1QHXA

Chloramphenicol phosphotransferase in complex with atp from streptomyces venezuelae
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
178
structure length
178
Chain Sequence
MTTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQSAEGGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLDVLWVGVRCDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTHKESIECAWAIAAHVVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CHLORAMPHENICOL PHOSPHOTRANSFERASE)
publication title The Crystal Structures of Chloramphenicol Phosphotransferase Reveal a Novel Inactivation Mechanism
pubmed doi rcsb
molecule tags Transferase
total genus 61
structure length 178
sequence length 178
ec nomenclature ec 2.7.1.-:
pdb deposition date 1999-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07931 CPT Chloramphenicol phosphotransferase-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1qhxA00
4C0KA 4Q47A 2QT0A 1ZD8A 2ZVQX 1IONA 1XTSA 1AGRA 3BXZA 2QP9X 3GJ6A 3VHXA 3EA5A 2C8VA 2VTKA 2ZJZA 2QAGB 3AF0A 1LS6A 3R8FA 2ATVA 5AUPB 2HCJB 1EFUA 1ZUHA 2O5VA 5CYPA 5JCZA 4NH0A 1II0A 1QVAA 1VKJA 3B1ZA 1X1SA 1NJFA 1QVRA 4TQAA 3AF2A 5JJKA 1JEDA 5JRJA 3K53A 1PLKA 2AL7A 2WZQA 4LPSA 4OHWA 4FCVA 1KI6B 3HJNA 5CB8A 5CM8B 3B1WA 4P31A 2B8WA 4Q1CA 1SQ5A 1DOAA 4FCWA 3SJAA 3MFYA 3IIMA 1S9DA 3A37A 2AKAB 1VYVA 4RZUA 4C0JA 1NI3A 4QJ3A 721PA 1WB9A 3QXXA 2G0TA 1W0JD 1NF3A 3CM0A 2H1LA 3EIEA 2Q21A 4XSHA 4N0DA 4CEJA 1C9KA 1KHTA 1GKYA 2A3RA 4ZI2A 3GP8A 1WMSA 2ERXA 4PPFA 1ZRHA 1F6BA 4BQSA 1CP2A 2CJWB 2ZYUX 3B6EA 1E4VA 2W00A 1JALA 5G3ZA 1IBRA 1BYUA 4RD0A 4HLUA 4DCTA 1GVNB 4GL2A 3AP2A 4A8JB 1HYQA 4GP6A 2JDIA 2LKCA 2AKYA 5L8VA 3PEVA 2ATXA 1DELA 1NKSA 3L2OB 2IYTA 5GJVC 5JSZB 3F3YA 4G5GA 2WKPA 3SYLA 2OT3B 2Y8EA 5G3YA 3WMGA 1Q3HA 3RLFA 121PA 2PZFA 4Q4AB 1AS2A 2O0HA 1Q20A 1F2TB 3WMEA 2FGKA 2OESA 3PUZA 4OQNA 3VKHA 4CGZA 4MYTA 1O87A 3BFXA 3BB3A 1G4AE 5CIQA 3FGNA 1KK3A 1YKSA 5EUMA 2NTYC 1VTKA 1CR1A 4ASUD 2WJHA 1FQKA 5M04A 1OH5A 3FHOA 4N3NA 4ASUA 1P2TA 2OAQ1 3SQWA 5EP3A 1WBBA 5LD2C 1Q1BA 2D62A 1AQYA 4UJ5A 2NMVA 3X1ZA 2FX3A 4GFDA 4I1VA 1NNEA 1L4YA 2OE2A 4W7SA 1A2BA 2DWQA 3TSWA 1M8PA 2E9SA 1QG4A 2FEMA 2ZI3A 4DXAA 2C96A 4MITA 1AGPA 2A5FA 2W6IA 5CITA 3K8YA 3LNCA 2QU8A 1DTSA 4AKGA 3WYGA 1OHHD 2OO7A 3VNUA 1J99A 1ONBA 1G7RA 3PV0A 4QHTA 4URYR 2FN4A 4URWR 2GZHA 1EWRA 2DR3A 1E4YA 2C9CA 2XTNA 3I8XA 5FI0B 1N2CE 4GOXA 3R8CA 1W2GA 4NZYA 2ZYWX 2HT6A 4QM6A 3KJIA 2CL0X 3GLGA 4GDFA 3PFIA 1OH8A 4ESVA 3UIEA 2QGNA 2RH5A 5JCPA 3DHWC 3VFDA 4RCYA 1FW6A 5K8UA 1R4AA 5FOXA 1YJ5A 3I62A 4JLKA 1NN1A 4V0KA 4MDFA 4YMSA 4ZI3A 2QBYA 2VHTA 4WOPA 1FP6A 1ZNZA 3DM5A 1OB2A 2ZE5A 2HCBA 1Y63A 4MUAA 1U9IC 5AR1A 2IYVA 3LQRA 1SVKA 3U3RA 1P4SA 2A78A 1UBFA 2XB4A 3B9PA 2ZRBA 2ZM5A 1BOFA 2Q9BA 4RSGA 1ZAKA 2BCJQ 1MO3A 1N0VC 2MSDB 4PQFA 2GF9A 2XNDA 4OQXA 1KI1A 5BYJA 3PITA 2DPXA 3FE2A 3O8BA 2BHRA 5B57C 3QG5A 5FR2A 3IHLA 3GJXC 3VKWA 4ACBA 3HR8A 4BEJA 2P0EA 3LXRA 1R8QA 4ZKEA 1MR3F 1XTIA 4GBMA 1WE2A 5J4HA 2EWVA 4XJXA 1BYIA 3ZS8A 4GOKA 3B60A 3TR5A 2L0XA 3IO5A 2WKRA 2XSZD 1W5SA 2ZYTX 3BB4A 3CX7A 5F98A 5LPNA 2XSZA 5JS8A 4CEJB 1UBEA 5KHOC 1JXMA 2HUPA 4X8OA 4OK3A 1C4OA 4NCJA 2H17A 4E03A 1YHNA 3CWQA 4GT1A 4QXAA 2GVDC 2EFHB 4KLNA 4CRWB 2VHCA 1RRFA 3EASA 2ZYVX 2X19A 2BM0A 1GSIA 2GESA 3QKTA 4RKFA 4EFMA 3U5ZB 1OXUA 1S2MA 5DHFA 4JLPA 1OSNA 3OAAD 1RZ3A 1OFTA 1PLJA 4PC6A 1COWD 1P2VA 1T8UA 4IDOA 2ODNA 1DVRA 4N0EA 4YONB 4AK9A 2QA5A 5K8IA 3PEWA 1QBKC 3ZZUA 5FBLB 3MLEA 2ZE6A 1E96A 3CONA 4V0MA 3NBFA 3IILA 4V0ME 1XEXA 1E1RA 2PL3A 2ORWA 2ODEA 3K0CA 2BJWA 3U44A 1Q0UA 3T5GA 3KQNA 4D4MA 1US8A 2WM9B 2GXQA 1RYHA 2RGNC 4OJQA 4TMZA 2OCAA 1R5BA 1BS1A 4YC7A 2NPFA 2FEOA 2NPIA 2C9YA 1DG3A 3C15C 3X1XA 4BUJA 2G1JA 2G77B 2RGBA 4O2RA 5L3VA 4D0GA 2WJJA 4M9SA 3KUDA 3B1YA 5C18A 4LHXA 1CF4A 4PXAA 1T3HA 2K5UA 4OQMA 2QSYA 4ZDIA 2JCSA 2ZRGA 4G01B 4PPGA 5DH9A 4PSAA 1EX7A 4LDJA 1E69A 5JJIA 2WBLC 1PZNA 3LA6A 4E07A 2WJGA 1AJEA 1MT0A 2MSCB 3CX8A 5C4GB 2ZSAA 3GLGB 2QI9C 4A1FA 4IHQA 1A7JA 1K5DA 4PFSA 1EGAA 4MGZR 1E9EA 3OE7D 5AUOB 1JPJA 3D7MA 4TT3D 2A30A 4GOJA 2ZRCA 2VSOA 2VBCA 3OFND 4PC3A 2JLZA 2QBYB 2D3WA 2J45A 2F1JA 3OFNA 4KCGA 5GJBA 4QOSA 3MWJA 4NYJR 1G5RA 4XVUA 1IJFA 3CRRA 3T5DA 3EARA 3ZJYA 2EU8A 1AM4D 3HDTA 2Z83A 2VHJA 4A0FA 4C3ZA 4LJ9A 2GJKA 5EP1A 1S4QA 4BFVA 1F60A 1CRPA 3W34A 6Q21A 2NZJA 4B48A 2OZEA 2VP9A 3BRWD 1KO4A 3ND9A 3AVXA 3VQTA 3OEHD 1XJ0A 3ZVRA 2XXAA 1GILA 5C2JB 5JJLA 1KZ7B 4TLCA 4BFUA 2CK3A 4LJAA 3BE4A 3GJ7A 1Z63A 4PZYA 3QUSA 3UMSA 4TN1A 4C0AC 2MSEB 3TIFA 2QMUA 2FV8A 3DO6A 4LHYA 2H18A 4M9XA 4CF7A 2WSSD 2JJ2D 4JBYA 1YR7A 5DIFA 2WAXA 3RDPA 2WSSA 3GEIA 3UMRA 2JJ2A 4PHHA 4A9AA 3TGPA 4BFZA 4LBWA 3NBXX 4FMBB 3A1UA 3W3ZB 3T34A 2XZPA 4Q7JB 1B23P 3KXKA 1E2PA 4NPHA 5JLJA 1GAJA 3SQXA 1PJRA 2NOAA 3CB4A 2IHYA 1II8B 3T61A 1ZM2A 4TTRA 2ZS8A 4W5JA 4BLTA 2VEDA 3Q3JB 1UF9A 2N46A 4MRRA 3W9YA 1W46A 3TK1A 4LJ8A 1EFCA 4P4UA 2DFKB 4IVPA 2C98A 2MMGA 4UNSA 5E4FA 4U00A 2R6DA 2J0QA 2CE2X 1UKEA 3NEYA 1U0JA 1TADA 1E2EA 2VPPA 5LD2B 4WXPA 4ZIRA 2AHOA 4WZAE 5AJVB 5SZJA 3K1JA 1T4GA 1T91A 4QBGB 4PZZA 4Q9JA 3VMFA 4YLGA 3FMFA 4XVRA 1KOFA 1S96A 3MCAA 2WAYA 5EJEA 3SHWA 5HZKA 1R5OA 1YU9A 3KZ1E 2HEIA 4BLOA 1R0XA 4EPXA 4DLSA 4HB0A 1IXRC 1NG1A 3PEUA 5HPYB 3A58B 2WV9A 4TYWA 2FFHA 4P4TA 3GLFA 4IJMA 1UADA 1U2RA 3GLFE 3ZQJA 5DI9A 3TSOA 4LI0A 1FMLA 2YC4C 2WMNB 4KODA 1JAIA 4HAXA 2KSQA 2RAPA 3F8TA 2G6BA 1DG1G 2QENA 4ZCLA 3SR0A 4MKGA 2DYKA 3PCRB 3U4QB 2GEDA 3HP1A 3LVRE 4Q1EA 3CH5A 3BGWA 3QPWA 3A1WA 2WPDA 4IDHA 1Z47A 3B9QA 4PHFA 1P9WA 2OCPA 1D9ZA 1NVXQ 4YQFA 4TMVA 4AYWA 3GLIA 2GK6A 2ODWA 3VR5A 4QHSA 3GLIE 3LY5A 4NKRA 2A5DA 3W90A 2OXRA 1OIVA 4TMTA 4D0NA 1ZJ6A 2O8FA 2C9OA 2JA1A 1T9HA 2OBMA 4EPTA 4TYNA 4P0TA 3EWAA 1LY1A 2Q6TA 3QKUA 5FH9A 2Q0HA 2J87A 4Q1DA 3ZVLA 4LUCA 4CEIA 3T1QA 4UXJA 2ZSEA 5KSYA 1XTQA 3K0FA 4P4SA 4US1R 3AVYA 1G8GA 5EE5B 3ZZTA 1W1WA 1ZM9A 3SE0A 3CH4B 3CZQA 1HUQA 4LPKA 4LHVA 4C7OA 1SKYE 2Z5FA 1Q21A 2R65A 2D2EA 5CJPA 3REFA 5J47A 3O47A 3CRMA 1AS0A 5EXPA 2V9PA 2XXAB 3SJZA 3QY0A 5FUXA 5AWFC 1Z5ZA 2VQSA 4TWZA 3AGQA 1I4LD 2IYYA 3ZZ0A 1T5IA 4LZZA 1H8ED 4NYIR 5EE3A 1H8EA 3BD9A 4QG7A 3AF1A 2CHQA 2QZ4A 1OE0A 3WYFA 5EZ6B 4J0QA 1IN8A 3N2IA 5FTNA 3E70C 2G83A 3KTAA 5J4YA 4D26A 2DWOA 1SVSA 3QPVA 5CLLA 1IHUA 3SS8A 4Y0VA 2F9LA 4PO1A 1P9NA 4Z8YA 4XWAA 4AY2A 1XTRA 3GPLA 2E1RA 4X8MA 4JLDA 5DHAA 1VCIA 2QUZA 2CDNA 1KO1A 3EIHA 2VYFA 1WA5A 2RGXA 2YWGA 2FDCA 3L8ZA 5SZKB 1JQLB 2GNOA 1XZPA 1DO0A 4ZO4A 2QG6A 1U0HC 5L3QB 1XPRA 1DO2A 4UNPA 1AKEA 1VG0B 1KDRA 1YR6A 4ZIRB 1OFHA 2FSGA 1E9DA 4M1KA 2XZLA 2GBLA 1G6OA 5KUTA 4EPWA 2PT7A 4TYQA 1ZW6A 2P65A 1FUKA 2EW1A 4BE7B 5A5GA 5J4VA 1G21E 1NVWQ 3QKRB 3W6NA 1N6KA 3UWOA 3LRPA 4KSBA 1EK0A 3TMKA 4DT1B 4JBXA 3VX3A 5FR1A 4BFWA 3P26A 1DAHA 4A2QA 4C4PA 2XGJA 2BBTA 4Q02A 1XDBA 1E1QD 1Q22A 3SZRA 2WIAA 3GLFB 4DIEA 3SOPA 4LYJA 1E32A 3KQHA 2GK7A 3KXLA 5EXSA 3MRSA 3SFVA 4G5QA 1HY3A 5HCNA 1SVOA 1XMJA 3TKLA 4F7WA 3SNHA 2FH5B 5IHPA 2OXCA 5ANRB 4LGMA 3T15A 3TJZA 5BN3A 2FF7A 1CJKC 2TMKA 4LBVA 5LBIA 2WIBA 1YRAA 3LV8A 3X1WA 3C8UA 1WDTA 4DVGA 1F48A 1KK1A 4DHEA 2EYUA 2R62A 4QNMA 1E2DA 5JS7A 2B7CA 3BBPA 4TSFD 2VHUA 1G16A 5SZIA 4PZLA 2ZRLA 1KI6A 5FPHA 1DPFA 1N6PA 4B3FX 1PUJA 4ZPXA 3B85A 5LDDC 4D25A 2O8FB 1CJTC 3D3QA 3U6KA 3TAHA 621PA 2W2TA 1ZC3A 1JECA 3QVVA 4GMDA 4POAA 5TY0A 3BFVA 3FFAA 2BEKA 3AB3A 4HDCA 1OKKD 1IY2A 4V03A 3K0FB 1NL3A 4I81A 4F4CA 3PUYA 2V1XA 1FQJA 2CJWA 2ZI9A 4MQBA 1UKZA 2ZTSA 4EFLA 3EPHA 1OJLA 5FTJA 1ZC4A 1SKYB 4C7OB 2BV3A 3PVSA 2R6CA 4R98A 3FHTA 4WIAA 2R44A 3S1AA 2IF2A 2HT1A 1RVDA 5ELXA 4V0NA 3RC8A 3DZ8A 2VP6A 4E22A 2DWPA 3DMNA 2REXB 3VHLB 2YJTD 4B74A 3GJ3A 4AWXA 4F4JA 3VR6A 2C5LA 5A4JA 1KGDA 1W49A 2OFOA 2ORIA 4RZ3A 2FPMA 2AWOA 3UK6A 4H1VA 2QMHA 2QL6A 2W6JA 3AKCA 3DPUA 1XZQA 3IQWA 3LWNA 521PA 4NCKA 4NYMR 3KTAB 4A4DA 2HDNB 3M0EA 1NY6A 1E9BA 3KB2A 2J0VA 3Q7QA 2H5EA 4TL6A 1NLFA 5EP2A 2FU5C 2OBNA 2XOKD 1NN5A 5DO9A 3UG6A 3SFZA 4MRSA 4BLRA 2PMDA 2XOKA 2ZETA 3TQFA 1FUUA 1P61B 2J7PD 4Q48A 3N5CA 1XMSA 3VR3A 1TX4B 2WHXA 2RB4A 3GFPA 1AA9A 3KFXA 3EA0A 4OI1A 4BFYA 2YOGA 2F6RA 3QF4B 1Q44A 4LJ7A 3L43A 4JMPA 2FFAA 3P20A 4QL3A 1JR3A 2A9KA 2FA9A 4YMVA 4Z51A 2JIZD 2FE4A 1JR3E 2W83A 2CEAA 4HAVA 5C1BA 4M1TA 1M6NA 1ZNWA 1Z2AA 1J70A 4AD8A 1EWQA 1MO4A 3GJ8A 3SI7A 1JJ7A 4LJ4A 4A2WA 1UEJA 4CT5A 2PCLA 1G64A 1CIPA 2Q9CA 3FMOB 2ZRIA 4TMWA 1ZCAA 2FGJA 2W0SA 4HDQB 3WRYC 1M1YE 1MO6A 4PC7A 2ANCA 4QBHA 4M1OA 4FMCF 1OYYA 1LW7A 4JVNA 2NZ8A 4CEHB 4QC2A 3A36A 3TAUA 4C0QC 2ZE7A 1VDZA 3BOSA 3IGFA 3ZYCA 2ZRNA 2FPLA 4C30A 1Z6GA 1KMQA 2IW3A 2AR7A 3IKJA 4LCBA 5GJWC 3KKNA 1Q12A 3PXGA 3K09C 4L9SA 5SZHB 1G3IA 1DBSA 3ICEA 2G3YA 3WMFA 4OYHA 4KI0A 3KJHA 4M1WA 1ESNA 2CCGA 3QBVA 1U8YA 2OM2A 2IXGA 4FN5A 4LY6A 4NYJQ 3K9GA 2FG5A 4EPVA 2KJQA 4IOKA 1HV8A 3QXHA 4KFUA 1ZBDA 1D8TA 4JLOA 4JBWA 3ZGXA 5B64A 1DAIA 1YZUA 2V3CC 5HKKD 1UKVY 2ZAMA 4Q1BA 4Y0AA 5HKKA 2F3RA 1W0JA 1TEVA 5H1YA 2JAQA 4ILEA 4ZDJA 2QE7D 1CXZA 2E87A 4DIDA 2QORA 3VAAA 5J4KA 1HT1E 3QSYA 2UZIR 3F0TA 5JWOA 1CR2A 1U0LA 3LDAA 5FUYA 4KJZA 3N2EA 1FNMA 4IVQA 4KBGA 2CLSA 4EJSA 3A4NA 2CVFA 3BH0A 4EFNA 2J0UB 3S1AB 3WNBA 1TF5A 1WRBA 1G1MA 2ZPTX 3KJEA 3H0KA 1GP2A 1NN0A 1VYUA 4TL7A 1ZYUA 2FFBA 1T5LA 4V0LA 3WXMA 4B6FA 4JJZA 1TF7A 3IBGA 1KDPA 2ZRHA 4JLNA 4KXFB 5LB2A 5JWRA 4NCIA 3K70C 3U7HB 1OV4A 2OHFA 2GRJA 1P2SA 4XTCS 3EW9A 1W4RA 2ZUDA 2D7DA 4KFRA 1EFTA 2CMKA 3SJBA 5KDDA 1S8FA 2OFWA 3PJRA 3ICQB 3H2YA 2GAAA 3TBKA 3MWYW 4O25A 3RC3A 4B71A 4AKHA 1KJYA 3NBYC 5F2EA 5BWMA 1NVVR 4L16A 3T1OA 2NIPA 1KO8A 1QG2A 2WWXA 4E5UA 1UEIA 2QROA 1DAKA 4QBIA 1XCPA 2IF0A 1ELOA 1XBTA 3FMPB 3FVQA 2JLWA 1FL9A 1HQYE 4FCTA 3RABA 5IDVA 4OHXA 5HE8A 3MWLA 4JSYA 4G5OA 1Z2CA 1JPNA 1M2OB 1SULA 3W5IA 3NTUA 4URUR 2IYUA 2B6HA 4QJ4A 3ZD6A 1VG8A 4I99A 2A5GA 5CIWA 4YMUA 4B3GA 3FYHA 3I32A 1IXZA 1L2TA 2FWRA 2ZAOA 4AG5A 3FKQA 3OIYA 4ZV4A 3TRFA 1OHHA 2IS2A 1KY2A 1D9XA 2RKOA 3IHWA 4P32A 4A0RA 2J59A 4B43A 1IAQA 2F7SA 2X1VA 2H16A 1T0JB 4HSEA 4ACAA 4TL8A 2G88A 2BMJA 3GLGE 2N42A 4N1AA 3CPHA 1ZMXA 1RJ9A 3L8YA 3QOFA 4Q4HB 2GEVA 3IPYA 5TDHA 1TQ2A 1EG7A 1MABA 5HTKA 5DN6D 5FOVA 3HPQA 5DN6A 3MJHA 2Z4RA 1E79D 1W2HA 3K09A 4OL0A 5KPJA 1E79A 2ZI6A 2YKGA 5TARA 2ZJ8A 5GVSA 3QKSA 1EX6A 4RD6A 5DLQC 221PA 1G3RA 2QNRA 1TQ4A 4IFBA 4IW3B 3LW7A 1SXJC 1N0UA 2O52A 2AD5A 2ZJOA 3WBJA 1GKIA 2R8RA 5BW8A 3BAFA 3RANA 1OXTA 2ZSDA 3TH5A 1RIFA 1E9SA 2REBA 2X2EA 4F38A 2JLYA 2VP0A 4R9UC 1P9RA 3GFTA 3I3SR 3QEJA 2D4HA 2ZXUA 4G1UC 1SZPA 1W36C 4B3DA 4F93B 5FL7D 5JHGB 1NMXA 4DEXA 2ZS9A 3D6TB 3M1IA 2W0MA 4D4LA 2X2FA 4D0LB 4TMXA 4LRWA 4JZKA 3SJCA 4ZDWA 1OXXK 5CM9C 4BZPA 4UXHA 3DZDA 3VU9B 5AUQA 3AVTA 3LFUA 2ZS7A 3KFVA 4NYIQ 5E7JA 1E9AA 4TQ9A 2JLUA 1I2DA 3TQCA 4D80A 3K70D 4FIDA 4EJSB 5EUQB 4Q9IA 1KI3A 1II8A 4L8GA 4RJLA 2F3TA 5D3QA 4K81B 4OHYA 4FMCB 1PUIA 5EQTA 3NVAA 3GD7A 3T1TA 3ADDA 1CS4C 2F1HA 4UNRA 3K0EA 4KVAA 3NXSA 3A1TA 3OAAA 4G0NA 4Q7MB 2OFXA 2HJVA 2QM8A 1COWA 2ERYA 3KQLA 1P72A 3ZDQA 1OPXA 4IXNA 1TPZA 5KSPA 5C46F 4M1YA 4DZZA 3RWMB 5B30A 3I5YA 4DCVA 3AVOA 3DMDA 1Z0IA 3QXCA 2IYWA 1GOTA 2WWYA 2ASEA 2KWIA 4XWOA 2QTVB 1W4BA 5FI1B 1QRAA 2XITA 1N3BA 1XPUA 4C2UA 4ARZA 3TR0A 5BXQC 4BZQA 3X1YA 4MA4A 4V02A 3UMFA 3TUZC 2GKSA 1KSHA 3FFBA 1N5JA 2C99A 4JL8A 3U4QA 4C0HA 2OAP1 1HE1C 2PBRA 4DCUA 1X86B 4HEJA 4OHVA 2IUUA 1VG9B 3ND8A 2BOVA 3AVPA 3Q5EA 3CRW1 5FBRB 4C0SA 1G41A 1S1MA 1S0UA 2HLDD 3FTQA 2VF8A 1FX0A 4IFEA 4DCNA 1AZSC 3U2QA 2XTZA 4ERNA 3AM1A 2ZROA 3CR8A 1K8RA 4BLSA 3W5JA 1CBUA 4AI6A 1RJ9B 3W6PA 4Q19A 4PSVA 1M34E 4A6PA 1U9IA 1H65A 1GRNA 3OE7A 1MABB 2P6UA 4TT3A 1SXJD 3K0SA 1VPLA 1YVDA 2QPTA 3EPKA 1WXQA 3HU1A 3X2SA 4DLRA 2BC9A 2IEZA 1E2MA 1U98A 2QRZA 3IEUA 4Q1FA 4HAYA 2WTUA 3QKSB 4EPRA 1GRQA 1GL6A 1HH4A 2VP2A 5J4LA 2CCJA 1XNJA 1Z28A 4A82A 2FZLA 5DSZA 4KYIB 1LVGA 2P67A 2O8EB 1E9RA 3RS4A 2J46A 1NKTA 2ORVA 4DSOA 3OEHA 4LJYA 1AS3A 2GJAA 2BKEA 1Z83A 2ZEJA 1LF5A 1RKBA 3ZS9A 1E2NA 5KNBA 3H1TA 1HEIA 4QGHA 4XSGA 1JEEA 3R9WA 4HAUA 1G5TA 2BBSA 2D06A 2R6FA 3GMTA 5G40A 1G5PA 4FWTA 4JYCA 4RKEA 4Q9LA 2ZRKA 1FTSA 1QDEA 3FMIA 4RD2A 4DSNA 4CIDA 4ON9A 2BCGY 3NDBB 2O8CB 5EZ5A 2IWRA 3WRXC 5CK5A 3U3KA 421PA 4TTQA 2ZRPA 2JJ8A 2OSBA 3U7GA 1AIPA 3KJGA 3AVVA 2NO1A 1ZD1A 4XWKA 3LXXA 1P5ZB 5DYGA 3DKPA 3K70B 2CHVA 1UM8A 2ZUBA 1F5NA 3EC2A 2W2VA 4NYMQ 4DLXA 3B78A 3C16C 1XXHA 4DC9A 1MRSA 2HV8A 3Q85A 1Z06A 4URVR 2FSIA 1N0WA 5L3QA 2WICA 3PR1A 2FPKA 2B21A 3T35A 4Q21A 4A2PA 2XX3A 3A1VA 1LFDB 1BIFA 4UXIA 1GZSA 1XFAA 2RGNA 4ABYA 2OBLA 4A15A 1A2KC 2JLQA 1QHSA 1TQ6A 5JI2E 4Z54A 3O8DA 3J81k 4PAOA 3WP0A 3QKRA 2C95A 3NHBA 3ONWA 4DT1A 4W5WA 2YV5A 3CWZA 1KDOA 3G5UA 3CIOA 5KPDA 3GJ0A 4MYCA 2PEYA 2PT5A 4KHZA 1R0WA 3AUYA 3CLVA 4KVGA 4LV8B 3WHLA 2GILA 2QRNA 3ZVNA 2RGEA 3FWYA 2GA8A 1OF1A 1WP9A 4FINA 4II7A 1ANKA 2ZRDA 1D2EA 2CNWD 3AH8A 3BC1A 1ESMA 4MH0R 4ARZB 3B8HA 3BS4A 4HAZA 5A0FA 2ZU6A 3BJIC 2IYZA 3RYTC 4JL5A 4PR0A 4TLEA 1CR4A 4GZLA 4M0LA 1X6VA 3X1DA 2QTHA 3RS3A 3HU2A 4NBSA 1YR8A 5JRZA 1NMYA 5D3MB 3EZ2A 3HWSA 1Z6XA 1P7CA 2BIFA 5JHHB 2R6AA 1FX0B 3V00A 3UG7A 3DDCA 5FUWA 4TQUS 4FWIB 3OIWA 4AYXA 4B32A 1FPMA 5AK0A 3HR7A 3L0IB 2YZ2A 2OUKA 2I1VB 2XNSA 1M74A 4KYUA 2P3SA 4JYBA 5EXXA 3ECCA 4PPQA 2A5YB 4OKSA 4LX0A 2DB3A 2PMKA 4KSCA 3UANA 5G53C 1QHXA 1GDDA 2IS6A 1CJMA 2QAGC 2PJRA 4KO8A 4RD1A 2BVNA 3Q8XB 1K6MA 1G7CA 2IX3A 1JI0A 3NH6A 4UNQA 5HE9A 1IY1A 1WF3A 4M2LA 1XTJA 2AXNA 3MWKA 4OQLA 2AK3A 2IYXA 4CT4B 1NIPA 3LW8A 3PQCA 2BEJA 4PAMA 1VG1A 5G41A 2EFCB 2ZR9A 3LBIA 3LX8A 2Z43A 4LYHA 2NO0A 1KJZA 4DWJA 1E3MA 3B1VA 3RAPR 3DM9B 4YMTA 3ASYA 4KFTA 5DNYB 4LYFA 3LQQA 1VCNA 4PSKA 5CJ2A 1YE8A 4JVLA 2JASA 3THWA 3KKOA 2WOOA 2ZJAA 2YWHA 1R8SA 1UFQA 3AF3A 4A8JC 1ZD9A 2ZQ5A 1GTVA 1IN7A 5IT5A 3QJYA 1NY5A 3FB4A 1HQCA 3ZIAD 4WVFA 4M9QA 4LJ6A 4OI4A 1UPTA 4BWYA 1F3OA 4IOJA 2IXEA 3W8NA 1XXHB 1A5TA 1KKMA 4RFVA 4U02A 2UKDA 2QEQA 1NVVQ 4NONA 4NCNA 4QGGA 1KJWA 3N70A 3ETLA 3QF4A 2BDTA 4RZ2A 2IYRA 1QHYA 2DFNA 4M9ZA 1S1CA 3NH9A 1R0ZA 2CL7X 3WHKA 1BMFD 1Z08A 2BJVA 2IK8A 1HT2E 1OW3B 3OHMA 1W4CA 821PA 1NG9A 2KE5A 2WJYA 3TW4A 2WJVA 1NBMD 5F9FA 3CF6R 1II9A 1NBMA 1N6IA 1Q1EA 1QHHA 2WWFA 2OEPA 1E1QA 1SHKA 1YZTA 4MKHA 1KNQA 2VP4A 1KNXA 1KI2A 1WQ1R 4CEHA 1PLLA 4JVSB 4PAQA 1NN3A 2ZRFA 2JJ1D 2WWHA 4C0LA 4DRZA 1KIMA 5FTMA 1L8QA 4Q00A 1RYFA 2QSZA 3QENA 2Q3MA 4HDOB 2FMXA 3LLUA 1R0YA 3GJ5A 2ZI5A 3B13B 2MMCA 4BLQA 1BH2A 3U60B 1NRJB 4DLUA 4QHYA 5AUNB 4TSFA 4KBFA 1YZQA 2QQ0A 2EVWX 4WW0A 3SYKA 4DLTA 3THXB 2F43A 4B34A 5IK2D 4HZUA 5B2ZA 2GDJA 3LD9A 2CVHA 3K0AA 1M7HA 4QBFA 1SVMA 5E3HA 1GG2A 4BFXA 1KZGB 4RZXA 2PZGA 4QGAA 1W0KD 4NP6A 1FP7A 2A2ZA 1TU4A 5F9HA 3AVUA 1OKKA 5HCIA 4WZBE 5L3RA 4MRVA 5JZVA 3KX2A 4DSTA 4YMWA 4LYAA 4OK6A 1E0JA 2P6NA 4PC2A 3O8CA 3THYA 2ANBA 2IEYA 2YWFA 3WBKA 5BYKA 4XTRA 3C5CA 2OILA 2J0UA 4TMKA 1E2HA 1BKDR 4R2HA 1E2LA 1NIJA 4JVMA 4G5SA 3UPUA 4D2IA 1PVOA 3IQXA 4B3CA 2LCFA 1LB1B 3CKLA 1HE8B 3QVUA 5GVRA 1K5GA 2F1IA 2JEOA 2ZE8A 3P4XA 3CR7A 2QPAA 2V8OA 2IC5A 3A8TA 1A82A 4D4KA 3KKMA 2G9NA 3GEHA 1MV5A 2IHBA 2P5SA 3IEVA 3QBTA 1IXSB 1GKUB 4KFSA 3SYNA 2QP3A 2IYQA 4LJ5A 4UNNA 3B82A 3THWB 2HYIC 4TL9A 1QF9A 1SKQA 4HLUC 1CKEA 1G7TA 4M53A 4DCSA 1E2IA 4Q01A 2GCNA 3SDZA 2IWHA 2Q3HA 4HLCA 3TSZA 2W58A 3P4YA 3ASZA 3LX5A 5JMTA 2ZJ2A 4TYYA 3MUFA 1KI4A 2OG2A 1X8KA 4W9MC 3AV0B 1O3YA 3PIRA 2J7PA 1NMZA 1E2KA 2BBOA 1H8HD 4JIMA 5DISB 4Q03A 1H8HA 1OLOA 4H1UA 1T3LA 3OF5A 1G17A 2JLXA 3GLHB 1J8YF 3H86A 3KL4A 4D81A 1DARA 2JIZA 2P6RA 3FDIA 2FNAA 2WSMA 3EIQA 2GVZC 3IO3A 2G1KA 4C0BA 2YNMA 3ZLJA 3R9IA 2GAOA 1DAFA 4D6PA 4BGDA 3DVLA 3THOA 4US2R 2H7VA 2AK2A 2ZR7A 3NDPA 1R6BX 1LF0A 5CK4A 4I4LA 4Q4HA 4AG6A 4XD7D 2RHMA 1E2JA 1QHHB 2CLDX 5DI3A 1QHNA 3JZMA 4KV9A 3L0SA 2IS4A 2Z0MA 1X8JA 5DGXA 2IYLD 4AKEA 5FUVA 4IRUB 3ADKA 3BORA 1GM5A 2RHDA 3AEZA 5BN5A 3REGA 3IBYA 4PHGA 2B92A 5C4MA 3OEED 3V4FA 2YHSA 1NVUQ 3CF2A 3M6AA 1ZINA 4JKIA 1RRGA 1TAGA 4NMMA 5CDFA 2BM1A 4XIGS 3SU8A 2DFLA 1NSFA 3MD0A 4EIWA 3PEYA 5CDFE 4BPBA 2O8BA 3IUYA 4B76A 3FKSD 3G82C 4OQFA 2BKUA 2QAJA 1Z3IX 1UKYA 4HB2A 2YYZA 2EYQA 2ZR0A 1VHTA 1LS1A 5JEDA 1W5TA 1XD9A 2WVJA 4QJ5A 2V7QD 1TMKA 1RRCA 2F43B 1ZVQA 1RFLA 1Z6AA 2ECKA 2V7QA 1E94E 2ZJYA 4HZUB 2GEUA 4EQ6A 3QXSA 3QG1A 1T0HB 2RGDA 3R7WA 3K0AB 5H8WA 1CRQA 3C7KA 1UDWA 4NL4H 1GNPA 1Z22A 2IT1A 3V4RA 3RRNA 2OLJA 1P62B 4ZDKA 1XMVA 1GUAA 1M7BA 2VO1A 2XZOA 1TQDA 1GNQA 2DY1A 2J5XA 2QE7A 4MYUA 3VU9A 4TYPA 1V43A 2HF9A 4FI3C 2PX0A 3K9LA 4MGYR 4B6EA 3THYB 2RGGA 3UWKA 1CJVC 4AKIA 2JGNA 3LLMA 3QEOA 4Q4LA 5LB4A 5IF9A 4DB2A 3BFKA 1XJCA 3IPXA 5FPYA 3MSXA 2XJ9A 4TTPA 5FOSA 4IDNA 2REOA 3U7FB 4AYTA 3V9PA 1TUIA 1N5LA 5TVKA 3VKGA 4OJKA 1AQUA 3UATA 1XEWX 1NLYA 1D6JA 4LOAA 2NQ2C 1OYWA 2ZI7A 4PO8A 4F91B 2PH1A 1SVIA 2JDID 3AP1A 4PQYA 2DCUA 1J2JA 1KI7A 1LNZA 2NO7A 3CPEA 3H4MA 3I1FA 3M4YA 4DSUA 2O8DB 3KQKA 1ZM7A 2GZDA 3HPRA 1ZP6A 4US0R 3MMPA 3SN6A 2KI5A 4B2PA 4M22A 1OIXA 4Q66C 4AIIA 3OESA 2X8AA 3FOZA 3I92A 2ZUCA 4B3XA 2J9RA 1WBDA 1ZU5A 4FD2A 1MOZA 2ZITA 3LH5A 4EDHA 3U3MA 3CBQA 4QRHA 1N5KA 1IJEA 2ONJA 3SBDA 4LWZA 1WCV1 1YZNA 4DDWA 4GPTA 2BMFA 4UKDA 1VIAA 2JATA 4G3XA 1P75A 3BERA 2I3BA 4BFTA 4QKQA 2DBYA 5E7MA 3A6PC 4G5RA 1XD2A 2WJIA 2IUSA 3CZPA 1XTKA 4PQRA 3TUJC 1U99A 4HATA 2AFHE 3IIJA 3T1VA 1YZLA 3K0CC 1OXSC 1E2GA 1KMHA 3GEEA 4P3YA 5KNDA 4FMDF 3R9XA 4MKIA 1RRPA 5DI3B 2W6ID 1KO5A 1IM2A 3VR4A 4LBZA 1AN0A 2ZJBA 1LV7A 2CE7A 2VRWA 1TUEA 2XB2A 1KAOA 3CF0A 2VP5A 2FJUA 1IN5A 4LSGA 3RSOA 3ZH9B 4CVNA 3B7GA 1LTQA 1DE0A 4Q4JA 3K9NA 4RD4A 2O8BB 1A1VA 3NC1C 2O8EA 4TLAA 1N6RA 3CNLA 3IIKA 3KKPA 3SEAA 4CDGA 3EZFA 1AK2A 4RFSA 2IS1A 3UKDA 1KSJA 1VECA 1KSFX 1Y3AA 5H70A 4EQ6B 3F5FA 5KOYA 1P73A 3R7WB 5KO2A 4EPYA 1UBCA 4KAXA 1R10A 4LV6A 4B2IA 3OIVA 5FL7A 2CHGA 2V6JA 1N25A 5KTYA 2J1LA 4DLYA 1OXVA 4ESHA 2O8CA 2NO9A 2XNDD 3ZQ6A 2HXSA 1TEXA 3CNNA 2GJ9A 3RVBA 4JLJA 1CEEA 1E9CA 3I61A 1KO7A 1Z6YA 4F92B 5EE1A 2IBMA 4X8LA 2EFDB 1IN6A 3CNOA 4RD3A 1W48A 1YR9A 1IN4A 3B1XA 4MUBA 1QHGA 4JL6A 2W2XA 2GJSA 2WMOB 1KI9A 3EZ6A 1NJGA 1XWIA 2BMEA 2XAUA 3AKDA 3VR1A 1G8HA 1CULC 3L0PA 4TLDA 4GI7A 3ADCA 4LBYA 4DLWA 3TLXA 3Q7PA 5KNCA 1TU3A 2N1BA 2R9VA 1TL7C 3TNFA 2ONKA 5DE3A 1B0UA 3E2IA 2XJ4A 1XP8A 2OLKA 3LBNA 2EWWA 2CCKA 2XEXA 4MYHA 1T6NA 1EXMA 2V4ZA 1G7SA 3B2EA 1XCGB 2H92A 3Q5DA 3OIUA 2GCOA 1EFHA 4JLMA 5E95A 1YQTA 3TVDA 4C9BA 2ZVPX 4MRPA 2EFEB 2GXSA 4GRAA 3DOFA 1VHLA 2EFGA 4OI0A 3R20A 2PZEA 1E98A 2FSFA 4R2IA 3NIBA 2GXAA 1Z0DA 3LBHA 1Z0FA 2GXUA 4DLZA 1DAEA 1Z0JA 2O0JA 2ZRMA 4DJTA 2D7CA 3KUCA 3WY9A 1MKYA 1KKLA 1P3JA 4PX9A 2X77A 1G4UR 1E1RD 2KBFA 4BZXA 4DDVA 3W3AA 2PLFA 3AQ4A 3MAAC 3VTKA 3Q9LA 3GCGA 1XD2B 3EAQA 2VHQA 4JSTA 5D3MA 3A1SA 4PHTA 4HUQA 1E6CA 2YOHA 2J3EA 3AP3A 3RS2A 3AF4A 2HLDA 4Z8XA 4Q9KA 1VYTA 1KMHB 3RRZA 2HF8A 2P2LA 4DBLC 3BK7A 5FPSA 1Q1QA 4TZ6A 5FOWA 5KDOA 2RMKA 2ZJ5A 5JWHA 1JR6A 4KU4A 3CRQA 1Z0KA 1EFRD 1SXJA 3KDSE 1KK0A 1EFRA 3DOEA 1SXJE 1DEKA 1NLZA 4BECA 2C04A 1XMIA 4RY2A 3BB1A 4I1OA 1KDTA 4IOMA 2RCNA 1D2NA 4P33A 2VSXA 2A7QA 4Q4JB 2GZAA 1ZM3A 1W36D 2YOFA 1FMJA 3MG9A 5CLQA 1G18A 5TXGA 3GQBA 3CUEF 4JLBA 4B44A 3DEFA 4RFSB 2GCPA 1FFHA 2ZSFA 2PX3A 4CYMA 1HTWA 1N6NA 4GZMA 1KI8A 1Q3TA 1ZM4A 1EESA 4JS0A 1Z8FA 4MKFA 3PUWA 1XEFA 4A0HA 3HYRA 5F3WB 1FZQA 3FPAA 1SGWA 3PUXA 4NCHA 3I4LA 1VCOA 5H68A 4B33A 1G6HA 2Q9AA 2B8TA 3WP1B 1L7VC 4YDSA 2HJGA 1F2UA 1G20E 1T8TA 5FOUA 2PEZA 5AJXA 5J40A 5AJWA 3PG5A 1ZIPA 4PO9A 4B73A 4M4SA 1ETUA 4FXPA 2CK3D 4TZ0A 4FMDB 2DFTA 4HAWA 4WBSA 4BFSA 1MH1A 1G19A 3TVTA 4C2TA 5EP4A 1XX6A 1J90A 2AN9A 3AKYA 3RHFA 1UBGA 4DKXA 4NDZA 2DHRA 2BWJA 2F9MA 4UJ3A 1J8MF 3LAWA 3U7EB 2GETA 2V55B 3QNUA 1Q1ZA 1SVWA 1XXHE 3NG1A 4IDQA 4OBEA 4YXWD 4A36A 5TV2A 4O2LA 4YXWA 1TNDA 3C5HA 2Z4SA 1CLUA 4A92A 4HI0E 1Z07A 3D8BA 1AKYA 3QF7A 3K9HA 1P60A 2G0NA 1AZTA 2OCBA 3PENA 3WNDA 1OFIA 3NBZC 5FPKA 2YWEA 4IEEA 3BH6A 2GCOB 4JT4A 3SBEA 1OH7A 2ZI4A 1YZGA 4MGIR 4M1SA 1OB5A 3T06B 4IXMA 5KU1A 5UKDA 1J7KA 2ZSBA 3EWSA 4CZ2A 1N5IA 4L4UA 2WWIA 4NU0A 5GJCA 1CR0A 2CNWA 4K46A 4W5HA 2C77A 3RS5A 3RWOA 3TW8B 2HYDA 3U3OA 1JNYA 2PCJA 4LK2A 5L3SA 4DLVA 1XEXB 4E09A 4GMXA 4BEBA 3U44B 2YINC 4Q9HA 4B47A 1UDXA 4EUNA 1R7RA 4B75A 1US8B 3NWJA 4LC1A 4ITRC 3UXMA 3VR2A 4DEYA 5JBQA 1XB2A 1HURA 2IXFA 1GRRA 2GBLC 2Q3FA 4HUQB 4M8NE 4PPNA 5FTKA 5J5CA 2YVUA 4B2LA 1P6XA 1FNNA 1S9HA 1L4UA 4JJKA 1GIAA 2PJZA 4M21A 1KSGA 3RS0A 1T3SA 3THXA 3CO5A 4HZIA 1FTNA 4B3BA 4S2EA 4HB4A 1XPOA 2BMDA 4DUGD 4NTZA 4DUGA 2O0KA 3ZVMA 1N6OA 4FW9A 4WAUA 1VIYA 1GWNA 3B5JA 1N6LA 1I2MA 2WPDD 1JB1A 1SXJB 3I72A 5FBVB 2R2AA 3E5HA 4HLQB 3W8RA 4IEIA 2XTMA 2PLRA 5K8LA 4MRNA 1NSTA 4PTLA 1ODFA 1I4TD 3OZXA 5JI3E 3A4MA 4NE2A 4BRUA 2J0SA 3EPLA 4XH9B 5AJZA 1E0KA 3KB1A 3DKVA 2LWIA 1SVLA 2HXYA 3NKVA 3H84A 8OHMA 1RC8A 3QXJA 2CLCX 3MGCA 1W36B 2F55A 4H9GA 2C03A 1S3SA 1V5WA 2OV2A 1JAHA 4BASA 4JLVA 3ADBA 1XCMA 4R71A 2VSFA 1U94A 5JEEA 2YC2C 3U61B 1DS6A 1E9FA 1JQJC 4I1SA 4GSYA 5FL3A 1IQPA 4QGFA 1XEWY 4MDEA 1E0AA 1XJQA 1G9XA 4BRWA 4LV5B 3G0HA 4L15A 4LHZA 1HA3A 3BH7A 1ZUIA 2I1QA 4BLPA 1F2UB 1BO6A 1QZXA 2QT1A 1GL9B 2NO6A 3CW2A 3HU3A 4QM7A 3EC1A 3RRYA 1G3QA 1XF9A 4RCZA 3U6BA 4HYYA 3QI2A 1IY0A 3ZIAA 1CTQA 4JLAA 2C2HA 4L9WA 2V1UA 2V6IA 4ZCIA 5K8TA 4WXRA 5GADl 2ZIAA 1D2MA 2CL6X 1QHIA 4K8OA 3KKQA 2AWNA 2V54A 3I73A 4DDUA 4EAQA 2ODBA 3GLHA 1KY3A 5KDLA 2FSHA 3GLHE 2AD1A 3PUVA 2J7KA 4Q7KA 4XVQA 5P21A 1OFUX 3TE6A 2C78A 4URZR 1GNRA 2GHIA 2GTPA 1BMFA 1I4DD 1N6HA 2KB0A 2VIIA 2QMEA 3P32A 4RVCA 3AGPA 1IOZA 2FFQA 2UVQA 3O8RA 2D2FA 3QPUA 1Z29A 4IKEA 1W7AA 5EXTA 3LO5A 3I8SA 1XD8A 1NBME 4QNRA 2WWGA 4O0MA 3T12A 2VA8A 1MRNA 2D74A 1ZNXA 5BN4A 3D31A 1DAMA 4S35A 3P1JA 1RPZA 3AKEA 1E2FA 4OHZA 3KQUA 2CXXA 2WKQA 3A4LA 2KBEA 3VX4A 4Z1MD 4Q18A 4Z1MA 4DDTA 5L3SB 2JJ1A 5FBWB 1M7GA 3KXIA 4TLBA 3WNCA 1OT3A 4HLDA 2WOJA 1XRJA 3C14C 2LKDA 2QTFA 1GL7A 2H57A 1ZNYA 1GFIA 1X8LA 4LHWA 3JVUA 3U3JA 5HZHA 1Z6TA 3EZ7A 3QQ5A 1U8AA 3EG5A 2ZANA 3CRVA 4XOIA 3RSLA 5IK2A 1W4AA 1DAGA 1CU1A 1YZKA 4KLZA 1ZCBA 3RS7A 2VH5R 2QAGA 5TB5A 5IRCD 1G291 3EPJA 4PANA 3AVWA 4OI2A 4MGKR 4PC1A 3AUXA 4X8HA 4V0OA 3GFOA 5EE9A 4D4JA 3BWDD 1ZUNB 1W44A 3E1SA 2I4IA 3SC3A 1W0KA 4IDPA 4A6XA 3EZ9A 1VMAA 1R5NA 1Q57A 2IA5A 2SHKA 2AFIE 3BIFA 4GP7A 3GLIB 5FTLA 2RGAA 1W47A 5EE0A 3W6OA 4HB3A 5TMPA 2QGZA 2QY9A 2ZU0C 3EXAA 4NHOA 1VCMA 3IDQA 4R7ZA 5FBQB 2BBWA 4F4IA 5KSOA 2UZ3A 3MJRA 2VF7A 2GF0A 1KAGA 1X1RA 4IOLA 1G8PA 5B58C 4CEIB 4B35A 2IL1A 4AURA 2JLSA 3NC0C 2Z6VA 3L0OA 4P4SB 2OCYC 2H8KA 3FHCB 1KK2A 2CBZA 3WYAA 1GITA 2QN6A 5AJYA 1G8FA 3CPJB 4YDHB 1JXOA 4A8JA 2ZRJA 4DB4A 1Z0AA 1G8YA 1YRBA 1RE0A 2IUTA 3JZAA 4JT2A 5CYOA 4Q1AA 3Q72A 4OK5A 2A5JA 2QM7A 5JSZA 2O8DA 2AX4A 3QE0A 3SHFA 1DADA 1JBKA 2P5TB 2NG1A 1MO5A 2ZRAA 1XU4A 4CW7A 1KTVA 4EJSC 3LVQE 2NGRA 4Q4AA 2VLIA 1F2TA 4GNKA 5DYIA 2JLRA 3I5XA 1OH6A 3DL0A 2W6JD 1G3MA 1P2UA 2B7BA 4Q7LA 4QFMA 2F1RA 1C1YA 2ZREA 5CB6A 4O3MA 1KYIA 1NP6A 2J41A 4JKYA 4ZKDA 5KSZA 1U90A 4UQOA 1U81A 4WZ6A 3TUIC 3RNLA 2GJ8A 5JECA 3CX6A 2QPOA 3EX7C 1ZIOA 4I1UA 2RGCA 1UAAA 1G3UA 3C4JA 1CJUC 3VNVA 4EKDA 1E2QA 2EQBA 3AVQA 4URXR 5FPTA 1TF2A 1E0SA 4D82A 1X3SA 4Q5IA 1A4RA 5HR5A 3P27A 4KITB 1TTTA 4LC0A 4HUTA 4XD7A 5E7IA 3GJ4A 1FOEB 4L5BA 4U7DA 1S3GA 1PV4A 1OIWA 1JR3D 5JFGA 1SHZA 1ZU4A 2AXPA 4A0GA 3NHAA 1R2QA 1JJVA 2R6GA 4IVRA 2VL7A 3HYTA 1RW4A 1U8ZA 2FZ4A 3C41J 2QMOA 2QQEA 3OEEA 3NEJA 3RRMA 4AC9A 2JLVA 3QIAA 4M1MA 5FFMA 3L82B 1D5CA 4ZCMA 4WA7A 4U5XA 3ZD7A 2IYSA 2FOLA 2QP4A 5BQ5A 3JVVA 3FKSA 2WWWA 5FOTA 1E99A 1UJ2A 5KYKA 2GWHA
chains in the Genus database with same CATH superfamily
4Q47A 1Z8NA 2JK1A 1ZD8A 2VVTA 1XTSA 3BXZA 1AGRA 3KSRA 2QP9X 4KN6A 5HKLA 3VHXA 2R00C 1MB0A 1T9DA 2VTKA 2ZJZA 4J94A 2QAGB 3AF0A 1LS6A 3VSDA 4ES6A 3R8FA 1VSUA 2HCJB 3KSUA 3TQOA 1ZUHA 4ECAA 3EGEA 4Z1MD 3AEQB 4FJ2A 4M7OA 1NBOA 1LQUA 2IZOA 1II0A 1VKJA 5TE9A 5LMUB 3B1ZA 4TQAA 2CUZA 4IDGA 2WUEA 4LZNA 1L5MA 2AFIB 1CY7A 1S8AA 2AV6A 4GZ3A 5DGIA 1XWFA 2CJPA 2QXUA 2OOSA 3CRZA 3OOHA 2H52A 3QP9A 2C9DA 4FCVA 4FKZA 5AI6A 1KI6B 1ID1A 1QV6A 1U0NA 3HJNA 2Y3IA 1PVVA 1YAHA 2WILA 2YY6A 3QGMA 4Q9AA 3LGSA 3SJAA 2WABA 1GYRA 3MFYA 4JBNA 4KHPB 2B4QA 1ADYA 1SVNA 3IPLA 4MVJP 4Y3UA 3M4JA 1SN7A 2AKAB 4PFJA 4C0JA 1WB9A 2IYNA 2G0TA 1WOMA 2PSSA 4TVKA 2Q21A 3E22A 4BQQA 1R1DA 4CEJA 2PFSA 3K20A 1VMKA 2HL6A 1WMSA 4TS1A 4CKZA 3BTUA 2ERXA 1XC7A 1ZRHA 1F6BA 2CJXA 3B6EA 2ZYUX 5AHXA 3FZNA 4UZSA 3T3PB 5G3ZA 3VBEA 4KBYA 5AXBA 5A3RA 1BYUA 3HB0A 3VVBA 4DCTA 4MS4A 3AP2A 3H3JA 3T7TA 3P2YA 4BO9A 2PAFA 2LKCA 2OWEA 3S99A 2HD4A 1NKSA 2P2DA 4DREA 4QUAA 5KNBH 3BA6A 3UHOA 3WLNA 2LIVA 5LQNA 5KOJB 3I58A 3LC2O 1UM9A 2QTAA 4G5GA 4CMAA 4KACA 4YEDA 3FX2A 4BDSA 3VC3A 4UMDA 3UFXB 2BDEA 2FR8C 4JJAA 3KOMA 1MIOA 1DEAA 1JDPA 3VVCA 3WMEA 3C3CA 2KLBA 1GYQA 4OQNA 5FUMA 2PE5A 2VYVA 3VKHA 1QH8A 3ROMA 4ZOEA 3EEQA 5JO9A 2DUUA 3UCXA 1SRQA 4QT4A 4KPFC 4CIBA 3ETNA 5EUMA 4E1AA 4PYRA 2NTYC 5IBRA 3QE9Y 1DGQA 4J90A 2F8SA 1CR1A 1N1GA 1YZVA 2AUTA 5JDIC 4B6PA 5M04A 1UBUS 4EA9A 2G7ZA 3NLLA 5HBGA 1FK8A 4J29A 2D62A 3GGPA 5ER6A 5IJAA 4LIPD 3CHYA 1I0LA 1SUIA 3AR6A 3WGZA 4AJEA 5CBKA 1TAUA 3X1ZA 4JLUA 4OJYA 3HB7A 3DGEC 1L4YA 2OE2A 4FSXA 1A2BA 2VXYA 4KMOA 1RE1A 1GG9A 1L5ZA 2E9SA 3EVDA 2GHRA 1L4GA 4CIWA 3U1BA 1GGNA 3VH1A 3WFIA 2FEMA 4QX6A 1JSRA 3LP6A 2WC1A 1UINA 3JPYA 4WNYA 3VISA 1UFRA 3AESB 3CZ9A 2W6IA 2XW6A 5H02A 1THMA 5CITA 1IOLA 1URPA 3SSMA 5L6MB 2QU8A 1DTSA 3KEOA 2BFDB 4KV7A 3WJ2A 1I1QB 2X8JA 3MYYA 4ZC8A 5JASA 4AKGA 1ZQ9A 4QHTA 2PU5A 4YWHA 4OJNA 4BNYA 1LEHA 1EWRA 2DR3A 4OA5A 4WOBA 4GOXA 2X4IA 4GPD1 4NAHA 3FNGA 4GDFA 2BFOA 1S02A 4ZCTA 2J5RA 5J58A 4BGVA 1O6BA 1QO0A 4FDTA 3KHSA 2RH5A 3LQKA 3RW9A 1UZMA 1X2BA 4RCYA 1ZAYA 2NADA 3MSCA 1GT91 3MXOA 1Q14A 2WYUA 5BRAA 1M1YB 4X94A 3G8DA 1AT1A 2FLKA 3HUTA 3T6KA 3GR6A 3L07A 3FGPA 2AEFA 4R84A 1ZNZA 2PXAA 4WOPA 3PQEA 4Y7DA 3JAMA 3FUCA 1JG4A 4HVCA 3TXXA 4AJ9A 5ALPA 3E53A 4JBGA 4HLNA 2AQKA 2Z5VA 3PPXA 3T7SA 3MFQA 1ZXLA 1UWVA 2I1LA 3HB9A 1ZNQO 1P5JA 3B9PA 1D1QA 1N1MA 1BOFA 2C8LA 1RZRD 2OR3A 1RQGA 5EIBC 5LYJB 1GZ5A 3GJTA 5EZSA 4D5GA 1ZAKA 1T36A 1LJUA 2BCJQ 3DL2A 3PC8A 4FLFA 4O1MA 4B8ZA 1O97D 1G6Q1 3ZE8A 3JR7A 4OQXA 1KI1A 3NFRA 2PRIA 5CXXA 2JGDB 3PITA 2B2XA 1WKVA 3FE2A 3FPEA 5ILGA 3WWEA 1KEEB 1T2UA 3BDAA 3G0BA 5B57C 4GDMA 3ANNA 3TJMA 3H2KA 2O3JA 1R8QA 4L5AA 5ED4A 4PRYA 3EZNA 1XTIA 2XMQA 3QA9A 1SCUA 5CVDA 3G13A 1ABBA 1XHFA 5ALSA 4C6RA 3GCXA 1MA0A 4TV8B 1HKHA 1VQ1A 3QH4A 3FR8A 2C9ZA 3PNKA 3GGDA 1XNQB 2B8EA 3DAHA 2V45A 3MPOA 3I28A 3CX7A 5KHOC 5EIWA 4RX1A 1JXMA 2IPAB 3O2QB 3ZGNA 4LG1A 3WB1A 3EGIA 4E5SA 1W5FA 4OP2A 4E03A 3CWQA 3HFSA 4JAVC 4QXAA 4I3FA 1E4OA 3ZLBA 1Y1QA 2GAJA 2EFHB 2J4DA 5DB4A 5J9FA 5JVDA 4JA2A 3QKIA 1XVVA 2PUVA 4F9EA 2VDRB 3N0VA 3TZKA 1ZSNA 2Z30A 5EWMA 2X19A 2Q5EA 1GSIA 3QKTA 4F06A 4V0SA 4R0MA 3OZAA 3MWFA 1MT3A 4JLPA 2QTZA 5GOZA 4AXXA 4M0CA 3HN7A 2YXPX 1HRKA 1JBQA 3MQFA 3I2GA 3N5KA 4PC6A 3UJNA 5KOHA 3CLRC 4QUKA 1KH1A 5HF8A 2FW7A 1I4EB 2ODNA 3BWBA 4CKEB 2Y4OA 3CJTA 3RYCA 4UHKA 5K8IA 3PEWA 5TQ0B 4N39A 1OXBB 1MGOA 5FBLB 3VSAA 3JQDA 5HRAA 3CT6A 4B6QA 3IILA 1ZISA 3C39A 1KAHA 1MJNA 5DBHX 1PV4A 3TLYA 1QYXA 1S3IA 2HAEA 4Z49A 5D7NA 5FV7A 4BNFA 1JDVA 2GXQA 2RGNC 1USUA 3MTEA 3SBXA 4H7EA 2ONCA 2JFGA 1BS1A 4YC7A 1EGQA 3UO8B 1IRIA 4A2CA 2FEOA 3FF4A 4B82A 2BEUB 2C9YA 2D2VA 2IOFA 3C15C 4YRCA 2G1JA 2B99A 4CQJA 2RGBA 5L3VA 4D0GA 2P0AA 3AOGA 3B1YA 3DTYA 2GWRA 1IG3A 1CF4A 2JCYA 4GYYA 1T3HA 1PZMA 1B3BA 4OQMA 3ETJA 2C54A 2H00A 3CY6A 2NUBA 4A03A 1SNYA 5DBOA 1XMQB 4Y9TA 4PYJA 4CN8A 4PCAA 3N8GA 3PQ8A 4DLPA 1ZGGA 5DH9A 3O6VA 4G1MB 4H4EA 4WK0B 5HM8A 1KKUA 4IO1A 1PZNA 3MLBA 1OZHA 4QUJA 4D7AA 5EHXA 1AJEA 5C4GB 1ODSA 5K1ZA 4X1OA 5KJEA 1A7JA 3KDAA 4YRDA 2DUMA 4AZVA 4B79A 4F72A 1WB5A 3BL8A 1YBVA 4MGZR 4W8HA 4B1FA 5AIAA 5AUOB 5HJ7A 4M7RA 1FRFS 1AQNA 1J23A 2XR1A 4P4LA 5AKKA 4AU1A 1J0XO 1JHAA 2VSOA 1SUSA 2J3DA 3OFND 4PC3A 4JB2A 2D3WA 2JLZA 3GPDG 4KCGA 1JG3A 5GJBA 3I6BA 2PQMA 1TI7A 1IY9A 2ZIVB 4PZ9A 4NYJR 2X1HA 4KPUA 5BQFA 2FN9A 2IU3A 3R0XA 1R0SA 2GR9A 1OX5A 3TEJA 4C3ZA 2WT4A 1X15A 4LJ9A 2AI3A 2GJKA 4HWKA 1S4QA 4PZEA 4KTVE 5EP1A 5HF5A 3IULA 6Q21A 2PKRA 2UVPB 1CR6A 2PH7A 3GBVA 4KLAA 4N9WA 1XCLA 2MSKA 4RIIA 2VZ9A 4PTYA 5E3IA 5LNK6 2IP4A 1W87A 3ZVRA 4ETWA 2W8BA 3U9SA 4JYZA 3E3LA 1GV0A 3LGXA 3P8ZA 4X90A 1KZ7B 4TLCA 1V16A 1A04A 1YL5A 4BFUA 4LJAA 4ZVQA 3GJ7A 5K6RA 4UM5A 3Q3HA 4PZYA 1PBNA 1T26A 1Y9DA 3FETA 3UMSA 3ZGLA 4BU0A 4C0AC 1DAPA 2MSEB 1MEJA 2QHXA 1YR2A 2H18A 3JQAD 1NWCA 3EMVA 1ECPA 1Z4QA 2JJ2D 2QW1A 3GJQA 1ICIA 2WAXA 3L8FA 2AW3A 2WSSA 3RDPA 2AC4A 3SICE 3V48A 3QUQA 5TT1A 2CXSA 4A9AA 1CVLA 2BHLA 4DMMA 1Z9BA 4Q0MA 1IXKA 4WESB 3SPXA 3VV2A 4H16A 2PQ2A 3ZHRA 3KXKA 3KFLA 1E3TA 4ENTA 3AT1A 1QGZA 1IM5A 2ZULA 4UTPA 3SQXA 3KNZA 5FWXB 1VRCA 3MUNA 4AP9A 4AY5A 2IQ5A 5CR9A 3T61A 2ZS8A 1N9GB 5D1NA 5JAQA 5D85A 1DXQA 2GKOA 3Q3JB 4N0PA 4YECA 4O4IF 2H4FA 4MA0A 3AR8A 1PG2A 5F5NA 2DLCX 4ZTBA 2D1SA 3MF4A 1T1IA 2VRCA 4J0JA 3UMVA 1UT5A 2RBGA 3UN1A 5EZYB 2QF7A 3MJDA 2DFKB 1ICEA 3QLUC 2MMGA 1DJOA 4IVPA 4P4UA 1RM5A 4U00A 4F9GA 2QX7A 3RU2A 5CIYA 4LWPA 5LZ8A 3Q15C 2IPLA 1WMDA 2VXOA 3GNTA 2HPHA 3L92A 4ZIRA 5JG7A 1XRNA 2AHOA 4FHGA 2V3WA 1H9BA 4MR9A 1S7GA 4C04A 1SOUA 4YV1A 4ZMBA 1AZWA 4W9RA 1S96A 4GZ5A 3NM6B 4JP1A 3ZK7A 4AJIA 2BGUA 3R74A 2GPBA 3U7RA 2BDUA 4EENA 4HMOA 3NATA 4RK7A 3N0WA 1IXRC 2H0QA 2XYGA 4ND6A 5EG5A 1NG1A 1ZXBA 5HDBB 5HPYB 1FJHA 2RKBA 2WV9A 1SZJG 3A58B 3IBCA 2O05A 3F7MA 4JLWA 4P4TA 3HR4A 2YN4A 1FXWF 1UADA 1U2RA 3DKIA 4FFBA 3TSOA 4LI0A 1FMLA 2YC4C 1SKAA 1Z4LA 2ACVA 3GD5A 2ILVA 3HRIA 1Y5NA 4JJ4A 3F8TA 4AJKA 1GVHA 1SG6A 3DO5A 2BE7A 3DTVA 4MV7A 1R18A 1A96A 4DIOA 2P2YA 5C80A 3U4QB 2GEDA 5SYMA 4L4RA 1NZFA 3QPWA 4IDHA 4HXFB 1Z47A 4H60A 2JBAA 1CY2A 3NTRA 2VUIB 3OFJA 3X2FA 2PKYX 1Y6RA 1DQSA 1NVXQ 1ZBQA 1ZICA 3A3YA 1D1TA 2EFYA 2IX9A 2MDTA 2WK1A 4ADSG 1N32B 1Y8RB 1AU9A 1KBOA 3LKZA 3LY5A 4MUYA 2OXRA 3PK0A 1FYEA 4WCFB 2ZZNA 3QJ5A 1O6ZA 2IEAA 1XTVA 1Z0ZA 2Z8YA 3KVRA 3GB9A 1R0BA 2CW5A 4RHFA 2G08A 3TTVA 1T9HA 3WOVA 4CL3A 1PFYA 3V80A 3HKCB 2YQ4A 3QKUA 3VVMA 1KC1A 1V5IA 2Q0HA 4Q1DA 4ZXFA 4RWZA 2ZSEA 3PHBE 4FEAA 3U1TA 2VP3A 2BHNA 2AUMA 3E2PA 4MW6A 1QG0A 1YJCA 3OLQA 5I8ZA 3VTZA 4F46A 4MW0A 3AVYA 1G8GA 4ARBA 4QOGA 2WB2A 1IDOA 4HVLA 1UXOA 1KMNA 1MLDA 3SE0A 1JQ5A 1PJAA 4ZZ0A 3G7NA 1TVKB 2PL1A 2R66A 4UNIA 1CFZA 5A2QA 3A1EA 5J47A 3O47A 1K88A 4XLLA 1KJ9A 2O6HA 5JMOA 3QWFA 2XXAB 1XF1A 2HHCA 2PRKA 9MHTA 3EFBA 3KQWA 3BD7A 1O54A 1NNSA 5FV4A 3TGWA 2NYAA 3AGQA 3HBLA 1I4LD 1QV7A 2IYYA 5BR7A 5KYYA 1GQRA 3FVTA 5C5EA 4DY4A 4ZEMA 2QQGA 1CVIA 4NYIR 4D96A 2AI2A 3GT3A 4ZYWA 1OPRA 4BYGA 4GKKB 3LHIA 4CKWA 5EJ4A 1OFVA 2F1KA 2QZ4A 2HFJA 3I4FA 3L6OO 5IC4A 4KNYA 3MJCA 3QLVA 4J0QA 5E4TA 4DUZB 1YMUA 3C1UA 2G83A 3NHWA 2H1CA 1R6TA 3M4XA 5CNKA 1SVSA 5CLLA 3E9QA 1QPZA 2I2WA 1RBMA 1L7PA 1YOVB 4Y0VA 5EPUA 2F9LA 3ZNNA 1P9NA 1Q17A 2M32A 1QANA 4XWAA 2FR0A 2ID4A 4IICA 2WF7A 2OCLA 4W7HA 2M1XA 1L8LA 2E1RA 3RHZA 4H3VA 1SEPA 4X8MA 3TPFA 4EGCB 4Z4CA 5IWAB 1VCIA 1PR5A 1SXGA 3EXFA 3R7BA 1YB7A 2CDNA 3D8RA 1C41A 3LSTA 3ZX5A 3O2NA 1XCBA 3UBMA 1IFXA 2B9EA 2AJ8A 3EDYA 3M4ZA 5JSQA 1T10A 2X86A 5B37A 4I19A 2GNOA 1HE4A 4YCDA 1U0HC 4L0CA 4PAWA 5EMMA 4PN7A 4Y6LA 3K4HA 3Q7SA 2CLHB 2OZLA 3L8HA 1R0KA 4OFZA 1OFHA 4EY4A 2G1AA 2XZLA 3CEAA 3BJRA 3FLMA 1DEHA 4KI7A 1BDIA 3WLPA 1JIIA 4ITUA 1RWXA 2VJPA 3AJ9A 2IHNA 1IZ8A 1G1AA 2BFPA 2O3SA 4KXNA 4MWEA 3AEUB 3LRPA 3L8DA 4C7KA 5FR1A 3P26A 2JLBA 2OBXA 2HN9A 5IYZA 1ABFA 2P8JA 1XDBA 3RADC 1Q22A 2ZWMA 3O8QB 1R4ZA 2VKQA 4A26A 3GLFB 2RIRA 1F1BA 3HHPA 1V3UA 4LCEA 4NATA 4PYKA 4Q24A 5EUBA 2Y2VA 3KQHA 4Z4IA 2QVZX 1QIMA 2BR3A 4ZAZA 3KVNA 3H65A 4WWHA 1FEZA 2E6UX 1BQ4A 4L73A 2ET6A 5HIIA 5C8YA 1Y89A 5ANRB 3Q11A 1H6BA 4AWBA 2HJHA 1HQKA 4IXTA 3UUFA 4WX2B 3LV8A 5TJ9A 3C8UA 2GYYA 3AJEA 3BJMA 4IJ5A 1EHIA 4O4IB 2EYUA 1H4TA 1TOAA 1E2DA 3LCJA 4IPTA 4MH0R 4X24A 3EUWA 4J1SA 1GAXA 1H2WA 5A62A 2VHUA 3AEYA 1G16A 3K30A 3LPCA 5SZIA 3IB3A 1XRPA 5FPHA 1L5WA 1N6PA 3CKMA 3DVSX 3DLPX 4PN3A 2B8JA 3IA7A 3KKZA 3B85A 4D25A 4ZMRA 3BUSA 4F8EA 3RUIA 4PIVA 3D3QA 5ABPA 1X77A 2W2TA 1VB3A 3QVVA 1H93A 4GMDA 5BVHA 4JFAA 3VYWA 1YQDA 3FFAA 1Y3HA 3PICA 1WZNA 1V3TA 3UEOA 1WKBA 4LYYA 1SHJA 4V03A 3K0FB 3QXGA 1NL3A 5EIEA 4I81A 5BVGA 3KT6A 2UUAB 2ZKLA 3AK4A 2O3TA 4JQCA 2ZI9A 4O4JA 1EVKA 3NBKA 2NSJA 4PF1A 1NYRA 2ZTSA 5U1PA 1ZC4A 3ZV7A 1B2RA 5I01A 4MS3B 2BV3A 2O07A 2V98A 3GVCA 4R98A 2I6FA 5TGDA 1JHVA 1EBFA 2PKCA 5THKA 1VL5A 3BEOA 4DQLA 2IF2A 5JQGF 5THQA 4ZU3A 1L5GB 3MGAA 3KK0A 1EZ4A 3JZDA 2NV2B 3I9V1 2MYTA 2G36A 3B2NA 1Z0UA 1QTIA 1BHO1 3TL2A 1XZDA 1RWOA 4J43A 4OHBA 4ZVOA 1PFGA 3T3HA 3P5BA 1PR3A 3DULA 3FDXA 4I50F 4ZVVA 2YCLA 1BFKA 1U31A 2OFOA 3MRTA 2FPMA 1NVTA 1J25A 1V95A 3L1IA 4MQEA 4ZK6A 3WLKX 9LDBA 1Y6JA 1JLRA 1RJWA 2W6JA 1ISJA 4UFNA 1XZQA 3CE6A 1BXKA 3NI2A 4PWYA 5BUZA 5A4IS 5C3MA 2JGFA 2VCHA 5FHQA 4ECEA 3B9RA 1PJ4A 3DT9A 2DTXA 2OHXA 3KKLA 3MJVA 4CR7A 1CUAA 3EOAI 4CETA 1GU1A 1O8CA 3BKXA 4TL6A 3TNYA 3V4ZA 1SWVA 2CMGA 1EDEA 1Q0HA 4NY1A 4RC9A 3UG6A 4GI3A 2XOKA 3PQ7A 2ZETA 4OPMA 3BL5A 1C1DB 3QMVA 4HQFA 4AAYA 1ZOIA 2COKA 2J7PD 1MW9X 3N5CA 3HCRA 4ZVTA 2PWAA 4KMRA 1TM4E 4L3OA 3GFPA 4PBSA 4CMEA 4I3GA 3TEFA 4OTZA 1TW3A 4RIEA 3QF4B 1GAQA 3P9SA 1F4LA 1KFJB 1Q44A 3B1FA 4OQ4A 4G26A 5FADA 2FFAA 3P20A 1ENYA 2FA9A 3AFHA 2JJYA 4OHKA 5E4JA 1F1JA 2IOQA 1YT5A 3PU6A 4PAGA 4M1TA 1DU4A 2WF6A 4C6HA 2PKQP 5KX5A 2YNMD 2AZTA 2JEZA 1Z2AA 4R16A 4DJJA 4AD8A 3ZZNA 3D3WB 4WN9A 1JJ7A 3NYWA 4LJ4A 4A2WA 5HDQA 3H2ZA 4HHEA 5KNDH 5K2OA 3MIZA 3Q8WA 3G2MA 3GLUA 3VR4H 2ZRIA 3EGDB 1ZCAA 3ZX4A 4JA0A 5DVZA 2W0SA 1H1TA 2DBVO 2H11A 4IJVA 4TWIA 4ZCQA 4EH1A 2I67A 2I34A 3WRYC 3BMCA 5CVVA 2HW8A 1RJDA 2ANCA 3H7IA 4BX3A 3IA2A 2FZGA 3ED5A 4HX9A 1O0CA 1P1RA 2BL4A 2NZ8A 3LQYA 4F4FA 2P4QA 4CEHB 3A36A 1FP1D 5DM0A 2DY0A 5A04A 4C0QC 1AX9A 1TECE 1V25A 2ZE7A 3IGFA 5BN3B 4PSCA 1PQWA 5A5DA 2IW3A 3G6WA 3NCTA 1KQ3A 3O8OA 4U6NA 4URFA 2WAAA 3I0MA 3CS3A 3I34X 2W2KA 4E13A 2IOHA 3T1YB 1T24A 2EJTA 1O03A 1PWXA 4MVJG 1O2DA 2OGTA 3T38A 4M1WA 1YCDA 2R6ZA 4EHKA 5KQRA 2CCGA 4RADA 5KAMA 1CYEA 2PX4A 3NGMA 3CCFA 3PXAA 3BSWA 2FG5A 3IP9A 1J2TA 3RSQA 2RGUA 1CJCA 4EPVA 3C2QA 5CVUA 2KJQA 3LX4A 1A4UA 4GMHA 3QFCA 1WXDA 4MV8A 5HIKA 3Q3IA 4JBWA 2AN1A 2W2PA 4M0KA 1KE2A 3F3SA 2VDWA 4Y9UA 2V3CC 5C1DA 4QGBA 5AJHA 1GPJA 1R8YA 2C2XA 1TEVA 3EXIA 4DC1A 4XX0B 1CXZA 2BGTA 4DIDA 4YROA 3R4CA 2QIOA 5J4KA 1HT1E 1VCHA 5AW6A 2AH5A 2UZIR 3F0TA 4JBIA 2XLBA 3GEDA 3HZHA 1QDLB 2DPYA 3LDAA 3NJ8A 1AVTA 1OU4A 4UCFA 3N2EA 1VSTA 4M0PA 4HTFB 3OMLA 5AO9A 4RK6A 3ZZMA 5BW4A 3KYCA 1WY7A 1PX0A 1NN0A 3KJEA 4TL7A 1Z33A 4JT8A 4OLJA 2FFBA 3QEKA 4JN6B 5M34A 1N7GA 4PZAA 4JJZA 3WXMA 1TA4A 1TF7A 3AEKB 3LKDA 3ZLUA 3R0QA 4B6RA 4JLNA 5LB2A 1YXMA 4GMGA 1KYXA 1OV4A 2DP4E 1WVIA 3M1AA 1DQZA 1WTAA 4H18A 2XYVA 3N1UA 3HVKA 2BP7A 2E5LB 2FR1A 3KYJB 5KDDA 1FS6A 3W7AA 1ZW1A 3G1TA 2FI1A 4HFRA 1T0IA 5CTJA 4RANA 3GZJA 3RHSA 3TBKA 3Q7EA 3ZY4A 4TWAA 2QB5A 3MWYW 4B71A 1V3VA 3ESDA 4QFBA 4YCCA 4AKHA 3GPBA 1PN3A 4UBLA 2D7JA 4OM8A 2X9VA 2MCFA 3SIPA 4ZEXA 2HF7A 2FRXA 4XLZA 4RV4A 2C4KA 1NE7A 1Z12A 1P2BA 4FDVA 4LECA 5BO5A 1JLMA 1G8AA 2WWXA 3K5WA 1L4BA 2JHAA 4I66A 3VH2A 4QBIA 2XKJE 5G4KB 4ZQGA 4E5UA 1Z3CA 3FVQA 3I5MA 1FNBA 1KZ9A 1FL9A 1HQYE 4S1OA 3H2JA 2I2AA 5IDVA 3MAJA 2R87A 5B7NA 2FMHA 4REMA 4KMSA 4NWIA 3H05A 2AEJA 4M7WA 2YUTA 2NQTA 2NU8A 3RS9A 4V3CA 5BRNA 2O3QA 1R88A 3SSAA 4TXMA 1GDTA 1TA9A 4QDZA 1VG8A 4LWQA 4YMUA 4PLWA 5CIWA 5C7OO 2JI8A 1IAVA 3I32A 2KS6A 5DNWA 4Z2YA 3HCNA 1GD1O 1IXZA 4AG5A 5JQGB 4P4NA 3TRFA 5LQRA 2Y1DA 1J8FA 1OHHA 1U7HA 1KEVA 3K6KA 3KZXA 2BHTA 2RKOA 3MD9A 1U7PA 4YYEA 2J59A 3ICWA 1KPGA 4ND2A 3WB9A 1CQWA 4B43A 1XO1A 1CS0A 4HEQA 3BXHA 2XYQA 3NANA 1T0JB 4TL8A 3GLGE 2BMJA 2N42A 3FYSA 4UC0A 4W99A 4I50B 3UV7A 4R8KA 4AWAA 1BVUA 1RJ9A 3QOFA 4ER0A 1PEYA 1RLJA 1Z4PX 2UYOA 2ZB3A 3FZEA 3IPYA 5J1TB 5TDHA 2VZ0A 1MABA 3NHRA 4EK9A 1L4EA 2RGYA 3L6CA 2R7AA 1CY1A 2JCBA 3HPQA 4RNDB 2ZAYA 4D45A 1SHTX 1E79D 2Q41A 5CP8A 3BK2A 4XDGA 3W8DA 3TQSA 2YKGA 5GVSA 1RU3A 4XB2A 4RD6A 221PA 1G3RA 2H08A 1TQ4A 2QNRA 4MCHA 1CUEA 3D5TA 3PL5A 3LW7A 1SXJC 2J48A 3W9UA 2GHQA 4GP9A 5T57A 4BLVA 1G38A 4YP6A 4DMFA 1PJTA 4YAEA 3KQSA 1OH8A 1GKIA 3O21A 1OXTA 3F2VA 4KXMA 5AJUA 4CODB 4D6YA 5H59A 5K6TA 2NVUA 3TH5A 4F38A 4KE8A 2VP0A 1XDGA 3NOVA 4R9UC 3SHOA 3ZDDA 3H1AA 2X41A 1WB4A 1XQ9A 1I2CA 2EBFX 3EXEA 2FWAA 2JAHA 3P96A 3PHJA 2CV0A 1ZN8A 2QQ5A 2I3AA 2R8OA 5JS2A 4F93B 1NYTA 2ZUEA 4KYVA 2P9BA 2HXGA 2ZS9A 3D6TB 3JALB 4H3SA 4LA4A 3RFUA 1DWOA 2X58A 4CFZA 2AMJA 3UA4A 2H63A 4D0LB 4AX4A 4CLOB 2QNBA 3IKMB 4MINA 1LI4A 3SJCA 3GDOA 3LYHA 1GCOA 1UP7A 3DZDA 2AYZA 3GDHA 3CLHA 4PG7A 1U7UA 1L1FA 3C3AA 4O63O 4UUMA 2IU0A 5C1PA 1LA2A 1ZXXA 2QMYA 3KFVA 3BVPA 3QYPA 3F73A 1E9AA 1OWOA 3EDMA 4MUHA 4OCZA 4WLNA 5JNWA 4N76A 2C2KA 2I3GA 1II8A 2VHZA 2ZAIA 4L8GA 5ALQA 3TSYA 5DIZA 3TTWA 1YS7A 2P35A 2Y6UA 4PYLA 3RB8A 5EQTA 4BNHA 3A3KA 3HCBA 3RODA 3MINB 4EZIA 4HFMA 3NXSA 3OAAA 4L8LA 1Z4MA 2VYND 5IT9A 1OC4A 4Q7MB 2OFXA 2M6RA 2WUDA 3I2HA 1LZLA 3EJWA 3G1WA 2Y9MB 3NT5A 4XGNA 2PUWA 2WD7A 3W6ZA 3O9ZA 3ZJUA 2J9GA 4FT4A 1YRYE 3HMQA 1KVRA 5LOVA 1UZNA 3TW0A 1LTKA 2OBFA 1GZ6A 3EHDA 2AGVA 4EB0A 3DWFA 2BUAA 5C46F 3WIVA 5A71A 5AW7A 3RWMB 2J4CA 1NW6A 5D00A 2IH4A 2IPNA 1E6EA 1MAHA 3D1JA 4DCVA 3GCDA 4H4CA 4I0WB 1KU0A 1TGVA 1UBKS 1Z16A 1O5IA 2ID7A 3CTPA 4MWOA 1NDHA 1FYFA 1Z0IA 5DX0A 2Q1WA 8GPBA 3M9XA 2ASEA 2WMYA 1P6QA 5GONF 2Q1TA 1GQQA 4IH1A 2R6HA 1Y7PA 2OLEA 3G9TA 3DV9A 1WSBA 2HHAA 2X4DA 3QEMA 1L1QA 4NK5A 3MJSA 1W9MA 5K45A 3A7EA 4KWHA 2BGJA 4MA4A 3SDBA 3PDIB 3PX2A 2VDJA 4ENWA 2N9UA 2GKSA 3QUAA 3JWIA 2FRDA 1ONOA 1C0IA 2G82A 4N48A 4OHVA 1TCCA 4FYKA 4G8BA 3AVPA 4RJKA 1W75A 4DIKA 2OP1A 3QHAA 4FUQA 1KFCB 5FBRB 2HNKA 1XZGA 1G41A 1SCNE 3AZOA 3BMNA 1S0UA 2Y1OA 4QUDA 1W34A 3U31A 2XCIA 4QNNA 3VU3A 3IL2A 3IE1A 1AZSC 1ZK0A 5B55A 1YVRA 3FN4A 4BBZA 2ZROA 3A6DA 1WCWA 3A3OA 1EVJA 1XZNA 1HLDA 4BLSA 3S55A 1CBUA 2NTNA 4LHSA 2R25B 3W5JA 2B83A 3W6PA 4Q19A 1MNAA 2H4HA 1H85A 4GEKA 3FPFA 1GRNA 1XVTA 1JU9A 2CXPA 2O6LA 2P6UA 2P5UA 4TT3A 4UE3S 4W1QA 3RBVA 4I55F 3EYAA 3GUHA 4WEQA 3HU1A 2EZ9A 4UW9A 5EIBD 2R8YA 4DLRA 4MAMA 4RMNA 1RWBA 4IH4A 4OP3A 4EI2A 1YZFA 2XCQA 3IEUA 1BGXT 3MCZA 2WTUA 2P9QA 3QKSB 2PUEA 2CFOA 2BKVA 2CCJA 1BWPA 3WIEA 2VS1A 5EEGA 4ZVRA 1ZJ5A 4LISA 1FFCA 2R2GA 3EYWA 4JOSA 4F3CA 4ND8A 4D4GA 1FTYA 2WJ4A 3RS4A 3EVEA 3U80A 2ORVA 2J9ZB 4P36A 2Y6VA 3OEHA 1AS3A 5HTOA 2GJAA 3I12A 3CISA 3GC6A 4OMDA 2F90A 4Q3CA 1E2NA 1MAAA 3WMWA 4CU2A 3H1TA 3U37A 1X7YA 1QCDA 1W30A 4QGHA 5AH0A 5BWNA 3PNBA 2D06A 2R6FA 5G40A 1TVEA 4JYCA 4DV3B 4NMWA 1E7SA 5FQOA 4AG3A 2LV8A 1P4AA 1Y1TA 5BSHA 3FMIA 2PBFA 1M0WA 4C7BA 4YV7A 3I0NA 2QG9A 4RPKA 3NDBB 3ASVA 3RJMA 4Y2GA 2GI4A 4TXLA 5EZ5A 3BJEA 3L6EA 1QU3A 3U3KA 421PA 1PD1A 2OSBA 3NT2A 4QBKA 1X0VA 2G63A 3B6MA 1NBIA 1IN1A 5FIUA 3HFRA 2EF1A 4GZ6A 2KLHA 4MPJA 4QECA 2PMEA 4BU1A 5DYGA 7AT1A 1XMXA 5HJEA 3MPUA 3OT4A 5CT5A 1J20A 1UM8A 1G5FA 2HQRA 1ND5A 2EEPA 2W2VA 4IYRA 2I2BA 2IV3A 3IOYA 2YRFA 2V6BA 2ZLBA 3UWMA 5LQAA 3C16C 4N9QA 1XXHA 1MRSA 3KSMA 4CKBB 5JPCA 4URVR 1XRQA 2FSIA 3NS7A 1N0WA 3OD5A 3PNSA 3WJ1A 4ENQA 1IZ7A 3O75A 3PR1A 2FPKA 4YCJA 1SKMA 5TS2A 3H87A 2P9TA 2RH9B 1UBNA 2ZWVA 4QSHA 3ZH2A 2P9CA 4NXMB 1BIFA 1XFAA 2JLQA 1SG0A 4LXYA 1ZGJA 1IMJA 1N33B 4RM2A 5CA0F 1Y7HA 3PQ6A 4CBVA 1C9DB 5K20A 4UTOA 3CW9A 1I7NA 2A9PA 3HY3A 3TQIA 1EDOA 2GRUA 2YFQA 3I9FA 3NHBA 3ONWA 1KDOA 3G5UA 1HFWA 2BW0A 2YJNA 3F9CA 3GJ0A 4KIJA 4RSHA 4YUXA 2RJNA 2W4MA 3T3MB 2PT5A 5JD4A 2WFLA 3AUYA 3V3KA 2IW1A 2AMFA 3FWHA 2GH1A 1IWPB 4WDRA 3RREA 1OF1A 2FW9A 5FAXA 2A5LA 3WK4A 1JG1A 4R3WA 2H7CA 2C7RA 3BS4A 1KXZA 5A0FA 4D57A 2H1IA 1GT6A 1WBJB 3BJIC 2IYZA 3DFZA 4QXMA 4RSRA 3RYTC 4HGZA 3S1LA 4IMIB 1X6VA 3X1DA 4YCMA 5IJWA 1FNCA 2BKXA 2EKLA 4L4XA 4U0JA 3VR2D 4J91A 3EZ2A 5CTAA 5KAPA 4UATA 1A2QA 1BXRA 1ZR4A 2QUJA 1OVGA 5JHHB 4WKGA 2WSLA 2JKZA 3UG7A 1Y3IA 4J9VA 8ATCA 1AKNA 2JGLA 5HM6A 1LQTA 5F1KA 1IQ0A 1J8DA 3SKXA 4ED9A 1GTL1 3KO8A 1SELA 4M9RA 1NVBA 4R01A 3L0IB 2YZ2A 5AK0A 5CCDA 5FWAA 1FMTA 2MJLA 4YAGA 5JCJD 5KMGA 3ESAA 4GQAA 1D2GA 4WFIA 5HF6A 2P3SA 3PL1A 5LZ2A 4GKJB 2Q5QA 2Q1SA 1V39A 3SOZA 1E4EA 1C9MA 1KJIA 4GSLA 1XU7A 3YASA 3UANA 3I53A 2PXCA 3GFFA 3DFIA 2IS6A 1ISPA 1YC2A 1PX2A 4DV4B 4KO8A 4RD1A 2IPOA 3O4HA 2H1RA 2ISCA 3L7JA 1JI0A 2XD9A 1X92A 3AR4A 5GONB 2EKBA 4RH3A 4U4AA 4DR2B 5GWXA 2ECPA 4NCBA 3GLTA 4M2LA 4B6SA 1QF6A 1HNNA 3MWKA 2EKPA 4CT4B 3DA8A 3GI1A 5I45A 1RM3A 2ZP1A 3PQCA 4U63A 2ZM6B 2XDYA 2EFCB 2XDAA 4E94A 2ZR9A 4LYHA 1MN6A 4EB8A 1Q50A 6PFKA 2NO0A 2OORA 3OKCA 3E3NA 4QEKA 1E3MA 1F38A 1DXOA 3DM9B 4PZCA 3B6JA 4YMTA 2YIDA 3ASYA 1N77A 1M2JA 2C57A 1O9HA 2FWIA 1DB3A 2VG8A 4NENA 5KWVA 3EZLA 3LUBA 3LQQA 1YE8A 3DDZX 1E8DA 4C0WA 3VPXA 1W8DA 4XPIA 3I5AA 3I04M 2OYRA 1ODIA 3KKOA 1YA4A 4GPAA 4AMBA 4CKWB 4H6WA 3GWGA 4O33A 2X22A 5IJ0B 3KRTA 2ZQ5A 3H9QA 1GTVA 1JEOA 1MVNA 3IXLA 5IT5A 3QJYA 1DCKA 1O6FA 2P75A 1N2XA 1N8SA 4E5NA 1HQCA 1ZN9A 1DLIA 4H1HA 4CQMA 4CIYA 3EWIA 4NBKA 3RSZA 3UAYA 4WQMA 4BWYA 4DMGA 3Q3VA 4PSDA 2IHUA 3OLCX 3V97A 3HZZA 1SC4A 1Y42X 2A3NA 4IGKA 4RFVA 3C6BA 3F9IA 3LC7O 4NCNA 1R37A 3FDFA 5DOVA 3N70A 3QTLA 2EDCA 4L85A 2PFKA 3UJ9A 3HXQA 5LA6F 1SC9A 1K4MA 5JAZA 5IVDA 1A9XA 1H2AS 3C5EA 1THGA 4G5XA 4A1OA 5K4AA 1BMFD 1Q16A 2I4MA 2FG6C 1OW3B 1T2EA 3KAKA 4HL6A 4EP1A 4XYLA 1V7ZA 3QU2A 1BSVA 3E15A 1NBMD 3ID6C 3CF6R 1FSZA 1RI2A 5EWLB 1B6TA 1Q1EA 2OQRA 2OEPA 2VT7A 2XDWA 2BFBA 1SHKA 1ULAA 1E58A 3H5NA 1NW3A 3IEXA 1IQRA 4NECA 4WXEA 2LP4Y 1WPQA 4EA8A 1QFZA 2VP4A 4OH7A 1ILEA 5JXWA 1FFXB 2G9RA 4GE3A 5K9ZA 1I10A 4PS0A 2JJ1D 3RROA 1GUZA