1QHYA

Chloramphenicol phosphotransferase from streptomyces venezuelae in complex with atpgammas and chloramphenicol
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
178
structure length
178
Chain Sequence
MTTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQSAEGGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLDVLWVGVRCDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTHKESIECAWAIAAHVVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structures of Chloramphenicol Phosphotransferase Reveal a Novel Inactivation Mechanism
pubmed doi rcsb
molecule tags Transferase
molecule keywords CHLORAMPHENICOL PHOSPHOTRANSFERASE
total genus 62
structure length 178
sequence length 178
ec nomenclature ec 2.7.1.-:
pdb deposition date 1999-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07931 CPT Chloramphenicol phosphotransferase-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1qhyA00
1Z0JA 2O8CB 2GBLC 1GKUB 1XXHB 5H8WA 3B13B 2ZI9A 2GZAA 2R6GA 1XMVA 2CLCX 2ATVA 3LFUA 3B2EA 3ZS9A 1KKLA 2IXEA 3QXCA 1T3SA 4HLDA 2ZEJA 3QKSB 2ONJA 5CITA 1ZAKA 4QGHA 2CK3A 1MKYA 1W4RA 1X8LA 1Z6GA 5KSOA 4IOLA 4LK2A 4QJ4A 3U3OA 3OEHA 4HAVA 1RRFA 4LDJA 2RGEA 1CS4C 3EIHA 3KKNA 1E6CA 1G8PA 1XXHE 2H7VA 4JL6A 2OE2A 3K70B 3K53A 1N6IA 2IBMA 4H9GA 1OIVA 5FL3A 3TR0A 4Q1BA 1X8KA 2R6AA 5FOSA 1QBKC 2GBLA 4LWZA 1VTKA 5JI3E 1L4YA 5CJPA 2A5FA 4XVUA 1YHNA 2VYFA 1AS2A 4A8JC 2FGJA 1XPOA 3MJHA 3CIOA 3LW7A 1O87A 4NYIR 3WNCA 1GRRA 5A0FA 4LJYA 4ARZB 1MH1A 4YMTA 1NSFA 1VECA 2GK7A 2FA9A 2JJ8A 3RC3A 2N46A 3K9LA 1XDBA 2ZE7A 3PUWA 5J4LA 2DFNA 2QTFA 1SVLA 4Z8YA 3KQNA 1JAIA 1M74A 3MMPA 4LJ8A 4A2QA 2ZREA 5KDOA 2J59A 5F9FA 2ZTSA 3BGWA 5EXTA 1AIPA 3GJ3A 3TBKA 3TUJC 3A1TA 1RRPA 3AKYA 5JEEA 1S0UA 5EP4A 3KQUA 1OH7A 3ZS8A 4A8JA 3VHXA 1JQLB 3U3RA 4P4SB 1XB2A 2J5XA 3QUSA 2EQBA 1NMXA 2P3SA 2AR7A 3QE0A 4EJSC 1KSJA 3I73A 1N6KA 1CLUA 4IOJA 1E2IA 3QXSA 1E99A 3NTUA 4P33A 2ZSBA 4YLGA 3AM1A 2AKYA 4BZPA 4KBFA 3D8BA 2O8CA 1RJ9A 3B1VA 1F2UA 1A4RA 4BRUA 3EZ2A 2VHUA 1Q0UA 1CJTC 1LTQA 4PHHA 1Q1BA 4WZBE 3EPHA 1CF4A 2JDIA 2ZRGA 4PANA 3VFDA 3FHOA 3A1SA 2IK8A 2J41A 2IT1A 1CR0A 3WNDA 1VG0B 5IHPA 1VG8A 4HZUB 2OSBA 5G3ZA 1NVVQ 1GILA 2KJQA 1ZNYA 2X1VA 5K8IA 4L15A 5FTMA 1KYIA 5J40A 3BXZA 3W6PA 4D4KA 1HY3A 4HAWA 5FPTA 1GP2A 2P5TB 2LKDA 1JR3A 4WBSA 1EFCA 3EPLA 1CXZA 1R2QA 1V43A 1VHTA 2QRZA 4A0HA 3C4JA 2CDNA 3FFBA 4HATA 3NBXX 4IEIA 1VPLA 1Z0AA 3PQCA 1BH2A 1LFDB 2ZETA 3I32A 1N0UA 2BMEA 2BJVA 4K8OA 4LJAA 1BO6A 2BMFA 3E70C 2AX4A 5EE9A 821PA 1R5OA 3B9QA 2OCAA 1G3QA 4B2LA 2BOVA 4JBWA 2QT0A 2OM2A 4X8MA 1R0WA 2PZGA 1BKDR 3SDZA 3TKLA 1Q1EA 2ZUDA 1AKYA 1Q22A 4H1VA 2ORIA 2EFGA 2PJRA 1S3GA 3KTAB 1LVGA 5AK0A 2VPPA 2O8BA 1OLOA 5AJVB 1R5BA 3BC1A 2ZSAA 1CULC 3GMTA 4CEHB 3TUZC 3ZVLA 4JVSB 2NZJA 3L8YA 5C46F 3IPXA 1NY5A 3Q7PA 2BV3A 3S1AB 3TH5A 5BXQC 3B1XA 3I1FA 4PHFA 4MUBA 2AD5A 3TK1A 4EQ6A 5EUMA 4MYTA 1E2GA 5J4HA 3NHBA 1YZUA 4GOXA 2CNWD 3T35A 1NP6A 4FWTA 4PO8A 5FUWA 1MO3A 2QG6A 2ZRPA 2CXXA 4NYJQ 1NG1A 3NWJA 4GOJA 3M1IA 1YE8A 2PEYA 4DBLC 1R4AA 2JLZA 2QSYA 4B3XA 4HB4A 5CLQA 3CRRA 1KKMA 1E1RA 2F7SA 5K8UA 1XU4A 1ZC3A 4J0QA 4NP6A 3R7WA 4YQFA 5DE3A 5FI0B 3U2QA 3KFVA 3SI7A 3WYAA 4L5BA 4OQFA 2PJZA 4MYHA 1N6RA 2Q9AA 3RRMA 2XZOA 2G6BA 3RHFA 3KB1A 1P60A 3CRQA 3KFXA 3VX3A 4C0HA 4C0QC 4R71A 2EVWX 3VHLB 4QHTA 2ZROA 4D82A 3SJZA 2HXSA 3T5DA 2PEZA 4DRZA 2BCGY 4KI0A 2JJ1D 1VCIA 1KOFA 2WSSA 3NHAA 5FR2A 3BAFA 5E7JA 4BQSA 5M04A 2JAQA 3UMSA 3OF5A 4D81A 2NZ8A 1CJMA 1G19A 1ZINA 3A4NA 4GP6A 4JSTA 1EFTA 1F48A 1Z2AA 4H1UA 2FH5B 5HCIA 4AK9A 2VBCA 2W58A 4QC2A 1GKYA 3LXXA 1OXSC 4DZZA 4QJ3A 5FPSA 2BEKA 1Z83A 4HDCA 4A1FA 3IEVA 3CM0A 1S1CA 3SNHA 2FFBA 2EU8A 1AS3A 4DLUA 5E4FA 3ZQJA 2ZS8A 2QPAA 2GTPA 3THWB 1XEFA 3BIFA 3KJIA 3EA5A 4DSUA 4MGIR 3X1ZA 3BOSA 3CZPA 1NBMD 2A7QA 3JVVA 3QPUA 1L7VC 5JRZA 3VX4A 4EPTA 4BWYA 4EFMA 1E2FA 1G7TA 1KK0A 4WOPA 4AYWA 4QRHA 1S9HA 1S1MA 4ERNA 3O8BA 2W6JD 4TMWA 2WIAA 4V0NA 3RS2A 4BE7B 3FVQA 1FQJA 4IDHA 1W0JD 4PTLA 2R2AA 4B6FA 2G0TA 2HJGA 3TAHA 2PCLA 3V4FA 1F60A 2ANBA 1G8GA 5KPJA 1N5LA 3I5XA 4M1SA 2ODNA 1W46A 4BEBA 4EPXA 5GJVC 4V0LA 3RRZA 2CHQA 5P21A 3UWOA 2C99A 3LAWA 4DLVA 4NCKA 1F2TB 1OT3A 1NKTA 2OAQ1 3CRMA 3I92A 5F2EA 2V4ZA 3FFAA 2F43B 5HR5A 1E96A 3A4MA 3T15A 4JLOA 4A2PA 3IDQA 3AB3A 1J90A 1FTSA 2NGRA 2H92A 4NCHA 2CHGA 2O5VA 4YXWA 3WMGA 3MGCA 1GOTA 1KGDA 3VR3A 5JWRA 3PG5A 2BVNA 2EFDB 3MWJA 3CH4B 1F2UB 3AF3A 2JLWA 4QGGA 2PZFA 2B7CA 1KDOA 4M4SA 2HV8A 4NU0A 4HLCA 3R8FA 1IXSB 2FZLA 4ZI2A 2J0SA 3S1AA 1G3RA 4FMDF 3RS3A 2WWGA 1RKBA 4A9AA 1UM8A 1Z6YA 5E3HA 2JLUA 4UNNA 4A0RA 1KK3A 3K0CC 1NLFA 3T1QA 1PLLA 5TDHA 1WQ1R 3QF7A 1OH5A 1TQ4A 4N3NA 2XEXA 1XZQA 1GIAA 4LRWA 4HLQB 2FPMA 2OFWA 1K5DA 1KI6A 1YZKA 4PZYA 1KO7A 4BZQA 2W2XA 2PH1A 3QNUA 4DUGA 4DDTA 1ZM2A 2XNDD 3DOEA 2FMXA 1ZVQA 2WAXA 3LWNA 1DELA 1Q44A 1H65A 4BFSA 2FFQA 3QBTA 4AKHA 3I5YA 1W4AA 2QTVB 3C7KA 3L0OA 4Q9LA 2KB0A 2A5DA 1XRJA 2XNDA 1CU1A 5DYIA 1G17A 4LV8B 1TX4B 1KZ7B 1T6NA 1WBBA 1FW6A 5FOVA 3FMFA 3PXGA 1IN6A 2HF9A 4EFLA 2CL0X 4PC6A 1IBRA 1NF3A 3RS5A 3ICQB 2O8EB 1HURA 5AUOB 2YOGA 1RRCA 4LJ9A 5JJKA 4LPKA 2GAAA 4AI6A 4C2UA 2C77A 4EQ6B 4A2WA 4I1SA 4F38A 1QDEA 1AQUA 3DZDA 2IYSA 2DR3A 3AVPA 4Q7LA 3RLFA 1T3LA 3QI2A 4G5SA 4TMTA 4PX9A 3T5GA 3B60A 2V9PA 2JLQA 2LKCA 4Q66C 5DI9A 4PR0A 4JT4A 4KVGA 3IGFA 5LD2C 3TGPA 4JLMA 2FGKA 3TR5A 1M7HA 4V03A 2C03A 4KFRA 4QBHA 2GILA 4C0KA 3HPQA 2AFHE 1YR6A 2W00A 5EE0A 1KO8A 2DYKA 4QM6A 5KSYA 1NLZA 3DMDA 4A36A 2O8BB 1XXHA 1IN5A 1XCPA 2QMUA 2GESA 4RCYA 5BW8A 1JEEA 2HJVA 3LA6A 4OHWA 1KI2A 4M9XA 1E2NA 3FYHA 4XVRA 1P73A 1T4GA 1QG4A 3PEUA 2AFIE 3HR8A 4TLCA 1DPFA 1M1YE 2YWHA 5G41A 2W6IA 4DCTA 2NOAA 4Z1MA 3BFVA 3U5ZB 4A8JB 2DB3A 1KIMA 2WJJA 3C14C 1XTJA 2C98A 4JVMA 5L3VA 5FOTA 4PO9A 5JCZA 3THXB 3W3ZB 2IS6A 2B7BA 3ONWA 3BB3A 3CZQA 4Q7KA 5E7IA 1U8YA 5J4VA 4C0AC 4XD7A 2Q9CA 1Z29A 1ZU4A 1ZNXA 2FU5C 4Y0VA 4TSFD 2BMJA 4HZUA 2QROA 4ZIRA 2OBLA 4M8NE 1DOAA 1A82A 1PLKA 2A78A 3AF0A 2NO1A 3X1WA 1FQKA 2CVFA 4G5GA 1MRSA 2RH5A 2ZI4A 2NG1A 4O0MA 4MKIA 3G5UA 2O0KA 1AM4D 2J87A 2ZE8A 3ND8A 1HTWA 2ZU6A 4UXHA 2Z6VA 2ZRCA 1NKSA 4V0MA 1DO0A 1W49A 2OO7A 3FMPB 1Q1QA 5DH9A 1QG2A 4DCVA 6Q21A 1E9SA 3I4LA 1GAJA 4NYMR 1HA3A 1XJCA 3MAAC 1U9IC 4TLEA 1CKEA 4ASUA 2OZEA 2PMDA 2W0SA 1Z6AA 3ZH9B 4TYYA 2BBOA 3X1YA 1DAGA 5L3RA 3CNLA 1VCMA 1AN0A 1LNZA 1E9BA 2AXPA 3CNOA 3QIAA 3FE2A 2RGXA 1YRBA 3C15C 1SKYE 2PX0A 4Q1FA 4Q7MB 3VTKA 2N42A 1HV8A 2V6JA 3QKSA 2HYIC 1K8RA 4DLRA 5F98A 2GXQA 2QAGC 1KY2A 2DPXA 2YV5A 4RCZA 3SOPA 3VKWA 1W48A 3VR1A 4W5HA 2BBSA 4EAQA 3IHWA 5JFGA 2WOJA 1NVWQ 5G53C 2J46A 2EFHB 4PC3A 4DCUA 1FZQA 3LQQA 5C4GB 4RD6A 3EC1A 3PEVA 3GLIB 1YZNA 3HPRA 4N1AA 3THYB 1NIJA 2H1LA 4TQ9A 2ONKA 4HLUA 2D2FA 2D74A 2PCJA 3D3QA 4QBGB 3HU1A 5HKKA 5B2ZA 3K9NA 3SJAA 1DEKA 1A5TA 4UXJA 3W8NA 4WXRA 2XTNA 1SVOA 5DNYB 4MYUA 4MRRA 4Q1EA 1NIPA 5H68A 1EFRA 4GRAA 3MRSA 4B35A 2QAGB 1II8B 1Q1ZA 2L0XA 2VLIA 3DVLA 3QY0A 2X19A 1YU9A 1U81A 2QSZA 1IN7A 3QENA 2FFHA 3QBVA 3K9HA 4DB4A 2XSZD 3SN6A 4XWOA 2K5UA 1P9NA 2VEDA 2ZANA 3P1JA 3CPHA 3EZ9A 2IF2A 2IYQA 2OCBA 4CF7A 5LBIA 1AA9A 1COWA 3EARA 5FL7A 1GVNB 4MKFA 4TLAA 3GEHA 4K81B 2V1UA 4NH0A 1WB9A 1SGWA 4Q48A 2C78A 1KMHB 3VR6A 4F92B 4LYAA 3DKPA 4D4LA 3I62A 2Z43A 2QGZA 1FP7A 3GLGA 4C0BA 4L9SA 1KAOA 1I2MA 1TAGA 4OQLA 2QMHA 1P75A 2WMOB 3QF4A 2VP5A 1E9AA 1S9DA 3DEFA 4JKIA 4KO8A 4PAMA 4OK5A 2ZJZA 2RGAA 1JR3E 4ZDJA 1HQCA 3A1VA 3U6KA 1AGRA 5B58C 3GJ8A 3CF6R 2QAGA 4OHZA 2Z0MA 4D25A 1J99A 1P5ZB 1ZUNB 1F3OA 2J0VA 3DM5A 2AHOA 4JL5A 4AY2A 5BWMA 2ZAOA 3I72A 4KBGA 4URWR 4DCNA 2XZPA 3EWAA 3OAAA 3RSOA 1MT0A 2A2ZA 2BHRA 3H86A 1TNDA 3SEAA 1QHHB 1P6XA 2WOOA 3T1OA 3AVWA 3T1VA 3EZ6A 1TEXA 5IDVA 4U5XA 4BFZA 5JWHA 3AEZA 1LF5A 1K5GA 3F3YA 3Q5DA 5DN6A 2JLXA 4OI4A 4B71A 4V0OA 4Z8XA 1CJUC 1U98A 1N6HA 1E2PA 2RAPA 2VHCA 3B1YA 3L8ZA 4B44A 1KMQA 1G6HA 3B7GA 5EE3A 5KTYA 2V7QA 3W3AA 4OBEA 2DWQA 2SHKA 4RZUA 5FBQB 5FOWA 4NPHA 2QN6A 3ADCA 3K0AB 1VDZA 1DAFA 1UEJA 2QL6A 1Z28A 2IXFA 2WJVA 1S96A 4EPYA 1R5NA 4Q4AA 4RFVA 4L4UA 1VG9B 4NMMA 1N6NA 2ZJ5A 1XEXA 1AGPA 3KX2A 4OJKA 4JLJA 2ODBA 5L3SB 4KFTA 1GUAA 2G83A 1AS0A 1KDRA 3PUZA 4MGZR 4PC2A 4NYMQ 3Q3JB 1XEWX 3N5CA 1LW7A 4C7OA 1VCOA 1VIYA 3VKHA 4A82A 2FFAA 2VHTA 1X86B 4GMXA 4OK3A 5G3YA 4TMKA 5KSPA 4AKGA 5FPYA 3OHMA 4IHQA 4CEIA 1MOZA 1T9HA 4TN1A 3V00A 2P6NA 1J8YF 2FG5A 2F3RA 5IRCD 621PA 3J81k 1OHHD 4LV5B 5HZKA 4CDGA 2D7DA 3W5IA 4EPRA 3SYLA 1XD8A 4HAZA 3SC3A 1ZNZA 4ZIRB 1E98A 5EZ6B 2QA5A 2YWFA 2BWJA 2J7PA 4QBIA 4IOMA 4QBFA 5SZJA 1GRQA 1W5TA 2D62A 3ASYA 1ZIPA 4A0GA 2J9RA 4A6PA 2A5GA 3IIMA 5GJBA 5JHHB 3HYTA 2WJGA 5L3QA 4WIAA 3RS7A 2FJUA 2A30A 2KBFA 5TVKA 4MUAA 4EIWA 3PJRA 1VYVA 3Q5EA 4M1KA 1KO1A 4Q03A 2FSFA 5L8VA 1UDWA 2WBLC 3LX8A 1NSTA 1IAQA 1YR8A 3ZJYA 2E1RA 2Q6TA 4BGDA 1P2SA 1N5IA 4MITA 1W1WA 5BN5A 1KNQA 2JLVA 4LBZA 1US8A 4P4UA 3VNVA 2H57A 4DEYA 3KQLA 4NDZA 4B74A 3GFPA 5D3MB 4BPBA 1ZJ6A 1XX6A 2ORWA 3X2SA 3OE7A 1N5KA 5FFMA 2KI5A 2CE7A 2XTMA 5KNBA 2OILA 2VSXA 1NN0A 2Q9BA 2W2TA 4TLBA 4RFSA 3GLIE 2OAP1 1CJVC 1QHYA 4M0LA 2PMKA 5H1YA 2V55B 4DC9A 5GJWC 4JJZA 2VH5R 5TMPA 3KJGA 1D2EA 1EX7A 3OAAD 1COWD 4NE2A 4FW9A 3V4RA 1G3IA 3CR8A 1NVUQ 3ETLA 1M7GA 2QORA 2H17A 2IYLD 4JS0A 4Z54A 1W4BA 2XGJA 2FE4A 2I1VB 3SE0A 2WICA 1R6BX 2F1JA 3I61A 3QKUA 2NO0A 221PA 1A7JA 2IYRA 3LVQE 1UKZA 1UF9A 1XCMA 1E0AA 4RSGA 1M6NA 1SVWA 2QI9C 2BIFA 4A92A 1H8HA 4PXAA 3W8RA 2W6JA 5AUPB 3SQWA 3GJXC 1M7BA 1MABA 4LJ5A 4PQYA 5FBWB 4UKDA 2C9YA 3AUYA 3GP8A 721PA 3MG9A 1NNEA 2FWRA 4FCVA 2VIIA 2VP9A 5EXXA 3ZZUA 1E3MA 5JJLA 2F43A 2MMGA 4G5RA 1G7SA 3F0TA 3LLMA 2REBA 3ZIAA 3TUIC 4TT3A 3KQKA 4ITRC 1QVAA 2QENA 2VTKA 3R7WB 1W0KD 5EZ5A 3PEYA 4BLQA 3BK7A 2Q3MA 4OK6A 2ZRLA 2ZPTX 2ZR7A 2G1JA 3ASZA 3WMEA 3ZGXA 4LI0A 4B34A 2ZI5A 3KXLA 2QY9A 4G1UC 2WV9A 4FIDA 4YXWD 2P65A 2JJ2A 3KKMA 4Q4LA 1N6OA 4D0NA 1YJ5A 2E87A 1DO2A 4X8OA 1Q3TA 2UKDA 1T91A 3OE7D 3CONA 4C3ZA 2QM8A 5FTNA 5L3QB 1P72A 4US2R 2F1RA 2WSSD 2ZS7A 5EE5B 4ZKDA 4LHXA 3VKGA 2JJ1A 4DXAA 4PFSA 4GMDA 3WHKA 1I4TD 3LDAA 4PPGA 2NO6A 4P0TA 4DLZA 1U90A 1XF9A 4IDPA 2F6RA 1CR2A 4NHOA 4B3BA 3BERA 3A36A 3TNFA 1VIAA 3AF4A 3Q85A 1IXZA 4LX0A 3VNUA 1S8FA 4B3DA 1W47A 2CHVA 3R8CA 2IYTA 4TT3D 2D2EA 4F4JA 3IPYA 3FHCB 4PZLA 5CIQA 2AK3A 2ZRKA 3GLFE 1G7CA 1E0JA 5TARA 2XJ4A 5JS8A 2GHIA 5D3MA 1IXRC 3TQCA 4CIDA 2ZITA 4OJQA 1E32A 1RFLA 4S35A 1H8HD 1P2UA 3BORA 1JNYA 1XP8A 4DLYA 2C9OA 2QE7D 3NBFA 3KQHA 4TTPA 2F1IA 3BS4A 5L3SA 1GL6A 3QG1A 1TU3A 2OCPA 4I1VA 5JHGB 2FV8A 3NC1C 4MQBA 1DE0A 3CR7A 1GFIA 4TWZA 3WY9A 4M9QA 1I4LD 1EXMA 1U8AA 2QMEA 1NG9A 1L2TA 4Z1MD 3QVVA 2QAJA 3QG5A 3ZZ0A 3EX7C 5AWFC 4C2TA 2GEUA 1W44A 2J45A 3HYRA 3I3SR 4QG7A 3W34A 4HUQA 4JLKA 4KU4A 1G3MA 4LC0A 4NCIA 2PL3A 2ZRFA 4BASA 5C2JB 3B82A 4RD2A 1G1MA 1JB1A 2CCGA 1OF1A 1KSHA 2GCNA 4Q4JB 4PC7A 1YZQA 1G291 1VYUA 4Q21A 2C95A 3BH6A 4UNPA 1QHHA 1PUJA 3K70D 3G0HA 2AWNA 5IK2D 4C9BA 1NL3A 3MWLA 1Q12A 5KSZA 4KSBA 3IQXA 4F4IA 2A3RA 1OW3B 5KUTA 2P0EA 4NYIQ 3VR5A 4NKRA 4C7OB 1IOZA 3WP0A 3QPWA 3AKEA 4B2PA 2QP3A 3P4YA 4TTQA 3JZAA 2FSHA 1Z22A 2RHMA 2QUZA 2LWIA 3KUDA 2GF9A 3MJRA 3E1SA 4ACBA 4URXR 4E03A 3U60B 2DWOA 3BFXA 5DIFA 1FUKA 3RAPR 2B6HA 1AQYA 4AYXA 2V54A 1X1SA 1RYHA 4Q4AB 1OH6A 3AVTA 2NTYC 2QP9X 4DLSA 1UFQA 3T06B 3EWSA 1AJEA 3F8TA 1E9EA 1R8QA 4RVCA 5KYKA 3U7HB 3FWYA 1NN3A 1OHHA 4JKYA 1ZNWA 4DJTA 2QZ4A 2REXB 3JVUA 1SVSA 3QKTA 3LXRA 4CEJB 1TF2A 1D5CA 4V02A 1SHKA 3PCRB 4XH9B 3TW4A 3EPJA 1SQ5A 2X2EA 4L8GA 3R9IA 1E2DA 1EWRA 4XSGA 3WXMA 3TJZA 1UKYA 4WVFA 4AWXA 1N25A 2GVZC 5JSZA 3CWQA 3TAUA 2J3EA 2QP4A 5J5CA 4XTCS 5E7MA 3GEEA 2H16A 2IHYA 5DSZA 1TUEA 4B6EA 2NIPA 4TTRA 3UG7A 1E79A 4KODA 5FL7D 3NXSA 2RGCA 2EYUA 2OXCA 1OKKD 3SZRA 2ANCA 3IO5A 4M1YA 5CM9C 4U00A 4Q00A 4EUNA 4CEHA 2XXAB 5GADl 3CF2A 3NBZC 1NN5A 1X8JA 4YONB 2ZYWX 1GG2A 1EK0A 2JLSA 4ZDKA 2GAOA 4QJ5A 4JLAA 4YMSA 4B3FX 3KTAA 3EXAA 3SHWA 3K09A 2V7QD 4M2LA 1CR1A 4DHEA 1OXVA 1ESNA 4DVGA 3GLIA 1Q3HA 2RCNA 2RHDA 4M1TA 3TLXA 1HT2E 4HLUC 5EP3A 3LV8A 1BYIA 1D6JA 3C8UA 3UMRA 3U7GA 1P3JA 3T34A 1GRNA 3T1TA 1WA5A 1DS6A 1D9ZA 3LBNA 1IQPA 3O8DA 3SS8A 4I4LA 3KDSE 1UBFA 3QXXA 3UG6A 4ZI3A 1D2MA 5DHAA 3GJ7A 5BQ5A 1N6PA 3FMIA 3L0PA 4WXPA 3K09C 2JGNA 2KBEA 4LOAA 4ILEA 3CBQA 4UQOA 1RPZA 3ZVMA 1GL9B 1W4CA 1Z0KA 4EJSB 1ONBA 4BLPA 3I8SA 1W0JA 4TL7A 5IK2A 1CEEA 2GXUA 3GFTA 4QHSA 2CK3D 3FKQA 4DT1B 2ASEA 2F9LA 1P2TA 2QMOA 5JRJA 5FTLA 4R2IA 2QGNA 2GZHA 3WRYC 2QEQA 3E2IA 2FF7A 3DZ8A 2ZJBA 4O2LA 2ZRNA 3FGNA 4URUR 5CB6A 2ZYTX 5F9HA 3ZQ6A 1PVOA 1Q57A 2G1KA 2JLYA 1QHSA 1XJQA 3LVRE 2HDNB 1OPXA 1WXQA 1XTKA 1ZM7A 3GLFB 3QXHA 4N0EA 3UANA 3HU3A 4CEJA 1P61B 5BN3A 3IIJA 4GZMA 4NBSA 4R7ZA 3U61B 1SKYB 4G0NA 5FPHA 2PLRA 5TV2A 3FTQA 2R65A 1XZPA 1Z5ZA 2XSZA 4WZ6A 2CL6X 3KJEA 2HEIA 1B0UA 2HUPA 4TMXA 4BFVA 4Q47A 1K6MA 2QNRA 4DUGD 5EJEA 4C0JA 1U2RA 2QT1A 2IS2A 1GSIA 1T0JB 2FEMA 2VA8A 4M9ZA 3X1XA 4LJ6A 2G88A 4Q4HB 1ESMA 3SR0A 5EUQB 4IDQA 1Q20A 4US0R 4LHZA 2J1LA 1E2MA 1NBME 3K70C 3RRNA 1BIFA 2BKUA 4XD7D 3FOZA 2X2FA 1P62B 3AGQA 3SHFA 1TU4A 3U7EB 1TF7A 3U44A 2E9SA 4B3GA 4M22A 2VF7A 1PJRA 3ND9A 1RW4A 1U0JA 5FBLB 5KDLA 4PHTA 1OH8A 4LY6A 1PZNA 3A4LA 1IY2A 4PSAA 3UATA 5E95A 1KZGB 3SFVA 3PUXA 2W6ID 3AUXA 3B6EA 3ZLJA 1TPZA 1QVRA 2FPKA 3NC0C 2C96A 4Q4JA 1OV4A 2YJTD 2AD1A 3G82C 4OKSA 5IT5A 1D9XA 3VMFA 1WMSA 1A2BA 2V1XA 4JLPA 4JYCA 5FH9A 4DWJA 2OT3B 1FNMA 1RIFA 2DFKB 1N2CE 4IFEA 5HCNA 1WBDA 4DT1A 1R0XA 1T8UA 4Y0AA 121PA 1HT1E 1XTQA 2RGNA 3WNBA 2ZI3A 4B73A 4JLBA 2P2LA 3AF1A 5FBVB 2VQSA 3M6AA 2GF0A 1II9A 1EX6A 1MRNA 1X1RA 1JQJC 1YRAA 2JASA 1BOFA 4F91B 1JJ7A 4UNQA 1J70A 4ZO4A 2O8DA 1DG3A 4IFBA 1GL7A 3D6TB 3LX5A 4DDVA 4BLSA 1GKIA 4LHYA 2ZJAA 4W5JA 3B5JA 4A0FA 1Z0IA 1W0KA 3QXJA 3GJ4A 3L0IB 4Q9JA 3WP1B 5C1BA 5JBQA 1OKKA 4EDHA 5JEDA 2R8RA 3B8HA 3Q72A 3PFIA 2G77B 1FNNA 4D4JA 2IXGA 4V0KA 2ZUCA 2WTUA 1OXUA 4B75A 3MSXA 3K0CA 4B47A 1AK2A 3DL0A 4EPVA 3CPEA 2ZRMA 1N6LA 1KI6B 3AVUA 3Q9LA 4F4CA 421PA 1IY1A 5CDFA 3W90A 3C16C 2KE5A 3BD9A 3WHLA 4XWAA 4PPNA 2EYQA 3KKQA 4TMZA 2DFTA 2FN4A 3L43A 3T61A 4M1MA 3RRYA 1U9IA 4PQRA 1L4UA 5F3WB 1IN8A 2W2VA 4MKGA 1DVRA 3K1JA 1R0YA 1ZC4A 1U0LA 2IUTA 5BYKA 1KI4A 2VHQA 2HYDA 4QFMA 5DLQC 4ZCIA 2ZUBA 1EWQA 3HJNA 1GM5A 3ICEA 5DN6D 4LYFA 4BLOA 3CW2A 4QHYA 3TSZA 4UNSA 3IUYA 4U7DA 3RC8A 4PQFA 1YQTA 3GLFA 2FPLA 2IYZA 2I1QA 2OFOA 3R20A 4JJKA 4YDHB 4C4PA 4PO1A 2H18A 2V8OA 4TZ6A 1KK2A 2ERYA 2H8KA 4HB3A 2GNOA 3H1TA 4PSVA 1W36D 4DEXA 4FN5A 3MLEA 1GWNA 4JVNA 4N0DA 4HAYA 2RGNC 4KAXA 4IKEA 4NYJR 1P7CA 5HKKD 3NVAA 4QNMA 1NY6A 3OEHD 1T0HB 2ZSFA 1IY0A 1EFHA 3MWYW 1HUQA 3IQWA 2XNSA 4D6PA 2FZ4A 2Y8EA 5HTKA 1J7KA 2F1HA 4NONA 1DAEA 2X8AA 1R10A 2UZIR 4D2IA 4Q9HA 3EIEA 1Z0DA 1Z6TA 4BFWA 1KJYA 1XMSA 3OEED 4TLDA 4GSYA 1T5LA 4JVLA 1JALA 1N3BA 1CR4A 1G16A 4FCWA 1TADA 5CYPA 3CWZA 2QBYA 4PAQA 4WA7A 1VYTA 2IYYA 2PLFA 2YVUA 1Z2CA 2NO9A 1G7RA 1FFHA 2XB4A 2I4IA 2QE7A 1KDTA 4B48A 4CT5A 1ZW6A 4OI2A 5JMTA 3AVYA 3TQFA 2ZVPX 1OB2A 3IBYA 4AC9A 1DAKA 2G9NA 2OUKA 4RFSB 1RRGA 1EFRD 4UXIA 4HB0A 4ZPXA 3AVQA 3HDTA 5K8LA 2ODWA 3K0FB 4C0SA 1F2TA 1VMAA 2P67A 5K8TA 2KSQA 1G9XA 3LRPA 1Q21A 3NIBA 4OI0A 2Q0HA 5JS7A 1DBSA 4FMCF 3P32A 1CJKC 1PV4A 1NJFA 3ZVRA 2B21A 1DAHA 1DAIA 2MSDB 4QXAA 3KZ1E 4KFUA 4CRWB 4BFUA 2GXSA 3H4MA 1E69A 2ZJ8A 1G18A 2YHSA 2ZM5A 3A1UA 3IIKA 1ZM3A 2IWHA 1OSNA 3N2EA 2C8VA 4ESVA 2Z4SA 2ODEA 3TMKA 1MV5A 4ON9A 3EW9A 1Z3IX 2CL7X 2G0NA 4P4TA 1QF9A 3UKDA 2TMKA 3H2YA 1EFUA 4LHVA 3L2OB 4Q1CA 1KNXA 2JATA 4GPTA 1UPTA 3SFZA 1W7AA 1W2HA 3M0EA 3UMFA 4HI0E 3MD0A 1N0VC 2PBRA 1SVMA 1DAMA 2LCFA 4NL4H 2GEVA 4KJZA 1ZP6A 3CRW1 1KSGA 1XBTA 4B76A 4IDOA 4MA4A 4EPWA 3TVDA 3R9WA 1E4VA 2QBYB 3ZD6A 1E2KA 3ADDA 4LYHA 1CBUA 1CRQA 4JLNA 5JZVA 1QRAA 3U44B 4OHXA 1XNJA 3CUEF 5EP1A 1DARA 5FOXA 2WAYA 1XWIA 2GVDC 4Q5IA 2OHFA 1N5JA 3IEUA 3K9GA 3EPKA 3ZVNA 1XMJA 4TYQA 3EAQA 2JIZA 4LC1A 3WYGA 1U94A 3K8YA 1E9CA 1T3HA 1E9FA 4I1OA 2AK2A 4JBXA 1YZLA 1WE2A 4MRNA 4FMCB 4TSFA 4JMPA 4HZIA 2VF8A 4M53A 4KYUA 3UIEA 1YR7A 4R2HA 1ZM9A 2UZ3A 1FX0B 5DHFA 2WJYA 1GNPA 1NBMA 1YKSA 3AGPA 4M21A 4LHWA 2XOKD 1Y63A 3C5CA 1P9RA 3AVOA 4GT1A 4PC1A 1O3YA 4D80A 1XD9A 1VHLA 1LY1A 2HXYA 1E1QD 3A58B 4I99A 1US8B 4BZXA 1HEIA 1U99A 4FCTA 4G5QA 3MWKA 1G5RA 1C9KA 2WWHA 2F3TA 3RABA 2HF8A 4Q19A 5B64A 2VRWA 3PUVA 4DKXA 2WWIA 1DADA 1L8QA 2GETA 4GDFA 2OG2A 5C4MA 4ESHA 3QSYA 4OQXA 4KITB 2GJKA 1S4QA 3PVSA 2ZRJA 2P6RA 5A5GA 1TF5A 1ZM4A 5DYGA 2UVQA 3I8XA 4HUTA 2ZE6A 2FNAA 1ODFA 1PUIA 3A6PC 3LH5A 2Z83A 1A1VA 2IHBA 521PA 4ZCLA 4DSTA 2NO7A 1P4SA 3CH5A 4E22A 4Q1AA 1EG7A 1C4OA 1R8SA 3NG1A 1IHUA 1QZXA 3THWA 1MR3F 3TRFA 2ZJ2A 5LDDC 2J0QA 2FEOA 2BBTA 2JLRA 4MH0R 1OIWA 4MDEA 3D7MA 4B2IA 4DLWA 2BJWA 4CYMA 5EQTA 3MFYA 1OXXK 5C18A 5H70A 4AD8A 2OESA 2WSMA 4CT4B 2N1BA 4B3CA 2J7PD 1KAGA 3BBPA 3O47A 4KYIB 1TL7C 5AR1A 1NMYA 4MRVA 2IEZA 2PT5A 2ZJOA 1FMJA 3LBIA 1W2GA 5CK4A 2ZS9A 4LZZA 1OFHA 3V9PA 3L0SA 2GKSA 3CO5A 2CCJA 4GBMA 2CNWA 5JECA 5LPNA 4YMUA 4KSCA 2WMNB 5FUXA 4ASUD 1YZTA 2WM9B 1JECA 1G4AE 2CEAA 2GEDA 3GCGA 3C5HA 2DCUA 4YMVA 1HYQA 1IONA 1NVXQ 4TMVA 3GEIA 5CK5A 1KY3A 3KL4A 5AUQA 4MKHA 4RD3A 4WZAE 1G21E 1ZCBA 2WZQA 1X3SA 1DTSA 4TYNA 1SVKA 1KI3A 2GJ8A 2HCBA 5EP2A 1SULA 2ECKA 2XITA 3AKDA 4RD0A 4AYTA 4PPFA 3QEOA 3K0EA 2RMKA 4E5UA 2IF0A 1ZU5A 2OLKA 1XTRA 2F55A 4IVQA 1TUIA 2MMCA 4LBVA 3CX6A 1MABB 5UKDA 1ZCAA 2ZYVX 3TIFA 4HAXA 5JI2E 1ZUIA 4WW0A 4NCJA 4IOKA 4CEIB 4TZ0A 4ZV4A 3LLUA 4XJXA 3DOFA 3OESA 1NI3A 2PX3A 3W6NA 1N0WA 4HYYA 1QHIA 2EWVA 3LQRA 2REOA 2W83A 2XOKA 4XTRA 1XCGB 1JPNA 3LBHA 5AJWA 2X77A 2FX3A 2ZVQX 4RZXA 1XPUA 1TMKA 4ZCMA 4DDUA 4OI1A 4LBYA 4MRSA 4XIGS 4D0GA 1XEXB 1FP6A 3W5JA 1ZMXA 5BYJA 1EESA 1GITA 1G5TA 2IYXA 2EW1A 3OFND 4XOIA 3U6BA 1OJLA 3NBYC 2GXAA 4LBWA 2BM1A 3NDPA 2GDJA 4IW3B 4IEEA 1RYFA 3WMFA 3EIQA 1OE0A 2CE2X 2JDID 1MO4A 4MYCA 5D3QA 2YWGA 4MDFA 2ZIAA 2IEYA 1J2JA 1OFIA 4OHVA 4JLVA 4RKFA 3RANA 4BFTA 4C0LA 1NLYA 1XJ0A 4URVR 4A15A 2DY1A 3HP1A 3AP3A 1JR6A 2AL7A 2VP0A 3BWDD 3RS4A 1KJZA 2XXAA 2WJIA 4Q02A 2JCSA 4HSEA 1II8A 4HUQB 1E2HA 2CMKA 4RY2A 2NQ2C 1EGAA 3GLHA 2NPFA 2VL7A 3F5FA 3RWOA 1WRBA 3KUCA 3UK6A 3MCAA 1OXTA 1FOEB 1JI0A 1HQYE 1KTVA 1BYUA 4Q7JB 2YNMA 3TSOA 4MGYR 3PITA 2OFXA 2G3YA 4DDWA 4MGKR 1XD2A 4LJ7A 4NCNA 4Q9KA 5HPYB 2WKRA 2ZRBA 3A8TA 2WJHA 1NRJB 1FTNA 3BJIC 4AURA 2XZLA 2ORVA 2NPIA 4PZZA 4P32A 4E09A 1ETUA 1QHGA 2WWWA 3QEJA 2ZRHA 1FUUA 1E94E 1RZ3A 4KVAA 4RKEA 1SXJD 2EWWA 1MO6A 4NZYA 5FUYA 4W9MC 3JZMA 1G3UA 1ZBDA 4ZKEA 2BCJQ 3DO6A 2YZ2A 4R98A 1F5NA 4HEJA 4AG6A 2AKAB 3DHWC 1IJFA 3H0KA 3N2IA 3IILA 1G8YA 2XJ9A 5DISB 3K0SA 1TEVA 1HE1C 2ZAMA 3NEYA 4KXFB 5FOUA 4CZ2A 3N70A 1RC8A 1ZD9A 1Z08A 3AF2A 5BN4A 4RZ3A 1XMIA 4BLRA 1OYYA 2ZYUX 2RB4A 2IX3A 3CF0A 3B1WA 2O8FB 1G8HA 2ATXA 3WRXC 2RGDA 2J0UB 2QPTA 1UBGA 4L16A 3T12A 4AKEA 3R9XA 2IA5A 2FDCA 4X8HA 4LPSA 2IUSA 4GZLA 1V5WA 2GJ9A 3REFA 2ZRAA 4QNRA 2DBYA 3KXKA 4HB2A 3BB1A 3CRVA 3OFNA 2QM7A 3H84A 4QOSA 2Z5FA 4FI3C 2VP6A 1E2EA 3EC2A 2J7KA 4KCGA 1OB5A 2ZRDA 4HDQB 3EZFA 1G20E 2IS1A 3LW8A 2XTZA 3FB4A 2QRNA 5JLJA 4F93B 1OYWA 3AP1A 1SHZA 3QOFA 3M4YA 2FSGA 2CLSA 2CLDX 2BM0A 1BMFD 1GTVA 2JA1A 2R6CA 1XEWY 5TB5A 5TY0A 2ZR0A 2CJWA 5FTKA 4EJSA 3U7FB 5GJCA 4GNKA 4ABYA 1B23P 2JEOA 1CIPA 1WDTA 1S3SA 4Q01A 5J47A 2GRJA 5CM8B 4POAA 3SBDA 4IXMA 3U3MA 1Z6XA 3U4QB 5LD2B 4TQAA 1JBKA 1D8TA 3GJ5A 1SKQA 4B43A 4BRWA 1FMLA 3BFKA 3GFOA 3QPVA 5FUVA 3FKSA 3DPUA 1W36C 2OBMA 2QPOA 2MSCB 3QKRA 3MUFA 2P6UA 2C9CA 3TSWA 1UADA 2EFCB 2RGBA 4M1WA 2OBNA 3BB4A 3SBEA 3VU9A 5A4JA 4XSHA 2BBWA 1G6OA 5EE1A 3TW8B 2GCOA 3L82B 3RDPA 1YR9A 3CLVA 4AKIA 1KHTA 3HWSA 4PAOA 2B92A 2CVHA 1SZPA 1JR3D 2ZI7A 5ANRB 1ZUHA 3EG5A 4LGMA 5KNDA 1Y3AA 3DKVA 3QVUA 1IM2A 4P3YA 5AJYA 4KFSA 3PUYA 4URYR 2IUUA 4OQMA 2AN9A 2JIZD 2WVJA 4G01B 3Q7QA 3W9YA 4UJ3A 1U8ZA 2I3BA 5KNCA 3AVVA 3AVXA 2A5YB 1NMZA 4X8LA 4D26A 4JSYA 4F7WA 1DG1G 2IC5A 2YWEA 4R9UC 2O8EA 1QHXA 5EXSA 2WPDA 3GJ0A 3LY5A 2CCKA 4OYHA 4IXNA 1G41A 5JSZB 5CIWA 4G5OA 4HAUA 1YZGA 4OL0A 4I81A 2XAUA 4D0LB 2RKOA 3RVBA 3OIWA 2R9VA 5GVSA 1JXOA 1KI9A 4MRPA 3UPUA 4UJ5A 1BS1A 1E4YA 1ZD1A 1NVVR 1UAAA 4B32A 3CNNA 1LS6A 1UJ2A 4DB2A 4PPQA 5AUNB 1Z8FA 1TTTA 1Z0FA 4IJMA 1OFUX 5KO2A 2YC2C 1SXJB 4Q1DA 1FX0A 2QU8A 5KPDA 5DO9A 1E2QA 3ZDQA 4YDSA 1MO5A 2D4HA 2YOHA 4KLZA 2B8WA 4D4MA 4BECA 2ZXUA 3P4XA 3A37A 5EXPA 1ZIOA 4ACAA 3PEWA 2VP2A 4DIEA 4V0ME 1I2DA 3VU9B 1TQDA 4TQUS 2WWXA 4QGAA 3IO3A 1Z06A 1F6BA 2ZSEA 2YINC 5SZIA 1SXJC 1SXJE 1VCNA 4DSNA 5DI3A 4Z51A 4GI7A 1I4DD 1KO5A 2OV2A 4JZKA 3SJCA 1G8FA 1UKEA 2Q21A 1H8ED 3BH7A 1GNRA 3IKJA 1II0A 4AG5A 1JXMA 1KI7A 4A6XA 1U0HC 1X6VA 4K46A 5GVRA 3ZIAD 2B8TA 4QGFA 2NMVA 3CKLA 4U02A 1JAHA 2GZDA 4M1OA 2IS4A 4W5WA 2RGGA 2R6FA 4LV6A 1E9DA 1CTQA 5HE8A 1G64A 2ZI6A 1S2MA 2GWHA 2YC4C 3QQ5A 4EFNA 1XFAA 3NH6A 2GA8A 5CDFE 3KKPA 2R6DA 3U3JA 3K0AA 4JYBA 2WKQA 4L9WA 1SXJA 4W7SA 3CB4A 3VR4A 3PV0A 4LYJA 1UKVY 1CRPA 1KK1A 3GD7A 3NKVA 3THOA 8OHMA 4O3MA 2HT6A 3B1ZA 5FI1B 5IF9A 3NEJA 3OIVA 1KSFX 5CLLA 3B85A 3IBGA 3REGA 3HU2A 2DHRA 3THXA 3GQBA 4JBYA 4LCBA 3TVTA 4FMDB 3SJBA 4RZ2A 1HH4A 2GJAA 3EZ7A 1XPRA 3HR7A 3OEEA 2OCYC 4M9SA 4S2EA 3CPJB 3LNCA 4JIMA 4ZDWA 3SU8A 2C5LA 1ZRHA 4IDNA 4TYPA 4TL6A 2O0HA 4GOKA 4I1UA 1GZSA 2ZE5A 4FMBB 1XTIA 5HZHA 1PLJA 3U3KA 3IHLA 1ANKA 1JEDA 3FMOB 1R0ZA 4TL9A 1UBCA 3VAAA 1E2LA 2O8FA 5SZHB 2BKEA 2XX3A 3PENA 4GL2A 1OFTA 4QM7A 1WF3A 2HCJB 5CYOA 1GNQA 1KDPA 3KXIA 3WBKA 1XTSA 2HT1A 4FXPA 2KWIA 2HLDA 1P2VA 1AZTA 1UDXA 4CW7A 3VQTA 1LS1A 2FSIA 2WKPA 4JLDA 5SZKB 1KJWA 3AKCA 2AXNA 2PZEA 1SVIA 3FHTA 3ADKA 2V6IA 3B9PA 4Q18A 2W0MA 3BRWD 4YC7A 4ZDIA 1T5IA 2A5JA 3BE4A 3WYFA 2H5EA 4DLTA 2GCPA 2ZU0C 1J8MF 2C2HA 3X1DA 2VP4A 3TE6A 3DMNA 2R62A 3PIRA 3AQ4A 2IYVA 1W5SA 1XD2B 5FTJA 4E07A 1FPMA 3RNLA 1H8EA 2QQEA 3RSLA 5LB2A 2YYZA 4XVQA 3ADBA 4JL8A 5CJ2A 1AZSC 2CJWB 4Q9IA 1ELOA 5AJZA 4DSOA 3CX8A 4EKDA 5G40A 3GLHB 4WAUA 3FKSD 4HDOB 5LB4A 3KJHA 4C30A 3WBJA 5KU1A 3ZYCA 3D31A 1E79D 3ZD7A 5JJIA 1OIXA 2EFEB 2ZR9A 2WIBA 2D7CA 4BFXA 1LV7A 2Q3FA 1RVDA 2R44A 3UWKA 5J4YA 2YOFA 3LO5A 3VR2A 2BC9A 4G3XA 4CVNA 2QQ0A 4FWIB 1UEIA 1W36B 3QJYA 2IWRA 1T8TA 3GLHE 5CB8A 2ZRIA 3P27A 4URZR 3OIUA 3CX7A 4DIDA 1BMFA 2WWFA 4LUCA 3RYTC 3NDBB 4BUJA 4O25A 4YMWA 1RE0A 3GPLA 1KI8A 1JPJA 1GDDA 1NJGA 2WPDD 5KDDA 1ZYUA 3DM9B 2GJSA 2P5SA 2J0UA 5B30A 1IJEA 1R7RA 2GK6A 1A2KC 1E1RD 2BMDA 4OQNA 4QL3A 3P20A 4IRUB 4US1R 5DI3B 5ELXA 2ERXA 1Z63A 4RD1A 1VKJA 1Z47A 1NN1A 4LSGA 1HE8B 4BEJA 1JJVA 4Q4HA 3U4QA 4II7A 4P4SA 3Q8XB 2WWYA 2WHXA 5AJXA 4IVRA 2IYUA 2QTHA 2JJ2D 4AIIA 4RJLA 3GLGB 4BLTA 1UBEA 2VHJA 4TYWA 3RS0A 5TXGA 4IVPA 1QHNA 5HE9A 1KMHA 3AH8A 3BH0A 3ECCA 1G5PA 1E0KA 2FOLA 1E1QA 2BDTA 2IL1A 2ZSDA 2A9KA 1WCV1 3W6OA 2F9MA 3NH9A 1C1YA 5KHOC 4PHGA 2VO1A 5B57C 3E5HA 5JWOA 3GLGE 1LF0A 1M2OB 2MSEB 3B78A 1D2NA 1IN4A 4FD2A 4ARZA 5FR1A 1E9RA 2DFLA 1KI1A 2PT7A 3OIYA 3EA0A 3C41J 3PR1A 3ZZTA 5J4KA 4OHYA 2VSFA 4GP7A 4JT2A 4KLNA 2DWPA 1G4UR 2YKGA 1VG1A 2XB2A 5KOYA 2ZQ5A 2CBZA 3FPAA 2O8DB 3RWMB 2O52A 1TQ2A 2OXRA 1M34E 2D3WA 1WP9A 4DLXA 2OEPA 3KKOA 4PSKA 3SYKA 4CGZA 2HLDD 2IYWA 1FL9A 2D06A 3A1WA 3OZXA 5DGXA 3O8CA 1LB1B 4B33A 4A4DA 3K0FA 1KO4A 1TQ6A 4P31A 4TL8A 4KHZA 2IW3A 1E2JA 4LJ4A 4KV9A 4RD4A 3SYNA 4O2RA 1CP2A 2V3CC 2OLJA 2VSOA 2O0JA 5FPKA 1AKEA 1YVDA 2BEJA 4NTZA 2ZJYA 3QF4B 5FBRB 3AP2A 3UXMA 3KB2A 3LD9A 3FDIA 3DDCA 4FINA 4DCSA 1Z07A 2AWOA 3EASA 3O8RA 4GFDA 4BFYA 1E0SA 2GCOB 1M8PA 3P26A 3AV0B 3THYA 4UNRA 1P9WA 2Q3HA 2Z4RA 5JCPA 2C04A 3SQXA 4QKQA 1ZD8A 3GJ6A 3QKRB 4XWKA 1RJ9B
chains in the Genus database with same CATH superfamily
4I55A 3KJFA 4EKEA 2O8CB 1GKUB 3ZKWA 4MUKA 3FM9A 2AN1A 4FR5A 1V5EA 2R6GA 1QPBA 2XH8A 3VV3A 2W6PA 3C6BA 3B2EA 3QJGA 1P6UA 2YMLA 3BJRA 4HDKA 4LVNA 5F3DA 4UHFA 1HT0A 5IFLA 2CK3A 2B3TA 2UAGA 4EB6A 1LA2A 2C2ZA 5F7XA 1JI3A 1G66A 1Z6GA 4LK2A 1J4AA 1U28A 3H8VA 4DJ5X 2ZDGA 3DQZA 3ESDA 3D7RA 2IODA 2J5BA 1E6CA 1QCYA 1LNQA 1VMEA 1JIVA 4DIMA 4OPMA 2EQ5A 3M6MD 4C7BA 1Q91A 4KK3A 4LDZA 3K53A 6LDHA 1YQ9A 2IBMA 3O90A 5REQA 3VHQA 4B4VA 1I9GA 1VJTA 4WKBA 3UGQA 2R6AA 2CLFB 2GBLA 1OWMA 2QIOA 3G7UA 4RDXA 3KKEA 1TCAA 3ROMA 1MW8X 2BTEA 5JI3E 5EAIA 1INLA 1KF0A 1OI2A 3FGPA 4XVUA 5FNZA 3R3HA 4UAUA 1RPTA 2Q1SA 4CCSA 4CMHA 3AT1A 3IVMA 1NVBA 5JC1A 4NYIR 3A04A 3C8HA 3WNCA 4UFNA 5A0FA 3L7JA 3SVTA 3ZXXA 1MH1A 2PDAA 3QP9A 5DF1A 4YP1A 3RFFA 1DTWA 2FA9A 3OCXA 1JLHA 3QE3A 1ZH2A 1FS6A 2N46A 3QLVC 4I4TF 3TQSA 4BX9A 2Z2YA 3DCYA 2ZE7A 4I66A 3WKEA 4U0KA 1SVLA 5G02A 1J23A 3R44A 1VBMA 3HWWA 3DUFA 1M74A 4LJ8A 4TXMA 5DWVA 2ZREA 4ZC1A 1GPKA 2FUG6 4F71A 3WSTA 5EJ8A 3BGWA 1SZDA 3RBXA 1AIPA 2VBGA 4QWWA 3A1TA 2QVYX 3SM9A 3NS7A 4X1KA 5EP4A 5ALRA 2PFGA 1H6DA 1LI4A 4P4SB 1VKHA 2LGJA 2J5XA 4DLSA 4OXXA 5IUKC 2EQBA 1NMXA 1QKIA 1E1DA 2PK3A 3UUEA 4EJSC 4LXHA 1HL7A 4PAGA 5K03A 2ACKA 3RT1A 3MQFA 1IPHA 4R8SA 1CLUA 2HF7A 4UUBA 4EG1A 3RS8A 3ZDEA 3QXSA 1PW7A 1MHTA 2OGTA 2BR3A 3T7RA 1IE3A 1AB6A 2FW7A 2AKYA 2TRSB 3VZPA 4BZPA 2I2AA 2UUPA 4MULA 1V25A 1GGVA 4U3JB 3WJ7A 2MTBA 2BZ0A 2VP3A 3FYSA 1A4RA 4DRYA 3D2CA 3KP1A 4BRUA 4XWWA 3PFHA 3EZ2A 4HDMB 2VHUA 3VSAA 1A5ZA 1QIIA 2QLMA 5E9JA 2E6KA 2F1KA 1RXVA 4BPRA 2CMFA 3GH3A 1XA0A 3FHOA 3DDUA 2J41A 2W37A 5IHPA 1RYMA 2YHIB 2H2GA 2Z58A 2VJMB 1VG8A 1NQAO 2AOTA 3KKZA 3GA5A 2OSBA 1XTPA 5T41A 4R40A 4KH0A 4YRBA 3ZY5A 1AV7A 3KSMA 1BKSB 4II2A 4M46A 3V1TC 2ZYGA 1NVGA 1QNFA 3FVVA 3JQ6A 3BMXA 1PKXA 2JH8A 4I5FA 1L6IA 3BXZA 4J3JA 4L15A 3K72B 1UK7A 4J0HA 3MCZA 3S70A 4I9HA 1GP2A 3W0LB 1JE0A 3ZDYB 4KXYA 3U1BA 4WBSA 1EFCA 1J2RA 4R3WA 2Z95A 2GASA 3GRFA 3NGXA 4JP8A 1T2FA 2P11A 3HZOA 1Q16A 4HATA 3UGTA 3ZJTA 1VPLA 2WFAA 3PQCA 4CIVA 5D7BA 1HFWA 5BWLA 1BH2A 3ZNQA 2D3TA 2BKVA 3MEQA 4DCOA 2ZETA 1YCGA 4F21A 1T8YA 2BJVA 1WMBA 3FWPA 4EYOA 3FY4A 2PX4A 4GKBA 3H1BA 4QD3A 4Z9XA 1SWWA 4JI2B 4CKYA 1P8JA 3ZLTA 4RH1A 2IP4A 2OCGA 4OQ4A 2L42A 4IGFA 3VR4D 4GYKA 3PIIA 3CCCA 3T5BA 3WLMA 2XDQB 3B9QA 3KEGA 2D2XA 4MW5A 4YAJA 4PR3A 4DTIA 4B2LA 3ZCSA 2BOVA 1B6SA 4Y67A 1JX6A 3P9IA 3IAM1 4OHKA 1T3ZA 2PKYX 2Z5LA 4C20A 3FUXA 1N1DA 3ZIUA 1SBCA 5DLPA 1XDWA 5EQFA 3AZOA 4H1VA 1RADA 4KC0A 1OPRA 2Q99A 2PJRA 4JC4A 1S3GA 2H9IA 3ZOKA 2Z8XA 4DQDA 3QFCA 3SXPA 4KMRA 4NDAA 4BKOA 4QUGA 4HQNA 3ZJ5A 5K3AA 1ZK0A 2PIDA 5AJVB 3X2EA 1CULC 1FP4B 3GMTA 3H1FA 4CEHB 3TUZC 2RG1A 4JVSB 5C46F 2I91A 4JITA 5D01A 4FT2A 5E3IA 1BEZA 3IAS1 3HBLA 4FKMA 2YYYA 2AD5A 3P2IA 4JUBA 4GOMD 4EQ6A 2BGKA 5EUMA 1PGQA 1E2GA 3K7EA 1A97A 3JYPA 1YZUA 2VDLB 1M83A 1H23A 1NP6A 1NRXA 1PK7A 1R6AA 4G07A 2XKAA 1MG0A 1MO3A 1BN6A 4P5PA 4RGQA 4YQEA 3OZAA 3T5DA 1NG1A 4GOJA 1AKMA 1DBQA 1K7SN 3WLLA 4EZIA 1WDWB 2PEYA 2ZKLA 2H48A 3R4CA 2JLZA 1K75A 5KCMA 1W581 1WNTA 2EP7A 3IHKA 4LHSA 4EGQA 5F7OA 3W1EA 1Y9ZA 3IAEA 3WWDA 1IOLA 2WQZA 3F6BX 2O06A 3OC0A 2WJAA 2F7SA 4LN1A 1XU4A 5IC5A 3SSOA 1PS0A 2X40A 3OFKA 2PV7A 2UUCB 4J4TA 1E5TA 3DAHA 4B83A 3E82A 5D5PA 5IYZA 2FWPA 4CMIB 1SZCA 3C5EA 2D0DA 2J32A 3LJKA 3GRZA 4UUQA 5C8YB 1T26A 1MV8A 3RRMA 3T5TA 4DMLA 3WWEA 2PE5A 1SFRA 1JKXA 3RHFA 3KB1A 4OREX 3VX3A 2VEOA 3DBLB 2P9EA 3P7MA 4C0QC 2H1CA 1JQAA 2ZROA 4BGUA 1QP0A 1HRDA 3LVBA 4ALKA 4LFCB 2BCGY 3F74A 4LZJA 5ICGA 4GL4A 1P2BA 5FR2A 3MGGA 5E7JA 2GZ2A 3JALA 3LNTA 2ZR8A 3VYUB 5H02A 3ERCA 4XOUA 5ALYA 1V37A 4EB0A 3WLFA 5HF9A 9ATCA 1CUJA 1V3QE 3U7QB 3Q11A 3W6ZA 3UHOA 5K7SA 5HCIA 4YA6A 4UPVA 4EATA 3UJ6A 4HPWA 4D26A 3HFJA 3LW8A 3EDQA 5ERXA 4DL9A 1V7PC 2IIVA 3OF2A 4ZMSA 3IEVA 4Q3OA 5EVJA 1S1CA 2DU8A 1Z4LA 3L05A 1N92A 4TRRA 3ZZMA 3R7SA 1ENPA 2ZS8A 1M2VB 4J94A 1UJCA 1XEFA 4N0MA 3ZNPA 1RM0A 1JFVA 2I9PA 2G9VA 3EA5A 5JZOA 4WY8A 3BOSA 4GR5A 4IQ0A 5EWJB 5EXDA 3ZHBA 1VL8A 3I09A 4EB8A 2Y0DA 2HGZA 3ELUA 1EM8B 3ZWVA 1RQLA 2ES4A 5ICCA 1UWCA 4K2HA 2VDKB 4L2IA 5B6JA 3SIPA 4KMOA 4WOPA 1WXXA 4WMLA 3K6RA 1ORHA 4J29A 1XLTA 1VPEA 2HA7A 4ERNA 3O8BA 2FZEA 4MUEA 4O4LF 1CUZA 2H5IA 4OCZA 2WIAA 3RS2A 1A96A 1DIOB 3KBOA 4BE7B 1TT5B 2BFBB 4QECA 1W0JD 1SOWA 2JAHA 2I6GA 1X1CA 2G76A 3HH8A 3RJTA 4B6FA 2I7DA 2HJGA 4OP2A 4YN3A 2AJBA 1B26A 1QONA 3PQ7A 4HS9A 3SC6A 2W2KA 2VC2B 3PQEA 2XCOA 3V4FA 3IQHX 2XE7A 7YASA 5KPJA 1N5LA 1Q7GA 4KQJA 1BXGA 1EAYA 3C74A 4FKZA 4QRDA 2CHUA 4EUFA 4Q3AA 3RRZA 4F45A 2HIMA 3CJQA 3EVBA 5TF4A 4UM9B 2M6RA 4DLVA 2COKA 4RPIA 4UM7A 3N76A 2YUIA 2BFCB 3CRMA 4MW6A 1U2PA 4L5IA 2F43B 2Q6VA 2AJ8A 1Q19A 1GXSA 1VL5A 2V58A 2AFHA 2R1ZA 3A4MA 3AY3A 5ERGB 4JI3B 3TI7A 3NHWA 5AXDA 2EOAA 5NLLA 4MGEA 3OP1A 1T5OA 2H92A 4IJKA 1G5IA 1DIRA 2G5TA 4QTYA 2H63A 1KGDA 5TGDA 2IXBA 2BVNA 2XNHA 1LK5A 5A05A 1UC5B 4UHBA 4BFLA 4MB6A 3TIGA 7REQA 3G5TA 1RQ7A 1RJEA 3OM1A 3PKZA 4QGGA 4IO1A 5E6SA 4IG4A 2C7VA 3G8YA 4NU0A 4D8YA 1L5HA 2O3QA 3R8FA 5IVDA 2QRKA 4ZOLF 1I2BA 4ZI2A 1JDUA 1R74A 1RKBA 1COZA 2BONA 3DSRA 3V2IA 3V8BA 5E3HA 1X74A 1FVHA 1KK3A 1A69A 2RHGB 1U3UA 2DPLA 3CE6A 1WQ1R 1P5HA 3P0JA 2I8CA 4ENWA 5CFOA 1O2DA 5K05A 3EDOA 4KIGA 2YZKA 4RF5A 1XZQA 4IICA 1KAHA 2ZAGA 3GYBA 2B4KA 5JSQA 3AFGA 2PQMA 3DUWA 4HWOA 1KI6A 1VMIA 4RGYA 3M9WA 2W2XA 3TLMA 3WLIA 4QEZA 1GG9A 4ECAA 2IBTA 3I01M 4DUGA 3DOEA 3LYAA 4RVFA 5DK6A 3TIVA 2C7GA 1DELA 1KJ8A 4BFSA 3QBTA 1KP9A 2J08A 3RFTA 1WXWA 2QTVB 2DEUA 2B5OA 1G9SA 3N2ZB 1SU6A 3AWDA 2KB0A 4MOWA 3STWA 3MELA 1R1DA 2A5DA 3GPBA 5CTJA 1NI4B 2XNDA 4EG8A 2I3GA 1KEWA 1G17A 4LV8B 4A6DA 2EC5A 3CC8A 1FW6A 2W5UA 3A1EA 2JGAA 4YQYA 4OQDA 1ENOA 5FOVA 1HNWB 4ZQIA 1EVLA 1P17A 3ZCXA 2ZVJA 3KSZO 1M6HA 4ND3A 4QX6A 4S1NA 2CL0X 3RS5A 5G1PA 5I01A 1NVKA 1WXDA 3F6RA 2NUTB 2YOGA 1RRCA 2UYQA 5DMXA 2GBGA 2NYUA 4QDJA 3K9FC 2BKAA 1MCZA 3CPSA 4Z0HO 3AW8A 4C2UA 4I1SA 1GPYA 1QDEA 3H5AA 4WEOA 4D7AA 2JI6A 1D4FA 4MQMA 1IL0A 1UWKA 2IYSA 4Q7LA 1VBNA 1A1SA 2PGOA 1BCSB 1RAIA 4ZGWA 5I4CA 3QI2A 1I2AA 1QYRA 4F9GA 2VTBA 2CFOA 1FNSA 2R7MA 3PC3A 3T5GA 4J9VA 2A1UA 3FF4A 4R5HA 1R9GA 2OL4A 3JR3A 3NBMA 4PR0A 2AXEA 1DSSG 2X4GA 4JLMA 2IDMA 5BSEA 1ZCZA 4EB6B 1M7HA 1NSYA 3IDAA 2ODPA 2PTHA 4C0KA 1Z4PX 3HPQA 3W06A 3HXQA 3D8SA 4EUKA 2W00A 1KO8A 4FOSA 4MIEA 3IL2A 3DBVO 3MILA 1RR6A 1GN8A 1EP2B 3R1IA 1N4DA 1Y3CE 4NECA 3W4JA 3INRA 2GD0A 2YVKA 5KNCD 3GDHA 2PM8A 2QMUA 4RCYA 5LP6F 1CY7A 1RLJA 1C8KA 1N1GA 2HJVA 2PS9A 1EVJA 3K0KA 2A4MA 4L78A 5DB4A 2JFGA 2QUAA 5ARCA 1TVCA 4QBKA 1E2NA 3FYHA 4XVRA 1P73A 2OCDA 1B8VA 4YJ3F 1F8FA 2G17A 2XE4A 3PJFA 3H9EO 5MN4A 3DH0A 1SQ0A 2EJTA 4ETIA 4G9EA 4KG7A 3KWLA 2YXBA 5GQSA 3T6KA 3C1TA 4M8SA 2W6IA 1NUHA 2NOAA 5CD9A 4QDZA 3BFVA 3GR6A 5CVDA 1QIJA 1KIMA 4XCQA 4JVMA 5FOTA 1ZO8A 4GZ3A 4R8VA 4U9IS 4PNPA 4D8UA 4H3KB 3FLBA 2D5LA 2IS6A 1JHYA 1QRUA 4MCIA 1CF4A 5G0WA 3BXXA 4BV2A 3W5BA 1XRPA 3B70A 3UWMA 3V34A 1U8YA 1X7WA 2GBIA 4KHPB 3P71T 4OOFA 4C0AC 4XD7A 1W2WB 1T0IA 3K2BA 3L8DA 1DRJA 6REQA 2BMJA 1V7QA 2VOEA 4ZIRA 1KVQA 2PX6A 2V65A 2HRBA 1A82A 1PLKA 2A78A 3E23A 4RKWA 3X1WA 1MZVA 2NO1A 3OE5A 1XMOB 3OIFA 4X95A 2CVFA 4F46A 4HT3B 4YT2A 3O83A 2PWYA 4DWVA 2ZI4A 4BC1A 1HNNA 2IDJA 2NG1A 2OHXA 4MKIA 5T67A 3G5UA 1GAQA 3AFNA 3HXLA 3HYLA 3P9QA 2ZU6A 1D0VA 2Y1DA 4I2VA 4AY5A 5ALJA 2B0CA 1JDJA 4ZZ3A 2WU1A 1W49A 3FMPB 3T95A 1Q1QA 1NBOA 4I6JA 4OU4A 3LQ1A 3ZWXA 4IXWA 5D84A 1E9SA 1N2JA 3I4LA 1XCJA 1GAJA 1M1NA 5KTRA 3OQMA 5JS2A 3FR7A 1PGPA 5CEFA 1H2HA 1HE4A 2J9XB 1PSDA 4L7QA 3OH8A 2H8GA 4ASUA 2OZEA 1NJ6A 2W0SA 3CQ9A 1SG9A 3RTGA 4X94A 4DAOA 4QUBA 2YY6A 5I9IA 1Z6AA 4R16A 4XFJA 3EMVA 2NV2B 3FTFA 4I3HA 4TYYA 1JZQA 4FSDA 3CNOA 2AXPA 4DKJA 3HXTA 3U37A 1H85A 1SKYE 3JYHA 5ITSA 2AMLA 2N42A 1PZFA 2XMDA 2O48X 3ELDA 4MJ3A 1K8RA 2XF8A 3UHJA 4RJ2A 4DLRA 3ELYA 5IH7A 1SEVA 2YV5A 2DWUA 1Y3DE 1Z82A 4FVTA 3SSNA 3ZXYA 2UU9B 2F90A 3V8MA 3PUHA 4ZYWA 2AUTA 4ZQFA 4DABA 1NVWQ 2PFSA 3PXAA 5JFGA 2J46A 2I03A 1FSGA 3GCXA 4IGAA 4PC3A 4F8EA 1GUYA 1MVLA 3O1IC 3Q9UA 3VZDA 4DCUA 4RD6A 3PEVA 4MWBA 3HPRA 2XCTB 5CBPA 3DW3X 1P0IA 3JCZA 3F9IA 4Y2HA 4KACA 2O3SA 1JP7A 2ONKA 4ZVOA 1K92A 2R84A 3CSSA 3GYGA 5E2IA 3UNXA 1ZBQA 4BX2A 4DA0A 4D9IA 3VVMA 5EIXA 4K9NA 2CVZA 1TLLA 2PN1A 5B2ZA 1NU8A 3BDIA 4ZK6A 2VCEA 4KDFA 3L4JA 4F6RA 5H80A 1TJ3A 3TGLA 3RGGA 2MSNA 1QAQA 4MRRA 1WZCA 2FOIA 1CV2A 2BI7A 2KQUA 3DE7X 5CDSA 4JB2A 4MRMB 1Q1ZA 4CT0A 1U3VA 2PYDA 4IF4A 2W8BA 3EUEA 2X19A 3M6IA 4KYVA 4RBNA 3NAGA 3WGOA 1YC2A 4E30A 1AUOA 5AW9A 4DJDC 1U81A 3OCUA 2VJMA 4MAFA 3VOSA 1XDZA 1A0OA 4FGSA 2RAVA 1RKQA 1TIPA 1V3TA 2WF8A 5F4BA 4N3BA 3T7IA 2K5UA 1P9NA 3A6JA 3AIIA 5ABPA 3CPHA 2VZ8A 3JWJA 3MUEA 5EIAA 1JA0A 3JASB 1COWA 5FLKA 3UUWA 1NVTA 4X7RA 5FL7A 2O20A 2IHKA 3EFHA 3HJHA 4OJNA 1DC3A 3ROFA 1M8KA 2CXPA 3AI2A 4BFCA 4EG6A 1EFAA 2O5CA 3IIIA 4QUJA 2XW6A 4I4TB 1YBFA 3I04M 3KHSA 2D8AA 3N0XA 3DKPA 3C43A 4WLVA 1KOJA 3FDZA 5D51S 2Z43A 1NONA 4G1CA 2H2WA 4PLFA 4MYRA 4HQ0A 1EE1A 1O95C 1BVHA 3JD4A 5HKKD 2XE6A 1YB1A 3MERA 2ZBEA 3QF4A 4K05A 2ZFUA 5DNUA 4AIRA 1ZD2P 4OK5A 2ZJZA 4CMEA 4DJEC 1IWBB 2LTAA 3MWEB 1HOTA 1JR3E 1QYDA 3R3VA 1HQCA 2WG2A 3A1VA 4LK3A 3ETHA 4WZZA 4QZVA 1QQ6A 1ATZA 3FPCA 3PNKA 4MO2A 5K0ZA 2QLLA 4OHZA 4EX6A 2XMPA 4OJTA 5A5VA 4ZYYA 3W9UA 4CM6A 2XA2A 3OCVA 4UBNA 3K1ZA 4MHSA 5C34B 2GBCA 1XWFA 3DTVB 5LZ8A 4P35A 1VIDA 2X2OA 2XZPA 1ABBA 3RSOA 4JEIA 2A2ZA 4YH1A 2UXDB 3H86A 1E1LA 1P6XA 2OV8A 2WOOA 4G0PA 3T1VA 4XQ9A 3T1OA 3U7IA 4BQEA 1TEXA 5IDVA 5FD8A 4U5XA 4IZ6A 3AEZA 3F3YA 5CFZA 4KMMA 1L1FA 4OI4A 5DFAA 4XB2A 3D6UA 1TKAA 3TD9A 1N6HA 3B1YA 1IBMB 2VHCA 3FZGA 3L8ZA 1GTL1 2NU8A 3GNLA 5KQMA 4J0FA 5EE3A 2V7QA 2FZKA 2GPSA 4OBEA 4G89A 2B3DA 4O3FA 5JAOA 4RMNA 5HZMA 4BB0A 4B6SA 5FBQB 1E5VA 1JGTA 1X7DA 4M1ZA 1KERA 2CYCA 3FNBA 2QL6A 2WJVA 2I54A 2C9MA 4G4JA 1E6LA 1R5NA 3D6JA 3NEPX 2FQYA 4Q4AA 2GTIA 1VG9B 1XEXA 1PT9A 4Z9FA 4PCUA 4JLJA 4TWRA 4BOYA 5JT1A 1QE0A 1TZ2A 1MC1A 1E5QA 2JCBA 2VBIA 2JB9A 3GOHA 2A5LA 1TQ8A 2AOUA 4I1RA 4MKXA 3EDMA 5FJIA 4MGZR 4FOTA 2D54A 2FN8A 3U5TA 1LW7A 1TD1A 1XRLA 2CNNA 1POXA 4HFRA 4E2WA 5IXYA 4A82A 3M2PA 3WYEA 2Q3DA 4F12A 2BFFA 1GRCA 1X86B 1ZD5A 5K99A 2VRCD 3C3YA 1V16B 3IPAA 4OY3A 4F3RA 2P9ZA 2PXCA 1AE1A 1GZ5A 4JUDX 4MVJI 5FNVB 3OHMA 3K6SB 1DXQA 1UBMS 1WHTA 2FPIB 3CUUA 4BBPA 1T9HA 2V8BA 4CEIA 13PKA 2O07A 4ZARA 1EUZA 3RVRA 4OHPA 1OLSB 3O2QB 5B1IA 2VDJA 2V4UA 2YQ5A 1PYGA 3RODA 1CWUA 3M6XA 4TM8A 4D9FA 4DMCA 4F0JA 1ZDMA 1OHHD 3DC7A 5FHQA 3DKKA 1S2DA 4CQJA 3SYLA 3JYNA 3W2GA 2XA1A 4EK9A 1BXKA 3NBUA 1O8CA 4O4IB 3CCFA 1TGVA 4IOMA 4QBFA 4BZWA 1W5TA 3ASYA 4QUEA 3WOHA 1ZIPA 4FOLA 4A0GA 3SMVA 4KIJA 2VUTA 3KTFA 2AFIA 5GJBA 1SHUX 3AEXA 2QMQA 4LS3A 2A67A 4DUPA 1KO1A 4EHAA 3DZHA 1QYWA 4KK4A 2DQYA 2OVBA 4S12A 4X6LA 2ZDQA 3U9SA 3TZHA 3LXMA 3RUEA 2NO5A 1RQNA 1YR8A 4X66B 1Q1AA 4OP3A 1P2SA 3LU1A 4ZI7F 3HXMA 2BE7A 1KNQA 3W4IA 2J9FB 4TVOA 4OHRA 3AERA 3SXUA 3D2AA 4EJMA 4QG3A 3NMUF 2Z3WA 4TKMA 1Y8ZA 1RSZA 4B74A 5KYUA 3FPEA 3ZWPA 1ZGZA 4XW2A 1I1QB 3QU4A 3R41A 1EJBA 1JTVA 5ESRA 2KI5A 2XTMA 1EM8A 2OILA 4E5VA 1NN0A 2Q9BA 2W2TA 2ORYA 3COPA 3ITNA 4RFSA 1C30B 1ISRA 1EXDA 4M0LA 4ALLA 4BXOA 3H17A 2V55B 1IBLB 1U6IA 1MTZA 2HQRA 3FZNA 1D2EA 2JGDB 3KHTA 1SD5A 2GPTA 1QZTA 2CXOA 2VH2A 5DNDA 1NRWA 3OAAD 4LNHA 3PNMA 3IJ5A 4RLSA 3L1VA 1ZCFA 3DDHA 3EXHC 5TMDA 3CR8A 5I7FA 3N1UA 1NZFA 2J6IA 2QORA 3V80A 2R4TA 3S1LA 2IYLD 4XARA 4Z54A 5IU6A 1XQWA 3BGOS 2FE4A 4MVWA 4MI9A 3SE0A 1K66A 5LYYA 5ADVA 2F1JA 4CTMA 5I3ZA 4GPBA 4PAWA 2NO0A 3T1YB 1A7JA 3CT6A 4BX8A 5B12A 1UF9A 3JPYA 2Y9PB 3TOSA 1XCMA 1E0AA 4MIOA 2OAGA 3PNVA 2HF2A 3H5IA 4MYDA 3AONB 1V11B 3H2JA 4CDMA 3AX6A 4CG0A 1K0UA 4PXAA 2L2QA 2W6JA 3MJFA 2EKBA 4KVZA 2L82A 3SICE 1XA3A 3W3AH 4ZGBA 5FBWB 4KQFA 2H52A 1X7YB 3AUYA 1FSPA 3C70A 1ZK2A 3QQPA 721PA 2Z56A 1QIHA 3GNSA 3LG2A 4XI9A 4DBLE 4YCNA 1R6VA 3TRHA 1H2WA 4L4YA 1V9CA 4M36A 5IVPA 2RK6A 4K26A 5JJLA 4O4JA 3A3KA 5E1DA 2WD8A 1XZDA 3I37X 2H2IA 4L07A 2HGSA 4IIGA 2X4DA 5HF5A 3KPYA 3TUIC 1ETHA 4YRTA 2WHPB 1VPTA 3E6AA 4ITRC 4J1QA 3R7WB 1WKCA 4H17A 4PCAA 1LDYA 2Q3MA 3OPYB 4RE6A 2C97A 3TTSA 1UT8A 3WMEA 1U1CA 2G1JA 1EDZA 2ZI5A 1I3KA 3PXEA 4BO6A 4QFDA 3M83A 4U7WA 1JMYA 4G1UC 4CWAA 2RHBA 2PIAA 4Q4LA 4Q34A 3WYNA 1UMCB 3RHZA 2FTKE 1DO2A 2CXSA 3LO8A 3QHPA 3W4KA 2YS7A 1I13A 1X2BA 3OE7D 4OKIA 3CONA 2IV3A 4BKMA 3SNKA 1U5AA 2Q5OA 4JXXA 2WSSD 3ED5A 4OBXA 1QYCA 4EO4A 3HA7A 4LHXA 5LDGA 2R1VA 4GMDA 3VNAA 1VP3A 5D3ZA 4AL4A 3HCAA 4P0TA 3N87A 2F6RA 3WLRA 1K4MA 1CR2A 1E6UA 3DBHA 4KKXB 5FI5A 4NQRA 3A36A 4U2EA 4UHHA 4F4FA 3I42A 2ZBUA 2J67A 1Y6QA 3CVXA 2IYTA 3OJWA 4F4JA 1EK5A 2P30A 2BSAA 1HRKA 4NZMA 2IGTA 1YOBA 2AK3A 2Y1CA 4HFMA 3GLFE 1VJRA 1G7CA 3BFPA 3QZUA 3QKWA 3RVNA 3COYA 2ON6A 2DKFA 3GZTB 2PT6A 5TARA 5BSWA 2R1VB 4PYLA 4ZT3A 3L92A 5JS8A 2GHIA 3DC2A 3PGXA 3TQCA 3R0ZA 2FDXA 3SSMA 4CIDA 2ZITA 1OD6A 1JAXA 3JASA 4Q3KA 1LKZA 4AJ1A 3GPCA 1H8HD 5M7EA 3BEOA 1FTGA 5KOHB 2O2JA 2QAIA 3I6QA 3N74A 3ORQA 1JNYA 1XP8A 4DLYA 3NBFA 3PPWA 2F1IA 3BS4A 1GL6A 3QG1A 1TU3A 1VKZA 4I1VA 4Y7CA 5JHGB 1TZMA 2Z98A 3CYFA 3FSJX 4EG5A 3WY9A 3GVXA 3I9FA 2YNMC 3OTOB 4ZZ1A 5JH7A 2FUCA 1EXMA 1U8AA 2QMEA 5L40A 3DBLA 1D2AA 3PHCA 5THQA 1J2YA 3LT0A 4ND6A 2GEUA 4WFQA 2J45A 3I3SR 3LGSA 2XCSB 4ZJYA 5FWAA 2F8MA 3E4DA 5HQ3A 1X15A 3KCNA 3W34A 1L4NA 1ZL0A 2H2DA 1A9YA 4EMBA 4LC0A 2XPCA 1TO1E 3EZGA 5HF6A 1AC5A 2XTAA 3AY0A 5JNTA 3TLJA 4BASA 5C2JB 3I2GA 2BRUC 4CV1A 3B82A 1LQUA 3OZ7A 2XMCA 3HCOA 1KSHA 4Q4JB 2E82A 3AEQA 1S02A 1CY8A 3DE3X 3GLUA 2XUAA 2G4VA 2C95A 4GHWA 4DIUA 3TRJA 3K70D 1ECBA 2AWNA 1WCIA 1JDPA 3TFOA 5FNVA 3K6SA 5JAUA 3PXDA 3K6JA 4PGMA 2RCYA 3MWLA 3WGTA 3WJAA 2IHUA 3I76A 3UPDA 4RUKA 5BV0A 1FFBA 3BSSA 3QX9A 3QTTA 2B2XA 4BP3A 1CHDA 2H51A 2ID7A 2P0EA 4OBBA 2VJYA 5J5VA 1PSWA 4QGSA 3VYWA 4J4BA 1YB2A 2R8OA 3QPWA 3V7NA 4B7UA 3OLCX 3HO6A 5SY4A 1UZLA 2FSHA 4PS1A 2IOQA 2OMKA 5FLEX 5LQNA 3BCUA 4L1KA 4FYJA 3GPIA 2EJUA 1DINA 3VGPA 3KXPA 5C1DA 5DIFA 1FLDA 4M99A 3R9KA 3RAPR 3TO5A 5TT0A 3WG9A 4Q4AB 4I9GA 1O4VA 3I6ZA 1OYVA 1GUFA 4HR7A 3JRWA 2TMGA 1AJEA 3V1NA 1A9OA 1Z9BA 3F8TA 5C7YA 5EZYF 5TVGA 3VU1A 1KS2A 1ZICA 3TMYA 4WN9B 3LI2A 4LCEA 3JVUA 2PQ0A 4Y8VA 1YR2A 4GQAA 3QYFA 1DRUA 3ECAA 3WI7A 1Y6GA 3BIWA 3SF8A 1MRZA 1O5TA 1YBVA 3PCRB 3HEAA 5TLSA 4G4SP 1NW3A 3LHDA 4MLPA 1E2DA 3R9IA 2NZYA 4D46A 1SK9A 1QLWA 1AUPA 4G65A 4PYRA 1XVLA 3HN6A 1N25A 1UQTA 1X77A 3CNBA 4UULA 5ADUS 3Q8KA 1D7OA 2EEZA 2ZBDA 3TAUA 2J3EA 3Q7RA 1JZSA 4P58A 3VM6A 4TTIA 4A16A 3WLEA 2OK8A 3GEEA 4UEWA 2IHYA 2VQEB 1O9GA 3OLQA 5FV7A 3TPCA 3V7FA 4R9RA 3VTAA 4G8JA 3LC0A 2NIPA 1VPWA 1X80B 2WA2A 3UG7A 3NXSA 1W73A 2DOKA 2RGCA 2Y05A 4TWBA 3IO5A 4M1YA 5CM9C 4Q00A 3I9V6 2ZIEA 3CBGA 4DCJA 2V96A 2WUVA 3CF2A 1NNSA 1ULBA 4QYTA 1X8JA 3I2YX 1RYDA 2V7UA 3C7AA 3K2EA 3M6WA 1GG2A 1P77A 1S8AA 4ND7A 2JLSA 3EXEA 3QV1A 1GQYA 4IZHA 4HHEA 1BKYA 3A0UA 4UC0A 3W78A 4B3FX 3EXAA 3K09A 1JQDA 4M2LA 4B3TB 1GU1A 2VKQA 2WD7A 4ENPA 1CUVA 1CE8A 2JS7A 2V0NA 1ESNA 4Y9RA 4M8IA 3UT6A 4DVGA 2N0SA 1GA6A 4DUYB 4PGAA 1TAUA 2RCNA 1Z35A 2A9QA 2NSDA 2BFOA 3PTZA 3TLXA 1O95A 2J3QA 4WFIA 4IIEA 1AKRA 1E3WB 3UMRA 1SOVA 4ETWA 1ZWLA 3U7GA 2PR7A 4ID3A 1Q84A 1RXUA 5TQ0A 5AT1A 3T1TA 1DS6A 1D9ZA 4JGBA 4RQBA 4YMGA 3RSFA 3T5MA 3IC5A 1MJGM 4X7BA 4IFIA 1NX9A 2NU7B 5IANA 1EBUA 4H18A 4ZVKA 2IV7A 3T5CA 4BZZA 3L3BA 1KS9A 2X8WA 1PYOA 3IMGA 3C1OA 3K31A 3ZU4A 2PL9A 4F3KA 3OF3A 4B4OA 3JSXA 1O0CA 2DLCX 5E9WA 1UR5A 3BZUA 3K09C 1XTUA 2I8AA 1RP7A 3CBQA 3NJ8A 1RPZA 1GL9B 4RMHA 1A8UA 3L04A 2VPYA 4BLUA 2ZUTA 1MAVA 2FQWA 1RP1A 2Z2JA 1X19A 4PYIA 2COEA 2H9AA 3EHEA 5KJEA 4BLPA 3QWIA 4L4SA 5A4MS 1CEEA 1JQ5A 4QHSA 4J7XA 1BDBA 2CK3D 4D43A 1YGPA 4BKPA 1SC1A 2X9NA 3G59A 5JRJA 1P1FA 4R2IA 2GZHA 3RQIA 5DM2A 3RYFA 4KYTA 4X54A 3DZ8A 4O2LA 2ZRNA 4IX1A 1P81A 5CB6A 3A3NA 2ZYTX 1GTMA 5KNDD 2CJXA 1PVOA 5ES3A 3GJSA 3M2TA 1WY7A 3RRBA 2GSWA 2WTNA 5FYQA 5FA6A 4FBMA 1AK9A 2HDNB 1ZUD1 5BSKA 2I5PO 3L1UA 3GLFB 1VYHA 3PLAE 4CMAA 4N0EA 2Z5GA 3GZNA 3OWHA 4C87A 4TVSA 2AGVA 4ANFA 4XXHA 4NBSA 1RBZA 4GYWA 4OGKA 3WR5A 3D6FA 1SKYB 4GGOA 3O4GA 1TC2A 4JGGA 4ES6A 2D7JA 4B2YA 2PMBA 1Z73A 4H7HA 2P91A 5A6SB 2Q2WA 2P5YA 4WZ6A 4WNAA 1CDDA 1J0CA 2B94A 2HUPA 2YIVX 1PR0A 4KO4S 2QUJA 4DUGD 5EJEA 3N8IA 5G0TA 3HCPA 4C6HA 1T8RA 4JN6B 1RRKA 2VA8A 3TTWA 5LYJF 2MINB 3C6ZA 2G88A 2DX7A 3LFHA 4JU8A 4PIVA 1P1RA 1SEPA 4R1QA 2YDYA 4IYJA 2Q0SA 5EUQB 5JXHA 2OCKA 3CEAA 4US0R 3O4RA 3ZD8A 3K70C 1NBME 1Y6FA 1BIFA 4R83A 2X2FA 1GU0A 1P62B 2O8NA 2RFLA 2MDTA 2Q8QA 4LF7B 4WNAB 1TU4A 2MIIA 1NPDA 2E9SA 2G28A 5LMZA 4B3GA 2VF7A 1PJRA 3ND9A 1U0JA 2BDUA 4HGOA 5FBLB 1CETA 1FLAA 4LY6A 4O5AA 1PZNA 5DWDA 4AWBA 1OH8A 1PFUA 3A4LA 4HH4A 3HC7A 4BVGA 3UATA 2D0PB 1JQBA 4MV8A 1D3AA 2WIFA 1TPZA 1QVRA 2FPKA 3NC0C 1U65A 2B99A 4Q4JA 5DYYA 3LT1A 1M6WA 1OV4A 1R16A 2AD1A 1IEQA 3G82C 3ZHCA 1O1YA 5KTPA 4BV8A 1A2BA 3WGLA 4EBBA 5FH9A 1EQ2A 4B3HA 4L8VA 1TDJA 2DFKB 4CPDA 4D3XA 3A6GA 4XB1A 5FUMA 5LKRA 2ENUA 1WBDA 3K5WA 4K1LA 1YL6A 1R0XA 1F51E 2QVCA 2HA2A 2VQ6A 4Y0AA 1ZHFA 2XMSA 2ZI3A 4B0PA 3BRSA 4B73A 2W70A 5JRDS 4F4CA 1KQFA 5FUVA 1EX6A 3MCUA 1YRAA 1BOOA 1BOFA 4UNQA 3ZE0B 1J70A 4YACA 2FCAA 3RARA 2F9FA 1LBEA 2O8DA 1O8BA 4PSDA 4QLAA 5HFNA 4BLSA 1P0QA 1FRNA 3N28A 3NHJA 2WYIA 4U4AA 4W5JA 4ZO9A 1TK3A 1TT5A 2QX8A 2XDAA 4G4GA 3K2IA 1W0KA 4HPJB 4BTVA 4F4HA 8ABPA 4CETA 2VKTA 4LJSA 2ORED 5IJAA 2YJ5A 1YA8A 3L0IB 3KEFA 3E9QA 3WIOA 4RJKA 4PEVA 3WGVA 3EGDA 2NU6B 3KJQA 3SKVA 3U4IA 3ANXA 4DS3A 1FJHA 3Q72A 4HCJA 2BTOA 3OTIA 2UVPB 5I9SA 3RFCA 2IXGA 4IUYA 2ZYRA 2CFRA 3A1CA 4KQWA 2Z04A 4FPXA 3LOQA 4J0GA 2WTUA 2VJAA 4J2HA 3M6VA 3H04A 4E2FA 4EPVA 1UODA 2QLJA 3CX4A 4HXGA 4E6PA 2ZRMA 3D3NA 1Y6ZA 1E2BA 1R0SA 1IY1A 5FT9A 4WL0A 3R6WA 3RRFA 1KPHA 4XWAA 3V46A 4LSWA 5FX2A 4QDKA 5KTMA 4TMZA 2UUAB 2FN4A 1PNVA 2AG0A 1E92A 5DGTA 5KKAA 4M1MA 3M9LA 3QGMA 1BN7A 1U9IA 1PWYE 3JQQA 1CF9A 1WPRA 2VTBB 1AURA 1GPNA 1N9KA 1HWYA 1YQWA 1Y4SA 4I4CA 1RXWA 4RO0A 1WIWA 1O54A 3U7QA 1QYXA 1R0YA 4HNAB 1HLPA 1MVNA 3KYDB 3PRHA 4UD2A 5BYKA 4NBWA 3MJCA 2O59A 4AJLA 1F4LA 1EWQA