1QHXA

Chloramphenicol phosphotransferase in complex with atp from streptomyces venezuelae
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
178
structure length
178
Chain Sequence
MTTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQSAEGGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLDVLWVGVRCDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTHKESIECAWAIAAHVVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structures of Chloramphenicol Phosphotransferase Reveal a Novel Inactivation Mechanism
pubmed doi rcsb
molecule tags Transferase
molecule keywords PROTEIN (CHLORAMPHENICOL PHOSPHOTRANSFERASE)
total genus 61
structure length 178
sequence length 178
ec nomenclature ec 2.7.1.-:
pdb deposition date 1999-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07931 CPT Chloramphenicol phosphotransferase-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1qhxA00
4XWKA 4XSHA 4OHVA 5TV2A 5IF9A 3LLUA 3Q85A 2OG2A 4NDZA 4TN1A 5SZJA 3GP8A 4UKDA 2Z4SA 2YC4C 4LWZA 1HQYE 3C7KA 3LRPA 4DB4A 2O8CB 4EDHA 2HUPA 2QU8A 1FQJA 1ZUIA 4PZYA 4RFSB 1Y3AA 2FFBA 4WZBE 2KE5A 3QI2A 5DISB 2VO1A 3QIAA 4CYMA 1MO5A 4PC1A 1N6HA 1KKLA 2AR7A 1RVDA 2C9CA 3QKRA 3FTQA 1C4OA 1CLUA 5HZHA 4W9MC 2GK6A 1RRCA 4EPXA 5G3YA 3PUXA 2H18A 3LW7A 3AH8A 4V03A 1DAIA 3Q72A 3LBHA 2NG1A 4Q48A 1QG2A 2F43B 4GMDA 1E2FA 1Z6GA 5JJKA 2BBWA 4MYTA 5AJXA 2J59A 4UNQA 3B1XA 4LC1A 1FP7A 2ZUDA 2VSOA 1ZU4A 1JNYA 2J1LA 4H1UA 1MABA 1E2HA 3DL0A 4KFRA 3IKJA 1NLZA 5CK5A 1QHNA 1GRNA 4NCJA 3EAQA 5C46F 3C4JA 2ZIAA 4W5HA 4BWYA 2YWHA 4GL2A 2DBYA 2CE2X 4JZKA 1F2TA 5KNCA 2QPOA 4K81B 2OESA 2J3EA 3UPUA 3W3ZB 4MRPA 4JLKA 5HE9A 1HEIA 3WRYC 3PR1A 1KSHA 3AQ4A 5FBLB 2NO7A 3DEFA 4ZV4A 2YWEA 5DI3A 2ZI5A 4OHYA 2ZS8A 4EPVA 5FTKA 3FDIA 2O0HA 4D0NA 2YVUA 3MLEA 4GZMA 1NIPA 3AKDA 1KMQA 2WOOA 2Z43A 3SJCA 4D4KA 1LTQA 2IWHA 3VNVA 2FV8A 2CLDX 2G0TA 2KB0A 4IDOA 2KJQA 1HE8B 1U90A 5JECA 5HKKD 1MO6A 1EG7A 1NLYA 2GKSA 4JIMA 3WMFA 5KSYA 2BKEA 2D4HA 1JI0A 5JSZA 4ESVA 3O8RA 4TMZA 4M21A 4JT2A 2R2AA 3IEUA 3U6KA 1P60A 2RCNA 2P5SA 4FINA 1OXSC 3EIQA 2QA5A 1J2JA 2ZRBA 4P0TA 5FH9A 2IT1A 1TADA 2ORIA 3VAAA 2XGJA 3SC3A 5B57C 1T0HB 1G17A 1LF5A 5DN6A 2RB4A 3ASYA 4A6PA 1I2DA 3CLVA 2XJ4A 3MMPA 2QZ4A 2FZLA 3DO6A 1G5RA 4DSOA 3EWAA 2ZUBA 5D3MA 1IONA 1GKIA 2V55B 1E1QA 1ZAKA 4AKIA 1E2EA 5CDFA 1G20E 4WBSA 2ZYTX 5JEDA 2J7KA 2REXB 1EXMA 3FYHA 2A5JA 4V02A 2OSBA 1MH1A 3TK1A 4LCBA 5KUTA 2IYWA 3X1XA 3LH5A 4R2IA 4M9ZA 3A58B 4I1OA 3UKDA 1T0JB 2ZROA 4FW9A 3NHBA 4LJ4A 1YZUA 3HU3A 5IK2A 1W47A 3EWSA 1ZIPA 3PQCA 4C30A 2OAQ1 5TB5A 3UXMA 1LS6A 1KK1A 1M1YE 3EPJA 3V9PA 2E9SA 1NKTA 1R10A 3KJIA 1G7CA 1I4TD 3TE6A 2XOKA 4D80A 3QXHA 4DHEA 1CJVC 2DHRA 4G5QA 4BPBA 5SZIA 2AX4A 4D0LB 1TUIA 4WXPA 1IJEA 1Z2CA 2PBRA 1N6KA 4MKIA 3QNUA 4XVRA 3NH9A 5E4FA 2QGNA 2I1QA 5FR1A 2Q0HA 1OHHD 1CR1A 2V54A 4UNSA 4TMWA 2GBLA 4D6PA 1NVXQ 2NMVA 1KDOA 4ABYA 3UG7A 1SZPA 1E9FA 1E2KA 2XB2A 2GK7A 3TMKA 1XD9A 4QGFA 2ZPTX 3TNFA 1EGAA 5FOWA 2G77B 5K8UA 5JJLA 4OHZA 1A7JA 4EUNA 1AZTA 1UDXA 1ZRHA 4TL8A 3IO3A 2UKDA 1OT3A 1F5NA 2C9YA 3THOA 3OEED 4JBXA 4JL5A 3NHAA 1OHHA 4DCNA 4M8NE 1DVRA 1OFHA 1W2HA 2D74A 4TMKA 4B2LA 2FPMA 2GESA 4C2TA 3PEWA 2BIFA 4D82A 1S8FA 4II7A 4IEIA 4PQRA 4AD8A 4GDFA 1P75A 1YZTA 3RWOA 1J70A 3L0SA 5DE3A 5AUOB 4CT5A 5BW8A 3L8ZA 1ZUNB 2WWIA 3TUZC 2O52A 3GLFA 1OPXA 2PEYA 3W8NA 2FF7A 4XSGA 3T34A 3VR5A 3EARA 1FPMA 5FTNA 3ZVNA 4DLXA 1R6BX 5H70A 4Q9JA 5DN6D 1M34E 2ORWA 4GOKA 1JEEA 5CB6A 2VL7A 5E95A 2ZRJA 1OFIA 3U6BA 3QEJA 2BMFA 3DPUA 4DEXA 1EFCA 3HYRA 2GJ8A 4I4LA 4Q4AA 4YC7A 5JS7A 2KI5A 4US0R 5EE0A 3IBYA 4DLWA 4HAWA 4TMXA 3RS7A 4NHOA 2CCJA 1XEWY 1QHGA 3UATA 1XTKA 2IC5A 3CB4A 2FWRA 5KO2A 1S1MA 1XZQA 5DGXA 4OHWA 1E1RA 1F2TB 3D8BA 4JT4A 3AP2A 4TT3D 4DLYA 3RS4A 3WNBA 1Q0UA 4JLNA 3RSOA 1CF4A 2OE2A 4UNNA 2ZRKA 3TAUA 1G6HA 1R0WA 3IUYA 2V1XA 2VQSA 4PPGA 3GLFB 1F2UB 4A36A 2PX3A 1P2UA 3WYAA 3A1SA 1E79D 1EFTA 2GILA 4LSGA 1T8UA 3FWYA 3K0CA 3EASA 4K46A 1Q1QA 3BWDD 3CONA 3QJYA 1NG1A 2ZS7A 4OYHA 5F2EA 1SXJC 2JLVA 1E32A 2A5GA 5BXQC 4MRRA 1U9IC 2OXRA 5IRCD 2PJRA 1E2JA 1XEWX 2X19A 3MWYW 1Z0KA 2XTMA 2JDID 2JIZD 2F6RA 2ZRCA 2ZI6A 3AF2A 3LO5A 1COWA 2GWHA 1S9DA 4KO8A 4TWZA 2RHMA 1NRJB 3AB3A 2Q9AA 5FBRB 5DSZA 1XCGB 1TQ4A 5EP4A 3EZFA 2O0KA 2OAP1 1ZNWA 2XAUA 3GJ3A 4URUR 3SHWA 3RRYA 4NL4H 3EW9A 5CITA 1J90A 4WZ6A 2GCNA 4WW0A 5H68A 1FW6A 3ZD7A 1IN5A 1XTJA 3A1VA 3VFDA 2OCAA 1G3UA 4YMWA 2OILA 1P73A 2GEDA 1HH4A 3D31A 3I1FA 3N70A 3MWJA 3NG1A 5DH9A 1KHTA 4QL3A 1E4YA 1G7RA 4NYJR 4CIDA 1KI7A 1G16A 4TL9A 4D4MA 4LJ5A 2YWGA 2IXEA 4W5WA 1LB1B 4A6XA 3ZVRA 3I72A 5FI1B 4DIEA 2CVHA 4RD1A 3VR6A 4Q4JA 3FFAA 3V4FA 2PLFA 2QEQA 2ATXA 3A1UA 1GRRA 2PT5A 5IDVA 4TL6A 1GKUB 1GL9B 2QMEA 4B3GA 3K9NA 1QVRA 3AM1A 2ZJBA 1XMSA 1SVOA 1XCMA 3SU8A 3ADKA 2Q6TA 3EIHA 3KTAB 3TJZA 1IJFA 1S9HA 1WBBA 2LWIA 4R7ZA 3O8CA 3IPYA 5FFMA 3OIUA 1SGWA 2H17A 2ZSDA 4KFTA 4AWXA 3IIMA 1CJKC 2QENA 3Q9LA 3AF4A 2DB3A 1UM8A 3E70C 3BFVA 4JYBA 5FUXA 4LV5B 4HAUA 1DO0A 1FX0B 1E9RA 4QBGB 2PJZA 4KYUA 4QBHA 3MJRA 1P2VA 4AKGA 3B7GA 1C1YA 1D5CA 2FNAA 2Q3MA 5E7IA 3EZ6A 4OI1A 2A5FA 2XX3A 1SXJA 3UANA 3FVQA 3WHKA 2J0SA 5KHOC 3THYA 1XEFA 4NZYA 3QPWA 3KKPA 4F4CA 2FPKA 2ZREA 2ZU6A 4Q18A 1D6JA 1YR7A 3PUVA 4IDQA 1PZNA 5JWOA 1KAGA 5FUWA 2GA8A 4BFXA 3DVLA 4LBVA 2V7QD 3CRQA 4GI7A 3K1JA 3UK6A 5HCNA 3N2EA 2WSSA 4FWIB 4Q03A 2C04A 2GZDA 2ZJAA 5B2ZA 1FX0A 1M7BA 2CL7X 5JLJA 2HF8A 2GEUA 4IOMA 4YDSA 4B32A 3KXIA 4GT1A 2DFTA 3REGA 3ZLJA 4U7DA 3TVTA 1QG4A 3RNLA 3L0IB 1N0VC 3VX3A 1NN5A 1E9SA 2C8VA 3REFA 4NU0A 4MRSA 1RKBA 2BC9A 4AG6A 3THYB 4YQFA 5A0FA 2HJGA 4QOSA 1RPZA 2JEOA 2ZR9A 4F4IA 3KFVA 4LJ7A 3B5JA 1KJZA 4A9AA 2BCJQ 2HYIC 1AGPA 3U3OA 1F6BA 1WE2A 2YZ2A 1G64A 4GPTA 3QSYA 1QBKC 3IQXA 1HYQA 2CCGA 5AJWA 1RZ3A 1OJLA 2Q9BA 1GRQA 3JZAA 3FOZA 2PCLA 4HI0E 1T3LA 1K5DA 5FBVB 1VTKA 2HT6A 2FFQA 2Q9CA 5L3SB 3PEUA 1P9RA 5F9HA 1GDDA 1IOZA 4DXAA 2WJVA 5J4KA 1TPZA 2QP4A 3THXB 2PZFA 2UZIR 3EA0A 3CR7A 4GZLA 4UQOA 1PV4A 1NY5A 5K8LA 5CM8B 4Q7KA 1XZPA 2W6JA 3SBEA 3ADDA 1US8B 3UWOA 4HYYA 4OQNA 4NCNA 1MKYA 3SNHA 3MSXA 1R4AA 2ZRNA 1NVUQ 3PUYA 1WMSA 5EXPA 2AKAB 4P33A 4DDUA 1SHZA 3GLFE 4MRVA 1O3YA 1RYFA 2JGNA 3EPLA 1XNJA 1NG9A 1U9IA 4I1VA 1GWNA 4XVUA 2VHQA 1Z3IX 4ZIRA 5FOVA 4YDHB 1WXQA 2N46A 4IOJA 4JBWA 1A5TA 4OQXA 3ONWA 4ZI2A 2IK8A 4C0SA 3MGCA 4ZCIA 1XD2A 4HAXA 3P27A 2QAGC 4BLTA 3IIKA 1KI2A 3FE2A 1TEVA 3DHWC 1XXHE 5HCIA 2HJVA 2XSZD 2Q21A 5J4LA 2V8OA 1XEXA 3A8TA 1D2MA 4LGMA 4MGKR 2YYZA 2AWNA 4MGYR 3O8DA 2QTHA 4XH9B 5E7MA 2P3SA 1MABB 1XCPA 3EZ9A 2F1JA 1XFAA 1NMXA 4B3BA 1N5LA 1A4RA 3NXSA 4LV6A 4RZ2A 1II8A 5EP1A 4NCIA 3WBJA 5LB2A 1KAOA 5BN3A 1AA9A 1MT0A 3TAHA 5FPTA 1LV7A 5BYJA 1AQUA 2IYYA 2VEDA 4M1OA 5HE8A 3GLIA 3WY9A 3IQWA 4HLQB 2QE7A 3DKVA 4DCSA 3N5CA 4XJXA 4NYJQ 1M7HA 2CK3D 3OF5A 3SYNA 3LQRA 2AK3A 2IYVA 4W7SA 1FZQA 5B30A 1Q57A 2Z4RA 1SQ5A 1YRAA 3KXLA 2EU8A 3LDAA 4P4SB 2ZXUA 4JVMA 2VP5A 4JYCA 4EJSC 3S1AA 2WVJA 3FMPB 3PENA 3ZIAD 3ZJYA 1MR3F 3QF4A 2ZR0A 4C0LA 2ZRDA 4EJSB 4ZKDA 3RS2A 4CEIB 1EESA 2WKQA 2FSIA 2IEZA 4MUBA 1E9BA 5CJPA 4KCGA 5FL7D 1EFUA 4IFBA 2W2XA 1OH6A 2J45A 3AVYA 1G3MA 3QXCA 5J4VA 3VKWA 4HAVA 2RH5A 3H4MA 1Z8FA 1RRPA 2ZETA 5E7JA 4Z51A 1Z0FA 4DUGD 3TLXA 5J40A 4R98A 4BASA 4LYJA 2HT1A 1MV5A 1Q1EA 2AXNA 2QRZA 2F7SA 1GTVA 2ZJYA 3S1AB 3RRNA 1ZINA 3LBNA 3SN6A 1T91A 3IHLA 1PUIA 3UMSA 4C9BA 3BS4A 5JCZA 3W6PA 5KYKA 2RGDA 1EX7A 4N3NA 3QXJA 1IM2A 1QHHA 4YMVA 2EFDB 1OH7A 5L3VA 3K9GA 4PHHA 1GFIA 1N6NA 3G5UA 2GJKA 2F9LA 2YOFA 2FEOA 3AF1A 3OEHA 4MKFA 3CF6R 2QAGA 4A82A 4NKRA 2O8EA 2O8DA 1KMHA 1N25A 4K8OA 1O87A 4B71A 3R9WA 3K0CC 3PUWA 1R0ZA 1CJTC 3ADBA 1DE0A 1JJ7A 1AIPA 1TEXA 4PC6A 1GG2A 2FX3A 4JL6A 4Q66C 4B47A 3UG6A 3TGPA 5A5GA 2R6AA 3W9YA 2W2TA 2ODNA 2BJVA 2FSGA 1UAAA 1G8FA 1OB2A 4NYIQ 2D06A 4MGIR 4BLRA 3SZRA 1E2LA 1FUKA 5HR5A 1R8SA 1TUEA 3SOPA 1TF7A 3THXA 2L0XA 2VHCA 5JRZA 4BQSA 2PEZA 3I3SR 1QF9A 1AGRA 2DPXA 3DM5A 1E6CA 1XB2A 4IRUB 4JLJA 3HU2A 5HPYB 5K8IA 2ZI4A 1F48A 2FE4A 3SFVA 5DI9A 1NMZA 2NO9A 1NJGA 1P3JA 5BYKA 2QROA 2VHJA 4KV9A 4QBIA 2Z5FA 3UMRA 2XTNA 1KO1A 3QEOA 1ZD9A 3AVWA 2HXYA 1AJEA 3Q3JB 4XVQA 5TVKA 5FPSA 2FEMA 2FDCA 1TTTA 3CF0A 3FGNA 2N1BA 4ARZB 3LAWA 2GVDC 4EKDA 4TSFA 2VTKA 2GCOB 2JLXA 1Z6AA 3PJRA 4FXPA 4DDWA 3UWKA 3AEZA 3AVUA 1CXZA 2H8KA 3B1YA 1NP6A 3PG5A 3SFZA 1G7SA 2NGRA 2UVQA 4KBFA 4IKEA 4HZUB 1R0YA 3U3JA 2IYTA 2DWOA 2C9OA 1Z06A 2GJSA 3NBZC 3ZH9B 2V3CC 1H8HD 4CT4B 3MUFA 4Q9HA 1TF5A 1Z2AA 2RAPA 4LPSA 3KQNA 1IY1A 2YOGA 3P4XA 2NO6A 1NBMA 1G5PA 1N6PA 2IUSA 1ZM9A 3CRW1 2IL1A 4B75A 2ZVQX 2HV8A 2FA9A 3MWLA 3NVAA 2J46A 1G291 2BEKA 4TT3A 5LD2B 3AVPA 2NO0A 2V6IA 3Q7QA 1GP2A 4KAXA 4PTLA 1E1RD 5KU1A 3OFNA 2V9PA 2NIPA 3QKSB 1NN0A 4G5RA 1OKKA 1G5TA 2OZEA 1WQ1R 4LUCA 2EYQA 3FB4A 2CE7A 1U8ZA 3ZZUA 4LJ9A 1X1SA 1Z0IA 4XD7A 2JA1A 3C15C 3C5HA 2R65A 3LNCA 2WJIA 1VHTA 2XXAA 2REOA 4BLPA 4B73A 3LWNA 4Q21A 3CRVA 4NPHA 4Q4LA 4Q4AB 4YMUA 3AV0B 3BJIC 1DG3A 3U60B 4JLOA 4EQ6B 5KSPA 1P9NA 4LZZA 3VR3A 1W0JA 2AFHE 3NBXX 2NPIA 4IDNA 2CVFA 1XPOA 2AD1A 2BHRA 1SHKA 3EA5A 5JRJA 3T1VA 2PMDA 1ESNA 4UJ3A 3DMNA 3L8YA 3MAAC 3GLIE 5F98A 2ORVA 3K70D 4GNKA 4RD4A 1VIYA 4F91B 1M2OB 2VHUA 3BH6A 3MWKA 4FMCF 2X2EA 4C0JA 1Z6XA 2VSFA 4PC7A 4LDJA 1G18A 4O2LA 3NEJA 4IOKA 5EQTA 3F5FA 1MOZA 2CBZA 2R6GA 1P4SA 4GSYA 4HEJA 3OEEA 3H2YA 3AP1A 1W49A 3VX4A 2E87A 1SXJE 2AL7A 2CLSA 2R9VA 2VYFA 4IVRA 2QP9X 4ZO4A 4A8JB 5AUQA 1CRQA 1OFUX 3NDBB 2D7CA 4KI0A 1ZCBA 4JVLA 4QGHA 4LV8B 4A8JC 1ELOA 2G1KA 3X1DA 2F1HA 4IDPA 2R6CA 5P21A 1FFHA 3GLHA 3OIVA 2W0MA 4IVPA 2BCGY 4DSUA 4TLCA 5KDOA 3ICEA 1ESMA 3Q5DA 1UBGA 5EP2A 4V0OA 5K8TA 1Q3TA 2W6ID 1JAHA 3GD7A 4JL8A 4ZPXA 5JHHB 4HDQB 4RZ3A 2ODEA 5F3WB 2O8FB 1TMKA 3DZ8A 4WVFA 3VMFA 3D7MA 3TH5A 2XOKD 1M7GA 3ZS8A 4A1FA 1R5OA 1G3IA 2JLWA 2QRNA 2A9KA 5FOXA 3KJGA 3J81k 2CCKA 2FMXA 1G4UR 5L3QA 2Q3HA 5IK2D 3WP0A 3GLGA 4D26A 3VTKA 1HURA 2UZ3A 4Z8XA 1I4DD 4QNRA 4CEHA 3H1TA 2BVNA 1Z0DA 2VA8A 3CWZA 5JBQA 1RC8A 1U0LA 4ASUD 1KO5A 2A7QA 2ZI7A 2AHOA 3BERA 1E99A 1KO7A 4PQYA 1JR3A 4NCKA 1ZMXA 2NO1A 4LPKA 3H0KA 3TKLA 4FWTA 1G9XA 1E1QD 1ZP6A 1T8TA 4US1R 2J7PD 4OQFA 4OK3A 1W36B 3WHLA 3FKSA 3RSLA 3AP3A 1PLKA 5FUYA 3T5DA 1GKYA 1NVVQ 4BRWA 5L3RA 1X86B 5J4YA 4WOPA 2C2HA 1KI9A 2CMKA 4FMBB 5KTYA 1U8AA 3GJ8A 5EZ5A 4Z54A 1E2PA 4ZDJA 2F55A 1EFRA 3DOFA 2FSHA 1CR4A 1KI6B 1X1RA 1XTSA 3ASZA 3O8BA 4DKXA 1UF9A 4MUAA 4ZCMA 5GVSA 1ZD8A 4DJTA 4TTPA 1YE8A 5SZHB 4P3YA 4L16A 2ZJ2A 4JLAA 1LFDB 2ZAMA 1Q1ZA 4Q4JB 3B85A 2AD5A 4WXRA 1AS2A 4HDOB 3M0EA 3I5YA 4QGAA 2WSMA 3K0AB 3GEHA 2GXUA 4D0GA 1EK0A 3K09C 2ZJOA 4E5UA 2YOHA 2BV3A 1NNEA 3IHWA 3CRRA 4G5SA 3C16C 2BMDA 2XNDD 5G41A 1ZM4A 3LX5A 1GVNB 1KSGA 3ECCA 4ZKEA 1OH5A 2XNDA 1DADA 3HR8A 4IHQA 1HV8A 2XZLA 5C4GB 2RGNA 2ZUCA 2QGZA 4DRZA 1FNMA 1SVWA 3FMOB 3KKOA 3FPAA 3DMDA 4BFWA 2CXXA 2FPLA 4G5GA 3ZD6A 1KI6A 4GRAA 3QG1A 3ND8A 1PJRA 4TQUS 3H86A 3RS5A 3TBKA 4BLOA 2XXAB 3VHLB 3VKGA 3LD9A 4TYWA 2OT3B 2J0UB 5FPKA 1BYIA 3HWSA 4ZI3A 4URYR 2HLDA 1VHLA 4JLPA 3QXSA 3KUCA 4QBFA 4E22A 4UXHA 1TNDA 1FTNA 3VKHA 1YR6A 4NBSA 5FBWB 3WXMA 1IY0A 2ERYA 3Q5EA 1UBFA 2ATVA 3WYFA 3PCRB 2CNWD 4HB3A 2ZYVX 3NH6A 2IXGA 5FOSA 1N5KA 2D62A 4URWR 1II0A 2E1RA 3BORA 4FCVA 1CR2A 2ZRIA 2KBFA 2OFXA 4BZXA 3QF7A 1S3SA 3FKSD 1XTQA 2VP0A 4B6FA 4LHWA 2B21A 2J7PA 4O25A 1D9XA 4C7OA 4C4PA 4DCVA 2XZPA 3PUZA 4TTQA 3HDTA 1U99A 1UKVY 4U5XA 4BECA 1QHXA 4JKYA 4LBWA 1FMJA 1W4CA 4WA7A 1AN0A 4MGZR 4ASUA 1N5JA 1UJ2A 3WMGA 4C0BA 3U44A 2RGNC 3CX7A 1A82A 4IXNA 4OK6A 4Q1EA 5ANRB 3QF4B 1JJVA 3R7WA 3T12A 2DWPA 2FZ4A 4IXMA 3W34A 2VHTA 4F92B 5DNYB 4B35A 4ZDWA 1ZUHA 5EUMA 4YXWD 4F38A 1U81A 2CJWA 2WJGA 2BJWA 4MA4A 2VP9A 2WMOB 2OFOA 4HSEA 4US2R 1GL6A 4TLEA 1CRPA 5J47A 2RGXA 2Z6VA 2QMOA 2QM8A 4NYMR 2QORA 1E69A 1XTRA 3WNCA 3CPEA 4EPYA 2G0NA 4DLRA 1W36D 3V00A 1AS3A 1H8ED 2QG6A 1N6OA 2IS4A 2ANBA 2QMUA 3EC1A 2B6HA 2QTVB 2WTUA 5JFGA 5KNDA 1W5TA 2OLKA 3VR1A 1YKSA 3L0OA 1CJUC 2XJ9A 2R62A 2H16A 1XXHA 1X8JA 1IBRA 4OI4A 3JZMA 4ERNA 2P0EA 1MRNA 4B3CA 3AGPA 4CVNA 1Q22A 3P26A 1RE0A 4KSCA 2CHVA 1VCIA 4JVSB 1WB9A 4E09A 1YZGA 2ZTSA 4LYAA 3K09A 1E0SA 1JEDA 4OKSA 1KNQA 1GNRA 5L8VA 3A4LA 2DR3A 3TUJC 2DFNA 4C7OB 3U7GA 2C95A 5KNBA 2ZJ8A 2CJWB 1KZ7B 4KU4A 1S4QA 3CX8A 2XB4A 4BFSA 2WWHA 3MFYA 3I8XA 1JAIA 2QP3A 2VIIA 5DYGA 3TVDA 3IO5A 1DAGA 4FN5A 1FMLA 2F43A 4QHYA 3GJ7A 4Q4HB 3C5CA 2ZE5A 5FTJA 3X1WA 4FIDA 1ZU5A 1OXTA 5AUPB 421PA 3LQQA 4ITRC 1DS6A 5DHFA 4LHZA 4PO8A 1OYWA 2YJTD 1ZIOA 2GXQA 1NJFA 4HUQB 5BN5A 2WWXA 1W46A 4QKQA 2FFAA 4G1UC 2IBMA 1XD8A 1M8PA 2AWOA 2QSYA 4ZDIA 3SYKA 1JXOA 5LPNA 3RRZA 2LKDA 1P2SA 5C2JB 3BBPA 2IYZA 1SXJB 2OV2A 1Z08A 1D2EA 2FSFA 4LJYA 5DI3B 3KQKA 2BMJA 1AKYA 1BMFD 1OKKD 4TZ0A 4EFMA 4NTZA 5GJCA 1NN1A 4Y0AA 2GCOA 2WV9A 3A4NA 4Q00A 3KKMA 3P32A 1WCV1 1KGDA 1QHSA 4TLAA 2G9NA 3K70B 4KXFB 5LBIA 4A0GA 1NBMD 1KY3A 2ONKA 4GMXA 3ZS9A 2J9RA 2O8EB 3T1OA 2NTYC 1ONBA 1NL3A 2YKGA 1S2MA 1HT2E 4BGDA 2W58A 1XPUA 1HTWA 5KSOA 1XPRA 1H8HA 1IXZA 1S0UA 4QHSA 4WIAA 4AG5A 5EE9A 2PCJA 3QE0A 3GMTA 1T3SA 1WA5A 2I1VB 1KY2A 4MH0R 1ZD1A 3QKUA 3AVQA 4BLSA 5HZKA 1R5BA 1DBSA 3ICQB 3MD0A 4CEIA 3WBKA 1NIJA 1ANKA 4A4DA 2OFWA 2BDTA 1E2MA 1SKQA 1Z0JA 4JLVA 5FTMA 3QKTA 4KODA 3B1ZA 3PITA 1DAFA 1YVDA 1W2GA 1YZQA 4HDCA 8OHMA 3T1QA 1VCOA 2O8CA 1JPJA 2QSZA 1ZCAA 1KSJA 2B92A 2B8WA 2F9MA 4RCZA 2JJ1D 4B48A 2X2FA 1AKEA 1BS1A 5BWMA 2OBLA 3R8CA 1DAEA 1TAGA 2GAAA 4PX9A 4LI0A 1DO2A 4JJKA 3E2IA 4DBLC 1JECA 1BKDR 2JLUA 1LW7A 4XTCS 2DFKB 3BK7A 2XITA 1XF9A 1YHNA 3CNOA 5JI3E 2ZRLA 5HTKA 1W0KD 4PANA 2GCPA 1R8QA 1Z28A 4BE7B 4LX0A 3JVVA 3FMFA 4Z1MD 1MRSA 2PMKA 3K0SA 2H5EA 1TQ6A 4DCUA 4PC3A 1JR3E 4KFUA 4DWJA 5A4JA 2FH5B 2IA5A 1KK0A 3KDSE 3C41J 1OLOA 2WZQA 3VR4A 1WRBA 2J0QA 2BMEA 5KDLA 2QAJA 3RHFA 1FOEB 2FFHA 3LW8A 2BM0A 2EVWX 1Q20A 2WHXA 4N0EA 2O8DB 2RGAA 1HT1E 3LXXA 2ASEA 3GQBA 2WKPA 2WICA 4XOIA 2HYDA 2P6UA 3OESA 1P9WA 5AJZA 1Q12A 3KQUA 4NE2A 2O8FA 1F60A 1X6VA 4M1KA 4LY6A 1Z6YA 4Q01A 2NPFA 4LYHA 3DZDA 4EQ6A 5JMTA 1ETUA 3D3QA 1L7VC 2ODBA 4X8OA 2GNOA 2C99A 1GZSA 2PZEA 2ECKA 4PHTA 3BXZA 4P4UA 1SVKA 2P6RA 2ZR7A 1NF3A 4TYPA 4EIWA 3OIYA 4CW7A 4A15A 4FI3C 3E1SA 5AJYA 621PA 2JLQA 4Q5IA 2G83A 5DLQC 4DC9A 4BFTA 1ZM3A 5LD2C 3K0EA 4B3XA 1E0AA 4MKHA 4RKFA 1NSFA 3A4MA 2ONJA 2ZI9A 3KQLA 4EFNA 4FCTA 2R8RA 3GJ0A 1OIXA 4KLZA 4PPNA 3U7FB 2BOVA 1E94E 1E3MA 4RFVA 2ZITA 3KFXA 4FMDF 4NYIR 121PA 2H92A 1KOFA 2JJ1A 1RJ9B 2ZANA 4H9GA 4P32A 3VQTA 1G8PA 4YMSA 4AYTA 2GZAA 4WAUA 3R20A 4Q7LA 1TU3A 2LKCA 3FKQA 1NVVR 3ZIAA 3NDPA 1W0KA 3TIFA 1Z47A 2HXSA 3KKNA 4JLMA 4HLUA 3TRFA 3TSOA 3WP1B 5BN4A 1SKYE 2PZGA 2VPPA 4R2HA 1QRAA 2Q3FA 3I32A 3X1ZA 4LRWA 2FGJA 3DDCA 4PC2A 1UKYA 2ZRFA 3CPHA 3PV0A 2WJYA 3U7EB 5DO9A 1YZKA 4RD6A 1DG1G 1XMIA 4A0HA 1CS4C 5FTLA 3I61A 3PIRA 4LBZA 4C0HA 3IPXA 4DZZA 3GLGB 3CKLA 4V0LA 2QE7D 2R6DA 1NN3A 4DDTA 4A2QA 4JVNA 221PA 4URZR 4KVAA 2JLRA 2OBMA 3BH7A 3ETLA 4MDFA 3UIEA 1P5ZB 1RIFA 2JJ8A 4BFYA 4PZZA 2OO7A 1JQJC 1AZSC 1CP2A 4AKEA 2O5VA 1KI8A 3SQWA 2HCJB 1E98A 1ZW6A 4QRHA 1BMFA 1I4LD 1TQ2A 4EFLA 2QQ0A 1GITA 1L2TA 1LS1A 1YRBA 3RRMA 2ZQ5A 1V5WA 2XSZA 4AC9A 3QPUA 1JPNA 2OXCA 5CYOA 4KITB 2QPTA 4YMTA 521PA 1ZM7A 1WF3A 4FMCB 2MMCA 4NYMQ 4X8HA 5TY0A 4ZDKA 3QBTA 3EIEA 1VYUA 1L8QA 5FOUA 2ZE8A 2ZJZA 4PHGA 4ARZA 1US8A 4OBEA 3C8UA 4JSTA 5FI0B 4DDVA 4HAZA 5FUVA 1N2CE 3OAAD 4DT1B 3B1WA 3RVBA 2IW3A 1M74A 3LFUA 3WYGA 1ODFA 4MYCA 2K5UA 1Q44A 4OI0A 4WZAE 2BBOA 2D2EA 2P65A 2CDNA 2CL6X 1T5IA 4LJ8A 1E9DA 4KBGA 3W5JA 3AKEA 2O8BA 3IIJA 1NMYA 3I92A 3CM0A 3SDZA 4OQMA 4LJ6A 2EWWA 1VECA 1KDPA 2P5TB 2ZRGA 1ZM2A 3TSWA 4BFZA 3TR0A 2EFEB 4ZCLA 2AFIE 1XU4A 5BQ5A 3CR8A 2ZSAA 5GVRA 4D4LA 3FFBA 3W5IA 2VRWA 3K0FB 4GP6A 3F3YA 4Q9IA 4E03A 4LK2A 3ZDQA 1ZYUA 4IEEA 3ZYCA 3GCGA 2JLSA 4TLBA 4CEHB 3GJ4A 1Y63A 2R44A 2OM2A 3PXGA 4DLTA 1RYHA 1E2DA 1XTIA 2EW1A 2MMGA 2J5XA 2JASA 3U4QA 2JATA 4DIDA 3U61B 2GZHA 3BC1A 2JLYA 1HUQA 2VH5R 1E2QA 3OE7A 4CEJA 4PQFA 1G41A 1S96A 3GLHE 3GFOA 1SVMA 1XX6A 4L9SA 2IS1A 1T3HA 4HATA 4JMPA 2O0JA 5JWHA 2W2VA 2CLCX 2OEPA 4LYFA 3T1TA 3WMEA 3QQ5A 1VYVA 4LHXA 4PAMA 3CO5A 1IN8A 1VG1A 2DCUA 3KJEA 2D3WA 2WJJA 1RRFA 3RYTC 4B74A 1KJYA 3SS8A 5EJEA 2FG5A 1N6RA 2DWQA 4MITA 1RW4A 1E9CA 4A0RA 1UBCA 4DCTA 2DY1A 2HEIA 3EC2A 5CLQA 5KDDA 3ZQJA 3CBQA 3KQHA 2OBNA 1FNNA 3BE4A 4QXAA 4IVQA 2QT1A 1K8RA 3KXKA 4PR0A 1E2NA 2XNSA 4G0NA 3K70C 1JXMA 3QKRB 1LY1A 2F3RA 1U8YA 2O8BB 4M1SA 3SI7A 4F7WA 4MDEA 5CB8A 3I73A 1Z22A 2A3RA 1QZXA 4B2PA 2IYQA 3CIOA 3BGWA 4IOLA 1DARA 2MSEB 2X8AA 2WOJA 3RS0A 3DOEA 1RJ9A 1EFHA 1UADA 4YXWA 2GF9A 1XBTA 1S1CA 5CJ2A 1LF0A 4OQLA 2ZSEA 3A1WA 4NMMA 3H84A 2RGBA 5FBQB 3GLHB 4KFSA 3B78A 2HDNB 4R9UC 3ZZ0A 1W36C 2CNWA 2ZYUX 4Q19A 1OSNA 4FCWA 4Y0VA 1W4RA 3U4QB 4Q1AA 2GETA 1ZVQA 3SYLA 2BBSA 3QY0A 4RY2A 1Z63A 3LXRA 4QNMA 4RD3A 1UKZA 3CH4B 4UXJA 2EYUA 3ADCA 1E2IA 4C0QC 3B8HA 4DLUA 3ZGXA 1UPTA 3W6NA 2DFLA 1CBUA 2BKUA 1KSFX 2QTFA 4DVGA 1R7RA 4RSGA 4TTRA 4PXAA 3LVRE 4N0DA 2QUZA 5KPDA 2WPDD 4Q9KA 3BFKA 4A8JA 4URVR 3SQXA 3TR5A 3B9PA 1E0JA 4FD2A 5KOYA 1QVAA 1KO8A 4BFUA 2ERXA 1P7CA 1G1MA 3R8FA 3AKCA 2B7CA 3QENA 4OJKA 3NEYA 1COWD 3TQCA 5CIQA 1YQTA 5EXSA 1EX6A 3ND9A 2JIZA 3VU9A 2JDIA 2HLDD 2WMNB 3G0HA 2I3BA 1E9EA 3SJAA 4EAQA 2AXPA 3W6OA 1YR9A 1XXHB 2IYRA 2QM7A 2R6FA 1HY3A 2ZRHA 4RD2A 4NP6A 5FOTA 3C14C 2IYSA 4I81A 4XWAA 5CLLA 5EXTA 3U3MA 3ZQ6A 1YJ5A 4ON9A 3JVUA 4F93B 3GLIB 4C2UA 4HLUC 1A2BA 1KNXA 1G21E 2KSQA 2VP2A 5B64A 3U3KA 1XD2B 1XJQA 1E79A 2N42A 1EFRD 1GSIA 2Y8EA 1XJCA 1I2MA 4QG7A 3T15A 3RABA 4BLQA 3GPLA 3MRSA 1YU9A 4DLSA 1HQCA 2H7VA 4V0KA 4X8LA 1GAJA 1W7AA 4TYYA 2Z83A 4MQBA 1KMHB 4G5OA 4GFDA 1GOTA 1OF1A 2WM9B 3EZ2A 2WPDA 1HE1C 2A5DA 3I4LA 1U0HC 4B33A 1NI3A 3GLGE 2GEVA 3QVVA 4V0NA 5CYPA 3IEVA 1T9HA 2F1RA 5JHGB 1XRJA 3TUIC 3EPKA 3U44B 3VU9B 2OCYC 721PA 4AURA 1JR3D 2I4IA 3CZQA 3M6AA 2EWVA 5AJVB 3X2SA 4M1WA 4ACBA 4TZ6A 1G3QA 1KJWA 2V4ZA 3LBIA 4OK5A 1T5LA 3R7WB 3MJHA 2XTZA 4POAA 4M53A 2GJ9A 2WJHA 4PSAA 4BFVA 1NY6A 3KB1A 4W5JA 3GJXC 2FOLA 3NWJA 3KX2A 3UMFA 1TX4B 5TDHA 1T6NA 2IF2A 5JCPA 2HCBA 3DKPA 3OHMA 3TQFA 1IN6A 4C3ZA 1WBDA 3IGFA 2J87A 1H65A 4KSBA 1ZC4A 3CPJB 1QHYA 3TW4A 1UDWA 3BIFA 1CEEA 3FHOA 3OIWA 1R5NA 3LVQE 1D8TA 2F3TA 2EQBA 2LCFA 2IEYA 2W6IA 3K9HA 4M9SA 4M9QA 4HB2A 4V0ME 4D4JA 1G8YA 1OYYA 4ZIRB 4AIIA 5JI2E 4Q7JB 2J41A 2WWWA 4DB2A 1J8MF 4YLGA 1OB5A 3NBFA 3U5ZB 5SZKB 2IYLD 3AF0A 4NH0A 5J4HA 3SEAA 2C98A 2WBLC 5KPJA 5D3QA 2VP4A 4HB0A 3CH5A 4GBMA 1ZJ6A 1E2GA 3M1IA 1M6NA 4KHZA 1G19A 4BRUA 2J0VA 3E5HA 4MYUA 3HYTA 1CTQA 3U3RA 2QMHA 4XTRA 1DOAA 2QAGB 4JKIA 5JWRA 1BIFA 2C78A 1F2UA 4BZQA 3GFTA 4QM7A 3PEYA 4CGZA 3W90A 4R71A 5AUNB 1VMAA 2PX0A 3T06B 2D7DA 4L8GA 5G40A 4PO9A 1AM4D 1FL9A 2GAOA 2IHBA 2QT0A 3SJZA 1AQYA 1VPLA 4QJ4A 5FR2A 1VG0B 3BD9A 4OI2A 4B6EA 3EXAA 2QQEA 4NONA 4TMTA 4JJZA 1PLJA 4TMVA 1CR0A 1SKYB 1E9AA 3OE7D 2A2ZA 1OIWA 2GTPA 4TQ9A 1R2QA 4MKGA 5AWFC 2ZEJA 2VF7A 3FMIA 5E3HA 1KDRA 1OH8A 1DEKA 4P4SA 1XP8A 4UXIA 3AF3A 1JB1A 2FN4A 1P6XA 1Z29A 2XEXA 1XEXB 4KYIB 4PO1A 4GP7A 2VLIA 1DAHA 2JCSA 4RCYA 1WP9A 4CZ2A 2WIBA 5EE3A 4PSKA 2A78A 3CRMA 3P4YA 5AK0A 4JLBA 2VBCA 4B76A 4EPRA 3WNDA 3QXXA 4JLDA 1UEIA 2NOAA 2AN9A 1KI4A 1VDZA 1X8LA 2B7BA 2H1LA 2G88A 3NC1C 2MSCB 3QKSA 1VG8A 4HLCA 5KSZA 3B82A 3V4RA 4I1UA 4PFSA 2QL6A 4PPQA 2G6BA 4OJQA 4GOXA 1X8KA 1VYTA 2OUKA 2X1VA 1IXRC 2WAXA 3OAAA 3OZXA 4I1SA 4Q1CA 1ZNYA 1Z83A 1W0JD 3QBVA 3SBDA 4U00A 4TYQA 2VSXA 5J5CA 4ESHA 4BEJA 1QHIA 4DLZA 1J99A 1II9A 2FJUA 2DYKA 1UFQA 3KTAA 2RGGA 4E07A 1G8HA 1T4GA 3HPRA 1SVLA 1B0UA 5G53C 1N0UA 2WIAA 4CF7A 2FGKA 3Q7PA 1IY2A 4H1VA 1ZNZA 4AY2A 3AUXA 2NQ2C 3K53A 3A6PC 1P2TA 1P61B 4XD7D 1OE0A 1LNZA 2ZRMA 1U2RA 3BB4A 4P31A 4ACAA 4B43A 1OXVA 821PA 2BM1A 1K6MA 5HKKA 5B58C 4PAQA 4HLDA 4ILEA 4M22A 4AYWA 5JSZB 3R9IA 3U2QA 3KL4A 4OHXA 4TSFD 4JS0A 3OFND 1FP6A 2G1JA 2W00A 3R9XA 1ZBDA 4LC0A 2NZ8A 2EFCB 1N3BA 4M1MA 1MO4A 1F3OA 4KJZA 3RANA 4TQAA 1CIPA 3B9QA 1P72A 1NVWQ 1Z0AA 3TW8B 5GADl 4V0MA 5CK4A 1K5GA 4A92A 1VIAA 4A0FA 3W8RA 2WWGA 5GJVC 2EFGA 1IQPA 3AVTA 2XZOA 3GFPA 2WAYA 3B1VA 3KJHA 2WKRA 2CHGA 1EWQA 4M1YA 3T61A 4Q1DA 2GHIA 1KDTA 4B34A 1KIMA 4L5BA 4IW3B 1SVIA 4O2RA 3BOSA 2BBTA 3AVXA 3EZ7A 2ZYWX 1GL7A 1GUAA 1SULA 4PHFA 1DELA 4UNPA 4C0AC 4MRNA 1JR6A 1X3SA 4N1AA 1XMVA 3I8SA 2GXAA 5EP3A 4TLDA 4L9WA 1PLLA 1V43A 2PL3A 4HUQA 2B8TA 1IHUA 1W4BA 1LVGA 4Q1BA 3BRWD 5CDFE 1RRGA 1WDTA 4NCHA 5JS8A 2ZE7A 3M4YA 1IN7A 1YZNA 1VCNA 4PSVA 4QFMA 4JSYA 2JAQA 3ZVLA 3AVOA 2RGCA 1OXXK 1PVOA 2REBA 3NTUA 4QGGA 2W0SA 1UKEA 3AUYA 3EX7C 1XDBA 4L15A 1JQLB 5GJBA 3GJ6A 1QDEA 3VR2A 3CF2A 3CNLA 3L2OB 4Q7MB 2PH1A 2A5YB 1RFLA 3PFIA 4QHTA 2ZI3A 5C1BA 1GNPA 4RD0A 2QNRA 2X77A 4O3MA 5DIFA 4HB4A 2WWYA 3IDQA 4B2IA 4QC2A 3B6EA 2YV5A 5JZVA 4HZIA 2YNMA 1Z5ZA 5CM9C 4DEYA 4LBYA 4S35A 1G7TA 4QJ5A 5G3ZA 3ZVMA 2PLRA 4DSNA 3RWMB 3CWQA 4DUGA 2IYUA 1CULC 4CRWB 1VKJA 1W48A 1W44A 2IHYA 2OHFA 2OCBA 4Q47A 1D9ZA 4IFEA 3L82B 1OFTA 2EFHB 2MSDB 3OEHD 5EE1A 4FMDB 2ZRPA 1G3RA 1A2KC 2GBLC 4M1TA 1HA3A 3DM9B 5H8WA 4DT1A 5JEEA 1BH2A 1MO3A 2P6NA 3B13B 1GNQA 5EUQB 5C18A 4O0MA 3LV8A 3SHFA 2JJ2A 2Z0MA 1E96A 1KI3A 1SVSA 3NIBA 2FU5C 1II8B 3KKQA 4IDHA 2C03A 4D81A 3QOFA 4RZXA 4CEJB 4L4UA 4XIGS 1XWIA 3RC8A 4Z1MA 1L4UA 2OCPA 4Z8YA 3KB2A 4HUTA 3FHTA 4X8MA 5IT5A 4AI6A 4HZUA 3I62A 3SR0A 4HAYA 5TXGA 3K0FA 1ZNXA 1G8GA 1J8YF 1Q1BA 5FL3A 3HR7A 3B2EA 1N6LA 1AS0A 4XWOA 1IXSB 5CIWA 3K8YA 2GDJA 3RS3A 4BZPA 3KZ1E 2IUUA 1JALA 3TSZA 5FL7A 3G82C 3WRXC 3GEEA 2CEAA 1L4YA 2C96A 3BB1A 3T35A 4QJ3A 1E4VA 2YC2C 1GM5A 3QVUA 3CX6A 3GJ5A 4RJLA 2RMKA 4PAOA 1N6IA 2RGEA 2V1UA 1G6OA 3LX8A 4S2EA 3RC3A 2ZSFA 4EPTA 2ZE6A 3QG5A 1BO6A 1TU4A 1N0WA 3MCAA 3P20A 2F1IA 4D25A 1ZC3A 5ELXA 4Q02A 1D2NA 4KLNA 2IS2A 2ZS9A 1S3GA 2RHDA 2VF8A 4QM6A 3BFXA 3B60A 3CW2A 1A1VA 3BAFA 4TYNA 4KVGA 2BEJA 3HJNA 3VHXA 3L0PA 2CK3A 2BWJA 3QUSA 2RKOA 5GJWC 3HU1A 2QN6A 1IN4A 2PT7A 2ZAOA 4M0LA 1W1WA 5EZ6B 4B3DA 1TL7C 4A2PA 2IS6A 3SJBA 5JJIA 4Q1FA 3L43A 2IF0A 4AYXA 1U0JA 5F9FA 4LJAA 4GOJA 2ZU0C 5TMPA 4A2WA 4RVCA 1KYIA 3HPQA 3AVVA 2HF9A 3K0AA 1FTSA 2GVZC 1AK2A 1W4AA 2GRJA 5AR1A 5LDDC 3AGQA 2J0UA 3RDPA 1U98A 4PZLA 3THWB 1BOFA 1KKMA 2AKYA 3O47A 1QHHB 3F0TA 3HP1A 1J7KA 1R0XA 4AK9A 2ZSBA 4TL7A 2IYXA 1C9KA 4DLVA 5DYIA 4M2LA 1EWRA 2QY9A 1GILA 2AK2A 2YINC 1YR8A 1TF2A 4MYHA 1KO4A 4P4TA 2GXSA 3RLFA 3I5XA 3NKVA 3CNNA 4BEBA 1XMJA 4PPFA 1KK2A 4RZUA 5EXXA 2YWFA 4UNRA 2YHSA 4C0KA 1CJMA 1G4AE 1NKSA 3IBGA 4LHVA 3EG5A 1UBEA 5H1YA 3ZZTA 1VCMA 2ODWA 3THWA 1IAQA 5DHAA 3VNUA 1KI1A 2ZM5A 2H57A 3A37A 1Z07A 5LB4A 1Q3HA 3A1TA 2KBEA 1OXUA 3AKYA 2QBYA 5D3MB 1KZGB 1OW3B 2W6JD 2JLZA 3U7HB 3X1YA 3EPHA 1KK3A 1OIVA 2A30A 1NLFA 3K9LA 5C4MA 2IX3A 2ZVPX 1DPFA 1W5SA 5IHPA 2QI9C 5FPYA 4B44A 4IJMA 4D2IA 4J0QA 5L3QB 3LY5A 3NBYC 5EE5B 1CKEA 2GJAA 4M9XA 3N2IA 3P1JA 2GF0A 2W83A 3D6TB 1XJ0A 1Q21A 3T5GA 3A36A 2V6JA 2G3YA 2V7QA 3GEIA 1VG9B 1Z6TA 1UEJA 4BUJA 3NC0C 3F8TA 3MG9A 1E0KA 1YZLA 4UJ5A 1OV4A 1PUJA 1U94A 2VP6A 2CL0X 2JJ2D 3W3AA 3PVSA 5FPHA 4EPWA 1FQKA 4JBYA 4CDGA 1KTVA 4Q9LA 1BYUA 1N5IA 3CUEF 4EJSA 1SXJD 1H8EA 3LA6A 2D2FA 4G01B 2OLJA 3LLMA 5L3SA 3KUDA 2ZJ5A 5TARA 3PEVA 4M4SA 2QBYB 2ZRAA 1GIAA 1DTSA 4I99A 2WWFA 3Q8XB 1NBME 4LOAA 3SE0A 2P2LA 4URXR 3BB3A 4AKHA 1P62B 2IXFA 6Q21A 2QPAA 3IILA 1JBKA 2C5LA 4YONB 4DSTA 2WSSD 3RAPR 2IWRA 1CU1A 4OL0A 5M04A 4G3XA 2P67A 4F4JA 4RFSA 2ANCA 3BH0A 4LHYA 2CHQA 3QPVA 4RKEA 2SHKA 5UKDA 1DAMA 1DAKA 2KWIA 2NZJA 1FUUA 2IUTA 1NSTA 1TQDA 1B23P 3CZPA 4U02A 2TMKA 4B3FX 2C77A 3FHCB 4Q4HA
chains in the Genus database with same CATH superfamily
2VQEB 4OHVA 3BJRA 5DLDA 4AMUA 4L2IB 2JK0A 2LDBA 5SZJA 2I55A 3GP8A 2QE6A 4UKDA 2Z4SA 5ALJA 1KIAA 1JG4A 1Z88A 5ESDA 1VI6A 2ZIWB 5AKYA 2HUPA 2QU8A 3ZOKA 4EDHA 1KIFA 1ZUIA 2ZJ3A 1HTBA 1Q11A 2VH2A 2KE5A 3I6ZA 2IH2A 1HNXB 4NRDA 2WWTA 3FOBA 3QEMB 4CYMA 1MO5A 3UK1A 2PU7A 2XGMA 1ZHOA 2FMFA 1RVDA 2VRCD 3SBXA 3QKRA 3TOZA 3AUTA 5IXSA 5KVSA 1JIIA 2VDMB 3B7WA 1LK5A 4HFRA 2R96A 1XTUA 2CMGA 4EGJA 4EPXA 3DJYA 3F74A 3PUXA 4YXFA 4ZJPA 1AQJA 1L4BA 3KT3A 4GP9A 3C85A 3QBDA 3K71B 4XX1A 3G9ZA 5CMLA 4D9EA 1O6GA 3D81A 3LBHA 2RH9B 4LOJA 4Q48A 1QIEA 2F43B 2RHJA 4JI6B 3EVBA 3T3IA 3VOSA 1WNTA 2NAPA 3A6DA 1V11A 4UNQA 3T7RA 2J6IA 3UICA 2ZUDA 1J24A 3TL3A 4IQGA 1ZU4A 2B20A 4HRVA 2C4KA 4XEHA 4I3FA 4FDTA 1X77A 2IE0A 1IC6A 1Z15A 4DYVA 3B3AA 5BVGB 4CM4A 4UOQA 5F2KA 2I2FA 4WGFA 1FMTA 1MABA 3DL0A 3PXBA 3DW3X 3IKJA 3NOVA 4JYAB 3C4JA 4BWYA 4L5IA 3ZX4A 5CX1A 3Q3HA 2OESA 3CURA 3T5CA 3GUVA 2OD7A 4WJZA 2ZBDA 3PR1A 3AQ4A 2HWUA 3TRJA 5FEUA 4BMOB 3EZYA 1OOEA 1SZDA 2NO7A 3DEFA 3B12A 3SEQA 3OG9A 2YWEA 3A6FA 4ZV4A 4OHYA 2ZS8A 2X3FA 4ZXFA 4EPVA 5KAMA 1RIIA 2X0EA 3FDIA 1E18A 1IZ9A 2O0HA 1ATZA 2YVUA 2HO4A 4D7AA 1JHZA 3QHPA 4Q24A 2Z43A 3WGVA 4D4KA 4WY8A 1D6NA 5ER6A 1SUIA 1TYBE 2IWHA 2XHZA 3VNVA 1ENYA 5ERXA 5L7YA 4EBFA 4WN3A 4PV7A 1U90A 3DOUA 3P2JA 5HKKD 2XQFA 4EHNA 3Q2IA 4CQLB 3R6GA 5CEEA 2BKEA 2BE7A 3QI7A 1JDVA 5G0SA 2AFIA 3KSZO 4F04A 1WF6A 3BIWA 4AY6A 4G5FA 1C2TA 2VF5X 2Y0DA 4I5IA 1WUHS 1U6JA 2L18A 1QE0A 2R2AA 1CY8A 3N0XA 5DJ5A 4BP9A 3U6KA 2P5SA 1NUHA 1GEEA 2OENG 2RCNA 2K7FA 1PV1A 1QX3A 5IVDA 2QA5A 3KKEA 5CYFA 3OFSA 4QWMA 3VAAA 2XGJA 1PEDA 2UXBB 1T0HB 1H23A 2JFBA 2RB4A 2VTBB 2FZKA 3EYAA 1C0LA 2OHOA 4RHXA 1NASA 3FPLA 1LQTA 4HEA6 2RHGB 5FXMA 2HA3A 5D01A 4BO6A 1Z4IA 5L6LB 3D6MA 4XDYA 2CFSA 4LZWA 1ULHA 2QIOA 4WBSA 5THKA 3KSBC 1AMUA 1XMXA 3STXA 3WYCA 5JADA 3N3AC 4RIFA 1ZD3A 4MMZB 1IHDA 4TRJA 3PDJA 4ZARA 2OSBA 2C5SA 5KUTA 4LCBA 4AL4A 1FP4A 4CCSA 3KR2A 2B2NA 3KK0A 1TDJA 4QVGA 5CT9A 3Q3VA 2BZSA 4PICA 3TZQA 4F11A 3FJ1A 2VQ6A 4AJ4A 3JQBC 3EFOB 3HCOA 4R2IA 5FPPA 3UKDA 1OXMA 2OC4A 1T0JB 1J7JA 4LJ4A 4JA2A 2B3DA 4JCCA 3Q1KA 1ZIPA 1GNTA 4HHEA 3C43A 1A9QA 1M1YE 3G49A 4K1LA 4AT1A 5JXGA 3EPJA 4EUFA 3VR5D 3V9PA 4WK0B 1FFCA 3WGTA 1NKTA 1D7OA 1R10A 3DZKA 3KJIA 3I5MA 5I7AA 1G7CA 3MGKA 1J0AA 3TE6A 4D0SA 5L4SA 4W5QA 2XOKA 3H3XA 3IERA 4D80A 4E5SA 2Y76A 4DHEA 2H1RA 1VRCA 4WZBB 1ZOPA 3P0EA 2ZWPA 3QH4A 1AUVA 4M0MA 4TSRA 4NI5A 3OLYA 1TUIA 4HRYA 1IJEA 4XVRA 1L5GB 5JBQA 3QLUC 3QNUA 2I8LA 5FR1A 3SGLA 3TLGA 1GCOA 2IY7A 3OF2A 1OHHD 1VGVA 2WF7A 3JYHA 2V54A 3WGYA 3ROTA 3DSRA 3IBTA 4HNTA 5K3FA 4TN5A 5CFMA 4D6PA 1NBIA 1K6XA 2O2IA 4FUTA 5DHQA 1J0BA 1E9FA 1E2KA 2B37A 2X6RA 2GK7A 4GDMA 4W8GA 3KEGA 3TMKA 3F7MA 3DVSX 3HWX1 3TNFA 5FOWA 1AZLA 5DM4A 5K8UA 1HBJA 5JJLA 4KQWA 4AY4A 1R12A 3P2IA 2DLCX 2R7MA 1YD7A 1UDXA 3QW4B 4J7XA 4E3ZA 1PGPA 3IO3A 4OGWA 4QO8A 4BMXA 4FR5A 5LKAA 4IH1A 5JJCA 3PS9A 3V5NA 3WGHA 1E6MA 2PBFA 1ULBA 3ETHA 4RYDA 3QUCA 2JARA 2GESA 5AW0A 2YJ3A 1X1QA 3GDGA 1SMKA 5K3FB 3G6WA 1QGOA 3ECAA 4RK7A 4II7A 4IEIA 4PQRA 3TCNA 4XRGA 1JYSA 2EZ8A 1P75A 1YZTA 1GU1A 3G5AA 4IBOA 2WHEA 4YDQA 3GT7A 5J2UF 4CKCA 3OZIA 5IUNC 5K4HA 2I4NA 4UM8B 3ILYA 3TUZC 4GBJA 2PUDA 1LLCA 3FYTA 2PEYA 2C9BA 4U7FA 1XV5A 2QN3A 1F8UA 3AT1A 4OP1A 4JXZA 1ZCFA 1S8NA 3H83A 3KEOA 5H70A 4XM1A 3VR3D 1FXWA 3MBKA 4JROA 4BVAA 5DX8A 4L4XA 4GOKA 3RFVA 5LMCA 3H4IA 3I9LA 2NV0A 4F5WA 1KKUA 2J33A 5J2TF 1XZNA 3K1ZA 4E2ZA 5E95A 2ZRJA 3HYRA 3WB0A 3WFJA 1LX6A 1T1IA 3FOAA 3EXHB 3H9QA 1P2GA 4RMIA 5JS7A 3ZWYA 1AQ6A 2AN1A 2OWEA 4JP5A 5TMDA 3IBYA 2RHBA 3FYCA 3RNOA 1SD5A 4ESEA 4DLWA 5B2FA 1WETA 5TX7A 1C0EA 2X9QA 2MU1A 4MKRA 5AQEA 3OJLA 1JRLA 3PHGA 2CCJA 4TSKA 1XEWY 2C2OA 1XMPA 1XTKA 2IC5A 3HVJA 1WOYA 3MQ4A 4X3OA 1TZJA 3D02A 4YN3A 2XRMA 4XUEA 1S1MA 1YS6A 1LJUA 3QJGA 4OHWA 5DGXA 5DLEA 3MWGA 1F2TB 2OWDA 3D8BA 4JT4A 3LYUA 1O94D 2Q07A 1UBSB 3I9JA 4MARA 3RS4A 5DYWA 3WNBA 3MJEA 4X66B 1UC4B 2WP0A 1NW9B 1JFFA 1G6HA 1R0WA 3TOSA 4ZI7A 3AHEA 5GONF 4CNQA 1PJCA 4B31A 4A36A 1Z0ZA 5DTMA 1I9GA 1FPQA 4KNYA 1J9ZA 1E79D 2NU7B 1J5XA 2HJRA 1T8UA 2BF7A 2W98A 3LKDA 4DLAA 3EASA 3DVQX 3EFBA 3BWDD 1QH9A 5DOZA 4YREA 3CONA 1KZ9A 3A9CA 3D0OA 2ZS7A 3QJYA 4OYHA 1Y33E 3W5DA 4R81A 2JAHA 2APJA 2ERCA 2BE9A 1P0CA 1G6Q1 1EG2A 1HZZC 1GQRA 3NRBA 3PD0A 1U9IC 3H8SA 1D5WA 4OYRA 1O4VA 1XEWX 2AZTA 2X19A 4L08A 5A6SB 4GKVA 3SX2A 4BN0A 4EVQA 4QGSA 1DC5A 3OKPA 4K6CA 4R2KA 2VXCA 2QLMA 4P4NA 4I4TA 2A59A 2FMHA 3KPVA 1GV0A 1FVOA 3D5TA 2ZRCA 4TTIA 1GG9A 1COWA 4TWZA 3VVLA 4CHGA 3DLBA 2Q6OA 1NRJB 2AG8A 2Q9AA 4PZCA 5EP4A 2WT8A 3FROA 1R50A 1XQXA 3M9LA 4G6ZA 4CV1A 1COZA 1QORA 2YXDA 4CKBA 2BLLA 3VH4A 3D3NA 1YL6A 1R18A 1ZNWA 1EE2A 3GJ3A 1JAZA 4GX2A 3ZHRA 1PGJA 3ZWMA 2A8YA 2ROQA 1FFGA 3EW9A 4GKBA 1JZSA 4H31A 4NL4H 5CH3A 1E7QA 5H68A 5TE9A 1XTJA 2GRUA 3PSHA 3VFDA 4AF6A 3KETA 3KYDA 5B3JC 2FX5A 4NBUA 1MAHA 4YAGA 1S2DA 3GAZA 1P73A 4GGPA 3MINA 2V74B 4I3GA 4WFJA 3ABQB 1HH4A 2AW3A 1T6BY 2UVDA 3U62A 3I1FA 4P4GA 2QR3A 3GRVA 1KHTA 1AKMA 1D0IA 1FQOA 3NT5A 1JVSA 4CIDA 1KI7A 4R5MA 4D4MA 3PL5A 4UHEA 3CEAA 3AJ9A 3EG9A 1LB1B 1N7GA 4A6XA 5FI1B 1LBSA 4C0WA 4MB0A 4RD1A 1OMOA 4U4AA 2WDPA 2XEDA 2VG8A 3D1JA 3LKBA 4NAHA 3TQHA 2PLFA 3MM4A 3UUEA 3V4FA 5BR1A 4TL6A 4F6CA 4TV9F 5BRJA 1GKUB 1N5OX 4DLLA 4U2GA 1QIHA 4DM3A 4E11A 3JY6A 4PXYA 2Q6TA 1NQAO 3EIHA 3KTAB 3TJZA 1WBBA 2LWIA 2R48A 2ETVA 3NTXA 2DP4E 3A0RB 2ZSDA 1QTRA 4KFTA 2WF5A 1YK0A 3CH7A 5LZ4A 4AWXA 3IIMA 2X7XA 1R4MB 1Q6ZA 2AMJA 2YNMC 4NOMA 3JSAA 1SXGA 1UM8A 2UYQA 2WIJA 4IG9A 4NE9A 3D7SA 2OYCA 3DBRA 1EUZA 4PTZA 1E3LA 3K9BA 1AXRA 1P17A 2RJNA 3EULA 3B7GA 1S2LA 1QR6A 3VSDA 3EZ6A 4UZEA 2A5FA 3E9QA 3EN0A 4G8DA 4S12A 3TQTA 4H7IA 2WUDA 4CM9A 5KHOC 4UBNA 4MVJI 2FE1A 3RFTA 3RYFA 4B6PA 2ZREA 4JQSA 1R15A 4BBJA 3F7NA 3HNOA 4Q18A 2P90A 2NU9B 1FJXA 1EXDA 4L07A 4KHPB 2X15A 4UAJA 5AMXA 1KAGA 4ZD6A 1HOTA 7AT1A 1RVV1 3TX6A 3STVA 4GI7A 5TQVA 3K1JA 3WSTA 2OCDA 1SC3A 3N2EA 3ZHTA 3S8YA 2XMPA 2GZDA 3CLSD 1K7FB 3C8ZA 4IQ8A 5EIXA 16PKA 1QHFA 1O6ZA 1RI5A 1MB9A 2GEUA 3F9RA 4IOMA 4EG7A 6CHYA 4RVDA 2E0IA 4GT1A 3DWGA 1RWNA 3REGA 5EKDA 2FK7A 1BHQ1 4U7DA 1QG4A 1MHPA 2JJYA 1N0VC 3MYRA 2C8VA 1U4NA 3ZXIA 3R3XA 1QGAA 1RKBA 1AQIA 3NLLA 3PHHA 3ICOA 3E22B 3CMMA 1RPZA 2H5LA 2PGLA 3WQRA 2JEOA 3GGOA 4EJMA 2ZR9A 3F97A 4GVLA 2XUGA 1RFGE 1FF9A 3B5JA 4JENA 2Q3LA 2I5PO 4A9AA 1FFXB 2HNBA 2BCJQ 3UV7A 1OWPA 4DNQA 1B42A 3U3OA 3WSWA 1TJYA 5LXTF 1SU7A 1G64A 2HCRA 4GPTA 4NESA 4PGFA 3M1YA 3O7MA 2GBFA 5A9TA 2CCGA 1P1BA 2BP7B 2V8BA 2VZ9A 5AJWA 4XAQA 1U6IA 2I29A 4HFJA 1GRQA 5IPFA 5KX5B 3V48A 3M4ZA 1K5DA 1N7JA 1VTKA 3LA8A 5HFJA 4S1VA 4D4HA 5L3SB 3PEUA 3TLCA 3GYBA 2H0RA 5IJ0A 5EJ8A 1K1EA 4FDVA 4TMFA 4F86A 3L40A 2QUBA 4B8YA 3MCZA 1LK0A 3L7KA 2PZFA 3E9EA 4RVFA 1P91A 1PW5A 4RF4A 3HVRA 4CMCA 4KWCA 3EVFA 3HUFA 4MCIA 3D3WA 3L1KA 4OP2A 4Q7KA 2ZAYA 1UMCB 4FBGA 3EH2A 1USWA 2HU7A 4NCNA 1CNFA 1MKYA 4Y6QA 1R4AA 1X8XA 2HH9A 1P45A 3PUYA 1DAPA 4TS9A 2AKAB 5EXPA 5AW7A 1SHZA 1BE6A 1NBAA 1KRWA 5IDQA 2ZTUA 2WT4A 3CYFA 2HU5A 4BEVA 3PPIA 1TYEB 1UP4A 4FHEA 1C7EA 4OMCA 2JFHA 2F59A 5HMMA 3URKA 4DMUB 1VA5A 2I4TA 4D96A 1ZJJA 2XQVA 1D04A 3ONWA 2WW8A 4X7BA 1USKA 2CNDA 2AIRA 4F1WA 3I3OA 2I7DA 1QQ6A 4BLTA 5IKMA 4L22A 2AOVA 3FE2A 1TEVA 3ITKA 4AS1A 2O50A 1EVZA 4NK4A 3B8EA 2XSZD 5J4LA 4UASA 2ZWMA 1XEXA 3R3SA 1U2DA 2UYCA 1OI2A 3AOGA 2W8ZA 4J0KA 4MGKR 1V9LA 2ZBRA 4O4IA 4OJNA 2P3SA 4DMRA 1JLLB 1XCPA 2O2ZA 4R2MA 4LMAA 1XFAA 3O7WA 1F7UA 1J56A 4OA5A 4LV6A 3RYCB 3GFFA 1KAOA 4BCBA 1XTVA 3DFUA 1YBMA 3VU0A 1W581 2ZBPA 3C3AA 5C5IA 1J8QA 3E4CA 4OFBA 4X7MA 1KQFA 4CV2A 3E0XA 2VEDA 3C6YA 3RRJA 1CC1S 3LUGA 4EATA 4HRAA 3IQWA 4HLQB 1DBIA 4DCSA 3CSUA 4XJXA 3F90A 3FOWA 1GPLA 2HJSA 1SKAA 1Y6JA 2Z56A 1TAHA 1BGWA 3RG8A 1YRQA 1FZQA 2AQIA 2XADA 2Q7XA 1GQ2A 5HDBB 3TLMA 3DMTA 4O2AB 1Q57A 2I6QA 1YRAA 3CX3A 2AQKA 4P4SB 2VP5A 4JYCA 3W04A 3F6YA 4N0QA 1NVMB 3BXXA 3MCTA 3PJGA 2ZPAA 5AK4A 4TXHA 1ZUWA 4XARA 1UMBB 3HI6A 4U7TB 3ZIAD 1MR3F 2P3LA 2ZR0A 3CG0A 1F38A 3H2ZA 2JLBA 3UN1A 1TT5B 4PG4A 3QPCA 4C0LA 4P3XA 4EJSB 1V5EA 2IFTA 2GAFA 1OR8A 3RS2A 1L4HA 3G89A 3FUXA 3LYAA 3D4IA 2V0GA 1JWAB 4A26A 1EESA 3ESZA 2FSIA 1SPBS 1QMPA 2IEZA 3CUWA 3FZNA 4Y7DA 1C30A 1TJNA 5CJPA 5FL7D 1EFUA 3DXZA 3SHOA 2IPXA 4LHSA 1DLIA 4QQRA 4XDHA 2VHWA 3C6QA 3H13A 5D2CA 1XPJA 3AVYA 1OQAA 3QXCA 1IMJA 3DCIA 1R6TA 4D57A 5H3CA 2E82A 1V3VA 3V34A 3IQHX 2FCAA 1G60A 2FWMX 2B2CA 3GNQA 5M3BA 4HAVA 2RH5A 5K20A 3GG2A 5HZMA 3FGZA 4ER6A 1CEXA 4CF3A 1P5JA 1E5XA 3TTUA 3KO8A 5K4AA 1Z0FA 1YRLA 3ZIDA 5AHKA 4TT8A 2WJPA 5ES3A 5C8ZA 2FHPA 1T25A 2G04A 1VBNA 4BWFB 1Q1EA 2B8NA 4WLFA 4ZWNA 5A0VA 2F7SA 4WXMA 1FYDA 3D4OA 1Y4DE 2P8JA 3A26A 3SLGA 3DE3X 4P38A 5G0UA 2OXTA 1GKKA 5JCZA 3BS4A 4LE1A 3W6PA 2QLLA 3PDUA 1EQAA 4DNXA 4RULA 1EX7A 2XHEA 4N3NA 4B3RB 3D7NA 3F5DA 2XT9A 5LXTA 2HK9A 1DINA 3R44A 3R7SA 1IM2A 1QHHA 4D8WA 4YMVA 1OH7A 4P82A 5L3VA 1UPBA 3K9GA 1GFIA 1PJQA 3G5UA 4DWWA 4KG7A 3VA7A 2Y05A 3BSYA 2WLSA 4GLFA 3AEXA 3ZW9A 3SYRA 4UM9B 3UMMA 4ZTZB 4BNDB 3L84A 4ARSA 2FPIA 2NWQA 4HNSA 1YOBA 4RX1A 1XTTA 3KYBA 1YONA 4PFQA 1I5RA 1R0ZA 2O1WA 4MVJE 1CJTC 2FY8A 2RAFA 3K5WA 3OICA 5FDFA 4JEUA 2VSQA 1GUBA 3B1JA 4PC6A 1G38A 4HEHA 1C7FA 1CQZA 1UZLA 1Z39A 2P8SA 4Q66C 4QYWA 5DHRA 4B47A 3TGPA 2VDQB 5AP9A 2P6PA 1AN9A 2H1VA 3QKIA 3W9YA 1QO0A 2BJVA 2WPNA 1UAAA 3BILA 2WLTA 3LY8A 1D1PA 1H0SA 4NYIQ 1V1MB 3V80A 1XNQB 2J6CA 1E2LA 3KEMA 5M7EA 2GJ4A 2Y93A 3HP7A 3WA6A 1WHSA 4TS4A 3SOPA 1DWQA 2L0XA 3RKUA 4BMNA 3U9SA 4BQSA 1ZSNA 5C0OE 4B3HA 3W1VA 1YT5A 4MMXB 1L9XA 1AGRA 2DPXA 3THRA 2C92A 2EARA 4WACA 1D2AA 4JLJA 3VPHA 2GBGA 1JLKA 3HU2A 4CM3A 5JSQA 2YVQA 2PK3A 4KRFA 1NR7A 5CAEB 1FP2A 4GMGA 3V8NA 1K88A 1KC1A 4E1AA 1EDDA 2I2CA 5AXBA 5KYYA 3OJWA 4RY9A 5JO0A 1K6EA 3OZFA 5DTJA 3Q11A 4UHHA 5BYAA 3WL8A 2PZMA 1Y3FE 1M2VA 1PVVA 2Z5FA 4PSUA 1GQFA 2XTNA 1N8NA 4WHMA 1T1RA 1ZD9A 2OP0A 2HXYA 1Y4ZA 3Q3JB 4XVQA 2XE7A 1JEYB 1CV2A 1JHUA 5I9NA 1TTTA 4IJUA 4J94A 1YU6A 2BHTA 2N1BA 4ARZB 1JH9A 1HNNA 2VDLB 4HQRA 4Z0TA 2C3UA 4CU5A 1WPXA 3AW9A 2PVPA 4P54A 1OD6A 5I7SA 1YQEA 1V7ZA 3PJRA 2FZGA 4DMMA 2AEMA 1CXZA 4CR8A 1NP6A 4ZVUA 2DTDA 1LBEA 1PDWA 2B69A 3V42A 4BGEA 4ZZ3A 1A77A 5HJEA 5GINE 3MJVA 5EL0A 3JYPA 5AJHA 5HXAA 2GJSA 3IUBA 5BOSB 1L8XA 2ORYA 5IN5A 2PAFA 2CBGA 4N7RA 1ZEJA 4W6QA 2X5OA 4FSXA 1E3TA 4C7KA 4J16C 2YOGA 5AW8A 1BH6A 2NO6A 2GGSA 3ZUPA 1I4OA 4H77A 4B75A 2P6OA 1FJGB 1P5FA 3MWLA 1G291 2BEKA 5ESXA 1T0PA 1TI7A 2BEVB 2QUAA 2V6IA 3AVPA 3C7TA 2FFJA 1CE8A 3D2BA 1KFKB 3Q7QA 1QDUA 2OB1A 2JZNA 2Q2NA 4PTLA 3RUFA 2IP4A 5KU1A 2IE8A 1IHXA 1NN0A 2LR0A 3GVIA 3OM8A 1XTPA 2IXDA 1A97A 3PCXA 2BHLA 3EC7A 2EYQA 2H4FA 2OXEA 2PXXA 4LUCA 4OH7A 4HNVA 2QYTA 4MAMA 3ZD8A 1U8ZA 4EGCB 4XJVA 1X1SA 5AVKA 1NVKA 2JA1A 2PG3A 3GBSA 4B4DA 5I47A 1YS9A 1VHTA 1OTHA 3QEKA 1O5OA 4BLPA 3C7AA 4X1IA 1KDYA 3ZLBA 5JATA 2ZM6B 3TTXA 4N5IX 2J5BA 3QUQA 2NU8B 5GGXA 1ZGJA 2W22A 1P9NA 3DEJA 4ENVA 2IEIA 3NBXX 2FW7A 2NPIA 4K88A 4BB9A 4XCQA 4XD2A 3VVCA 4DCPA 4EBBA 5L45A 1XPOA 1EEXB 5J1TB 4HPWA 3EA5A 1NWCA 5B1IA 3KXPA 1B74A 2PMDA 1ESNA 4UJ3A 3GLIE 2ZJ0A 3K7EA 1LV8A 1FBTA 3AONB 3QX8A 4WLEA 3K70D 3C8MA 1AC5A 2VHUA 3JQFC 5D5QA 4C22A 4D9JA 4OF4A 4ZHSA 1Q83A 1J5EB 2PX2A 1GA4A 3ZDFA 4C08A 1NU6A 2OBYA 5HJ2A 4H1HA 3TQOA 1P3Y1 2AE2A 4O2LA 1UQTA 4IOKA 2MT9A 4O33A 1MXFA 3OURA 4KMMA 5A1JA 2GN4A 1ECBA 1MOZA 3X1KA 2C5AA 2QN7A 2DH6A 3TW8A 1YDGA 1TEHA 2FXVA 5HEKA 5EAIA 2DOKA 1VPDA 2ZJ6A 1FNBA 2CLSA 2VYFA 4HXFB 2IELA 4YH1A 3T9AA 3SHVA 3LE8A 5AUQA 1IM8A 1FVHA 3K35A 3EZNA 3VPSA 5HX7A 1OFUX 1MHTA 2D7CA 5KQSA 3H9BA 1FRVA 4JVLA 4LV8B 3FWPA 4BCDA 3RUDA 2G1KA 4JB8A 4IHJB 2XGOA 2F1HA 1A9OA 1LBIA 5TGDA 3UCFA 1P4RA 2HA2A 1ZH0A 2GO1A 1HFJA 2BCGY 5KYXB 1QAQA 5LU9A 1CS0A 4TLCA 4ETNA 2VJNA 1LPOA 1ZVMA 5C51B 3FDZA 2PUBA 5DHSA 3ZKWB 5EP2A 1CQIA 3PJDA 1Q3TA 2W6ID 1JAHA 1X15A 2QD2A 3GD7A 1HDEA 3M34A 2E1PA 3D4LA 3K1AA 4KUHA 1MJFA 3TQRA 5F3WB 1IQ0A 3D7MA 4LRTB 3B1FA 5FJIA 5HJ7A 4CL8A 1RLMA 1DKUA 4A1FA 2A67A 3K16A 2JLWA 1BMDA 5KHLB 3PQ5A 2A9KA 3QFSA 2J0EA 2OTCA 5HUJA 4N12A 5A03A 2GK4A 5E4YA 1MF7A 1E1LA 4INJA 5L3QA 1FUIA 4FIZA 5IK2D 2JFWA 1W19A 5KTMA 2OCIA 4D26A 2HIMA 3DZBA 4BNYA 4CTKA 5HVNA 2OB2A 3ZDXB 5G4KB 2R8EA 1I4DD 4QNRA 2EL9A 3EVEA 1V3QE 1P1JA 4RJKA 4IJ5A 3CWZA 3CLUD 1DX9A 2WM3A 1RC8A 1U0LA 4ZHQF 4F60A 2EV9A 4HCJA 1KO5A 4R54A 1R9NA 4AJPA 1E99A 4HPJB 4GGOA 1QK5A 4YJ2A 4Y1RB 4PQYA 1JTEA 4ZU6X 4EF5A 1ZMXA 1CUUA 1NMEA 1ARZA 3JYLA 5FAKA 4NZ9A 1TUBB 4LN1A 1E1QD 1ZP6A 3GA0A 1T8TA 4US1R 5ERYA 2V3WA 4OLJA 3SNHA 2V03A 5TEVA 4G4GA 2XECA 3VJLA 4DV0B 3WHLA 1UINA 1T5BA 1I24A 4IX9A 3CCBA 3T5DA 3SM3A 1VXRA 1GKYA 3RAGA 4IV5A 1B00A 1FTYA 2IZ0A 5GZ1A 4WOPA 1YHZA 1A4IA 2C2HA 5ALIA 4X95A 3FY4A 2OMEA 5JH7F 2F55A 1ONNA 1BFUA 1N1DA 2P5YA 3FNHA 1CR4A 1BU5A 1KI6B 2GVNA 4EY8A 1O96A 4ZCMA 1PJAA 3HJGA 1J8VA 3NAZA 4PLVA 4TTPA 4ZQGA 2ARKA 3CU5A 3K8ZA 1TB4A 1PZGA 5ECDA 4OJMX 1ISMA 5FQOA 4NNOA 4F56A 1V95A 1G6KA 3KOXA 4GE3A 1OLUB 5IVIA 3TRIA 3E8SA 1AS2A 4HDOB 2WUFA 1SBTA 3M0EA 2WSMA 1GTG1 1T3GA 3AR5A 5TRTA 1BX1A 2EERA 4Z2AA 1PFUA 1I1NA 1E5VA 4M0EA 3ZWNA 1EK0A 1KY4A 3K09C 4GNRA 4YAOA 5KB3A 4E5UA 2F8LA 3RJTA 3W7BA 2JFYA 1NNEA 3K9FC 2F3QA 3B53X 1XK6A 1F4PA 3D8SA 3IDAA 3P97A 5D5PA 3K20A 5G41A 3K9WA 3BWBA 3N2YA 1GVNB 1RHUA 4GE0A 4QDTA 5GM2A 1ULTA 1PKEA 4FM9A 2DTEA 4IHQA 2I6GA 3G59A 2A94A 5C4GB 1RQNA 2B83A 5IC5A 4OMDA 3KLPX 3TXYA 2VDRB 2QGZA 1SVWA 5K3SA 4E4RA 4KXNA 4RPHA 1XLUA 3IPLA 2DJIA 3DMDA 4AN4A 3ZD6A 3JALA 4EVIA 1KI6A 4Q7EA 1AGYA 3QEAZ 3G1TA 4R8VA 3OUUA 2H1FA 3RS5A 4G2NA 2H65A 3SCZA 4BLOA 4MUYA 4P83A 3KJXA 1R8JA 4BC0A 2BRUC 2VT6A 3RRFA 5JFOA 1C0KA 3I01M 3HWSA 3W1EA 4ZI3A 4URYR 5FPKA 2C4NA 3AR9A 3LIIA 3QXSA 4CLRB 3ZJVA 1VJ0A 3N05A 4PYRA 1VLZA 4UM5A 1VFNA 3JATA 2R87A 2B5VA 2PVCA 4IP0A 4UW9A 1YR6A 4GECA 4IEFB 1VRWA 2P9BA 4JC4A 5CURA 4ZOEA 3UA3A 3WXMA 4U6NA 4XYGA 4AJIA 4HNAB 1WPQA 4UAVA 3VYRB 2OYSA 2D62A 1VBFA 2PX8A 4DARA 1YRHA 4Q05A 1PJTA 3BSFA 2BEWB 2ZRIA 1TIPA 2IHJA 1QRSA 2NUAB 4ZVNA 2O59A 5FWXB 5JH7B 2NP6A 3R5FA 2VP0A 3BMXA 2IHNA 3M89A 2J7PA 4BRZA 1YASA 5B12A 3K5IA 4FFLA 4ABTA 1ZLXA 3OVMA 4X9XA 5CTJA 3DFFA 4HQLA 3HDTA 4TTQA 1Z37A 1VI2A 2QU7A 4J75A 4U5XA 4NV1A 3PDIA 2PT6A 4JKYA 4CDRA 1ENOA 1FMJA 1XRSB 1W4CA 3F49S 2AJCA 3UGTA 3A4IA 1HZJA 3GK3A 4X92A 3UC9A 4C0BA 3JPYA 5T6MA 1KPHA 4KTTE 1BXRB 3HKDB 2PXHA 1BCRA 3KOUA 4IXNA 3CBGA 5ANRB 3QF4B 4GU5A 2VXOA 5FTWA 4NBRA 1Q7EA 4KGXA 3CC8A 4C5BA 3BF7A 2W90A 4F92B 2LP4Y 1T8RA 4PQEA 2OY0A 5EUMA 3SSOA 2Y99A 3MTEA 3X3HA 2BJWA 4MA4A 4FX5A 1L5LA 3BMCA 3PUIA 5F64A 3M9XA 3M3HA 4WNAB 3KBOA 3TRDA 1ZN7A 1MN6A 1M2FA 2RGXA 3GNTA 3H5IA 4WPGA 3S27A 1E69A 4DMGA 2WTNA 1EP3B 3CPEA 4EPYA 4IICA 4DLRA 1KMCA 5K0GA 5HW0A 1W36D 2BD0A 1JAXA 3I5UA 2XB6A 4ECEA 3M2TA 5BQXA 2QMUA 3LDFA 3RPEA 2Y66A 3SK0A 3U7QA 4U7WA 2WTUA 5HCUA 1D6SA 5JFGA 1W5TA 3LYLA 1D2RA 3P0IA 4E51A 5CEJA 2WP8J 1CJUC 4RXUA 4BAGA 2H16A 1XXHA 3FTEA 1EFPB 2OO3A 4MWZA 1CLEA 2C2WA 1KVRA 2P0EA 4CVNA 4B3CA 1LJLA 2IHTA 4ZXPA 1VCIA 3BMCB 4JVSB 1IZ7A 1CEQA 4ND8A 4KPUB 2ILVA 3CVOA 4JYMA 1YZGA 5KAPA 1EKXA 3LI2A 4NDNE 3W6UA 3K09A 5JYCA 1GN8A 5KNLA 4G09A 1XLTA 4A27A 4P84A 1KNQA 4LNAA 3HNRA 3ZHCA 4ZYLA 3QEMA 3U7GA 2KMLA 4R2WA 3FI9A 4FYJA 2BPOA 2Q2WA 4BQIA 7YASA 1S4QA 3L0BA 3HUTA 2WWHA 1FYEA 4KQ1A 5K1ZA 2Y77A 1UCFA 1I7QB 3GDHA 3ODPA 3JSXA 1WHTA 3DTVA 1FLDA 3R6WA 1YMQA 3WZ2A 3TVDA 5SICE 3CPSA 4FN5A 2I78A 3OJEA 4N8SA 2HU8A 3D6NB 3GJ7A 2CUNA 1S02A 3G9TA 5JXHA 1OXTA 1WR8A 1ZVJA 3ZC3A 3JWIA 4DLNA 2W4MA 4RHTA 4TTTS 3I64A 4F3YA 3HBLA 1XRRA 3KQOA 5KTTA 1NJFA 1ZIDA 1RAEA 2WWXA 4HUQB 1RNLA 4RM2A 1OFVA 5BN5A 2R4UA 3K30A 4DA7A 5M2QA 1Z4PX 3E53A 5BY2A 1DJQA 3B7PA 3CZ9A 5J2UB 3SXJA 1ACJA 1ADYA 1QOPB 2HGZA 1L7AA 4FE3A 3U4MA 2IBMA 1UPXA 2NP7A 2FUNB 3SYKA 1JXOA 5LPNA 4HL6A 2CNNA 3RRZA 5DWQA 1P2SA 1QOZA 1U3UA 2EZTA 4B84A 1VJ5A 3HXOA 1N3IA 1RWPA 2OV2A 5JZ9A 1Z08A 2C57A 2FSFA 2I6SA 5DI3B 4G0VA 2BMJA 1BMFD 4WQMA 1WLYA 3PDHA 5GJCA 3B20A 2NZ2A 1JHDA 3TMYA 3EJWA 4IPTA 2WYIA 2B9EA 1VM6A 4EENA 2EF0A 3HFGA 1TZBA 5IS2A 1IIRA 2WZBA 3ZGNA 1KGDA 2P41A 4FLEA 2YZMA 3BJMA 4OQQA 2YTZA 1QFMA 1TM3E 3F5MA 3LZCA 1JDSA 1K66A 2VP3A 4A0GA 1G8MA 2C83A 2HB6A 2AZMA 4GMXA 4FFRA 4EFKA 5JSFA 3OTOB 3T1OA 1ONBA 1H0KA 3HXQA 4JP2A 2NT3A 4BGDA 1MW9X 3KUXA 2VOEA 3QLEA 3RTGA 4BKOA 3UM9A 3EEBA 4TGLA 3I9MA 4Y2XA 4QHSA 3ROQA 4BB5A 3QLJA 4PF1A 4BO1A 3GZJA 1ZGHA 4REOA 1KAQA 1Z56C 2XIQA 3HDHA 3LL4A 4UMEA 3GNLA 3QE0A 5KMGB 3ICVA 2RH4A 1S2NA 2I1VB 3I0ZA 1WW8A 1JILA 3JYNA 1IXYA 3W05A 3G5LA 4P3PA 1R5BA 1AV7A 5CGQB 4U3JB 1I8TA 3C70A 3LDUA 2VVTA 2YVKA 1QZZA 2XGGA 2TMYA 2I03A 4IXTA 4A4DA 2OFWA 4MJ7A 5LA6A 2JH8A 2WTBA 3DVAA 4U5QA 1Z0JA 4JLVA 3ZBQA 4R41A 4YP0A 4KODA 1F8FA 1SU8A 1ZOIA 3PITA 3LCRA 4WA8A 4HDCA 2BEWA 2PUCA 1M34B 2B8WA 1NRWA 2OLEA 3E2PA 1QIKA 1D2CA 4BQOA 2X2FA 3JQAA 2OBLA 3DP9A 4NBTA 3TL2A 2CNOA 2AV6A 4MHSA 1YZFA 1U2GA 1PFVA 3TTTA 1JECA 2YXEA 5K3OA 5ADWA 3KP1A 2VDKB 3BULA 3F96A 3IS3A 3A3KA 3DFMA 5ICFA 1JV2B 1AO3A 3PFKA 4N9WA 1YHNA 1Z5PA 3IT3A 1VHJA 5DNDA 1J0DA 2EWMA 5JI3E 4PANA 3Q12A 2BGWA 2KYRA 5AVSA 4BE7B 5IN4A 4LX0A 3JVVA 3IXLA 2ACWA 3EUAA 5G1OA 2IS4A 2SECE 4Z1MD 1MRSA 3EVAA 3CKMA 3K0SA 2H5EA 2UVPA 1AVTA 1HK7A 2CNLA 3CR3C 4OQYA 4PC3A 4KFUA 2OV8A 3AL3A 1PG5A 2BFBB 4WCDA 3TR6A 3WK4A 4DWJA 1KK0A 3K32A 4FX2A 4YRMA 1DFIA 5CR9A 1G8SA 2ONYA 2NYUA 4MRMB 3ZLUA 4G0WA 2BMEA 1EHYA 5JVDB 5ALGA 1O9BA 2FFHA 4L85A 2EVWX 3C48A 3QWBA 3NYIA 3GRYA 1TMYA 2FLKA 2PR2A 3BREA 3BWMA 3ETEA 1HWYA 2ASEA 3GH1A 3KQUA 5AJZA 1K98A 3OESA 1L5OA 3UYKA 1F60A 1X6VA 3PFNA 5LLSA 3CEJA 1IN1A 3WBBA 4DF3A 4AZTA 5HYVA 3HJHA 3PJFA 4YAUA 3SSAA 5DGCA 4RPKA 4G89A 4MV8A 3RUAA 3FOCA 5AKZA 3ZGZA 4Z0PA 1ETUA 3D3QA 4LC9A 2ODBA 4X8OA 1W5FA 1Y89A 4WN9A 2GNOA 1BKSB 2A14A 2GOYA 2O07A 4O4HA 4WCFC 5F76A 5B3JA 4E2FA 4EVRA 2NVUA 2ECKA 3QBEA 5EWLB 1QOQB 3BXZA 2NNLD 4A8TA 2PNJA 1SVKA 1UC8A 1VL2A 2BKVA 2PVSA 1KQ3A 4DEVA 3T7EA 5BURA 5IG2A 3WYBA 4YIKA 4GPBA 4A15A 4Z4FA 2JVKA 5L3ZA 2ECFA 3E1SA 3NV7A 4BV3A 3HY3A 2OZKA 2ID7A 4G97A 4HH3C 4BZZA