA 2JDID 4GMXA 1CP2A 1YZKA 2D4HA 1X3SA 3KJGA 3AVOA 3QE0A 1PJRA 2IYVA 3SBEA 4B48A 4AY2A 1FW6A 1KDOA 3GQBA 2G0TA 3K09C 4L4UA 1Z2AA 3KFXA 3ZZUA 3QBTA 1RZ3A 1VYUA 4WVFA 1UKYA 1TF2A 1K8RA 3BK7A 5BXQC 5JLJA 4TQ9A 3QXXA 4P4SB 2XGJA 3C14C 5FOVA 4C3ZA 3DMNA 3TSOA 2J1LA 3PVSA 2IXFA 4LOAA 4XH9B 1T5LA 1CEEA 3PENA 1Z08A 2FN4A 3MJRA 4NYIR 3FKQA 3TW8B 3B8HA 1TF5A 3CPHA 2RAPA 1GITA 4M1MA 5FOUA 2F9MA 1E69A 3ZZTA 4DC9A 3SJZA 5HKKA 3E5HA 2FV8A 3BD9A 1R0WA 4TWZA 2ZRNA 4FMBB 4ACAA 1GVNB 1WF3A 3AKYA 3T1TA 3DEFA 1JI0A 3RNLA 5DN6D 1Z0FA 3ZLJA 3BFXA 4OK3A 1ZNYA 4TL6A 1OFHA 4RFSB 4LY6A 1NG9A 4OI0A 2X2FA 3CX7A 1RYHA 5TXGA 2CCJA 5JZVA 4L9WA 4BFUA 2WHXA 1EFRD 1ZCAA 2IHYA 3QBVA 1CJVC 3OIWA 4AYXA 1NLZA 3RS7A 2AFHE 4OQMA 4A1FA 5KPJA 2YHSA 5EE3A 1WP9A 4MGKR 4PPNA 2YWFA 1OFIA 2QPTA 3RABA 5A4JA 2O8DB 2LCFA 3EX7C 4G5GA 4PO8A 1IN8A 4ARZB 2NO6A 4H1UA 3U4QB 2EVWX 1MABB 3W6PA 1YR9A 2E87A 3FMFA 1JJ7A 2ZXUA 2VEDA 5EP4A 3TUIC 3X1XA 3HYTA 5TB5A 2NMVA 4LJ6A 1OXXK 3VNVA 1H8EA 2ZANA 2ZSAA 1OXUA 3L2OB 1DO0A 2F1IA 4UNQA 4JLOA 3TRFA 1J90A 4AKHA 4ZCLA 4F93B 4LK2A 3HPRA 4UJ3A 1XMSA 3QG5A 2QP4A 2DB3A 2EQBA 2FFBA 3BJIC 4NCKA 2H7VA 2CE7A 2VP9A 2O52A 4C0HA 2IYTA 1MO5A 1GUAA 2GJSA 1Z0IA 3HR7A 3VKGA 1N6OA 2GWHA 4A6XA 4B73A 1GOTA 2VL7A 4DUGD 1X8JA 3EARA 3NBFA 5JRJA 3W90A 1P6XA 4TYYA 2Q9CA 3SZRA 3CW2A 3KKQA 2WM9B 1VHTA 4DLWA 4UNSA 1E2JA 1OYYA 2IUTA 2OV2A 3D8BA 1IQPA 5FUXA 4IDOA 2ATXA 1W48A 4LJ5A 1Q3TA 3K09A 4BUJA 2NZ8A 3KKMA 3RS3A 2X19A 3FGNA 3QJYA 3I73A 2H16A 4JKYA 1R0ZA 1XEWY 4TYPA 1K5GA 1N6RA 5SZHB 3GLHA 4LBYA 4WW0A 4QGHA 5FUWA 2HCJB 1D8TA 3NBZC 4PSKA 4BGDA 4NU0A 5KDDA 1NBMA 3EAQA 4UNRA 5F3WB 4PZYA 4HLQB 5C18A 3THYA 3TR0A 3CPJB 1E9AA 1S3SA 3WHLA 4Q4JA 1HURA 4U02A 2R8RA 1RKBA 1L2TA 3JVUA 3FKSA 4GT1A 1ZNXA 3LFUA 4PO9A 3V4FA 4CEIA 4Q18A 4YMTA 2EFEB 1W0JD 4BPBA 3IEVA 3QI2A 3K0AB 3VAAA 1ZIOA 3W9YA 1XJCA 4QNRA 4LYHA 2AK2A 4QJ3A 2CVHA 2CK3A 1G8PA 3A1TA 1BYUA 1G7TA 4GNKA 2F43A 2REBA 3LA6A 5BN4A 2C9YA 1NBME 2HT6A 4TLCA 3DOFA 4Q9HA 5CM9C 1X1SA 1SXJD 4LX0A 5SZIA 1BOFA 2DWOA 4LHVA 2GXAA 4LI0A 4EPWA 1IAQA 4MUAA 2F1RA 2F3TA 2FG5A 3QXJA 2ZRMA 4LJYA 5KOYA 4A0RA 3MWYW 2R2AA 2GCOA 3BGWA 5BW8A 3S1AA 1YJ5A 2CHGA 1ZM4A 4DIDA 4WA7A 3ZYCA 4RD4A 2ZRAA 1ZM2A 2V7QA 5D3QA 4L9SA 3W5JA 4KCGA 2CEAA 4D4LA 1Z0AA 2PEYA 3W8RA 1IONA 1JEEA 4A15A 2ZRBA 4A6PA 5DYGA 2XZPA 1CBUA 4FD2A 3R9XA 4QL3A 1HUQA 4LBWA 4DCUA 1OFTA 3B5JA 1KGDA 1HA3A 3GEIA 4DDTA 2QE7D 3ZVLA 1JXMA 3TLXA 1Q20A 1IJFA 4LUCA 4KLZA 4KLNA 4CT4B 1OB5A 2V6IA 1YR6A 1Q3HA 2WMNB 1LV7A 1KDTA 2XXAB 1F2UB 3CF6R 2YWHA 2P67A 1E2MA 4KVAA 3PUVA 2HLDD 3Q8XB 2BM0A 4G5SA 1AGRA 1KSJA 3BXZA 2WSMA 4IVRA 1TUIA 3AF0A 4A9AA 4GOXA 1U99A 1S1MA 2XEXA 2EYQA 4WZBE 3IEUA 4OHXA 4IFEA 1A4RA 3DM9B 3IILA 1G3QA 3W34A 5J4YA 4ZCMA 1NKTA 3WYAA 3IIJA 3RC3A 2OBMA 2R6FA 4W5JA 1SVLA 4UNNA 4NONA 3PV0A 2FMXA 1DAKA 3CX8A 3PUYA 2MSEB 2O8BA 1E2QA 2P6RA 4CEHA 4P32A 5EUQB 2EYUA 2FJUA 2ZJ2A 3OFNA 4M21A 1B23P 4QHTA 1W4RA 3LX8A 4NYMR 2Q6TA 3GJ0A 2ZAMA 3ECCA 4QNMA 5BYKA 1LS1A 4B3BA 2QM8A 3U3RA 3KB1A 1J2JA 1QF9A 1D6JA 4LHWA 1SGWA 3U44B 3R9IA 1P3JA 1G18A 4TMZA 5ANRB 4C7OB 4BZXA 2OILA 3RRZA 2PCJA 3OEED 4RZ3A 3BBPA 1T9HA 3EZ2A 3GFOA 3SHWA 2KWIA 2ODEA 5IHPA 1COWA 1ZD8A 3H84A 4E22A 4XD7A 2PLRA 4B43A 2AFIE 2BBOA 1OKKD 1E79A 2IEZA 5JJKA 2AKAB 3VHLB 1U0HC 3AVUA 4A8JC 1SKYE 1ZU4A 3AKEA 3B9PA 2C98A 4RD6A 1W49A 5GADl 3UWKA 2OBNA 3K1JA 4PAQA 3KFVA 1DVRA 4TYWA 4TT3A 5LBIA 5EE5B 1D2MA 1N0UA 1AM4D 1R4AA 2ERYA 3OZXA 4UXHA 1I4DD 1ZUIA 2WICA 3SEAA 4HLUC 5GJWC 5EP3A 2ZIAA 4URXR 2O8EB 4ZI3A 2JLYA 2WWWA 4PSVA 3A6PC 2ZRLA 1FX0A 2JLVA 4Q9KA 1YU9A 2V54A 3A1UA 1DG3A 2QU8A 4KV9A 3DKPA 4QRHA 4DHEA 5HR5A 5KSYA 3NBYC 1YQTA 4GBMA 2J45A 2XSZA 2PT5A 4NCJA 3NEJA 4EPXA 3BB1A 3GJ8A 4PX9A 2HXSA 4JL6A 5DGXA 2MSCB 4S2EA 3CB4A 2A5FA 1NVVR 3JZMA 4W5WA 5FUYA 2P6NA 3EPLA 4RZ2A 2FSIA 2QQ0A 3LBNA 2J0UA 2ZETA 3U3JA 5L3QA 1MKYA 1P72A 2GJ9A 2H8KA 1G5TA 2ZUBA 4MUBA 2FOLA 3CR8A 1UDWA 3KQNA 4II7A 5FOTA 2DCUA 4MDEA 5JMTA 3I92A 1WBBA 2FFAA 4OK5A 4P4TA 1NJGA 2ZRDA 4GRAA 4E09A 5FOWA 4CEJA 3LH5A 4PSAA 1VCIA 2AXNA 1Q1ZA 5TV2A 3AKDA 4A0HA 2OLKA 2Z5FA 1RRGA 2C99A 1DELA 3TQFA 3K70B 1E6CA 3T5DA 1U8YA 3K0FA 4BQSA 1ETUA 3M6AA 4PFSA 1KTVA 1TNDA 2BEJA 3HYRA 4F4JA 4A92A 4CT5A 1ZD9A 4OQLA 2QGNA 2QRZA 4O0MA 1NSTA 2KB0A 5ELXA 4A2PA 1N5KA 2XNDA 4LYAA 4C0LA 3L0PA 2CHVA 4DLVA 4XTCS 3U3KA 5LB2A 4Q4JB 4F38A 3BC1A 2QSZA 3Q9LA 4HLCA 2XB2A 1M2OB 3U5ZB 2W58A 4CEIB 3EW9A 3T1QA 3QKSA 4Q47A 3N2IA 4NDZA 2FGJA 3KJEA 4D6PA 1E0JA 1E2DA 3FMIA 1MRNA 4YXWD 5LDDC 3KQHA 2CLDX 4AIIA 5BYJA 2FPKA 5FBLB 1X6VA 2ANBA 4IEIA 3AVTA 2IUUA 1ZNWA 2WWFA 4A36A 1OH8A 2WV9A 5F9HA 4DIEA 3EZFA 4P4SA 1UKVY 4TYQA 4PQRA 4A8JA 3CO5A 2DFNA 5EXTA 1UAAA 2BCGY 4MRVA 4C0BA 1ODFA 2FE4A 1TQ4A 3PUWA 3REFA 1CF4A 1E2FA 1J8MF 2IBMA 3OE7A 1G9XA 2GCOB 1G41A 3T06B 3TGPA 3QG1A 1ZC4A 1I2MA 3CIOA 2QPAA 1A1VA 4OI1A 4EJSC 4KVGA 4HLUA 1F5NA 1BMFD 4BECA 2ZYUX 3HU3A 2VA8A 5UKDA 4BFXA 4YONB 2VP6A 4RFVA 4NTZA 2CMKA 4RCYA 1U8AA 1T5IA 1P75A 1RRFA 4XJXA 3QXCA 4RFSA 4EDHA 1V43A 2XX3A 3GCGA 4O2RA 3QEJA 4DCSA 2WBLC 4DB4A 1C1YA 3VNUA 5FPTA 1JXOA 4E07A 2PH1A 1MRSA 3O8DA 5CJPA 2VSFA 3B2EA 2P5TB 4FWTA 1HY3A 4YLGA 4Q48A 4B3FX 2IA5A 5H70A 2O8DA 1VKJA 1AZTA 4NCIA 4ZKDA 1SZPA 1E4VA 2V4ZA 2PZGA 2JATA 4HUQA 4ARZA 3AM1A 1MABA 3PIRA 2FEOA 1ZJ6A 4MGIR 1CR4A 1NP6A 1NVVQ 2AKYA 3RS4A 4BFSA 4EPVA 4V0MA 1E9BA 3M4YA 3WP0A 2V1XA 2CL7X 5L3SA 4TLEA 2ZUDA 4NHOA 2HF8A 4FCVA 2ZRPA 2ZR0A 4MRNA 3X1ZA 1S3GA 3HJNA 2X2EA 3BAFA 1RC8A 1OH6A 3FMOB 3HU1A 3X1WA 1LFDB 1XMJA 5CB8A 2BIFA 1Z22A 1Z0DA 1NN1A 1TX4B 2QAGB 4HAZA 1NVUQ 1E2PA 5FI1B 3J81k 3MG9A 2GVDC 3AP1A 4URYR 5EQTA 3W6NA 1N25A 1KJYA 4W7SA 1IN6A 4MQBA 3LQRA 3SYKA 1SKYB 2A78A 2WKPA 3BRWD 2SHKA 1MOZA 3L0OA 3E2IA 4IVPA 2KE5A 4JT4A 4V0ME 3CPEA 4PTLA 3ZVMA 4DLXA 2QI9C 3KUDA 3F5FA 3CF2A 5DI9A 2ONJA 4YMVA 3RYTC 1LNZA 4KJZA 1GAJA 2IYXA 2OCAA 2J41A 3NIBA 4GMDA 2TMKA 1QG2A 4TLAA 4JYBA 2QQEA 3U61B 2FPMA 1E1QD 5CYOA 2RGBA 1OPXA 2GJKA 5TARA 3MAAC 4D4MA 5FR2A 1U98A 3TH5A 2G1KA 2BC9A 1ESNA 2QEQA 2CCGA 2CNWA 2R9VA 4ASUA 1NY5A 4TMXA 1UPTA 1T3SA 2WWIA 2CJWA 1N6NA 4LSGA 5HTKA 3NKVA 2OHFA 3SOPA 4M8NE 2W6JA 3K9GA 1M34E 4JMPA 1D2NA 1T0HB 4DLTA 3I32A 1NG1A 1ZM7A 4EJSA 4JSYA 4XWOA 2F3RA 2ZI7A 3CBQA 4L16A 3KKOA 2Q0HA 4DCVA 3C8UA 1Q1QA 1R8SA 1M6NA 4P0TA 3ZQJA 2OFOA 1NN0A 2XAUA 1G8HA 2YWGA 3ASYA 1ZVQA 4UXIA 1B0UA 5C2JB 5EJEA 4WBSA 4I1SA 2AD5A 3N70A 4X8LA 5KUTA 1NN3A 3QPUA 3SR0A 2IYYA 1FX0B 3SYLA 4Q03A 1IN5A 3U6KA 4OQNA 2G9NA 2WWYA 4BLTA 2X1VA 5HPYB 1M7HA 1N3BA 2QL6A 2WOJA 3BH6A 3EZ6A 5FPKA 3AVPA 4POAA 1WBDA 1I2DA 4RJLA 4IOJA 5E4FA 2AL7A 2J0UB 3WRXC 2GEUA 5L3QB 1AN0A 1G8GA 1PUIA 3R7WA 2VHCA 2Z6VA 1DOAA 2VH5R 4PHHA 8OHMA 2IYRA 5DH9A 2GEDA 1Z63A 2ZJBA 2ZYTX 4PAMA 3BOSA 4ZDKA 4CZ2A 4Q7KA 2OM2A 3H4MA 3CWQA 3HPQA 2IX3A 4CEJB 5G53C 1KJZA 5TMPA 1E94E 2QT1A 4KYUA 2FSHA 5B30A 1RRCA 1A5TA 2FSFA 4BFTA 2B7CA 2XXAA 5BWMA 2Q9AA 4Q5IA 4TMKA 5JI2E 5JSZA 1U9IC 4DRZA 3TNFA 4TQUS 4Y0VA 2BKEA 4ESHA 2GBLC 4IJMA 2J59A 2BEKA 2ZU0C 3DL0A 3ZVRA 4TSFA 4DCNA 5JRZA 3PUXA 3E1SA 3RLFA 1KI1A 1IY2A 1N6KA 2ZJOA 3QPVA 3SJCA 2ZJYA 1NVXQ 1E2LA 3QQ5A 3QKSB 3QKRB 1XX6A 2ZE6A 3A1WA 1P73A 1V5WA 2GXSA 2W00A 1JR3A 3BH7A 3FFAA 4FCTA 4BLSA 3U3MA 1IXSB 1XU4A 3B1VA 4D4KA 4YMUA 3K70C 1KO7A 1VTKA 1R8QA 1L7VC 1ZD1A 4G5OA 5EP1A 4JLJA 4FXPA 2PL3A 4CDGA 1GNQA 1NLYA 4A8JB 4RD2A 4TMWA 5CIQA 4EPYA 1FP6A 1T8UA 3VX4A 5J47A 4NBSA 3ZH9B 1XEXB 3E70C 1W36C 2ZR9A 2GXUA 4ZDWA 2GESA 1G20E 4URZR 3L82B 1MO6A 3OAAD 3H1TA 3QVVA 2J0VA 3IDQA 3EXAA 3NEYA 4M1SA 1P7CA 4BASA 4AYWA 4CIDA 1E9SA 3D3QA 3U44A 3G0HA 4C7OA 3PEYA 1O87A 1R5NA 1JR3E 5K8UA 2FZ4A 4OJKA 1Y63A 2FF7A 4QGFA 1Q1EA 1KJWA 5K8TA 3EC2A 1P9RA 5AUNB 2AHOA 2EWWA 1SVIA 2BJWA 4RD3A 3K9HA 1WA5A 4A82A 1SHKA 4YMWA 3AUYA 4Z54A 1UEIA 4N1AA 4Q9IA 2HCBA 3LVQE 3F0TA 3PFIA 5IK2A 4N0EA 4EQ6A 6Q21A 1OJLA 1HT2E 3SBDA 1H8ED 3MMPA 1KY3A 2RGNA 1G291 4HYYA 2IF2A 1P2VA 2WSSD 2ERXA 2ZYVX 3C5CA 4NKRA 3A1VA 5H1YA 4B3CA 3U60B 4CGZA 2YC4C 3C7KA 4ERNA 3CZPA 1VCNA 3UXMA 1S9HA 4HUQB 2G88A 2ZSEA 3WNCA 1Z28A 4B2LA 4GPTA 1N0WA 4EKDA 4BLQA 5KTYA 1HE1C 2VIIA 4F92B 3I4LA 4KO8A 2O8EA 2GF0A 3KUCA 3I5YA 4BFWA 3KXKA 1PVOA 2JJ2D 2BMDA 1UBFA 5L3SB 3X2SA 1P2UA 1TQ2A 4R9UC 1FL9A 2RGCA 2X8AA 1T6NA 2VTKA 421PA 2HJVA 3R9WA 3TJZA 1S96A 1W5SA 3KZ1E 4M1OA 1CXZA 4YDHB 3SC3A 2BMJA 4DLZA 1U9IA 2PZEA 2HV8A 1LS6A 1XTIA 2O8CA 3P4XA 2GBLA 3SJBA 2IL1A 4I99A 3FTQA 1E2NA 2OXRA 1ZIPA 5EE1A 2C03A 5FH9A 1KDPA 1ZNZA 2ZRGA 2JLUA 3U7EB 2BBSA 1OW3B 2IWRA 3L8ZA 1FQKA 3AGPA 4H9GA 1SXJC 2DFTA 2UZIR 1FMJA 1G1MA 4C0JA 5FTKA 4NP6A 1QHSA 3PJRA 2YNMA 1QHGA 2YWEA 5FTJA 2XJ9A 1RRPA 2FDCA 3T15A 2D3WA 5AUPB 2GK6A 1FZQA 1N0VC 3N2EA 4AKEA 4TTPA 5FUVA 5DLQC 2GJAA 2K5UA 1CS4C 2IYSA 2OUKA 3NHAA 2F1HA 3FKSD 1F3OA 1BH2A 4JLBA 1XD8A 1FP7A 1QDEA 5EZ6B 5FL7A 3VR3A 1HQYE 1A82A 1DO2A 3F8TA 1YHNA 4US2R 2CK3D 3VR5A 4C0AC 5JHGB 2QAGC 4BLRA 1RIFA 4KFTA 2CJWB 5J4VA 1P9WA 2DR3A 2FA9A 2QSYA 2ZI5A 2QTHA 1W5TA 4HEJA 2GCPA 4O2LA 4F4IA 4HAXA 3UPUA 2PJZA 5JBQA 1G3RA 4WAUA 3IHLA 4EJSB 4MYUA 2RH5A 1CIPA 1KK0A 1OHHA 2G1JA 2QA5A 4NYIQ 2UZ3A 2W2TA 1XTQA 2NOAA 5EE0A 4DLUA 3MD0A 1W7AA 1P2SA 4JLNA 3TE6A 3BH0A 1XB2A 4KSBA 1IY1A 2QZ4A 2ODNA 5FTNA 2FGKA 4LJ9A 1TU3A 3MSXA 4NMMA 4F91B 1RPZA 5JWHA 1E0AA 1VG9B 2PMKA 3ZD7A 3TAUA 3B6EA 2A5DA 1E4YA 3LBIA 1US8B 3MWJA 4ZIRB 4NCNA 4CF7A 2R6DA 4RKEA 2BHRA 3MWLA 4V0LA 4W5HA 1W44A 1X8KA 2ODBA 4UKDA 1J70A 3TK1A 4AD8A 4GDFA 2EFDB 3R7WB 4HB3A 4URVR 2KSQA 2RMKA 3AB3A 4M0LA 4TMTA 4Q00A 2ZRCA 1VHLA 1BIFA 2J7PA 3B78A 5KSOA 3ZJYA 1G3IA 4IDPA 1DAGA 1H8HA 3U2QA 4B75A 1BYIA 1FNMA 4FW9A 3RRYA 3M0EA 3GP8A 1OYWA 2JIZA 4RD1A 4UJ5A 4LYFA 2G0NA 1KZ7B 1HQCA 1G64A 1Z6GA 3CNOA 1JECA 1DAIA 3CRRA 4JBYA 4WZ6A 4PC6A 2CDNA 4PXAA 5FFMA 5JS8A 4I81A 2ORIA 2QORA 4E5UA 3VTKA 2PJRA 3FHTA 4B74A 5FBRB 4G5QA 3TUZC 3KJHA 3ZD6A 1SHZA 5JSZB 4WZAE 5K8IA 2WPDA 1DAMA 3A37A 4BFZA 4KAXA 1BKDR 1M74A 3QUSA 1SXJA 4ZI2A 2ZU6A 2IK8A 2ORVA 5C4MA 2P0EA 5JWRA 4LJ4A 4IOKA 1OB2A 4LYJA 2VF8A 1R6BX 2P3SA 2NZJA 2O8FB 2JCSA 3OFND 4XTRA 3EIHA 1XWIA 3RC8A 1XZPA 4IKEA 1AKYA 4NPHA 3H0KA
chains in the Genus database with same CATH superfamily
2TMDA 3DTYA 3NFYA 5KDLA 5FUMA 3I9FA 4GI2A 3DZHA 2P7IA 2W4QA 1XJQA 4G0UA 1G3MA 1Z26A 2B78A 1M8GA 1MH9A 3SOZA 3W0LB 3OFKA 4XJVA 1OVMA 3N75A 4LQLA 5B57C 1W8DA 3N2GB 5EUCA 4MUHA 1NLFA 3UHFA 1KZYC 3D6TB 2ERCA 5AWFC 3D7NA 1OV4A 2V7VA 1L5LA 4CRWB 4CG3A 2WLSA 4MTLA 3SU8A 3WYDA 1SXJE 5HQTA 3HADA 1VECA 3VH3A 5A4DA 3QIVA 3DDNA 3U19A 1N2ZA 2ZWPA 3OE1A 4UEJA 1BWRA 3WDSA 4O33A 4EUEA 5KO2A 5BURA 4K26A 1IRXA 2B37A 2FWMX 2ZB7A 4AROA 4EPRA 1V4VA 4Z99A 1COWD 1EP2B 3AJEA 1DS6A 3DLHA 1UBCA 1W96A 3SZGA 1YBHA 3R6DA 1RMTA 4MYTA 1KIMA 2HM7A 4RIGA 4Y6RA 5ARBA 3JAKA 2DT8A 3SF8B 3UAVA 3TNDA 3VSCA 1NR5A 4EI7A 1IMOA 1J0CA 1MXFA 1D2HA 1U0SY 3CXRA 2MSLA 1Y8RB 3A36A 5FB3A 3S2GA 2FKNA 4P58A 2J6CA 4C0KA 5A9SA 2AN1A 1SC4A 4Q1BA 3TVDA 2FQWA 3V8RA 5IKMA 5K8VA 1SCQA 1GL9B 3UBTA 1Y6RA 1VJGA 3WHKA 1E9FA 3EEQA 2C4VA 1EXMA 3U9TA 2FPGA 4RF5A 4BVAA 4JDPA 5MFZA 1M0TA 4C7VA 2RARA 3DPSA 1CZKA 3V80A 2G7ZA 4HMQA 1M5RA 2WAYA 4FKZA 4DJAA 2H1FA 3EIEA 3NX4A 4IXWA 2JCYA 1A7KA 1CUCA 1RDFA 1XRQA 2P79A 2WMOB 5TS2A 3D7SA 2VHQA 2YIVX 2I4OA 2JJYA 4C30A 4EQ6B 1XQ6A 2QGZA 3BWDD 3I83A 4R1QA 4CPDA 5KWIA 1XAHA 4PQGA 3AF4A 4J0IA 4MR7B 1KDRA 3PYLA 4E32A 1Y7PA 2DQZA 4B3DA 3FOEC 5JFGA 3HO8A 3PR3A 4KN9S 3V8MA 5JJBA 3UTCA 4CM9D 3CBGA 3BL5A 4BNLA 5J2UA 2XMRA 2A1TS 2HXGA 4N3GA 4CR6A 4N7BA 3FCOA 1QH9A 3L6OO 4AWXA 1T3TA 3VISA 1LKZA 2IXEA 2OFPA 2AUTA 3DMGA 3EYWA 3MTQA 2JFVA 1JQJC 1XO1A 2W93A 1JHMA 1CNFA 4R2XA 4ZQIA 5ILOA 2RGRA 1K8ZB 3AVWA 4WOCA 2GK4A 3KVRA 2O2JA 1VPEA 1Y8QA 2BN4A 1SVSA 4TWIA 3KR0A 5JSUA 1J4AA 4F6LA 1TO6A 5EKDA 4FEAA 5CEJA 2W5UA 3JQGB 1YS6A 2GNOA 4R1NA 4RY2A 2EZ8A 4MYCA 4QTYA 5C7YA 1NVWQ 3I72A 3W2IA 5BVGA 4RMGA 5F9FA 2C0PA 1BU5A 1U4NA 3QTTA 2H07A 3W6UA 4BBJA 4URHA 1G16A 2FWNA 2GEVA 1CF9A 3QRWA 2O8CB 2FFHA 2ZSKA 2ECKA 4DHWA 2PY6A 3CUEF 2QRMA 1C7IA 4N3NA 4RLHA 2AJTA 4RWEA 2BCJQ 2QUAA 4MYRA 2JJ1A 3NVDA 4RL6A 2FRDC 4G89A 5T3UA 3RF6A 2G1AA 3WYCA 1V8PA 1X1RA 3AR4A 3FFBA 1H42A 3QVWA 4ZVSA 1W9MA 3QBJA 4WLEA 3TL6A 4XWWA 3I9LA 4RDXA 2LV8A 2MINA 3I53A 4ZYUA 4GLFA 4OHYA 3UJBA 1ULZA 4HNTA 3V4VB 3H1GA 1JHUA 2NG1A 2XITA 4HC4A 2FVXA 3RV3A 4UBNA 3LNCA 2WFLB 4E5NA 1MW8X 4LJKA 2QW0X 5BR7A 4XA8A 1XOIA 2GJ8A 3ISTA 1LVUA 3UFBA 1ZOIA 3LCUA 1RYBA 2A5JA 1U7DA 1KMIY 3ORHA 1K86A 4KXWA 3USZA 4OJQA 3RADC 2DUNA 3CGGA 1Q14A 3G5UA 4DG8A 2ZSJA 3JSXA 3BS4A 1OFVA 3HN2A 3H9GA 3LC7O 4CKBA 3IEIA 3SI7A 5SICE 1MFZA 3PHBE 3DM5A 1Y6JA 1CJMA 3VNBA 5AW5A 3UK2A 4CIVA 3L0IB 1I0IA 3THOA 5KJFA 5C7IO 3UT0A 1MQAA 2ZKLA 3T1VA 3X1JA 1GIAA 4R98A 1Q0ZA 1GPJA 1XMVA 3AI7A 3DTVA 5D1NA 1N8KA 3IBYA 4CN9A 1CHDA 1XLWA 3IUMA 3DOJA 3R8FA 5KUTA 2YYAA 3NB0A 4L08A 4BMXA 3Q12A 5K0JA 3HMKA 4QFCA 3S29A 1IHDA 5GAJA 2XWQA 3PGJA 2RCNA 2RHDA 4X62B 2MT9A 3R3ZA 1GTJ1 3HCNA 2IS1A 4OQYA 5ALYA 4INJA 4KXMA 4LQDA 4Q4AB 4DMRA 1ZMBA 1P19A 2XTAA 3KPJA 4HO1X 4KR7A 1H2HA 1I7PA 5M34A 1PZXA 1N6LA 3MT9A 3OP1A 1HFEL 1X7ZB 3HFRA 2FU5C 1LJLA 5GQSA 4US1R 3A6DA 1Z37A 2O59A 1U7UA 1E9EA 1N1DA 5KTTA 3DAPA 3HKDA 1NLMA 4D8VA 5FNVA 4QDXA 1DJQA 1DC8A 2D4AA 5D3MB 3U3XA 3T3OA 4B8ZA 1AQUA 3ECSA 1IIBA 3QSGA 4FHZA 2Z43A 5JDCC 1UDCA 1JJFA 2LDBA 2A67A 4LNAA 5ER6A 1D0IA 1FTGA 2P27A 3EWSA 1N1EA 5JH7F 2KBFA 3KQVA 1YMVA 4II3A 1FSPA 4PYLA 1PGJA 1TL7C 1CU1A 4JVSB 1IUPA 2WT9A 1JR4A 3FSEA 4ER7A 1CP3A 1O4WA 3NBKA 5EJ4A 4P9NA 5HE9A 1NUAA 1IXZA 3GLSA 3C6XA 1NBHA 2OG2A 1VL2A 2UKDA 1OZAA 1Q0PA 3A1SA 4FN5A 4BWGA 3K1YA 3KIPA 4AG6A 3HKCA 4WLFA 2OZLB 3IV9A 3O93A 2BGUA 3MTDA 2J5BA 3CONA 3C1TA 1W581 3N3BC 1IXRC 1CF2O 1DRWA 1QQTA 1VG8A 5AQEA 4RDIA 3I62A 4IVQA 3EEFA 2FLVA 1H0RA 2FPSA 5GJBA 3ZLTA 3FAKA 5T3YA 4JI8B 5CLLA 2HI0A 1QFMA 2JI8A 3C3JA 3EJ6A 3CZ9A 4FHFA 2ST1A 1UK6A 5P21A 3STYA 2BGRA 3Q8KA 2XB4A 1V3QE 1ABBA 1YOVA 3EN0A 3PX2A 5HP4A 4MEJA 3EMKA 4BN0A 1R88A 1HT0A 2OCIA 3FDIA 2P0YA 5E7JA 1YR8A 2OLJA 1QR2A 1SVKA 2W6ZA 1NWHA 5DYIA 4G4SO 2WJ4A 2WMDA 2YIDA 2LKCA 1FMLA 1KYZA 1NBAA 1YIOA 2JFQA 1W88A 4PPFA 4WA8A 1KZ4A 4NBKA 3S2YA 1IWBB 1K4MA 1UFVA 3TAXA 4BO9A 1O5IA 2FSVA 4N0DA 4E51A 1G0OA 3H1FA 5G2OA 2UU9B 1K6MA 2JRCA 3LA8A 4EB6B 5C8YB 2B3TA 1IEQA 1KAOA 3OPYA 1ZCBA 2WJGA 1MX5A 1K63A 3Q2IA 3FRHA 3KXIA 3EGWA 1T4BA 4HQ6A 1E1MA 4HX2A 2WF9A 5FHRA 4KDEA 4KQKA 4ZZIA 2AOVA 1TF7A 2QN6A 3OSZA 4MV1A 5LQNA 1U0JA 4MV6A 1I3KA 2V5VA 3EXEA 4JQCA 1ONBA 5H3LA 3VU0A 2W6PA 4K86A 2NVBA 1PBNA 1YONA 1PJBA 3L9XA 3LPDA 2QZSA 2VYND 1A4IA 4F9TA 1GV0A 2OAQ1 3NTUA 4U9UA 1VP3A 4O5AA 3AETA 3DA8A 3AUJB 1FYFA 4JLVA 5AUQA 1M33A 1T8WA 3IHWA 1I3LA 1FDOA 2JH3A 2VRWA 2I3GA 5HW0A 3EPRA 1KKUA 4Y2YA 1PR5A 1JHQA 3P27A 4JJAA 2QBYB 2WIDA 3EWIA 2YKGA 1EVLA 3A9VA 3DT9A 2QD1A 2BEVA 2W70A 2QN2A 1N7JA 1BSVA 1QSGA 2VPWA 3PSHA 2IYUA 2VI5A 2CFSA 1UKEA 2W8BA 4KQ6A 4XYEA 3SLKA 1QR6A 1RS0A 3HXPA 3HRHA 4TV8A 3D4BA 3RS0A 4XYLA 4MPRA 3U09A 3K0SA 4Z7NB 1F6BA 1ZIXA 3JATA 4R3WA 2FZLA 3C4QA 2R6R1 2WDPA 1A27A 4RTNA 2ZYIA 1QRDA 3FZYA 4NBNA 1I4TD 5KOIA 1SY7A 3QX3A 821PA 4PRYA 1ZK3A 1ZYUA 1G2IA 2D62A 1IEXA 1V3TA 1O6CA 3DHEA 3ENZA 3IE2A 4IDBA 5EYPB 5IDXA 1FUUA 4HDSA 2BHSA 4NC9A 2JFUA 4GR9A 1Y1LA 4HRVA 4HVAA 2F67A 4ZARA 5IABA 3W8NA 3WLNA 2CMFA 4YROA 4CF5A 2XBLA 1YOBA 1SCIA 3FMPB 3K0CA 4ZALA 4KOEC 1TYEB 1OX4A 1QWSA 3Q7RA 3RAEC 3U4CA 1TADA 1YQEA 4DV2B 1RXUA 2PMDA 1ZSYA 3K0EA 4NH0A 4QDOA 4PX5A 1ZEMA 3ILSA 2QUHA 4U9IS 4Y1GA 2Z58A 5I9NA 4MIOA 5IRCD 1M7BA 1LRLA 3PS9A 3HUUA 3IQDB 1LZLA 2BFAA 2CBXA 2XAAA 4V0KA 3VO1A 1WMAA 4DDWA 2IYWA 3UEOA 2AJDA 3P96A 1GV1A 2E89A 1ZK2A 4JIMA 3A0RB 3L6RA 3GXOA 3JTEA 4MUKA 2XXBA 3NHBA 3F7TA 4Q1DA 4TT8A 1QHIA 2WJ6A 1QYCA 3D43A 4JKOA 4RMJA 1O8CA 3DDZX 4XLLA 2W2LA 3LK7A 4NFHA 3LUPA 4F6RB 3BKXA 3DKKA 5EINA 1BMQA 3KYDB 4S1WA 3BQMB 1NNI1 1SWVA 4ZV9A 2WAAA 2O54A 3T9BA 1WG8A 3MILA 1H4SA 4GI1A 3S7TA 3NYIA 2O7SA 3G7SA 4JP5A 4D0GA 1QVAA 1C4OA 3OOHA 5C35A 3E15A 3B9QA 5L4LA 2GKSA 4M9ZA 2ECFA 2QRJA 4BUCA 3UJ8A 4YV2A 4QXPA 1WXDA 4PYJA 4AVYA 1G4AE 2ZJ5A 4J2HA 3OCCA 4PLVA 1E20A 4IUDS 1MA3A 1FRFS 4ZT3A 5TQJA 2FOIA 4XVCA 5MN6A 4QXOA 3BB3A 1EDOA 1C0LA 3BTOA 2BGLA 5GWXA 2FG7C 3HBJA 1JX6A 1N5JA 4LOJA 1UOPA 1MQ8B 2YMPA 8MHTA 3REQB 2E4VA 1IUNA 1FOEB 2F9FA 2JGDB 1JB9A 4MLPA 2IJGX 2ATEA 4G23A 3RUCA 1NM5C 3PNLA 1YRQA 4ZU1X 3V7YA 4LXUA 4BYMA 5LCXA 4HFNA 3RFXA 3TTTA 1PEKE 3ONWA 4GQBA 2J8ZA 4KFUA 1JB1A 1NBWB 3NH9A 5G0WA 4YWJA 3R7BA 3ZV5A 1OH7A 2Q0XA 2OEPA 4IVNA 2W2NA 1QO9A 2Z3VA 4ZXPA 4BEVA 1U7PA 1GU7A 1M2HA 1M1YB 2Z0MA 3H04A 1NTRA 3OJ0A 4RS4A 5KX5F 2OP0A 4S0XA 4J90A 3AONB 1CUYA 1YRAA 3U3ZA 3X0DA 4B87A 4DVJA 2W71A 4NE9A 2VP0A 3IUQA 4MLZA 3AY6A 4DV1B 4BO1A 1MV5A 4GFDA 3WBBA 2ASEA 1HEIA 2AC2A 3U4MA 4NICA 1OQAA 2XRZA 1T3ZA 2I03A 2B6NA 2B7BA 2MJLA 4DWOA 5KHOC 1KK2A 1J0EA 3PXGA 1QORA 1Z5ZA 2CBZA 4YY3B 1ODIA 3C3BA 3MJHA 1PLKA 2H7YA 3M89A 4OM7A 1N75A 4BCBA 1DIAA 1NA5A 2OV4A 4EGCB 2C97A 1OXTA 2PZMA 3JALA 1DC3A 2C84A 3GRVA 3M2PA 3KJIA 4ZOLF 2OVFA 1NC3A 4E5UA 3DR5A 2DH5A 1U8TA 2J3JA 3KTAB 3KT6A 3GZJA 3KCQA 2JB9A 1O5TA 2OE2A 5EJ2A 2HA2A 4LKOA 1TU4A 3CWZA 4DGSA 2EAUA 3E9RA 4XGRA 2RHOA 1LC3A 3ZIUA 1NVBA 1KMQA 4GLBA 2ZJAA 5TQVA 4K6GA 2PTHA 2Z9BA 3H1AA 3FOCA 4TXJA 5JLAA 3TXAA 2B36A 3BHJA 3HQ4O 4DQ0A 4FGZA 4EB3A 2GZAA 3WZ2A 5FWXB 5E6SB 3LE8A 4AK9A 3WYGA 5HZKA 2DEUA 1WVIA 3ROQA 3NWBA 1XTBA 2EP8A 3ZGXA 2B4KA 2AWOA 2BONA 2NT3A 3GOHA 5LBUA 2G6TA 1L4KA 4KDCA 1HYGA 2H92A 1UQRA 5AM4A 3GLFE 1G2PA 3V1TC 2W98A 5EJAA 5SY6A 4CE6A 1WRBA 4LDQA 1CD5A 4CL3A 3CX6A 3NCHA 4D9HA 2G67A 1N6IA 2Y1DA 5D2CA 3OIUA 3ZE2B 5BP7A 1IN4A 5CLFA 3KB2A 2VDUE 4M1KA 2B21A 2WJ3A 1VKHA 4P3PA 4QRIA 3M3PA 2D8AA 4KAFA 4TYMA 1BQ3A 3IAS1 2AYXA 4P84A 3DKIA 1I36A 1Z3IX 2WTNA 1YE8A 3MWDB 1MC5A 4DJEC 4YUYA 3D0RA 3VQTA 1EX6A 3ZWYA 2I7TA 3G8DA 4RMNA 3LO5A 1KP2A 1L8XA 4YQFA 2R6CA 2RAUA 3DAFA 4Q4CA 4J0FA 2H0RA 3JQGA 4RZSA 3WKDA 1YI0A 2H7XA 3IQWA 2F3UA 1ORWA 2KHZA 4LFBB 3EQZA 1C9JA 5FLKA 4DLPA 1KYXA 4HNUA 1DAFA 1XALA 5H83A 5FO0A 5CNKA 5JSKA 3GLGB 3VX3A 5CEEA 4QJBA 1I3MA 2ZTMA 4ARVA 2HHLA 2PXAA 4LZZA 4OGKA 1CK4A 4ZOCA 5ES3A 5C34B 1NRXA 3HFSA 4F5ZA 2L2QA 3IALA 4UHBA 2BGKA 2GZ3A 5LMCA 4V0NA 3K70D 2QRUA 3HXLA 2OYRA 1U11A 1Z5PA 5AOCA 5IANA 2ATIA 1E6KA 2IF0A 2X9GA 3GT0A 3H11A 5EKTA 1CQZA 3QX9A 5FAXA 4UEQA 1CKEA 3DE4X 4RHCA 4IFBA 1DTEA 1SOVA 1TCBA 4M89A 1Z45A 1UBEA 1QGZA 4E5DA 3TW4A 2ZJ0A 4EYQA 1SD1A 4XYGA 4Y8VA 4X0EA 2JLQA 2D8MA 3Q1KA 5IM5A 1Q1GA 3OPYI 2BJVA 2VHTA 2WFLA 1HE3A 1E5TA 4QFMA 1OGJA 2GO7A 3CSDA 2WJWA 3HUTA 3MD9A 4DQDA 5LPNA 1RBMA 5EMKA 3TINA 1OHHD 1Z5VA 5IT5A 4E4YA 1MGPA 2JJ2A 3RHFA 1MVOA 3UK0A 4B3XA 1Z12A 4HCJA 1NBIA 3CCBA 3LY9A 1H0HA 4MW9A 3WKCA 3FCEA 3QITA 3E7WA 4L4XA 3P9YA 1TKBA 1TK2A 1OA1A 3ZH2A 2IDZA 1IPHA 3TDNA 3I1FA 3WP1B 1TRHA 3WLQA 1O6ZA 1N33B 2HD4A 4ZICA 3N9IA 2DR2A 4BLOA 3NT5A 3KJXA 2EKZA 4Z4FA 3KXPA 1U3GA 2G04A 1GL3A 1PN3A 2VBIA 3IQFA 1IY9A 1GYRA 4IHJF 4JN6B 3PGA1 2XE8A 1KP3A 4EZBA 3Q7QA 4G1UC 1NW7A 4OGWA 4H0NA 3C3MA 4XFKA 5MDHA 5FBVB 4OXNA 1TMOA 4HTAA 5FRDA 3SQDA 2H31A 2NPFA 4TKVB 5JI3E 2LR0A 5KWJA 2IP1A 1QFZA 2IUSA 4R9VA 1YB7A 4Q4AA 1ABFA 1QPGA 2O0LA 4HH0A 4X8HA 2XTZA 3DYIA 1S02A 1AK9A 3QXHA 3T52A 3VZBA 3K73O 4ZK2A 5JNTA 2OUIA 4IJQA 3AHHA 2O23A 3CUVA 2RHGB 3UUFA 1BG6A 4Q6WA 5T5QA 3OZWA 1R0KA 1TEVA 1Q44A 1WB9A 4C5BA 3OF2A 4XRGA 1QHNA 2BGMA 2C78A 5DM0A 1RWQA 4Q3OA 1YCDA 2J7PD 2Q1WA 3I9KA 3GFTA 4FBGA 3B1XA 4FIDA 4GLOA 4JC8A 4LC1A 5D3MA 2C94A 3HA2A 3AR7A 4ZPXA 5EJMA 1JHVA 1NQOA 3GRRA 2IODA 1B0PA 1PK8A 5DI3B 1FK8A 1T1JA 1GPNA 3TEFA 2JIZD 4QU9A 4AF6A 4DKXA 3FNQA 1FY2A 5C5CA 1EM6A 1E61A 1FTSA 1SC1A 1W5AA 1EFCA 1GLGA 2VXYA 4J7AA 4MUJA 1KYYA 1PL7A 4XWYA 3ZEAA 1Z7WA 4PR3A 3WAGA 1K6IA 1H5QA 3O8OA 3AIIA 2JIDA 3GP5A 2ZPTX 4Z5XA 1Z7GA 3O4JA 3GK3A 5BUQA 3ESZA 1QLWA 4RD0A 3FYUB 3Q0EA 3A9UA 5GONB 3P9RA 5DCUA 3H4VA 4N9QA 4R0VA 1NVEA 3ILHA 2J46A 1W0JA 2OZLA 2ZTVA 3R23A 4GECA 4QQ8A 1RNLA 3EXFB 4WY8A 4NOKA 5EZSA 5DULA 4B6PA 4RA9B 4TKMA 4XLZA 3AWDA 3C87A 1MT3A 1USVA 5IT9A 5AHKA 2REOA 3WHPA 3WLAA 4OOEA 1DRUA 2HMTA 3ZCTA 5A5GA 2VTBB 4RJJA 1GT91 3K6RA 1TA9A 2R11A 2SNIE 1BMDA 4ZQCB 1EFPB 1UC5B 5K0FA 2CCKA 3K16A 1JDJA 3RJZA 4QO8A 3VR1A 3WMFA 3KSBC 2O2ZA 1F60A 3ED5A 4QYXA 3QHAA 1Z2OX 1L5SA 8ADHA 2QVLA 3UOGA 3K6SB 3I42A 1EVIA 2WWTA 3H9UA 1IZYA 2IY8A 1K0UA 3MJFA 1BWSA 4ND1A 3LT2A 4Z8XA 3ZJ5A 4C06A 5D6OA 4GYJA 4EW3A 1D9XA 2M32A 3AUXA 2FB9A 3INRA 1PEAA 3EISA 3DMHA 2H2DA 3IJPA 1YB2A 3KQKA 2RJOA 5F35A 3T9AA 1UH5A 2XMBA 3RHSA 4REQB 3AKZA 4UEKA 1FPQA 2DE0X 3IMFA 1YZ3A 2NU7B 3OZIA 3D6MA 4MK4A 4LS3A 5DISB 1FZTA 4IDQA 3ANYB 2NO9A 4HQFA 5EZ5A 4Y3UA 1N8TA 3RGGA 4S1NA 2P9JA 4TQAA 5KNDD 1B6SA 4NXNB 4N47A 1N36B 5HZGA 5DLPA 1T8TA 3BREA 2O0JA 3SKXA 2QRGA 4O5OA 1CY6A 1A04A 2X6QA 5CD1A 3ZHQA 3WL4A 3CNLA 5AXDA 4R1PA 4TTQA 3ZHYA 3EPJA 1CRPA 1DBIA 4HV4A 4KPYA 3E8MA 3UYKA 1FLDA 4NZOA 3WLRA 4PLPA 3B5EA 3OE5A 2PGJA 1T91A 3ONEA 3RFVA 1X42A 2QLJA 3FBWA 3MCZA 1BNCA 1IJEA 2I8LA 2JEYA 1GZSA 3JQFA 2BFBB 4H60A 3A6ZA 3EDQA 4I1VA 4C08A 3ZUGA 1TMKA 1Z4KA 1G5PA 2ZRFA 3E81A 3OU2A 3TMAA 3GQBB 1DINA 1WM1A 2I55A 1KI3A 2XRYA 2C8LA 1JVBA 1GZ5A 3NHUA 1KH3A 3RYHA 2Z2IA 1T5HX 3LPNA 4R4JA 5AH0A 3T35A 4F4FA 1XROA 2OTCA 3LCCA 3H2ZA 2R85A 2X0IA 3L49A 4S12A 3ZU6A 1E3SA 1ISFA 2UV8A 5B1DA 4MI9A 2IIQA 3CVOA 4CM1A 2PXXA 3GJ7A 1XPUA 1D2EA 4BDSA 1KRHA 3L43A 4BTEA 1QVWA 2YWRA 5AESA 4KBGA 2VSXA 4MKIA 1AJEA 1EDZA 4A2WA 2GFQA 1EEHA 3H2SA 3LXXA 5KINB 3DBOB 1E60A 4MEBA 2ZTSA 2HMAA 3PGXA 4HRAA 4MWTA 1ZI6A 3HFJA 1Z9BA 5AJZA 3UJPA 1RWMA 1DWPA 1AO3A 1VLJA 1ZY2A 2KLBA 3OU7A 4N48A 1CLEA 1JHZA 1RLOA 2ODQA 2DKNA 2C5FA 4FS8A 5EYPA 1JRLA 3SC6A 1EAMA 2XOEA 4FSHA 4QXMA 3RU2A 5EWLB 1DC6A 4AMVA 1MEJA 4EY6A 2OO7A 1T2EA 4WOBA 4ER3A 1XMOB 2HA7A 4GKBA 3R6GA 3BGSA 3NR2A 5K8CA 1HTBA 2OC9A 2V9CA 1OT5A 4ROSA 2B4YA 4L51A 1LBEA 2HEIA 3LRPA 2CLEB 5KU1A 2Q0QA 1ZMXA 2C9CA 5ALRA 3OZTA 1HFJA 2RGYA 3DKRA 1ECLA 3L8YA 9MHTA 3TKAA 4J6FA 1WL8A 4YBZA 1DFHA 5CA0F 3LAWA 5IAOA 1Q19A 3UZUA 1KEZA 3DJYA 5FOXA 1OIXA 4ZHQF 4KXYA 2C8VA 5CK4A 4Q21A 2ETVA 5DCWA 3RWMB 1ZJWA 3N2KA 3PEEA 1JW9B 4L72A 9LDTA 1MG0A 5IULC 1RRKA 2V6BA 3H2YA 2LW7A 1NJ6A 2C7RA 2ZEJA 3C8HA 5T4FA 3SSNA 5ALTA 5TS3A 3RQIA 2C2WA 3LW8A 3I01A 3QKTA 2PZ8A 3WYBA 1WCWA 2PLAA 3GPIA 4YRRA 4ESEA 3GLIA 4LFAB 4B81A 2M6SA 1GPYA 4IEFB 3WK6A 1TVEA 5BMOA 3U1VA 3STWA 5ERGB 1OKKA 1J7JA 4ZZ2A 1PR1A 5FV4A 2IXBA 4PFKA 4EFKA 5FEMA 3OTOB 1RMYA 3KYDA 4KR9A 2EZTA 5EGSA 1J99A 1QE5A 1PW7A 2FPRA 2VYVA 1RXSA 3UMCA 1HE4A 1U7WA 3D1JA 1JPVA 5ALVA 3DFKA 5IBRA 4YV1A 2PXHA 4JLKA 2GZRA 4LSWA 4G8CA 1H6DA 1I6WA 1WSWA 4H6VA 4WOJA 3FNGA 4JCOA 3QQPA 4GZLA 2XNDD 4DOMA 3IDFA 2J07A 3EIQA 3LPMA 1RM4A 1G42A 4AKSA 4B0PA 4GSYA 1I0LA 1WV1A 4HQLA 5THXA 2C95A 5M04A 1OWMA 2RK4A 3FUCA 3X1MA 1DAEA 5M3BA 3A28A 1KI9A 2Q1XA 3H2JA 4UATA 4IJKA 1SAYA 4PHGA 1A9ZA 1COZA 1NVFA 2V6JA 1DDGA 2GD6A 3IDAA 1E64A 3KV1A 4YHBA 3OOEA 1NJFA 3RVQA 1W1UA 2FW6A 4M8IA 3PNVA 4NNOA 3REQA 3TR6A 1YKSA 4F4HA 5B6PA 3D2CA 2VZ9A 3O4GA 1RWOA 1DCMA 2ZVQX 1B0ZA 1CJKC 3W7BA 4BMZA 1TJPB 3BCRA 3H5VA 4JVOA 1UL1X 1DBWA 2ZRQA 3CZQA 4UUMA 4FLEA 5JS8A 2L82A 3HB1A 2HPVA 2XQVA 3E35A 3PJEA 1GNTA 3KB6A 3KE9A 4CW7A 5HYVA 1M1YA 2XYHA 1AK2A 1AS3A 2NX2A 1ADFA 3IP9A 4GOND 1YV9A 4O4LB 1GDHA 4ZCQA 3GLHB 4YO7A 5FKJA 3Q88A 4MV8A 1XCOA 2O1WA 2W48A 4G24A 4GOKA 5FEUA 2B30A 2XMZA 3RBAA 1Z0ZA 3L93A 3KQMA 6NULA 1EGAA 2F1JA 3IAM1 4IHAA 2OENG 3TFQA 2ACKA 5B1IA 3UC5A 5F64A 4OV6B 3UB3A 5EVJA 1CG6A 3ER8A 4XFJA 2XA2A 4CMBA 2MMCA 1ONNA 5ALZA 1MEEA 2UUOA 1J09A 1CIVA 2QYHA 3HB9A 1H65A 1OXMA 3C97A 4HI0E 4WL0A 4X8OA 5DT2A 1NN5A 1SBCA 2ZRJA 1PWXA 1SUEA 4X20B 1INLA 4BX8A 1G8YA 1FFWA 1QZUA 3B1FA 5DF1A 3WG9A 4HWSA 3PQDA 1BU8A 5AM0A 4KREA 5DBHX 1WMEA 3VOSA 1XKTA 5BSFA 3ZZMA 1CZNA 1NI5A 1X74A 1Y1KE 3EZGA 2O07A 2B8TA 3FB4A 4HXFB 3RTCA 1DLIA 3O38A 4I8DA 4R2HA 3VR6D 3TGWA 1XIVA 3V1LA 1YDWA 4F60A 4DUZB 3EG9B 2CL5A 4R8VA 1M1ZA 3ZW9A 1GCAA 4N39A 4QBFA 5E6SA 3BHNA 2QW8A 5G3YA 1DLJA 2HJHA 4H31A 4UHCA 5B58T 2XMPA 4CU2A 4L0DA 1XDWA 1GKYA 4LMBA 5EQJB 2IHNA 1E9CA 1T4MA 1RXWA 5DSZA 1SK8A 4CR7A 4JT8A 5KKAA 1GPWB 5FPYA 5GIPE 3MJVA 1ZKDA 3G2PA 3UV7A 1O03A 2EBFX 3TQTA 3QTLA 4I6EA 3WB9A 5CFZA 2OHVA 4EKYA 1K7FB 4YJKA 2Z6QA 1OI4A 3H6KA 4MWGA 2P0AA 4MX8A 1X39A 4KH0A 2CFTA 1U90A 3NFRA 1VP9A 2HN9A 3MWDA 3AJ8A 3R7FA 5BRJA 4Q4LA 3QUAA 3D3NA 2P4UA 2YOGA 5C5IA 3WO0A 3I9OA 1JQLB 4WY2A 2CUTA 2I2FA 5A4KA 4EYGA 3WBJA 1BMFA 1RZRD 4KB5A 2ZB3A 4GXTA 1QVRA 3VKHA 3HCDA 3HBNA 4G2NA 3T41A 4HB2A 2BMAA 4B46A 3SXPA 4YPVA 1DC7A 3GLGA 3DVQX 3SIPA 5HRCA 2XPCA 1SULA 5FWNA 5IJ9B 3U4QA 2CV0A 5IT4A 1VCOA 3RFUA 4CJXA 2P5SA 1XDZA 2ZCVA 3ZWVA 2B4TO 1PSWA 1IM2A 2ZYHA 1FA9A 3NKLA 1I1QB 3WSWA 1XBTA 2ZUEA 3LUBA 3ZCSA 3FF4A 4L4ZA 1TE2A 2J3EA 2P40A 4HWRA 5EUMA 2OBFA 3U0BA 2G72A 1QK3A 1Z17A 1N6HA 1IWOA 1Z5UA 1X1EA 4IAOA 4LEIA 4BVLA 4M7OA 4G8JA 4UEOA 2GAOA 5K3DA 2WNHA 2R60A 4OB8A 3TCXB 1X1QA 4HEA6 4RSGA 1YJAA 4F6CA 3KWJA 3OG9A 2ZAOA 3L05A 1P7WA 4D81A 5DHFA 1PX0A 2C9OA 4KK3A 2C5GA 3V7FA 3F1KA 3T99A 4XPIB 1I7DA 2P65A 5K0ZA 2C4NA 2GZHA 2YVLA 2VK4A 1WUKS 2GILA 2X1LA 4BEJA 3WWZA 1VI6A 3VNAA 4IF4A 5KWVA 4FMDB 1FYVA 1JUDA 2DFDA 2C3MA 1WW3A 5CCDA 4YTEA 3V7NA 3QVXA 1DG1G 1E3DA 3U9LA 4ZRMA 1V7ZA 1A8QA 1ULUA 1C2TA 2PPLA 1YZQA 1TA0A 1ZO8A 2FX2A 2FWRA 2PWBA 3PDIB 4FYVA 5EWMA 1KVQA 2QL7A 2QMHA 3JWJA 4NVRA 2XMDA 4MKGA 5SY4A 5ESDA 4FOPA 4MDYA 2K4MA 4G84A 3ND5A 3LX5A 3VTZA 2OB1A 4M1TA 4BB6A 2OV6A 4EMBA 2VDWB 5LD2B 3E7XA 3EHDA 3IT1A 1Y80A 4PC7A 3SCZA 4TKVA 2B83A 5C46F 2Q5IA 1QFXA 4GP7A 5JUWA 2XKAA 3VNSA 4ZAYA 2GAJA 4G5YA 1ELOA 4KUGA 5IMBA 3WLPA 2RKOA 1VGQA 4F8JA 2NV6A 3DHVA 3F47A 1CRQA 4KXXA 4RZIA 1GGJA 2KJQA 5BT9A 3ZE0B 3AINA 5I9IA 3REOA 2FKAA 5JZBA 2VPPA 4MITA 4I1UA 4YREA 4MUYA 4TTTS 4BEWA 2AOTB 5SZKB 4DREA 1E1QA 3OESA 4AULA 1NMYA 1AKMA 4Q9LA 1N2CE 3IIMA 2HK6A 3IBGA 3OZBA 3QKIA 5JNWA 5IZ4A 3OJWA 4GOOD 3JVVA 2W2PA 1U8UA 1TPZA 3D31A 1EBUA 1TEXA 3DHYA 4JOQA 4ON9A 4P4GA 4M0FA 8GPBA 3Q7IA 4F3TA 5DP1A 3HHEA 3PVCA 1BMTA 5CFNA 3P2YA 1XNHA 5AHXA 2XNJA 5LKAA 2C1XA 4MWBA 5E7IA 3VKVA 4PLCA 4MGHA 2VN8A 4BLPA 2JFOA 3A4MA 3FYUA 2F3SA 4PSCA 2HU2A 2A9KA 5CDFA 1U6KA 2G82A 1JV2B 2JI9A 2PMCA 2VAMA 1X7WB 4HLDA 1R1DA 3MCUA 4CKCB 2ZRHA 1TU0A 3LYAA 3PQEA 1DMRA 2JNWA 2X41A 4RA9A 3WGYA 5HQ3B 3SBXA 5DNAA 4URWR 1XCMA 2J4FA 2W0SA 2FG6C 3NNDA 3PHJA 1NVKA 3N7TA 2C92A 4IKPA 4PGMA 3GGOA 2H57A 4DEYA 3R5HA 4WDQA 5JY6A 3ZZ0A 1JSCA 3SG0A 5BMVB 3B70A 1X3LA 2GA8A 4H1VA 4BO3A 3IB6A 2UZ4A 1ADYA 4BY9E 3OCZA 1TO2E 2NSJA 5DEIA 5BN5A 1O2DA 2C5AA 1JKJB 3WAKA 2IE0A 4JJEA 4D3ZA 3RAJA 2NZYA 3GRYA 1T6YA 4W63A 5B7NA 2BWJA 4ZREA 1WSDA 2P90A 1E0SA 3SNHA 3ERCA 4D2IA 3UWSA 4UBIA 3GCZA 5B1SA 1XEFA 5EC8A 4WOPA 4MI6A 4BQFA 3ITNA 1DE0A 1JKIA 1WEHA 2NU7A 2I3BA 3WRYA 1YJXA 4E31A 4EF4A 2C2OA 3GHHA 1NW8A 2P6UA 3U39A 3ZUPA 4AQYB 3UJAA 2H00A 4GX0A 4LPKA 1A97A 4RC9A 3TZBA 2Z8XA 3M6XA 2ETXA 5AKEA 3IA7A 2QTRA 2CYCA 1SIUA 2R6HA 1N57A 3L3BA 4M0PA 3W5IA 5H68A 4DWVA 3M6UA 2IIPA 5T7BA 3OF5A 3LT0A 1XA3A 3G88A 1I14A 2C04A 1VG1A 3A10A 1JLSA 4FYWA 4TVOA 4FYYA 2CLFB 2JFHA 3L4EA 3OTHA 2O5CA 4GMXA 2D0PB 1JU4A 4YP7A 4MV5A 1CP2A 5IASA 3KJGA 3OJEA 2C2MA 1FVFA 5T4HA 1OU4A 1DT5A 2XHEA 1K66A 3COZA 4EW1A 1BE0A 4AS3A 2FR8A 3RUEA 3GQBA 2G0TA 4LZAA 1L0BA 3KFXA 2X0EA 3F4BA 1RZ3A 1VYUA 3CF4A 4WVFA 1DNPA 1E3IA 1TF2A 3A1EA 3F4KA 3VJMA 2H4WA 5JLJA 5HTOA 2JVIA 4R5MA 4I08A 4KMSA 2V0NA 1K7EB 5IKPA 1WB4A 3TSOA 2FPXA 5DM70 2IXFA 3BA1A 3DV0B 4MAMA 2FRVA 2N75A 1Q91A 4E15A 4NYIR 1H69A 1JZQA 4G1EB 3MMXA 3TJMA 1SCAA 4FOSA 1TF5A 3EGDB 1TFRA 4YCJA 2D7JA 1XRMA 1PEYA 2F9MA 4YT2A 2BR3A 4O1MA 5DYTA 4YASA 5AXAA 5LOVF 1HE2A 1WZIA 2FP4B 4YRTA 2GERA 1EUCB 4MKRA 4TWZA 4BB9A 5EWLA 1EX9A 5IWAB 4CV0A 3P2EA 4ACAA 5BV1A 1BJTA 4DCCA 1JLKA 3DEFA 1UAYA 4NFSA 2ZG6A 4HAIA 5C7LO 3U7QA 2W6OA 1AHIA 3R44A 3MWEA 4WLUA 4X3PA 3WZMA 1YKFA 3N39C 4LF5B 4OI0A 2X2FA 1B14A 4LVNA 4P22A 1PNRA 1ULSA 3S2ZA 3WGNA 3NDRA 1HGXA 2H0AA 1EWYA 2AJ8A 3VDQA 1EFRD 1ZGBA 2IHYA 2JJQA 4QTTB 4MROA 3W1WA 3OIWA 4G0QA 3WB1A 1O1YA 3RS7A 5DWVA 3JWEA 3URMA 2GTHA 1XLVA 3CEPB 3A7DA 4MGKR 4MKXA 2YWFA 4TUYF 4WNAA 5A4JA 2EEZA 2ZT7A 1F17A 4DJFC 1P4GA 2DGDA 1ONSA 2GSDA 2NO6A 1OX6A