1QHXA

Chloramphenicol phosphotransferase in complex with atp from streptomyces venezuelae
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
178
structure length
178
Chain Sequence
b'MTTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQSAEGGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLDVLWVGVRCDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTHKESIECAWAIAAHVVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CHLORAMPHENICOL PHOSPHOTRANSFERASE)
molecule tags Transferase
publication title The Crystal Structures of Chloramphenicol Phosphotransferase Reveal a Novel Inactivation Mechanism
pubmed doi rcsb
total genus 61
structure length 178
sequence length 178
ec nomenclature ec 2.7.1.-:
pdb deposition date 1999-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07931 CPT Chloramphenicol phosphotransferase-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1qhxA00
2QPTA 1R0XA 5CIQA 3GD7A 4CW7A 2C2HA 3CR7A 1RFLA 4JBXA 4KCGA 3KFXA 2C9CA 5DIFA 1E9RA 3A4NA 2AWNA 2R65A 3R20A 5B64A 2P6NA 2C78A 2FEOA 1RJ9A 4KFUA 2IHBA 3GLFA 1T8UA 3HPQA 4GPTA 4BQSA 3RWOA 3SBEA 4JL6A 3OIWA 2JJ1D 1GG2A 3AB3A 1OLOA 1P2VA 4DLYA 4IDPA 3UIEA 1U81A 4LGMA 1MV5A 1QF9A 3B78A 2A3RA 3X2SA 1F2TA 4O2RA 4RD0A 4TQAA 3QG1A 3QXJA 4DUGA 4XH9B 1G7TA 2GHIA 4D4MA 4V0MA 2B8WA 2OCBA 4OHXA 2A5JA 4UXIA 1EX7A 1CR0A 3DL0A 4B35A 3VKGA 2J59A 3SI7A 4NDZA 4V0ME 2OBNA 4CYMA 1SVLA 2CVHA 2QL6A 1N5KA 4MYCA 1NBMD 4XD7A 5FR1A 4MGYR 1AZTA 4WVFA 2ANCA 3NWJA 4DDUA 5KDLA 3QF7A 3WYAA 5FOVA 1Z3IX 4TYWA 3D6TB 1AIPA 4GP6A 2ZRDA 3LBIA 3JZMA 4GI7A 3AF0A 4QG7A 5DO9A 2P2LA 3U2QA 1KSJA 4MITA 3EX7C 2QG6A 1TX4B 1LV7A 5JEDA 4ITRC 3ADDA 4TMZA 5DH9A 1XRJA 4LJAA 4JJZA 2WJYA 5EUQB 4Q1DA 2HXYA 3FHCB 4LC1A 4F4JA 4ZCIA 4FWIB 2HF9A 1NP6A 1OFTA 3UANA 5FBQB 5CM9C 3CH5A 1YU9A 2WICA 1XEXB 2VYFA 2W2TA 3CR8A 2C98A 2ZJ5A 1KSFX 3QPUA 3VR1A 3WNDA 3LA6A 4TYQA 4CGZA 2ZETA 4P4TA 2DYKA 4JVMA 1OYWA 3U4QA 4G5GA 3GJ3A 4DIEA 3G82C 3IDQA 4C0AC 1EWQA 1II0A 2ZR0A 4DLXA 5A0FA 2C9OA 3BD9A 4IDNA 4PANA 1Z83A 3BH6A 1OJLA 1UKYA 1IAQA 2V7QD 1A5TA 4OJKA 4PAMA 3B82A 3BH7A 3MD0A 1W1WA 1RYHA 2KSQA 2ZRHA 5CJPA 3TSZA 2YKGA 5EUMA 2JLVA 1AJEA 1XPUA 4PTLA 2XNSA 1GOTA 4LUCA 3I72A 2AXPA 1JEEA 1EFUA 5FL7D 1R8QA 3U3JA 3Q72A 4PHFA 1KKMA 4RFVA 4Z8YA 5CDFE 3T1OA 1Z0DA 2J5XA 3AVTA 3C15C 4KFRA 2IYUA 3VR4A 1XU4A 1U0HC 2WIAA 3BH0A 4YLGA 1G6HA 1R2QA 4HB2A 5IT5A 3P4XA 2IC5A 1NLYA 2OLJA 4PO9A 2PCLA 4FI3C 2QT0A 1IXSB 3GFTA 5HE9A 2R6DA 3UKDA 4JT4A 4PZYA 5L3VA 2FPKA 2J0VA 4WBSA 2CHQA 2JJ2A 1XX6A 3QQ5A 5FOTA 1US8A 4US1R 1E2LA 1HE1C 2FN4A 3BWDD 4LYAA 1CJKC 3LX5A 4FCVA 4G5QA 2WHXA 1T6NA 1GM5A 2QMEA 3WNBA 4Q01A 1CXZA 1YZUA 2B8TA 2E87A 2FFAA 4Q9KA 4B75A 1XXHE 3GJXC 4XWKA 1E1RD 2BOVA 3SE0A 1IOZA 2ZYTX 1NKTA 4W7SA 4FD2A 4URXR 1E2IA 1ZIPA 4P31A 2QAGB 3IHWA 4CEJB 1R5NA 3H1TA 1YKSA 4KLNA 4QGHA 4A82A 5EE9A 3SJCA 1CJUC 4FMDF 4DLWA 3KB1A 5J40A 1ZW6A 2WSSD 3HYTA 4V0NA 4C7OB 3TNFA 4XJXA 4M1OA 4GL2A 1E9CA 4CEJA 1VIAA 3LW7A 1M2OB 2H7VA 2JLWA 1RYFA 4TQUS 3TK1A 1A2BA 1RRCA 2ZVQX 4I1UA 2GNOA 4UNRA 1S2MA 4MDFA 3FHOA 4B48A 3CPHA 5SZHB 1Z2AA 4B6EA 3MJHA 4Q4AB 2F1IA 4TMTA 3LV8A 1YRAA 3A6PC 2IF2A 4TSFD 1VHLA 1AK2A 2C5LA 3IIJA 5GVSA 2HYIC 1Y3AA 5IRCD 3G5UA 3U3RA 1T8TA 4DSNA 1OPXA 2P6RA 4AY2A 1W36B 2OBLA 1TNDA 3KL4A 4QXAA 3P32A 1KYIA 5DISB 1FTSA 3MAAC 2VEDA 1KAGA 2ODEA 1KK0A 4FIDA 4Q4JA 1YR7A 1XXHB 2ZQ5A 3Q9LA 5LB2A 2C9YA 3BFXA 4NL4H 2MSCB 2W2VA 3S1AB 1ZBDA 4DCNA 4US2R 1KI6B 4G1UC 1WA5A 1OFIA 2QORA 1E94E 4L5BA 4D80A 3RSLA 2B7CA 2GF0A 1PJRA 3AP3A 1AQYA 1TUEA 1KMHA 2GK7A 4NCJA 3SS8A 2KB0A 4MKHA 1OIXA 1ZJ6A 1G7SA 2J7KA 2GEDA 5IK2A 2P3SA 4U7DA 5DI3B 5L3QA 2WJIA 4D4LA 4QOSA 4AKHA 1DEKA 1Z0IA 3W5IA 4O2LA 1IM2A 1MH1A 3AGPA 2J1LA 2OSBA 3SJAA 1CJTC 3GLGA 3GJ5A 2P0EA 4F91B 3FOZA 4PQYA 3SR0A 4JLVA 1ZD1A 2WWWA 4HDCA 1GUAA 1PV4A 2NO6A 4HAVA 2O8EB 4AD8A 2WWIA 4JVSB 5EJEA 1VYVA 4XVQA 1OYYA 3IEUA 4H9GA 1HYQA 2FA9A 1W0KA 2XEXA 1P2UA 3V4RA 4ASUD 2GCOA 2OILA 3VHXA 1KSHA 4LV5B 2ANBA 2ZAOA 4Q7KA 1LY1A 3S1AA 2ZTSA 4NCNA 2VSFA 1ZM4A 2QQ0A 4Q1BA 3LBHA 3PUVA 3RVBA 5K8UA 3QPVA 1G20E 2O5VA 2FFQA 3L2OB 1KK1A 3NBXX 1NF3A 1Q1QA 4QBFA 1DOAA 3OE7D 1WCV1 4O3MA 1Q3HA 1AS0A 2F3RA 2NMVA 4LHYA 2CJWA 1XJ0A 2XOKD 5TB5A 4IOJA 2GCOB 1XZPA 3LW8A 4Z8XA 1XEFA 1KO5A 1DPFA 2D3WA 4U5XA 2FU5C 3RWMB 1VG1A 2CL6X 4EFLA 3A8TA 3UG7A 3B1ZA 1OKKD 1KK3A 4TTPA 3SN6A 1R5OA 3C16C 3WYGA 1H8HD 1QG4A 1N0VC 1Z0AA 1SHKA 1GRRA 3R7WB 5B58C 3IIKA 2FSFA 4S35A 2X77A 2D74A 5HKKA 1HEIA 3EARA 4V0LA 3LY5A 2HLDA 121PA 2QAGA 1E9DA 3AUXA 5CLLA 4EPVA 3FHTA 4ZV4A 4A2QA 2V1UA 3RC3A 5DI3A 2KBEA 5JCPA 1JALA 3EPLA 1M1YE 2ZJOA 3UPUA 1DARA 2J46A 4DCSA 5HCIA 1WDTA 1NLFA 2GILA 2IUSA 3FMOB 4LDJA 3CM0A 2J0UA 3IIMA 4M9SA 3WP1B 1X6VA 2C77A 2ZANA 1J70A 3ZVRA 2W6JA 4HATA 2OE2A 2AD1A 4KO8A 2BC9A 2A5DA 3GCGA 2WKQA 3CH4B 3QKUA 2D7CA 3B5JA 2GJSA 3ZIAD 1NMYA 1G4AE 5FI0B 1G8PA 2H5EA 1KAOA 1XWIA 4DDTA 1NVWQ 2B21A 2BKUA 2QP9X 3FKSD 4IFBA 3AP1A 4Q7MB 4DRZA 1TEXA 1YQTA 4PSVA 1ZINA 1XEWX 1BH2A 4QHSA 2FEMA 1ZC3A 3AVUA 2GBLA 1P73A 2O8EA 3GLFE 1MR3F 2GK6A 4QJ3A 4NTZA 5A5GA 2F6RA 3T35A 3PXGA 3F8TA 2A5YB 3K0EA 1KO4A 4LCBA 3K9LA 3U6KA 1G8GA 2HYDA 4IOKA 2ZSAA 4MRPA 4A8JB 4C2UA 3K9GA 2OCAA 4RSGA 1X3SA 3RS3A 3TSOA 4EJSC 1ZNWA 1KMHB 3I4LA 3TGPA 2Q6TA 3EAQA 2GESA 4M21A 3EIQA 4DT1B 1HT2E 2VP4A 1E9AA 2HEIA 3WHLA 4RZ2A 2ZRLA 2ODWA 1E9EA 1P72A 1KTVA 1OFHA 2RGNC 4B3DA 1QRAA 5LBIA 5H8WA 1GIAA 2VHTA 3RS0A 3VR2A 2L0XA 3ZD6A 3LVQE 3OEHD 4A1FA 4TLAA 1N2CE 4GRAA 3A37A 1NL3A 2ZAMA 2O8DA 2WJGA 3W6NA 5TARA 1W36C 1COWA 1I4LD 3W6OA 3OESA 1Z47A 2NO1A 2FG5A 3AKDA 3AP2A 5EZ5A 4Q4HB 1YZLA 4CDGA 1WBBA 4G5RA 4Q7LA 5JS7A 4H1VA 2ZRPA 3M4YA 4HUTA 2HT6A 2RKOA 1Z0KA 1H8ED 5SZJA 1UEIA 4ZCMA 5G3YA 4M9XA 4R71A 1UKEA 3GLIE 4IEIA 1WQ1R 5G53C 4GP7A 5E7MA 1JAHA 2ZS7A 5E3HA 1FP6A 4IXNA 4PAQA 1G4UR 3I5YA 3H4MA 1W7AA 3CNLA 5FH9A 3BB1A 4DC9A 4DCUA 3A1WA 4YONB 3UXMA 1F5NA 4AKIA 1AGRA 1NIJA 1QHNA 1T3SA 4I4LA 4M1KA 4CEIA 1Z6AA 2C04A 3A1SA 2JASA 1LF5A 1DG1G 4P3YA 4C0QC 3U61B 3THYA 2JDIA 2IXFA 4PC3A 5E4FA 1D2MA 1N6NA 2VHCA 1DAMA 2IX3A 3JVUA 5FBWB 3EPHA 1ONBA 4B3FX 2CXXA 3ZJYA 1XTSA 3ZIAA 2HV8A 1F2TB 2E1RA 3C14C 5EXTA 4FMCF 2ZI6A 2WOOA 1NBMA 1E9FA 3BFVA 3FMFA 2QTFA 4TTRA 1IJEA 2WPDA 3SC3A 2ONJA 1GWNA 4FMDB 2V9PA 1Z63A 1TTTA 2QGZA 5DHFA 1L7VC 3B1XA 1ZM3A 5L3SA 2DWOA 3QEOA 1XTQA 4E5UA 1W0KD 3BRWD 4BLQA 3TUIC 1DAFA 4DUGD 4HSEA 4OJQA 5EXSA 5JWRA 1UAAA 3WBKA 5BQ5A 4X8OA 1EG7A 5DHAA 1J7KA 4KVGA 3PEWA 1QHHA 4HYYA 4FCTA 4MQBA 4GFDA 2WSMA 2WKPA 4ERNA 3EZ7A 3WXMA 4CT5A 2OCPA 4DB2A 2ECKA 3SDZA 1UADA 2LCFA 4Q00A 2DY1A 1Q20A 2D2FA 3NDBB 4BFSA 1N6PA 1CLUA 1OHHD 5F2EA 1Z22A 3HU1A 4E07A 4RCYA 4N0DA 5C18A 2IEYA 3IBGA 1BS1A 3AF4A 2GAAA 3GJ7A 3U44B 2H16A 2QMOA 4BFXA 5CITA 1OXTA 4N1AA 1XD2B 3BFKA 4JLNA 2CCKA 2OAP1 4JLAA 4NBSA 1BIFA 4FCWA 3MUFA 2NO7A 2D06A 2ZJBA 3AF1A 1VG9B 4BFYA 1W47A 1W49A 1NBME 3TVDA 1MO4A 3ZLJA 2G0TA 3CRQA 1P62B 1RRPA 3C41J 4AYTA 1UBEA 1OW3B 3ZQ6A 1PLKA 2EWVA 2QBYB 2YWGA 4JYCA 4EAQA 2ZE7A 3CF6R 3FVQA 1LTQA 2QTVB 3LAWA 4URWR 1DS6A 2XGJA 1RIFA 3GFOA 1UBFA 3RDPA 1YR6A 3FKQA 4TZ0A 1BYIA 1P9RA 2ZJZA 3W3AA 4TL7A 1AKYA 2ZREA 4EPXA 1NVUQ 3GEHA 2ZR7A 4LJ7A 4MUAA 4RD3A 5DI9A 5K8IA 4XVRA 2RGGA 3ZZTA 1SULA 2IS2A 4KSCA 1CS4C 1HE8B 4DZZA 5F98A 1SXJE 4LJ6A 4DCVA 5JBQA 2R8RA 2SHKA 2ZJ2A 2X2EA 4NE2A 821PA 5FR2A 4HLDA 4OK3A 2O8BB 1QDEA 4QHTA 1KGDA 1GRQA 1PLLA 1FUKA 2IYLD 5EP4A 4JSYA 2CEAA 2BEJA 3B1YA 3RSOA 5KPDA 3IGFA 4WIAA 1GILA 5EP3A 2KBFA 2VP9A 3TVTA 1K5DA 5JWHA 4AG5A 4BASA 1DTSA 3EA0A 3K8YA 4TYPA 2YOHA 2GCNA 5FOXA 4GT1A 1N6IA 2V3CC 5AK0A 1WE2A 2QN6A 4HZUA 2JATA 2RGAA 2EQBA 3ASZA 4OYHA 4NU0A 1S1CA 1GTVA 2FH5B 2G0NA 5FUXA 1JI0A 1OH7A 3U3KA 1P60A 8OHMA 3NBZC 1Z2CA 2XJ4A 3L0SA 1UBCA 5AJZA 3TKLA 1WF3A 4YQFA 1ODFA 1G64A 3CRRA 3OIVA 1CULC 1KO1A 3U5ZB 1EFCA 1SVWA 4W5JA 1T5LA 4WW0A 1FFHA 1SVOA 3GLGE 5CK4A 1E6CA 3EZ6A 3CX8A 3QENA 2VTKA 3ZD7A 3AVPA 3N2IA 4B33A 3NDPA 2CNWA 4C2TA 4RD4A 2XSZD 2OUKA 4BLPA 5JCZA 1OKKA 3K0CA 4NCIA 4Q9LA 1SKYB 1W0JD 1IN8A 1WP9A 2ZRIA 5BN4A 3RAPR 3CPEA 3FWYA 4RD6A 2J41A 3CUEF 4OBEA 3VHLB 1BMFD 3BB3A 3CPJB 4Q9JA 1JBKA 3CX6A 1R0WA 1W2HA 1G19A 3SFVA 4QHYA 1HY3A 4TWZA 1DO0A 5H70A 4KVAA 3K0FA 4YMTA 1XJQA 5FBLB 2NPFA 3EZFA 1D9ZA 1XCPA 4LBWA 3VX3A 1P7CA 4EKDA 2ZVPX 3RLFA 4MRNA 4UNPA 4QJ5A 4MYHA 2IYQA 3VNVA 2WSSA 1QVRA 3PIRA 1O3YA 5D3MB 5AUQA 5GJCA 2CHVA 1NRJB 3U7HB 1N6OA 4J0QA 4KLZA 3ZVLA 3HDTA 4DJTA 3WRXC 2GWHA 1XD8A 3FPAA 1XPOA 4MKGA 2QI9C 4Q4JB 3KQUA 5BYKA 4LV8B 2EFEB 4R98A 3BJIC 1NSTA 4TLEA 4L9SA 5AR1A 2F1JA 1EFRA 1E98A 1A82A 5G41A 1ZUIA 2OFXA 3SU8A 1P3JA 3QJYA 1OE0A 1LF0A 3GLIA 2J0QA 1KJWA 3DDCA 1JNYA 4Q4AA 5J4HA 3RRZA 1CJMA 3J81k 3ASYA 1OIVA 3ND9A 3SYLA 2AN9A 5L3QB 3NEYA 2O0JA 1R8SA 2O8BA 2PLRA 5D3MA 5FTMA 4YMSA 3QKRA 3KQLA 4JBWA 2VP2A 1M34E 1S9HA 1GKYA 4TTQA 5ANRB 2VP6A 5F3WB 3WMFA 2GDJA 4LYFA 4LWZA 4C0KA 1S0UA 3NIBA 3DKVA 2XTNA 4HLUA 3L8ZA 4RZUA 1G6OA 4M2LA 1II8A 2QROA 5M04A 5B2ZA 4HAXA 3DPUA 3KKOA 2CDNA 3TBKA 2IHYA 1X1RA 1X1SA 3F3YA 4BFWA 4BZXA 1E1QD 3VR3A 3LBNA 2YNMA 1SZPA 1UFQA 2DR3A 3AVOA 1GITA 2FDCA 4LYHA 2J0SA 3RS5A 4PO8A 2ZYUX 1IHUA 1VMAA 3CRW1 2QM7A 5ELXA 1VPLA 4JJKA 4TQ9A 5K8TA 3NG1A 1OH6A 2RMKA 3EWSA 4E22A 5HZKA 3U60B 1CRQA 1W44A 2JDID 2P67A 4BFTA 4DDWA 2GAOA 4X8HA 3TUZC 2R9VA 3GEIA 1NJFA 5GJBA 3V4FA 3QXXA 1E2JA 1MRSA 1II9A 3MWKA 1X8KA 4A0RA 1T5IA 1P6XA 4A2PA 2GVDC 4IRUB 3MWYW 5FBRB 3UATA 3KXKA 2GJ9A 1X8LA 2VLIA 3CONA 2Z5FA 3FE2A 1E0AA 2G9NA 1T0JB 3D7MA 2VF7A 1G3RA 1GVNB 4NONA 1ZC4A 4DLZA 2QMUA 3MRSA 3GJ8A 2WWXA 3QKSB 5J5CA 5J4VA 2YYZA 4DSOA 1G7CA 1MABB 2Q3FA 3KX2A 3SYNA 1XP8A 4PFSA 2FX3A 2XB2A 5KDDA 2QPAA 3PUXA 3D3QA 1CF4A 3T1VA 4FINA 3EG5A 3C5HA 1G5RA 1QHIA 2JJ8A 3IEVA 3NBFA 2JLQA 1U2RA 5UKDA 1JXOA 2BCJQ 2VRWA 3AF2A 2QAJA 1N6RA 4JSTA 4GSYA 4W5WA 1GL7A 3H2YA 2X19A 1G8FA 3TAHA 4DLTA 1W4RA 3VX4A 4C0SA 3THXB 3E2IA 1D9XA 1XXHA 1NVXQ 1WMSA 5AWFC 1UKVY 2ZR9A 2ZSFA 3L82B 3UWOA 3X1DA 1IN4A 3ZGXA 3QNUA 5DSZA 1W4CA 2EW1A 2IYWA 3DOFA 2QSYA 1KDTA 2AL7A 2J45A 2W83A 4A92A 4DLVA 3R9XA 2A9KA 4A0HA 3CF0A 2WM9B 1OXVA 1ZVQA 4DXAA 1COWD 3UK6A 1JEDA 4AIIA 3A4LA 1IY0A 4B43A 2WBLC 3QF4B 1M7BA 3AKEA 2WJJA 3ZZUA 3AVXA 4HAZA 4TMVA 1EFRD 1KIMA 4OK6A 4P0TA 2ZI3A 4JLKA 1TQ4A 4MGKR 4Q1EA 3QSYA 4LJ5A 4PC1A 1T91A 2DBYA 2ZE5A 1KNQA 1FL9A 4BZPA 3T61A 2JAQA 2FWRA 3VU9A 3MSXA 1IY1A 2RB4A 4M22A 2QRNA 2YVUA 3P20A 3U7FB 3N70A 3A1UA 2G77B 5GJVC 1DG3A 2XJ9A 2ZS9A 3ETLA 1YZTA 3IPXA 2Q9CA 3DHWC 1N5JA 2A2ZA 4QNRA 1ZUNB 2QTHA 1F6BA 1XJCA 2F3TA 4EPRA 3B85A 4DHEA 1OB5A 3VKHA 1Z6YA 2EYUA 3PJRA 2V4ZA 5JECA 4C4PA 1YRBA 4LJ9A 3TR0A 3H86A 3BB4A 1N6KA 4R7ZA 2OFWA 3X1ZA 5JRZA 2X8AA 2VBCA 4QKQA 2UZ3A 1GNQA 3W8NA 3AV0B 5KNDA 1Z0JA 3W34A 2XZOA 5JHGB 5C4GB 1S4QA 4TLCA 3W90A 1CU1A 4ZIRB 2UZIR 2FGKA 3TW4A 3LFUA 3K70C 3KB2A 5DN6D 4ZI3A 1PUIA 3H0KA 3BK7A 3AVYA 1KI4A 3WY9A 4LC0A 4C0HA 1ZD9A 3M0EA 2RGBA 1KDOA 1CBUA 3LVRE 4OI2A 2Q0HA 2F7SA 2W00A 2ZI9A 1A2KC 3FYHA 2G83A 3LXRA 4XD7D 4C0BA 3LD9A 3LDAA 2LWIA 1FOEB 3T12A 421PA 1CKEA 1H8EA 2NPIA 4LI0A 1DAHA 4NYMR 4WXRA 3OHMA 1L4YA 6Q21A 2ZRMA 4PR0A 1QHGA 3OAAA 1NIPA 2BBOA 2JEOA 2QAGC 1N6LA 4KBFA 2D62A 1P2SA 3HR7A 1HH4A 1S8FA 1Z6XA 1PUJA 3B9QA 3P27A 5L3RA 2XOKA 3CF2A 1AS2A 2EFDB 1NVVQ 2Z83A 2VL7A 5KU1A 3PR1A 2F9MA 2ZEJA 4XVUA 1WBDA 4B2LA 3IILA 3KKMA 1SXJA 1PZNA 2PMDA 2Q9AA 221PA 3AF3A 1KOFA 2WMNB 2HF8A 3U3OA 2GCPA 1W4AA 1OV4A 4ZDWA 4AKEA 4B44A 4D0NA 4KV9A 1P9WA 2R6FA 2ZJ8A 5JFGA 2J0UB 2IXGA 4P32A 4OHYA 4B34A 4BGDA 1JXMA 4NH0A 4QL3A 1G3MA 1N0WA 3TMKA 1TU4A 3K0FB 4F93B 2GETA 2VO1A 1FNMA 1Z28A 2AXNA 4QBIA 3ZVNA 621PA 1FP7A 1E4VA 4HAYA 3B60A 1RRFA 1XEXA 2GBLC 3KUDA 4Q47A 2NTYC 3FB4A 2BBSA 2FFHA 2AFHE 4PC7A 5GVRA 2HLDD 5HTKA 1JR3A 1DELA 2Z6VA 4OI1A 4EFMA 4F7WA 4A8JC 3PG5A 2QE7A 1Z6GA 4HEJA 4BFZA 2RGDA 1S96A 1U8YA 1OXUA 4NKRA 3UMRA 4BFVA 1ZNXA 1Q0UA 2RHMA 5BW8A 1E79D 1U9IC 5IK2D 3LQQA 1NMXA 4OHZA 3SJZA 4A36A 1T4GA 1CR4A 4MYUA 1VCOA 5A4JA 1U8AA 3K09A 4JL8A 1E99A 2CMKA 3OZXA 4LX0A 4YDHB 4ACAA 3IQWA 2BMDA 3RC8A 4OHWA 2GEVA 4DDVA 1GFIA 4XOIA 2RH5A 1TADA 2ZSBA 2EFGA 4Q9IA 5C2JB 4HZUB 4A6PA 3QBTA 4NYJR 2GA8A 4G3XA 2G3YA 2PLFA 3CBQA 3DMDA 5TXGA 3LNCA 2JLSA 2H1LA 1E32A 1BYUA 1E96A 4Q1FA 3KQNA 5F9HA 3THOA 2ZU0C 5HCNA 4AG6A 1AGPA 4QC2A 5FL3A 4HDOB 1BMFA 1XMIA 3MLEA 4A4DA 1E4YA 1CIPA 1ZP6A 1D5CA 1CEEA 3IO5A 3IQXA 5FOWA 2OG2A 4QM7A 4YDSA 1GNPA 1II8B 2DCUA 3HWSA 2BKEA 3RYTC 4R2IA 2GJAA 1ZM2A 2FSGA 2UKDA 4KODA 1F2UA 3ADKA 3N2EA 5FPHA 3R7WA 4MKFA 4Z51A 2DWPA 4Q1AA 4EPWA 5CYPA 4II7A 1ZMXA 1VG0B 2BCGY 4AC9A 1L2TA 2F9LA 1U98A 2GF9A 2G6BA 5HPYB 3GEEA 3QI2A 2OAQ1 2HUPA 1BOFA 1JQJC 1MT0A 3THWB 3C8UA 3CRMA 4JVNA 4AYWA 1TF2A 2E9SA 2BWJA 5J4LA 3DZ8A 2F43B 3FFAA 1OIWA 1E1RA 1E0KA 3LRPA 3FKSA 3KKNA 3OE7A 4N0EA 5DE3A 2ZS8A 1AZSC 1UEJA 4JMPA 5AUOB 3REFA 1KKLA 1XF9A 1E2QA 4RFSA 2XNDA 4MYTA 4ZDKA 4KFTA 3B2EA 4MRSA 1VDZA 2CK3D 1K8RA 5C1BA 2REOA 1SKYE 2FNAA 5CIWA 1GZSA 2YOFA 3U6BA 1GDDA 4NYIQ 4NCHA 1E69A 4M1MA 3CWZA 2C8VA 1TQ2A 4DIDA 1YZKA 4BLTA 3UMFA 1YE8A 2O52A 3DKPA 3THWA 4XIGS 4V0OA 2EVWX 4JT2A 3EC2A 4ARZA 5KYKA 4HZIA 1QHYA 4LBVA 1NNEA 2VSXA 2ONKA 2QNRA 5C4MA 1GL6A 4M8NE 4GOXA 4PC2A 4Q48A 4UNQA 4R9UC 2O8CB 1R4AA 3DZDA 5L3SB 5GADl 1KJZA 1E1QA 1NY5A 2D4HA 2XXAB 1E2FA 1G5TA 1XBTA 4X8MA 5KSOA 1XTIA 1AM4D 2QMHA 2VHQA 5P21A 2EWWA 5FBVB 3NBYC 3U4QB 4M1WA 2PMKA 1XFAA 3KJGA 2IWHA 4HLCA 1N3BA 1FQJA 3QBVA 2JLRA 4ESHA 2C03A 4E03A 4JKIA 4M4SA 5KDOA 2IYRA 3QY0A 4MRRA 3R9WA 1T3LA 4CEIB 3KDSE 2PT7A 3NEJA 3K0AA 1KMQA 2OO7A 1VCNA 4PHGA 1US8B 2HCJB 3T5DA 4XWAA 1SXJB 1XMJA 2OESA 5KSYA 1YR8A 521PA 4B32A 4JLMA 1LS1A 3I8XA 2N46A 2W6ID 1KZGB 2WMOB 1YHNA 2CLDX 3KXLA 3SBDA 2YC2C 3KXIA 4BECA 2IYXA 3KTAA 2VSOA 4Q5IA 1W5TA 4B47A 3U44A 4GDFA 5F9FA 1DVRA 1JJ7A 3GJ4A 3Q3JB 2O0HA 4P4SA 3EXAA 2WWGA 4AURA 4ILEA 5KUTA 1W4BA 1HV8A 2Z4RA 1UPTA 3A1TA 2ZITA 2WAXA 4US0R 4F4IA 3IO3A 2KWIA 2MMGA 4OI0A 4ZIRA 1M8PA 2CK3A 2OV2A 3BE4A 1NN0A 2IF0A 3L0IB 2IUUA 2HCBA 4QBGB 3ICQB 5AJXA 2XXAA 1NJGA 2ZPTX 3NH9A 2WVJA 1E2HA 1Q1BA 3I3SR 2R6GA 1F3OA 1PLJA 4HI0E 3K53A 5TMPA 2Y8EA 1XPRA 4D82A 4A2WA 1VG8A 5C46F 4PX9A 2ZRFA 4F92B 1ELOA 1SVSA 2G1JA 3HYRA 2IWRA 3ZVMA 1V43A 2H18A 3THXA 4JLJA 4LHWA 1E0SA 4LJYA 2V7QA 1C4OA 1JR3D 1E0JA 1KO8A 3Q5EA 1YVDA 1KI6A 5CB6A 2FZ4A 5JRJA 1XDBA 4B76A 1ESNA 1QVAA 4BLSA 5LDDC 2AKYA 2FE4A 3KFVA 4C0JA 3ZZ0A 1CR2A 1OFUX 4HB4A 3AUYA 3VTKA 2QEQA 4DLSA 4RZXA 4UJ5A 3T1TA 4L16A 3SJBA 4FWTA 3VFDA 1FQKA 5JMTA 4Q1CA 2DHRA 3CB4A 4Q19A 3GP8A 4ZKEA 4D25A 3WRYC 1OT3A 1OXSC 2ZJAA 1NN5A 3ZH9B 5KOYA 4UXJA 4HAUA 1CTQA 2BMFA 3B8HA 4FMBB 3WBJA 2W58A 1RJ9B 1ZCBA 5FUWA 3FMIA 3ZYCA 3NVAA 4TMWA 4A6XA 1ANKA 3PCRB 3DOEA 3UMSA 1C9KA 3IHLA 4WZAE 3WP0A 3KJEA 1IQPA 4URZR 1ZCAA 2XTMA 4IOMA 5TV2A 2FGJA 4AKGA 1DO2A 4BWYA 1N5LA 4N3NA 3K9NA 5KSPA 3E70C 3PV0A 3MJRA 5B30A 5HKKD 1W48A 4Y0VA 4C7OA 2JLZA 2WWYA 1Q57A 3X1WA 2KI5A 3CWQA 3F5FA 5SZIA 2J87A 3GLHA 2QP4A 2CE2X 3HP1A 3WMGA 4C30A 3RS7A 1R6BX 2PZFA 4RCZA 3V00A 3E5HA 4GBMA 1MO3A 3GMTA 2OZEA 4I1VA 5TY0A 2IS1A 4C3ZA 1UBGA 1KZ7B 1KDPA 4JLBA 1KI7A 3TQFA 3K09C 4LHVA 1ZU5A 3B9PA 1E2GA 4NYJQ 1E79A 4BEJA 3KUCA 4WA7A 4OI4A 4IDQA 2IS4A 3LWNA 1FPMA 4GZMA 4B3GA 3IUYA 4LZZA 4DT1A 4PHHA 4KXFB 2OT3B 3THYB 4LBYA 4TL9A 2ZE6A 5SZKB 3EA5A 3QG5A 4I1SA 1M6NA 1FZQA 1SVKA 4TN1A 3WYFA 2NIPA 1XZQA 1NI3A 3NH6A 2ZYVX 3CNNA 3EIHA 2AK2A 4L4UA 3GLHE 3MWJA 4P4UA 3L8YA 4ZDIA 4TZ6A 4QGAA 1TMKA 4LPKA 4Z54A 4CIDA 4PZZA 3IKJA 1SGWA 4XTRA 1XNJA 2GXQA 1ZYUA 2O0KA 4UJ3A 4BE7B 3V9PA 2R6CA 4CEHA 5EXXA 4QFMA 4GMXA 2ZM5A 4EPTA 2G88A 1D8TA 4JS0A 2VF8A 3O8DA 3FTQA 4NYIR 5JWOA 1U0JA 4EPYA 4K8OA 2YINC 2YJTD 2A78A 3DO6A 3ECCA 2CE7A 3FMPB 3CX7A 1X86B 1M7GA 1Q1EA 1IN7A 1UDWA 2GKSA 2GVZC 1B23P 3SHFA 2VA8A 4LRWA 1VHTA 2RGXA 4XSGA 1QZXA 3KZ1E 4V0KA 2IW3A 3LX8A 4KU4A 4OQXA 4A0GA 5FOSA 2F55A 4IDHA 1SXJC 1NN1A 3RHFA 4Q02A 5CYOA 1TQ6A 2WZQA 3I62A 3TW8B 5IHPA 2GTPA 4PO1A 4E09A 5BN5A 4PXAA 3QXCA 2YWHA 3NXSA 2ZROA 5EXPA 2AWOA 2QZ4A 2CLCX 3R8FA 2IS6A 4S2EA 2ZUCA 3ZDQA 1VKJA 1RPZA 3AVVA 2IYTA 2DFLA 4B2PA 2ERXA 2I3BA 4CF7A 2B6HA 5EZ6B 4B73A 3K0CC 1RKBA 2FOLA 3ONWA 4MA4A 3OAAD 1HUQA 1K5GA 2JA1A 1R0YA 4HAWA 1Z06A 3RRYA 2AD5A 3Q8XB 2KJQA 5JS8A 2WOJA 1LS6A 4RKEA 4LY6A 3EPJA 2BVNA 4CT4B 4L8GA 3DM5A 1SHZA 2YOGA 4FMCB 2IBMA 2BV3A 5JI2E 4RY2A 4BRWA 1LVGA 4O25A 2PEYA 3HU3A 4PPNA 4Q03A 2V1XA 5BXQC 1VIYA 1NSFA 4G5OA 4MGIR 5FPKA 3GJ0A 1P61B 1W5SA 3TIFA 3AH8A 1GRNA 3OEED 3CIOA 4MGZR 1Q44A 1BO6A 4HB3A 2F1RA 2FF7A 1GL9B 2ZRGA 1F60A 1JB1A 4JYBA 3I92A 3AKYA 4JVLA 2GRJA 1Z29A 4RKFA 3BOSA 5FPTA 2JJ1A 4A0FA 3CW2A 2ORVA 1EESA 2X2FA 1ZM9A 1SKQA 2KE5A 3VAAA 4NPHA 2BMEA 4L15A 2ZRAA 2CL7X 3CZPA 5LD2B 2Q9BA 1MABA 3EWAA 3W8RA 1IONA 1UF9A 2ZJYA 4H1UA 2VP0A 4CRWB 2OM2A 3D8BA 3I8SA 4NHOA 5JI3E 3CRVA 1JPJA 5FFMA 2VQSA 4PPQA 4PZLA 3L0PA 2Z0MA 4ON9A 3M1IA 4A8JA 3VMFA 4LHXA 2V6JA 4B71A 1ZU4A 2CVFA 4D0LB 2PX3A 2IYZA 1JQLB 5IF9A 2IT1A 4M1TA 3LXXA 2PZGA 2Q3HA 3QKRB 3VNUA 4BPBA 1IY2A 1U9IA 3CNOA 2ZSEA 2GXSA 4D0GA 3ICEA 1E2DA 3DVLA 4U00A 4BFUA 4EJSB 2O8FB 1K6MA 4QBHA 1BKDR 4C9BA 5KNCA 3U3MA 1WB9A 1XB2A 2VHJA 1OB2A 3AQ4A 3KTAB 4TL8A 4Q18A 1E2KA 2JLYA 3GFPA 4W5HA 5JLJA 2CBZA 4IEEA 3TRFA 1TPZA 3K70D 3HJNA 4QJ4A 2CL0X 3B13B 4TL6A 2G1KA 2BJWA 1ZD8A 4BUJA 3TAUA 4A15A 1VCMA 1TF5A 2IYYA 4RJLA 3EC1A 4LOAA 1LW7A 1FX0A 2RCNA 1JR3E 3O8BA 5KTYA 2AKAB 2ODBA 4RZ3A 1TQDA 3GJ6A 3QUSA 3PITA 1VYTA 4URYR 2XSZA 2XNDD 3BERA 3QVUA 4UNNA 4UNSA 2HXSA 1EWRA 1F2UB 3NKVA 2ERYA 1P9NA 2OXCA 4NMMA 3EASA 4IVQA 4LJ8A 2A30A 3VR5A 1IXZA 2W6JD 5JZVA 3KKQA 4BEBA 3GLGB 5E95A 4HB0A 1A1VA 2I1QA 5CDFA 3W6PA 4OHVA 4ZCLA 3GPLA 5FTJA 2BJVA 3K9HA 2QA5A 4GOKA 4DBLC 2DPXA 1JAIA 1CP2A 2A5FA 4KBGA 4URUR 5IDVA 3T34A 4Q66C 2JJ2D 4JL5A 3ZS9A 4DEXA 2P5SA 3W3ZB 4M53A 5FPYA 3RNLA 1J8MF 2V54A 1IN6A 4PQFA 3SEAA 3PUWA 4AWXA 2IYSA 1W0JA 1GKIA 2BEKA 2ORIA 2R2AA 2V6IA 3QVVA 3MMPA 4QGFA 2FZLA 3DMNA 3ADCA 1AKEA 4PPFA 2P6UA 4TYYA 3IBYA 3MFYA 2YV5A 1LB1B 4B74A 1U0LA 1U90A 4GOJA 4MUBA 3K0AB 1Z0FA 2ZYWX 1R5BA 3PEUA 1M74A 1YJ5A 2CHGA 1EX6A 1E2NA 1I4DD 3P4YA 1I4TD 4Q21A 3TLXA 3KQKA 3AGQA 2QE7D 2PJRA 4DLUA 1G3UA 2CCGA 3QKTA 1TL7C 1S9DA 5TVKA 3SOPA 4DKXA 3OEHA 3BIFA 4NZYA 2BHRA 4D6PA 1VYUA 4B6FA 3MWLA 2DWQA 2REBA 4I1OA 4QRHA 4DSTA 4MDEA 1D6JA 1H8HA 4Q9HA 2O8CA 1CR1A 2VHUA 2QUZA 1IXRC 3I61A 3D31A 3AKCA 3LO5A 3REGA 3T06B 4DCTA 721PA 2NGRA 2H57A 2PL3A 2WTUA 2GZAA 3QPWA 3QOFA 1FMLA 1G8HA 2YC4C 3TJZA 5FL7A 1OF1A 3Q7PA 4DB4A 3O47A 4KAXA 2IK8A 3RRNA 2FSIA 3Q7QA 5AJYA 1IN5A 1NKSA 1LNZA 4URVR 1A4RA 5B57C 2ZRNA 1RC8A 1G3IA 1QBKC 3QIAA 4R2HA 2NZ8A 1HTWA 3EIEA 2MSEB 1GNRA 4YC7A 5EQTA 2EU8A 4PSAA 4KI0A 5JJLA 1VECA 4TT3D 2YWEA 2JIZD 4WZ6A 5J4YA 4TYNA 2FFBA 4LPSA 2PT5A 3IPYA 3QXHA 4G01B 4JZKA 1UDXA 2J9RA 1RW4A 1P75A 1YZNA 2AX4A 1TF7A 3SZRA 3AVQA 4JLPA 1KI9A 2Q21A 3I73A 5KPJA 1G41A 2XTZA 5AUPB 1G17A 4OKSA 3BC1A 4KITB 4JLOA 5AUNB 2NOAA 1R0ZA 1X8JA 4U02A 1M7HA 2NQ2C 2OLKA 2CCJA 2VP5A 5HR5A 5DGXA 3KQHA 2W0SA 2WJHA 1JECA 4CEHB 4YMVA 2Z43A 4M1YA 2QSZA 5JEEA 1RZ3A 1G21E 2PX0A 5DN6A 2P65A 1KY2A 3QEJA 1XD9A 4O0MA 1U94A 3T15A 1QHXA 1FMJA 2QY9A 1W46A 2ZUDA 3FGNA 3T1QA 2FPMA 5J4KA 3NC1C 1T9HA 2WJVA 3R9IA 5JSZA 1TAGA 2REXB 4LSGA 1KNXA 3AVWA 3L0OA 2IEZA 1HQYE 3A1VA 3OIYA 2C99A 4PSKA 4F38A 1J8YF 4JLDA 1WXQA 2H17A 2W0MA 3U7GA 1ZAKA 2PH1A 2A7QA 3BAFA 2CNWD 4LYJA 3P26A 1G7RA 3LLUA 2PZEA 1ETUA 4B2IA 4BZQA 2BMJA 5FUVA 5KO2A 2AFIE 1FW6A 1DAKA 3C4JA 1YZGA 4KYIB 1I2DA 2PCJA 3JZAA 1G5PA 4AYXA 2AK3A 4EQ6A 1NN3A 2QENA 4HLQB 2V55B 2X1VA 3A4MA 3A36A 1E2EA 2ZSDA 2UVQA 4NYMQ 3VKWA 4WZBE 1HT1E 2FMXA 4QNMA 3KJIA 4BLRA 3SQWA 4PC6A 4LHZA 1OSNA 2WIBA 2LKDA 2D7DA 4P33A 2W6IA 2GJ8A 4ESVA 3C7KA 4IOLA 1JJVA 2WWFA 3OFNA 2ZXUA 4A9AA 5CB8A 3M6AA 2JIZA 1S1MA 3OFND 4ABYA 1G291 1DBSA 2ASEA 5JJIA 3N5CA 5DLQC 2BM1A 5BYJA 2ZI4A 4X8LA 5KHOC 1CRPA 1OXXK 2HJVA 2IL1A 2QGNA 4ACBA 2EFCB 1L4UA 2B7BA 4OQMA 1XCMA 2BBWA 5K8LA 4HLUC 3I1FA 1E3MA 2WV9A 1E2PA 1NY6A 3Q5DA 3SFZA 1ZNZA 3WMEA 3OEEA 2N1BA 1S3GA 5DNYB 1FTNA 4RD2A 1F48A 4BLOA 1GAJA 3SNHA 4AK9A 2PJZA 2IYVA 2PBRA 2JCSA 2FSHA 4F4CA 2FJUA 4KHZA 1G9XA 2Z4SA 1W36D 5CK5A 3R8CA 3CLVA 5DYGA 4YMUA 1XMSA 3KJHA 4MH0R 4KJZA 2XZLA 4KFSA 5TDHA 2OCYC 3QE0A 3K1JA 5JJKA 4GMDA 3K0SA 1DAGA 1Z8FA 4TT3A 3G0HA 4D81A 3FFBA 3BXZA 3F0TA 3GLHB 5FTNA 1PVOA 2WKRA 2ZU6A 3NTUA 3W9YA 4L9WA 2O8DB 1EXMA 3C5CA 2OBMA 1T3HA 4ZO4A 4DVGA 3EW9A 3K70B 2MSDB 1ZIOA 3EZ9A 4IKEA 3VU9B 4PPGA 3X1YA 1JR6A 2DFTA 1KDRA 4PHTA 5HE8A 1VCIA 2FV8A 3H84A 5KSZA 4OL0A 1MRNA 4OQNA 3QKSA 1YR9A 4B3XA 2ORWA 3RABA 5HZHA 3I5XA 4K46A 5D3QA 3NHBA 1Z08A 4TLBA 2I4IA 2WPDD 4FXPA 4EFNA 5JSZB 2B92A 1UM8A 5LB4A 5CM8B 2OFOA 4Q7JB 2QPOA 2CLSA 4PQRA 4TMKA 4YXWD 1KO7A 1RVDA 2DFNA 5DYIA 4I99A 4EUNA 3UG6A 1TUIA 4IVRA 1AS3A 4HUQA 2QP3A 3PFIA 1U99A 3PQCA 4MKIA 4PAOA 3ZS8A 2GEUA 4WOPA 3E1SA 3TSWA 1J99A 4FW9A 2OXRA 1KY3A 5G3ZA 1QHHB 1XTJA 2OHFA 2RAPA 5AJVB 3RANA 1DE0A 1KI8A 2GXAA 2ZUBA 4K81B 2I1VB 4XSHA 1J90A 3TQCA 3HU2A 4M1SA 4M0LA 4EQ6B 1NMZA 1DAEA 3HR8A 2R62A 2RGEA 5FOUA 2F1HA 5CLQA 1B0UA 1SVIA 2TMKA 5E7JA 1P2TA 2PEZA 2AR7A 2BIFA 4V02A 3W5JA 4ZDJA 1MO5A 1OH8A 1Q22A 1KI2A 2V8OA 2QU8A 2DB3A 2RGCA 3B6EA 4WXPA 2NO9A 3SYKA 3FDIA 3QXSA 1GSIA 3VQTA 4LJ4A 2XITA 4D4JA 3CZQA 1KHTA 1RRGA 1Q21A 1Z5ZA 4AI6A 1EFTA 1Q1ZA 2QM8A 4G0NA 3SHWA 3PEYA 3WNCA 5H1YA 2Q3MA 4MRVA 1R10A 4NCKA 2XZPA 4B3BA 4B3CA 3PENA 4OK5A 4ZKDA 5FTLA 3QF4A 4LK2A 2W2XA 1XEWY 2ZRJA 1NG9A 2QBYA 3EZ2A 3MCAA 1G3QA 2HJGA 4ZI2A 4D26A 1HURA 2N42A 2RGNA 3L43A 1NVVR 3TH5A 1CJVC 2JGNA 1N25A 1XTRA 5EE1A 2XX3A 4POAA 4I81A 3UWKA 2OEPA 2IXEA 2CJWB 4UXHA 2R6AA 4XTCS 5FPSA 2ZI7A 3PEVA 2J7PD 2VH5R 3PVSA 1KSGA 1Y63A 1G18A 3CKLA 4IFEA 1EFHA 4RFSB 4RVCA 3NHAA 1SXJD 5BN3A 3HPRA 5G40A 4Q4HA 1LFDB 1RE0A 1Z07A 3O8RA 2H8KA 1HA3A 1O87A 2MMCA 3BS4A 3TE6A 4XWOA 1KK2A 4D4KA 2ZI5A 1E9BA 1J2JA 3BBPA 1GKUB 2ZE8A 4YMWA 4W9MC 2ATVA 2C95A 3GQBA 2AHOA 3LQRA 4DEYA 4JBYA 1OHHA 1IBRA 2J7PA 5E7IA 1YZQA 3OF5A 5FUYA 1SVMA 2F43A 4Y0AA 3PUYA 1ZRHA 4C0LA 2WAYA 4DWJA 4IW3B 2NZJA 1V5WA 3DM9B 5CJ2A 5LD2C 4Q4LA 4GZLA 1E2MA 2QQEA 1GP2A 1MOZA 1AA9A 2ODNA 2XB4A 4CZ2A 1N0UA 4M9ZA 2RHDA 3KKPA 5KNBA 3RS4A 2H92A 2GXUA 4UQOA 4NP6A 1R7RA 3JVVA 2EYQA 4LV6A 5BWMA 1FNNA 1EGAA 4JIMA 4EDHA 4Z1MD 2JLUA 1TEVA 3GLIB 4G5SA 1OH5A 3CO5A 2A5GA 4P4SB 1S3SA 3LLMA 5J47A 1E9SA 4OQFA 1HQCA 1MO6A 3P1JA 4TSFA 1NLZA 2HDNB 2VPPA 4GNKA 5JHHB 2J3EA 2QRZA 1DAIA 1FX0B 3ZQJA 4KYUA 3AM1A 1C1YA 5LPNA 2P5TB 2XAUA 4V03A 3I32A 4QGGA 1ZUHA 2HT1A 1IJFA 1Z6TA 1XCGB 5EE0A 4QM6A 3AEZA 1AN0A 4JKYA 3B1VA 2WWHA 4IXMA 1KJYA 3MG9A 1XTKA 4HDQB 3DEFA 4HUQB 4LBZA 1TU3A 2LKCA 2VIIA 4TLDA 5FI1B 2JLXA 5FTKA 3EPKA 1UJ2A 1G16A 2YHSA 2YZ2A 1UKZA 1Q3TA 4UKDA 1JPNA 1G8YA 3ADBA 4IJMA 4EJSA 2O8FA 3A58B 5EE5B 3B7GA 2YWFA 2NO0A 2D2EA 4CVNA 5EE3A 1WRBA 2NG1A 1U8ZA 1N6HA 1G1MA 3RS2A 2QT1A 3NC0C 4DSUA 2GZDA 1VTKA 4YXWA 5EP2A 2ZRCA 1ZM7A 2BBTA 4OQLA 4TMXA 5AJWA 4IVPA 1T0HB 4Z1MA 3O8CA 2C96A 2BM0A 4BRUA 5L8VA 1ESMA 4EIWA 1MKYA 1I2MA 1Q12A 2FPLA 4ARZB 2ZRKA 5H68A 3TR5A 2GJKA 4M9QA 3VR6A 3ND8A 3LH5A 1P5ZB 1FUUA 2IA5A 2IUTA 3T5GA 1DADA 3MGCA 1KI3A 3PUZA 5EP1A 3U7EB 4IDOA 4RD1A 1ZNYA 2R44A 3RRMA 1L8QA 1XMVA 3Q85A 1P4SA 5GJWC 1QHSA 1D2EA 4ZPXA 2K5UA 3BORA 2GZHA 3SQXA 1KI1A 2ZRBA 2BDTA 4KSBA 3BGWA 4FN5A 1EK0A 1SQ5A 3TUJC 3X1XA 1NG1A 4D2IA 4WAUA 4DLRA 3B1WA 3OIUA 2ATXA 3GLFB 4IHQA 1XD2A 1W2GA 2DFKB 3WHKA 1N5IA 2ZIAA 1D2NA 2EFHB 1H65A 1AQUA 1QG2A 4ASUA 1A7JA
chains in the Genus database with same CATH superfamily
3TR6A 4PPYA 2XIJA 4PXSA 1R0XA 1FS4A 3C97A 3J80A 4CW7A 2SKDA 4PFKA 1RFLA 4B45A 3IT2A 3KFXA 4OAOA 2X4DA 2DE0X 2AWNA 2R65A 3K9QO 3CRZA 1OUMA 4X7MA 3R20A 1CQWA 4K6KA 5CGQB 5ENZA 4XB1A 5B64A 4FDLA 1WPQA 2B69A 2GSWA 3AL2A 4WDQA 5I5GA 2VPYA 1QV7A 3RYCB 1A1SA 1T8UA 2QPLA 1SA0A 1IZ8A 3GDWA 4C87A 1QGZA 1TTPB 4BWVA 3RWOA 1NR1A 4JODA 5J5AA 2ZT6A 4ZANA 1EP3B 3JASB 1FX1A 2WU3A 3L04A 4WK4B 2OMEA 2JJ1D 1PG0A 3T1NA 3A3KA 1QH0A 3SLRA 1B26A 2BGNA 4FLMA 3VISA 3CE6A 4DLYA 3FUUA 1ZL2A 4KO3S 4S1VA 2JGDA 4LGMA 4Y6OA 4TV9B 1QF9A 4GYKA 2A3RA 2X3YA 1Z4PX 4O2RA 4TQAA 5CMLA 4YPOA 3QXJA 2DGDA 4DUYB 5IAGA 4RO0A 2EKDA 1LI5A 3G6KA 5LOVB 3DFZA 5ES3A 2PS0A 4YALA 1XKLA 1EX7A 3DL0A 4QTXA 2EJCA 4MYDA 1RCFA 3NNSA 4L2IB 3SI7A 4EHFA 3PPWA 3KB8A 2PYDA 1AGYA 3E9QA 1A69A 3PD7A 1SH7A 5JQGA 1N5KA 2NU7B 1CP3A 3IBSA 2ZVJA 3ICCA 2DUNA 4MGYR 4L4ZA 1L7PA 3OECA 4BO5A 3NTRA 1CIJA 1WUYA 5BWBA 3BSSA 3AHEA 5FHQA 1C8KA 4IJUA 1XAHA 2P8JA 3F7OA 5LA6F 3UWMA 1HEUA 3WYAA 5MDHA 1Z3IX 2QLBA 2Q8NA 1JFTA 3AILA 3D6TB 4QUAA 1AIPA 3UNXA 1AH2A 2ZRDA 3LBIA 3U2QA 4QG7A 2P2LA 1KSJA 2ZDQA 4RHYA 4NBVA 4OIFA 5BRAA 2VP3A 4I0WB 2VTDA 4AS2A 1WWKA 1Y7HA 4L4XA 5JY1A 4IUDS 2UUCB 2HHJA 3PR2B 5JQGB 5GAJA 1XRJA 3PL1A 2EERA 3NXKA 4JJZA 3C43A 1JBEA 2PIAA 2E4UA 4Q1DA 2HXYA 3BCRA 1TW2A 4L3OA 4AS3A 1QMPA 4FWIB 4G84A 1T6XA 4M6WA 1OFTA 3QLVC 4GYWA 1O5IA 1RXEA 3HJTA 5IVDA 3OC6A 1REQB 2OYRA 1K3UB 4N39A 4EO4A 1JMKC 2GRAA 3MZ0A 1XVUA 3IVCA 3L4EA 3LK6A 3OCUA 4WN9A 1FFAA 2WMDA 4KIFA 1XVIA 2WKWA 3GMSA 1VRVA 1SBQA 1KSFX 4CM7A 5JARA 2PGJA 4GOMD 4M9CA 4B83A 3BDIA 1O57A 3U4QA 2MWMA 2I9PA 2QRPA 4AVYA 3GJ3A 4DIEA 1PNQA 3UK1A 2BH9A 3CIFA 3P97A 4DRXB 1X2BA 5E1BA 3DBHB 4DLXA 5EKSA 3WS7A 4HGYA 2YX1A 3BD9A 4FFPA 4IDNA 4A03A 3WGIA 3U17A 5FCDA 1UKYA 3KBBA 1ZH4A 3BK2A 1AB6A 3B82A 4PX5A 4ZTUB 3BH7A 2CW5A 1RYHA 2KSQA 2ZRHA 3SC4A 1ZUWA 3ET4A 3WC4A 5EUMA 2F3UA 1U2ZA 1DJOA 3P0HA 3UUGA 1M0TA 4RMIA 2XNSA 3FGOA 3R7NA 1AT1A 1W5AA 3I72A 2PMFA 4REQA 3U3JA 4TLMB 2I4LA 3Q72A 2G28A 1G5FA 3FFWA 1LQ2A 5AQEA 3RC2A 1AQNA 2I3DA 4RFVA 1DC5A 1E5DA 3I9NA 4Q7QA 5A04A 3E3MA 4DYVA 1E5QA 1F38A 1KEUA 1VGVA 2IYUA 4KFRA 3SBXA 3X2FA 1U0HC 1F5SA 2WIAA 5DBEX 4YRIA 3B3QA 5IT5A 4S1OA 3P4XA 5DF1A 3WYDA 2GKGA 3EUFA 4E94A 5EJIA 3VHRA 4GX0A 5AKGA 5K99A 5EJ8A 2QT0A 2AHRA 2JHPA 4MR8B 4QOHA 4E30A 2G9RA 3T95A 2W2LD 4WLOA 3KLNA 4AXXA 2QZPA 3FNEA 5KYGA 1LX7A 1L5QA 4QRDA 4KXVA 5JNVA 4WBSA 2JJ2A 1JG6A 3QQ5A 1FRVA 4PY2A 1US8A 4US1R 5TGTA 2J3KA 1MU0A 4FNOA 4A8TA 3RKRA 2HY7A 4CTJA 2C4MA 3UMVA 1CJKC 1MHPA 4FE3A 3P9SA 3EEBA 4Y1RB 1QUEA 2X4IA 4NY1A 5CX4A 2AW5A 2GA9A 2OHHA 3BF8A 1AGNA 1RQRA 3U1TA 1HKHA 4YAKA 2B8TA 4NXMB 4F3TA 3GJXC 1FDVA 3DCJA 5CW1A 4QYXA 1N9ZA 1P18A 1UXOA 4R40A 1IOZA 2ZYTX 4EFDA 1SCJA 4W7SA 4M0MA 3B6IA 3L05A 4QGHA 1TD1A 5LQUA 2B35A 1REQA 1DL5A 3KB1A 2GMWA 2SKEA 2CD7A 1N2SA 2WSSD 4O2AF 1Y48E 4HGPA 4MWBA 1GQFA 3CW8X 3HYTA 3KXDA 2LPMA 2AE1A 4C7OB 4EELA 3NAMA 5BVGA 4Y1FA 5F1YA 4RDIA 5EG5A 1I01A 1M2OB 1LPSA 1QH9A 1V41E 4W63A 4ZRNA 1A5BB 5H16A 4BOYA 3TK1A 4CMKA 1RRCA 3NFRA 3FPSA 4UCQA 4BZZA 1PN3A 3ZDYB 3PS9A 2ZT5A 4HNSA 4B48A 4NBUA 3CPHA 4BNDA 1EM6A 3RAJA 1ZW1A 1U11A 3P52A 1XRPA 3ONDA 1XZIA 1NW7A 4FZRA 1YWGO 2F1IA 4J0DA 4X66B 1K8XB 1YRAA 1FFGA 2ZJ7A 4TSFD 3VZDA 4UE2A 3WK9A 1QP7A 1AK2A 2C5LA 3AO0B 3IIJA 1FDTA 2Z5VA 5GVSA 3AKZA 2HYIC 3AESB 1F8UA 3HBFA 5MHTA 1UZUA 5IRCD 1G9SA 5JC8A 2YJ6A 2E55A 2YV1A 5HBGA 3HTXA 1TNDA 3KL4A 1L5HB 1KYIA 3P32A 4RHUA 1FTSA 3MAAC 4J7UA 5DTJA 3I6ZA 2ADMA 3AY3A 3CUUA 5T64A 4B1FA 2JAUA 1EEHA 2EZ4A 1MC4A 3DGEC 1XXHB 2WJWA 3PGXA 3HS3A 4RVHA 1QG6A 1WIWA 5I7FA 4Q6WA 1BOOA 2CUKA 2ONCA 2WHYA 4MS1A 5KQSA 4DCNA 3DF7A 3QVGB 4DV6B 2F48A 2XMDA 3I6YA 4LA4A 3ZHTA 2PK3A 5FLEX 2V3VA 1B0ZA 2C3YA 3IKLA 2GF0A 2VHZA 1TUEA 2XCOA 2GK7A 4HPWA 3MGKA 4MKHA 3IKMB 2BMVA 3GZ4A 1G7SA 4FYIA 3LK7A 4FOPA 4MZXA 1P2FA 2GEDA 3ESDA 4JA2A 3LTEA 4L3WA 5EA2A 4BNLA 4U7DA 3KEGA 2GAJA 3LKZA 1CSEE 5IJ0B 5K8CA 1UK7A 4QOSA 4AKHA 3FCEA 1DEKA 1Z0IA 3U5TA 2ZULA 4Y9SA 4BO7A 3SS7X 3LOQA 3LT5A 4ZHQF 2W8BB 3RKSA 3CKYA 4E4TA 5ICMA 1M5RA 4X97A 3GK3A 4K3VA 4PQYA 5HUQA 3HYCA 4JLVA 4EO7A 5FUBA 5CFNA 1W0CA 2QM3A 5EHZA 2X5OA 5K6AA 1KWKA 1GUAA 1NYRA 2A0YA 3ELBA 2ES4A 3PFCA 3EZXA 4HAVA 5LQMA 2BCEA 1SUBA 2GHQA 2ZCVA 3IEUA 2YQZA 3DE3X 1W0KA 1YHYA 1P2UA 2GPAA 2XEXA 3SC6A 10MHA 1XYYA 5I7AA 4ASUD 4H0NA 3VHXA 5DX8A 1MAUA 4BNNA 2PLNA 1KSHA 4LV5B 3SSMA 2ANBA 5HJEA 4Z7QB 2ZTSA 2AEJA 4G4GA 3VC7A 1QONA 3FGPA 3ZCVA 1ZM4A 3BTUA 2CZGA 4Q1BA 3LBHA 2F17A 2H3HA 3UXYA 4KQ2A 1JR2A 2O5VA 1YB5A 2WV7A 5BNWA 1Q1QA 2RH8A 3T3DA 1W8DA 4O4LA 4O3MA 1Q3HA 4RKYA 3WJ2A 3WSVA 3BTVA 1NQVA 3KCQA 2CJWA 2HWWA 4R1QA 1XJ0A 2OL4A 2XOKD 3RBVA 1HI9A 1CQPA 4NECA 5TB5A 1B1CA 2GCOB 2IOHA 1XZPA 4N7JA 5EY5B 3S44A 3ZU2A 2O6LA 2R8PA 2VJYA 5EOVA 3KYCA 3DS8A 2C2BA 4LVNA 1DCTA 1P0IA 2EJWA 4CL3A 1OTHA 1RI1A 4U5XA 1I36A 4IQ4A 3TQQA 1E7SA 3LU1A 3NJRA 5F1OA 4N7BA 1ECBA 4EFLA 1LSOA 5E7QA 3UJ6A 4KXNA 1R5OA 3LIPA 2WU4A 3U4AA 4KE7A 4YLYA 2I1WA 1UXGA 3WYGA 2WAAA 1W19A 3DVRX 4MO9A 1E7YA 1QTNA 1U8XX 2GZ2A 1ESDA 3OJXA 4LRQA 1N0VC 1OWNA 3K73O 1GRRA 5DBFA 3QU5A 3IIKA 2FSFA 2AQ8A 4N3CA 4C22A 3KEOA 2ZFUA 1Q0QA 2D74A 1SWWA 1F0YA 1M5UA 3EFOA 3AI1A 1HEIA 3GRVA 4L8YA 2XUJA 3KAKA 3CNEA 4KI7A 5ALSA 3LY5A 4FGWA 3RQSA 3RVKA 4AJOA 5I7WA 1E9DA 3H5WA 4JC4A 5CLLA 3FHTA 3B89A 4Z0TA 2XGOA 1UXKA 2Q8QA 1PL7A 3HB0A 4DMCA 3MWEA 2P75A 2ADOA 1DARA 2J46A 2XZDA 3GARA 2AMYA 1SCIA 1UKCA 2YMPA 5JR3A 2GILA 3JAKB 4KE8A 4LDJA 3CM0A 2J0UA 4M9SA 5AM1A 3VPDA 3WP1B 4G07A 4CFZA 3ZJUA 4D44A 1YMUA 2B8EA 2MCFA 3U49A 2W6JA 3K4HA 5L4SA 4KPGA 2QV7A 1A4XA 1N9GA 4JBIA 4ZAVA 4E0BA 2QTVA 4ISBA 3PCXA 5ERGB 2H7CA 2FR1A 4HRXA 2GJSA 4G5XA 4QWWA 3ZIAD 1G4AE 2FUG6 1L7AA 4CEJA 1WXIA 2FI1A 2XUHA 3EVBA 3BL8A 3OCWA 2WIFA 1XWIA 1NVWQ 2B21A 3EHDA 2QP9X 4AX8A 5I7OA 4FYYA 3AP1A 4DRZA 1ZINA 1XEWX 1BH2A 1T2CA 1SRQA 3UGKA 1ZC3A 2GBLA 3KQTA 1NGSA 3LQ1A 2WEKA 1D2CA 3MTIA 3JYNA 4BVBA 5IP5A 2O8EA 3D54D 3RAFC 5GGXA 5A2GA 1UAGA 4QJ3A 1XHFA 1Z75A 2A5LA 4CXMA 4MW0A 3BTSA 3I1YA 4S2UA 3T35A 1SHTX 2RIRA 3KO8A 1QE3A 3F8TA 1WMBA 4M9RA 4JP8A 5CM2Z 1JJFA 4JGBA 3G59A 4KO1S 4LCBA 3DO5A 1XL1A 2E85A 3UENA 1G8GA 1YVPA 2X0IA 2CNKA 2HLHA 4RK1A 3HNOA 2KS6A 1O94C 2AFHB 3A10A 3QNMA 1KMHB 2VHVA 1EEXB 3O8OA 1J8DA 5DRYA 5ER9A 2ID4A 1WBJB 3DONA 5IFKA 3WHLA 5K9ZA 2WAMA 1UANA 2DWCA 2JLCA 2HCTA 3LXUX 2E89A 2KMLA 1NW5A 2ODWA 2D0DA 2G8NA 4PAGA 3V4PB 4BO3A 2RGNC 2FLKA 5IMBA 2INGX 2VHTA 3B2NA 4JP2A 4M0CA 5AM2A 1AOXA 1DKPA 5CXQA 1NW3A 1GZ7A 3OEHD 4KQFA 1MPTA 2VT2A 4GRAA 1NL3A 5DNCA 3RM3A 3DSRA 3W6NA 1W36C 1I4LD 2A1IA 1GQRA 3BBLA 3HO6A 1Z47A 1QR2A 1CRWG 1EFKA 3AP2A 2QX6A 4NZMA 4MJXA 4GI1A 1U0RA 4G0OA 3EODA 3HEAA 1VYHA 3DEHA 5JS7A 5K0TA 4H1VA 2B5WA 2M6RA 1ZK3A 2LRHA 1ZJZA 2RAVA 5LQSA 2HT6A 3UV3A 4HUTA 5I7SA 5U4XA 3TDNA 3AHIA 1UEIA 4V3CA 4HX5A 4R71A 2ZBFA 4ZJYA 5A03A 2I67A 2A57A 3GLIE 3EWIA 1OOEA 5M2QA 3IP6A 5A3JA 5ITZA 1UXJA 1GUFA 3OPQA 4N4AA 1JAHA 1SU6A 4QQFA 1FP6A 1GAXA 1HETA 4PAQA 2FW7A 2ZSUA 2OC9A 1PD0A 3Q88A 4N8EA 4NICA 3VNQA 1K8ZB 1U9CA 1D8AA 4D9KA 2W4IA 1S8AA 1H1LB 1SUIA 3FH0A 3KAJA 1V47A 4GXNA 4UAVA 4WMLA 2XT9A 3V97A 2WF7A 1EK6A 1JKMA 1XDDA 5IEBA 4EHJA 3AI7A 1AGRA 1T3SA 4L5IA 1QFJA 4M1KA 1A5ZA 1Z6AA 3UK7A 4BXOA 3WGLA 2ZZNA 1DG1G 3O0TA 1HL3A 2EEPA 2RAUA 3OX2A 4C0QC 3THYA 5HYVA 2IXFA 4QDUA 3JAKA 3NVKI 1XL0A 2Q3BA 2IX3A 4ZGBA 3EPHA 3BWVA 4X93A 1ONBA 4BMYA 1N2CB 1EFVA 2AE2A 4BAZA 2H1FA 1NXXA 2D0OB 4MLCA 1H9CA 3ZJYA 3QK7A 1L0BA 1JWBB 1LXCA 1F2TB 2ZCUA 5EXTA 3ZIAA 1N78A 2ZI6A 2M98A 2RHBA 4CMIB 1O03A 2LDXA 3ZY4A 4YCSA 2IZ6A 2XKKA 1ZESA 2QTFA 3FDZB 1QGED 1C80A 1YVRA 2ONJA 1RM4A 2PKEA 1TTTA 2FDXA 3VGPA 3Q11A 1J0AA 4MK4A 4IAOA 4E5UA 3BRWD 2NUAA 3F5DA 4KZPA 4RGQA 4Y9TA 4BLQA 2XBMA 3D4NA 4G0ZA 2P9CA 4RWEA 5JWRA 3WBKA 5BQ5A 3ZGOA 1EG7A 5DHAA 1LV8A 1Z5OA 3KOMA 1IWBB 3THSA 3ENQA 2J5QA 4MQBA 1BW9A 3DWFA 4ZAWA 1H6BA 3WSTA 4E88A 4ERNA 1FP1D 1SBHA 2DAPA 3EZ7A 1MTZA 4LMBA 4M36A 3IAS1 3SDZA 4Q00A 1RAGA 1ZXLA 4EEZA 1G0NA 1N6PA 1R8XA 3S0JA 5BN1A 2G4LA 1FVFA 1NVDA 5DLDA 1Y82A 5FA8A 4RCYA 3SFTA 5C18A 2IEYA 2YJ5A 2NU8B 2AG0A 3AF4A 5BOSA 2GAAA 3GJ7A 2WILA 3S7TA 3K32A 4RTPA 5BVHB 3HKBA 5DHSA 1KF0A 3WGMA 5JOQA 1MX1A 2CCKA 3LY8A 4AJ9A 4JLAA 4CM5A 4E46A 4ETIA 2D5AA 5K0FA 1JG3A 1N2HA 1BIFA 1CE8B 1QLHA 2C8LA 1GZ3A 2LIVA 1ZZGA 3I6MA 3SX0A 1BDHA 1CUDA 1W47A 3FCCA 4CPDA 3HMQA 1RQPA 3WL3A 3ZLJA 3ZW8A 2G0TA 3CRQA 5KC8A 1P62B 3N9IA 4ERXA 3UKOA 5J2UB 2D8MA 3C41J 1D0VA 1SKAA 2GKOA 2PVCA 3ISJA 2GFQA 4BKRA 4X9XA 3ITKA 3CN7A 5ALHA 3T1HB 2Y0PA 2YJ3A 4IKOA 2QBYB 4EAQA 1HOXA 2ZE7A 3E9YA 2FSVA 3FTPA 2QTVB 4L0QA 3DV0B 4URWR 2SNIE 1XKXA 1KKUA 3V4ZA 3WZMA 4ZTZB 3MLBA 3W2GA 5AH0A 2B6NA 2GYVA 4LDZA 5BMVB 4QE3A 1CUYA 3A6FA 2LZ0A 3IH5A 4LZJA 4ZHQB 4PSCA 2ZREA 3Q8KA 1PGOA 1B3RA 3RYHA 3HRIA 3IT3A 3ZZTA 3OOEA 1CS4C 2RG7A 3WK4A 1AN9A 4DCVA 5EL0A 3FG9A 2P2GA 1YUMA 4QDKA 4ZC8A 4BVGA 4QWMA 4P36A 4HDNA 4YP6A 1QDEA 2FE1A 3HWRA 1KGDA 3FTEA 1FUKA 1Q77A 1MX3A 2OO5A 4JSYA 4FFRA 2NSLA 4LOKA 2GASA 5JZSA 1QLWA 2GD0A 1D2RA 1VP3A 5J2TF 1NR5A 1I2CA 3HCCA 5CHEA 4GHWA 4BASA 1OBCA 3VRHA 4DLAA 5IKOA 2GPYA 2Q4DA 3LPMA 4TYPA 3H1FA 4N5HX 2GCNA 3EULA 2PKQP 4A6DA 1L1QA 4JQOA 1SC4A 5AK0A 3K3PA 5AVYA 1USUA 3WRVA 2JATA 2RGAA 4OYHA 1ZMBA 3HBAA 4CGYA 3MT8A 2EL7A 2G0NA 5F3RA 1GAWA 3KYCB 2VF2A 3QYAA 1N1GA 2YUTA 4QBTA 3U3KA 4R0VA 1QTIA 3H9EO 1L5NA 1M6HA 2I7DA 3NETA 3OIVA 1USGA 3B3FA 3QTTA 1S8OA 1UK8A 4OQEA 1MQ8B 4IY1A 4EY7A 1EFCA 1SVWA 2P9ZA 4AMUA 4ARVA 4RF4A 4MVJE 1FQOA 3ZCPA 3IJRA 3RF6A 1YNOA 1N7HA 1NC3A 1QE0A 3OE4A 4LXXA 3CX8A 1O6BA 3ORSA 4U6NA 3MD9A 4O08A 2IOFA 1WMEA 2BKVA 3TQOA 3W2IA 5EHNA 2IOFK 2GFIA 2C7PA 3MGGA 2OPHA 1OKKA 4NCIA 1JRLA 2AZMA 4TVBA 3RAPR 3FWYA 1P6UA 2W42A 5G0SA 2YJNA 4EZIA 4KAJA 1SBIA 4DTCA 4WCFB 2DXIA 1DI0A 2XLCA 1KEVA 1OWMA 3CPJB 1JBKA 4Q9JA 3QXGA 1KZHA 5BQOA 3ZV5A 2R96A 5CH3A 1DRWA 3K94A 3PC8A 4KVAA 1PFVA 1OC4A 3HGQA 5E4YA 5H70A 4BO6A 1GFSA 1VRCA 5FBLB 2NPFA 1E1CA 3EZFA 3VX3A 4C03A 4RFLA 1GCIA 3AZOA 1JP7A 5F2KA 3W3AD 2IYQA 2VATA 4AUMA 1O3YA 1T1RA 4GO1A 4JOSA 2CHVA 4JBHA 2IU3A 4LW8A 1R6TA 4KLZA 1NWHA 2VRCD 5DZSA 3WRXC 2P9GA 2GWHA 2XWQA 3WRWA 3FPAA 2OCGA 2WD7B 1VZ2A 5EFZA 4R9NA 1XPOA 1FTQA 1MG5A 4BO1A 4FN4A 4IS3A 5BWNA 1KIFA 2G25A 1HRKA 5BYKA 3PPVA 4PWZA 1ZVJA 2E18A 3JD1A 3TGWA 1VL1A 2AI1A 3FNBA 4L9SA 4KX3A 1NW6A 1EFRA 1JAYA 1ICEA 4UDYX 1M8JA 1JKFA 1H0HA 4K9RA 3PX2A 5L6MB 4TVOA 3GLIA 3FYUB 3G49A 3OIFA 1Q91A 2WRZA 2WSYB 2DX7A 3EDCA 1FYFA 1C8LA 3SYLA 3U9LA 4F2GA 1QVVA 2AN9A 4XX1A 4B81A 4I4TF 2IKSA 1G38A 2J5RA 4HTFA 2MOKA 2C4HA 5FO0A 4QASA 1AXGA 2AC4A 3L8MA 3S81A 1QHEA 1FA9A 1A8QA 4KGDA 4YMSA 2PHZA 3QKRA 3Q9SA 2W8BA 4KR2A 2JRCA 4JBWA 3KQLA 4PM4A 1LPPA 1KVQA 1QB8A 1S9HA 1TZBA 3OI7A 4IJ6A 4LG1A 4QU9A 5IBPA 4FB4A 2WB2A 3WMFA 1ECCA 4LWZA 4DGQA 1S0UA 2IPOA 2DM6A 1JN0A 4PQGA 5KC9A 3DKVA 1VKHA 2Z2JA 3A2LA 2ERCA 4M2LA 1II8A 2QROA 4D42A 3G8BA 1ZOSA 5M04A 4MVJA 4Q3CA 3GZNB 3LKDA 5B2ZA 4DLLA 2CFTA 1T36B 2EHJA 3WL8A 4E2WA 3DYBA 1EQUA 3TBKA 3RTGA 2XYPA 3FVTA 5COAA 4CKXA 4UZFA 2XOEA 4HWPA 1E1QD 1TKRA 3PKIA 4RACA 2QTLA 3VR3A 4FJ1A 4HDMA 1QVZA 1K4YA 2D2IA 1U1DA 5JNTA 4WJZA 2DR3A 3OG9A 4RHXA 4Z4GA 2HWUA 3I9V1 3C45A 2JZOA 1R4NA 2CZQA 3A9VA 3D4PA 4M76B 2JVIA 3LMKA 2V9ZA 1VPLA 4TROA 5ALLA 3V7UA 1RYYA 4J6FA 1W5BA 2FF5A 5JISA 2D8AA 3U60B 4CDNA 3MJFA 4JU8A 1CRQA 2AZDA 1GQQA 2IDZA 1K63A 4X8HA 4DDWA 4F6RA 5HMMA 4BVHA 5KB3A 3E9DA 4WLEA 3SXUA 3VC2A 3PFWO 3L5OA 4K9LA 3ER9A 2C9MA 4LKRA 1KR5A 3A05A 4M87A 4HN4B 1LWOA 3HHEA 5FP0A 2JIQA 1X8KA 1PNVA 5FBHA 5K3SA 4JROA 4A0RA 1N32B 2D59A 2XT0A 1P6XA 4R16A 3EFBA 3HY6A 2CLFB 2GVDC 4AP5A 3FX2A 4PTZA 5K03A 1R4MA 2X40A 1I6KA 2J3DA 1X8LA 5BOVA 1MJGM 3FE2A 4YJDA 5TS3A 1PX0A 5CUQA 1E0AA 2BI8A 2HWKA 3A6JA 3FTDA 1FSPA 1GYPA 1GVNB 1NZJA 2BF7A 1Z82A 3E8XA 3OT4A 2QYSA 1MB0A 3GJ8A 2YYZA 4DSOA 2WQZA 1JSRA 2Q3FA 3O1JC 3QKWA 5IHXA 2AN3A 5IUJC 2PGXA 1Y7PA 1TM4E 2CHEA 1SOAA 3NHSA 3IXQA 3JQCA 1W94A 3A9TA 1DIBA 2X0DA 4ZYXA 5AP9A 3U48A 2VNSA 1LQUA 4TV9A 5F1KA 3DBOB 4MAAA 2QPAA 3QOWA 1IU9A 1XNRB 2C0CA 1V8DA 2LBPA 4MW7A 4FINA 2UUPA 5KJ6A 2NWQA 3C5HA 2DBZA 4DIUA 2II6A 1R6AA 1J6UA 1I0ZA 1QS0B 1SCQA 1U2RA 4Y1RA 2BCJQ 3LGSA 5HFJA 1GU7A 2GN0A 4L27A 5J2UA 1YRLA 4QX6A 1SY7A 5BV2P 2IKQA 1R15A 2P9YA 1Y4AE 1EM8A 1ZCFA 1C0IA 1Q5PA 2WUVA 3OCJA 5K51A 1VB5A 2GBIA 1D9XA 1CYEA 3TLZA 5AWFC 1UKVY 2J4CA 3KE9A 4Q4CA 4V1CI 1IN4A 2DSNA 2PV0A 4H59A 3NOVA 1AC5A 3QY9A 3GLRA 2QYHA 8ADHA 2K2WA 2W83A 2J45A 3CSSA 3SICE 1Z25A 4MPTA 2POQX 5I9BA 2A9KA 2WHEA 3EISA 3L6CA 4D96A 5HRUA 4PGHA 3UK6A 2NSHA 3I6IA 4AIIA 5EHGA 2WBLC 1M7BA 3LF2A 4U7TB 4C4AA 2E5FA 2WJJA 1UBTS 4J1TC 3AVXA 2BY4A 3JQ6A 4CN8A 5DM70 4Q12A 4DAOA 3R6WA 3FXAA 4LJ5A 1CUWA 2JGKA 4JNCA 4ML3A 4B3MB 2CMFA 2FOIA 1DFGA 1RE1A 2BFDB 2O4UX 4G5HA 2JAQA 4POOA 5DIZA 1YJAA 1KFJB 2P9QA 3ML1A 3QW4B 3WLFA 4M22A 3U7FB 5BQ3A 2QXTA 2YVUA 3A1UA 3AR8A 1EHIA 3GVCA 1H42A 2FPGB 1YZTA 4HDKA 4D3DA 2A2ZA 3O8QB 3KUKA 1NUPA 2QTHA 1F6BA 1OC2A 2V7XA 4IGAA 5DP2A 2GJ4A 4P5PA 1PL8A 1OB5A 3VKHA 5AW6A 1I3NA 1Z6YA 2A9OA 3WZ2A 4UOEA 2V4ZA 3VXKA 4JYAB 4Q82A 4D41A 3TN7A 1Z6QA 2B30A 2BGUA 2AG5A 5FX2A 3NWOA 4D8YA 3TZCA 1GN9A 1ISGA 2WINI 2OFWA 2OHOA 3F9CA 4JKOA 2X8AA 3URKA 1WULS 1GNQA 5EZYF 2WUDA 1XALA 3AV0B 3EK2A 1TJYA 3I1IA 1E61A 2B36A 3HP4A 1CU1A 1WCIA 3HVHA 2X0EA 2JGDB 5CP8A 3CR3C 4ETMA 4N82A 3HQ4O 3H18A 4ZI3A 3AVYA 4Z5XA 1E3LA 2LP4Y 4HN2A 4LC0A 3WY9A 2FWBA 2AJLI 1V1JA 1ZVVA 2Y4NA 2RGBA 1KDOA 2QVXX 3G1UA 3K5IA 3O03A 1M6VA 3O2QB 5ELMA 1Z88A 3TEFA 1IMJA 1KP2A 2ZI9A 2W00A 3KEFA 5DBGA 3WDSA 3FYHA 2PXCA 3KYIB 3WB2A 2C5SA 5E0KB 1JT2A 3LDAA 2LWIA 1FOEB 4IS2A 5GQSA 1I7LA 3CUKA 4KPUA 1JMVA 3BMCB 2HR1A 4RNDB 3H04A 3H87A 1V8PA 4Z3DA 2I3ZA 5ALWA 4JLUA 3NTOA 2JZNA 3OAAA 3UB2A 1KTIA 3LWZA 1NIPA 2GDZA 1HZJA 1QU3A 1ZCJA 2QAGC 2QZSA 5IS2A 3U26A 3GN1A 1V5EA 1VGRA 3RJ9A 4INAA 5JBIA 1HH4A 1S8FA 4U2CA 4KXWA 4MDYA 3HH8A 5B58T 3B9QA 3G2PA 5L3RA 5KU1A 3E82A 1AS2A 2Z83A 1NVVQ 2Y76A 3IUQA 4M0PA 3PR1A 3SHVA 3T0IA 5A7HA 5IDYA 2F9MA 5BXYA 2VWPA 5HM8A 2AG8A 3L7LA 1CQIB 4IIFA 1E2UA 4XVUA 2FZGA 1EFDN 4B2LA 4U4AA 3I5YA 1TLLA 221PA 2Q1SA 2WMNB 3KRTA 3D59A 4GPEA 2GCPA 5B37A 1OV4A 2WTBA 3FOAA 5DM0A 4KV9A 2GLTA 1C7FA 2R6FA 5JFGA 1DEAA 2PAFA 1FRQA 2AOXA 2XQKA 3GNTA 4UEKA 4LOJA 5CCEA 1IK6A 3K96A 4RYDA 1ODJA 1YAJA 1ZFNA 3DBRB 1U0TA 3G2QA 2G9VA 4B34A 4EYGA 3O74A 2C07A 3OUTA 4YRFA 5EERA 4C07A 1N0WA 4IM7A 5KYUA 3T5AA 1Y8CA 5BWLA 1UR5A 1Z28A 2R47A 4TWJA 3ZVNA 3ZWKA 1FP7A 2AFHA 1Q0SA 2AA3A 3DD1A 1RRFA 2O6HA 5SYAA 5K0SA 5ECWA 5DYTA 1C9MA 3FB4A 4IIJA 4PIVA 2O06A 4MXDA 1GPJA 1J49A 2YN0A 2AFHE 2SCUA 4ND1A 4XLLA 3CCFA 5ALUA 2QN9A 1B1AA 3LT4A 1JR3A 1TLTA 4C5CA 1EUYA 1STOA 4HNAB 3DL7A 4EB6A 2W2LA 3TJRA 5AKKA 2XR1A 1MQAA 1D1QA 5MN5A 2NV6A 3JYPA 3O38A 4BFZA 1UBMS 1S96A 2HJHA 3OJOA 4IQ8A 5COQA 2PL9A 2PQ6A 1PU2A 1E79D 1U9IC 3EGDB 4JB2A 5E8RA 2M1XA 4BJHB 5LXTB 2WTAA 3K4QA 1X42A 2Z3VA 4U6QA 3WLOA 1T4GA 5JO0A 5JVDF 5DN9A 5FNVB 3VA7A 1TYDE 1BQEA 4Z0HO 5A1JA 3SEQA 1VCOA 3HYSA 5A4JA 1EUCB 1GT91 1CF2O 1YNSA 3AQIA 1ODTC 1JAZA 1P5FA 4LX0A 3N75A 4C01A 1A9PA 1OX5A 4ACAA 3IQWA 1U31A 3RC8A 4RIFA 5JAZA 3IQFA 3OUZA 4XOIA 2C7GA 4F7DA 4G8DA 5IT9A 2QE6A 3UBMA 5C2JB 3QBTA 3USCS 4A1OA 1YBMA 2G3YA 2PLFA 3JD0A 3PD0A 5LYJA 3PI7A 5GOTA 2ZIWB 5E9WA 1NATA 3DMDA 5DCWA 5TXGA 5LUBA 5K01A 4MR7A 3VYRB 4A23A 2IZZA 3LVBA 3WDLA 2QR2A 4Q1FA 4FX5A 5DHQA 1SOUA 5F9HA 2OYCA 2DU8A 3MK31 1CUVA 1Q1GA 3RRXA 2RHOA 1LZKA 4AMYA 4ER5A 3PQEA 3W1WA 2PUEA 2EKQA 5DB4A 1KPGA 3R3VA 1NVKA 2FK7A 3BGIA 2NZXA 1E4YA 4PXYA 2PH7A 4ZVKA 4QM7A 4YDSA 1GNPA 1ZG3A 2DCUA 4GG1A 2BKEA 4YRLA 3RYTC 3DAOA 4H4DA 3FHLA 1ZM2A 4H7EA 1ST2A 3NYQA 4KODA 1UOEA 5AKJA 5FPHA 3H13A 3CLRC 2C1XA 5KWSA 1PEDA 4Z51A 2WIJA 3K1ZA 4II7A 1ZMXA 2BCGY 4AC9A 1L2TA 4DQXA 3ME5A 3R3SA 2GF9A 4BRZA 2NLOA 2O3UA 4QUKA 3JYHA 4MQFA 1P0FA 5KTOA 5IYZF 4BNUA 2Z8YA 2HUPA 1BOFA 2ZIZA 4FYXA 3ZBQA 3MILA 4BLWA 1K0FA 4P4GA 2FW6A 2VVTA 4LSWA 1Y5RA 1JH9A 3ABRB 4UUNA 1AU9A 1WQ3A 1LJUA 1TCVA 3J7AC 1A72A 2VS1A 4OM7A 4RF5A 3DLAA 3NBAA 5C51B 2F43B 3FFAA 1XRRA 1E1RA 3AJRA 3OE7A 3TJZA 1GAEO 1R74A 1J06A 5KJFA 1JJAA 2JA2A 4IIYA 4J9UE 1RXCA 2PL1A 3LUCA 1XDGA 1T24A 4ZYTA 5AUOB 5L4LA 3AX6A 5EUBA 4COOA 1E2QA 1EVQA 1H3FA 1RP1A 1E3SA 3E9NA 3DP7A 3GOHA 3HKEA 3I9FA 5HMLA 1EUZA 4KFTA 5LZ8A 4Z9AA 4G9GA 3VSDA 1NX6A 2YWRA 1VDZA 3EA4A 1MENA 4QYIA 4DILA 1CQIA 4DMKA 5EJ4A 3G85A 1LK7A 4CM6A 1B2RA 3CEHA 3WIBA 2YOFA 2LXNA 3D3WA 2ISCA 2FN3A 4D6XA 5IT4A 4NYIQ 4RM3A 3VHXB 1OFUA 4LNAA 1HC7A 1USWA 2YNMC 1UFKA 1T4BA 1MFPA 2HPVA 3CNQS 1TQ2A 2LCQA 4OQ4A 3SLGA 4JJ6A 1RWPA 4BLTA 1NXQA 1JZSA 1E3EA 1I7QB 2FWJA 2OD9A 1AX9A 3F5QA 4KN9S 4K2AA 4MWOA 2WHQA 3OQIA 2R8YA 4KRGA 4IGKA 4EZEA 1IUOA 3EC2A 1FU8A 1CHDA 1QHYA 4LBVA 1SUEA 2JH3A 3S99A 5K8TA 1AY0A 4U7PB 3EQ2A 3MN1A 4UNQA 4L5JA 1QP0A 1QDUA 2PSSA 1V7QA 4MB6A 2DFVA 4RETA 3WKCA 1KJZA 5L3SB 3JQ7B 5GADl 1EFAA 2X7HA 4MLPA 1L6IA 1XBTA 4HH3C 4N18A 3MXTA 1KC1A 3TTVA 2XWSA 2ZDHA 2YWCA 4MPRA 4MAFA 3LOUA 4CIWA 4B79A 1THZA 1DC3A 3K6SB 2O7NA 1H1TA 4IR7A 5P21A 2EWWA 3DW1X 4UOQA 2DLDA 3SDSA 2I2XB 2GNPA 5HRAA 2PMKA 2CLHB 3B1KA 2Q4TA 2ZW9A 3KJGA 3R7SA 4BEWA 3HYNA 3DZIA 5AI9A 5K8JB 1V25A 4F72A 3QBVA 3VDQA 5JMOA 3MQ2A 2C03A 4IIEA 4JKIA 5IXYA 2BE9A 2NYUA 3ZE7A 4MRRA 1VE5A 4OU4A 3MVEA 1MX5A 3UAVA 5B3KA 1IIBA 3FR8A 3I64A 4CL8A 4ZHSA 5BV0A 3PF9A 1ATZA 4QYIB 3L6UA 4LRYA 2MDTA 5DP1A 4XWAA 1L5HA 5JASA 4W5NA 3LY7A 4OHPA 2OESA 3RC9A 5JQGF 2EX1A 5KSYA 2TSYB 1UFRA 1EJBA 4JLMA 3I8XA 2WF9A 4CMBA 4XDYA 7YASA 3SY8A 1QQAA 2OHXA 3QE3A 5EMNA 5T4BA 3F90A 1J39A 5JTTA 2ZUEA 1M0EA 1ZIDA 1PQPA 1DHRA 3NYWA 3Q0IA 1B7GO 3KXIA 4RS3A 4X0EA 2ID8A 4D3SA 4QYTA 2VSOA 4LFCB 1W5TA 4I8IA 4GDFA 4KO4S 1JJ7A 3GJ4A 3WWPA 4AG3A 1RZRD 2D3TA 1I5RA 2QDKA 3Q3JB 4OHOA 4QEDA 3HUFA 4PG7A 5DTIA 4F5DA 2IPAB 2DR0A 2QLFA 3BZUA 3NYIA 4ILEA 5THXA 3CNHA 3ZH2A 3ZJ5A 4O59O 1WOMA 2DP4E 4JUCA 3IO3A 3ZY5A 3AJ9A 1IFXA 2X0NA 3PXBA 4LISA 2ZSHA 1X14A 1XAIA 2CK3A 2FQ1A 2OV2A 2IUUA 3IBFA 2R4QA 2OO5C 4I7EA