1QHYA

Chloramphenicol phosphotransferase from streptomyces venezuelae in complex with atpgammas and chloramphenicol
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
178
structure length
178
Chain Sequence
b'MTTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQSAEGGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLDVLWVGVRCDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTHKESIECAWAIAAHVVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHLORAMPHENICOL PHOSPHOTRANSFERASE
publication title The Crystal Structures of Chloramphenicol Phosphotransferase Reveal a Novel Inactivation Mechanism
pubmed doi rcsb
molecule tags Transferase
total genus 62
structure length 178
sequence length 178
ec nomenclature ec 2.7.1.-:
pdb deposition date 1999-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07931 CPT Chloramphenicol phosphotransferase-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1qhyA00
3F5FA 3BBPA 1R5OA 1ZBDA 2CL0X 2XJ4A 4BASA 4ARZA 2IS6A 3WRYC 3U44B 1QVAA 3F3YA 3M0EA 2JJ8A 1BMFA 4BLRA 1PLKA 1ZW6A 1NN5A 5HCIA 5JEEA 4G3XA 4D0GA 3W9YA 1E2LA 1UBGA 5IF9A 2EFCB 2F1RA 3CNOA 3MJRA 4BGDA 3I4LA 4MUAA 5L8VA 3HP1A 3TW8B 4GFDA 1U9IA 4HUQA 2NIPA 4JZKA 2R65A 3NC0C 3SI7A 4AURA 1FNNA 5JFGA 2B8TA 3C8UA 1T9HA 4E03A 1N6PA 3ZJYA 2QENA 3FPAA 1D2EA 4LJ7A 1KSFX 3CH4B 3CB4A 3EW9A 1MRSA 3MRSA 3W5IA 4B3FX 3O8DA 5FBVB 2BJWA 2BIFA 5HTKA 4BWYA 2ZE6A 5DI3A 5FPYA 1XMSA 5J4KA 3NHBA 5AR1A 1FNMA 1RZ3A 1BYUA 2GTPA 4KYUA 5KPJA 4V0ME 4B47A 4BZQA 3K70C 2IF0A 4LBYA 5A0FA 1ESMA 2VBCA 2NO7A 3ZQ6A 4DCSA 2I3BA 1HE1C 4IOMA 2ZJOA 1S2MA 2A3RA 3C7KA 4JLKA 3TQFA 3B1WA 4YC7A 3C41J 5LB2A 5CK4A 1FMJA 2W2XA 2XZOA 1MO5A 3BFXA 1E2GA 5KHOC 2A7QA 4LHVA 2P2LA 2C03A 2JCSA 4GP6A 5JCZA 3UG7A 1RIFA 4I81A 4AG5A 1ZAKA 4JLPA 4M1YA 4DVGA 2ZYVX 2WM9B 5DO9A 1I4DD 2ZI7A 4PAQA 1U90A 3AB3A 3KJGA 5DE3A 4AWXA 5K8LA 1NBMD 3LXXA 3NDPA 3K70D 1KY3A 1G64A 3LDAA 1SXJC 3IIJA 5DLQC 1E9CA 2ZETA 1PUIA 4F4JA 3GLIB 2FMXA 2WJVA 4S2EA 3WYGA 2J0UB 1XXHA 1E2EA 2Q9CA 3B1VA 3ZVNA 5GADl 4B3GA 5SZHB 4CT5A 4EKDA 1XDBA 2WPDA 4L15A 2KWIA 4BEJA 2ZITA 2J9RA 3CX7A 4LJ5A 4URXR 5FFMA 1KOFA 4OJQA 4NBSA 1MH1A 4IVQA 4US2R 2OHFA 3MLEA 4BFZA 1XX6A 2QQEA 1CJKC 1ZM9A 1KIMA 2QTVB 5GJBA 4C30A 1W4AA 3U3KA 4QHTA 1JNYA 2O0HA 1P60A 3KB1A 4V0MA 3U7EB 1JPNA 1GRNA 2DCUA 2P6NA 2V8OA 1RRFA 3AKCA 621PA 3QXXA 2WIBA 3L82B 2GCOA 4RD4A 2P65A 4OBEA 1UFQA 1IN7A 2GHIA 1C9KA 3DL0A 2A9KA 1ZNXA 2DFNA 4B2LA 4NZYA 5D3QA 2OBNA 4NCNA 4LJ8A 2SHKA 3EASA 2AN9A 4FWIB 3RVBA 1RYFA 2ZPTX 3R9WA 3PUWA 2ZAOA 2QBYB 5KSZA 2C8VA 1S96A 2ZU6A 5A4JA 2YKGA 2AX4A 1TEXA 4PTLA 1H8HD 3T5DA 4GRAA 4C0HA 1MV5A 4RZUA 3AM1A 2QGNA 1QHSA 2J1LA 2HYIC 1DEKA 2N1BA 4MH0R 1PV4A 1HUQA 5TXGA 4BLSA 1CR4A 3D7MA 3GFOA 1UJ2A 2CL6X 4RD3A 4TL8A 3LVQE 1S4QA 3L0SA 1HT2E 4RCZA 1N6IA 1R0WA 3U7FB 2XSZA 4OHYA 1RFLA 2JJ1D 4TYPA 1OFHA 1CXZA 1COWA 2NPIA 3B5JA 4NHOA 1AGPA 4QFMA 4MYHA 2WWFA 3V4RA 3VR5A 1T4GA 3FMFA 1XPOA 1KO8A 2WV9A 5CIWA 1U98A 3K0AA 1KMHB 4IDHA 5DYGA 2BKEA 1E79D 4LI0A 2IX3A 3U6KA 3Q3JB 1Z8FA 1HQCA 5G3ZA 1FMLA 3QPUA 1KZGB 1J90A 5AJZA 2EFDB 5DHFA 1KO5A 3OIUA 3D3QA 3OEEA 2OCYC 4Q66C 3W6NA 4A2WA 3LQQA 4JKYA 4L4UA 1JR6A 2FGKA 4BLPA 1XD2A 1A4RA 4EUNA 1LW7A 2CDNA 1NJFA 4AKEA 5FBWB 4RKFA 4O0MA 1LF5A 3M6AA 2VHCA 4US0R 1BKDR 3LFUA 1E2KA 4DT1B 2KJQA 1PVOA 5L3SA 1OB5A 2FOLA 2QP4A 2W83A 4PC2A 3SJBA 5JSZA 1F5NA 5EQTA 4PSKA 4WA7A 1R7RA 3RRZA 1Z0IA 1HA3A 5AUQA 1ZRHA 2GEVA 4OQMA 2OILA 2VF7A 5EZ6B 1U8YA 2PMDA 1YR8A 3WNBA 5FI0B 3Q5EA 2XEXA 1E2QA 1LV7A 2ZAMA 2GZDA 4PX9A 1E94E 4LJYA 5JS7A 2QRNA 4F38A 1U94A 4NH0A 2XTMA 3THYB 8OHMA 3QVVA 1YZQA 2HCBA 4QM6A 3RS3A 2FWRA 3VNVA 5AJVB 3U5ZB 3CRVA 3EWSA 3U3RA 3DZDA 1OSNA 3GJ3A 4DLWA 1OE0A 1YJ5A 2AXPA 5FOVA 3P4YA 1YR6A 4GPTA 3U3JA 2Z0MA 2VHQA 2C9CA 2V7QA 4JBWA 5JS8A 1N6HA 1T3SA 1BMFD 4YLGA 4N1AA 5EP4A 1HYQA 1T8TA 3BJIC 4XVQA 4G1UC 2YC2C 4V0OA 4HZUB 4TMXA 2FX3A 4DLTA 2RAPA 4LGMA 3A4LA 1Q0UA 1YKSA 5TV2A 3A8TA 2IUSA 3U44A 1XTIA 2IUUA 1EESA 2FG5A 2O8FA 1RRGA 4TQ9A 3THXA 4FN5A 2H1LA 4Q1AA 2HEIA 5AUNB 2ZSAA 3X1ZA 1G8FA 4DDWA 2QMEA 2PT7A 1UKEA 2ZJ5A 5ELXA 2MSCB 1G18A 3ZD6A 2X8AA 2D4HA 1P6XA 3RS0A 2JJ2A 4LJ4A 3GLIE 3BH7A 1NLFA 3AV0B 3PITA 1IY0A 2ZRPA 4LWZA 5CDFE 5JWOA 1FPMA 1UDXA 1Z29A 3CONA 4P0TA 4BLQA 4TZ0A 3U61B 5K8IA 1ZC4A 5BYKA 1LS1A 2A30A 2ZIAA 2IYLD 2J3EA 1BO6A 1E32A 4BQSA 2IWRA 1W0KA 3I73A 2FSFA 2HT6A 1TQDA 1W4RA 4HATA 4H9GA 4P4SB 5EXTA 2LKCA 2W2TA 2JGNA 4M1TA 4ESVA 5DI9A 1N0VC 4TMKA 3FE2A 1E9BA 2QP3A 2WTUA 2DWQA 2ODWA 4IHQA 5JWRA 2ONJA 1YZLA 1M1YE 3UMSA 3FFAA 2GA8A 1RVDA 4LSGA 1M7BA 4MRSA 5DHAA 3SQXA 1M7GA 2OZEA 4TQUS 4UNNA 4C7OA 3N2EA 1JQLB 3GEHA 3EG5A 3F0TA 5HE8A 2XXAB 1OFIA 1RKBA 2ZS8A 2KE5A 4OJKA 3QKUA 2FH5B 1IY1A 5EXPA 1AS0A 1ZJ6A 2ZJBA 3DOEA 4U5XA 1SVOA 4AG6A 4UNQA 3JVUA 4M2LA 2W58A 2IW3A 1N2CE 3NEJA 1Z2CA 1S9HA 2WPDD 4CYMA 4A1FA 2HXSA 2GXQA 2AK3A 3DM9B 5EJEA 2FFHA 4CGZA 2YVUA 2KI5A 5FUYA 3BB4A 3MUFA 2ATXA 3FDIA 4UNPA 4CT4B 1VG0B 4PC7A 3GLIA 3C5HA 1N25A 2VIIA 2O8BB 4R98A 3GJ7A 1P2SA 4EPRA 4PPQA 1QHIA 2RMKA 1KNQA 2QPAA 1XTJA 4QKQA 3S1AA 3NBYC 2ATVA 3AEZA 3DMNA 4ACAA 1KI2A 5JJKA 4QBGB 3V4FA 4ILEA 1QRAA 4GSYA 4JSYA 3PCRB 4I1SA 4C0LA 3AGQA 5B30A 2GK7A 3DZ8A 2CHGA 1M74A 1G3UA 1A82A 1U0HC 3QE0A 3TNFA 1KK2A 5EP2A 4OK5A 1Z0DA 3CPHA 3REFA 2XGJA 2V9PA 1SKQA 3QIAA 4QGFA 2CLDX 2WMNB 4G5GA 4C4PA 3NBXX 1UAAA 1OF1A 4PANA 4UQOA 4AKHA 3FMPB 2RH5A 4ARZB 1GL9B 3EZ7A 2QSYA 5BW8A 2X2FA 2F9LA 2ZSFA 1TQ2A 1AM4D 2XSZD 3E2IA 1Q12A 2Q9BA 4QBHA 1IN8A 1DG3A 1G7SA 1Q21A 2W6IA 4C0JA 5H8WA 1SQ5A 2IEZA 1E9RA 1E4VA 1COWD 1NIPA 2FPKA 4P32A 2VP9A 4EFNA 2HDNB 3GLFB 4FCVA 1E1RA 1QHHB 1Z47A 2Z43A 1N5IA 1P9NA 5D3MA 3JZMA 2WICA 1NN1A 4B44A 1N6LA 1WE2A 2BBTA 4HUQB 3KKOA 4QRHA 1Z6TA 2GK6A 4EQ6B 2EWWA 3VNUA 5EE9A 5TMPA 3T1VA 2D7CA 1XCGB 1FTSA 4LJAA 1FP6A 3WBKA 1Q57A 1D9XA 3TSOA 3OEED 4LX0A 4PAOA 2PBRA 1I2DA 3LW7A 3SU8A 4BUJA 1T3LA 2QG6A 2WWGA 1E69A 2CMKA 2DWOA 3SS8A 5M04A 1KMHA 1TEVA 4QC2A 3O47A 1WXQA 2VP5A 2CCKA 2ZRHA 4Z8XA 4EPTA 1VKJA 2NMVA 4G5SA 1G4AE 2QPTA 4U7DA 3ZDQA 3UKDA 2PZFA 5BN3A 4H1UA 2ZRGA 4W7SA 4KFSA 2ZSEA 3GQBA 4Q5IA 2CE2X 3BAFA 5FUVA 1NG1A 4F91B 3C5CA 3NTUA 4WZAE 1GTVA 2IYUA 1S1MA 4MYCA 2E9SA 3RS2A 1GDDA 2NO0A 3H2YA 3ICQB 2ZREA 4GOXA 4KVGA 4NYMQ 1IN6A 5EE3A 2ZI4A 4RSGA 2OBLA 5DH9A 5JCPA 2EQBA 2JLVA 3K1JA 4JLDA 4Q4JA 4TLAA 4PHTA 3RS4A 1NLYA 3ETLA 3KXKA 2ZUCA 4Q1EA 4XSHA 1ZD1A 4DDUA 1OIVA 1YZTA 2ZRLA 4Q4AA 1TQ6A 1E99A 1K8RA 4R71A 4NCHA 2VPPA 2OSBA 4J0QA 4HDCA 3U6BA 2QGZA 1E0SA 4I1UA 2ZS9A 3TIFA 4B32A 1P9RA 4O2RA 4QM7A 1HY3A 3IBGA 2YOGA 3CUEF 3GEEA 5JI2E 5FTLA 1MRNA 2R6DA 4YMWA 4Q18A 1XXHB 2R6FA 2V7QD 4LV5B 1G7CA 1KSHA 2ZR9A 3AKDA 4K81B 3K0SA 4JL8A 1ZD8A 4BLTA 1L4YA 3GJ5A 4DLVA 4RJLA 1T0HB 1NY6A 4QJ5A 2Q9AA 2ZI5A 1MO4A 2F1JA 3AP1A 3AVYA 5AUOB 2GXAA 3OEHA 1LNZA 4WBSA 3CR8A 4I1OA 2F55A 1NKTA 4K46A 1OXSC 1ZU4A 5E7JA 2GCOB 3C4JA 4E09A 2ZE7A 2EFGA 2G3YA 2E1RA 4JS0A 4MKGA 4WOPA 4ZV4A 3T5GA 3OE7A 1N6NA 2JJ2D 4QL3A 1YR7A 2FEOA 4HAZA 5CJPA 5KNDA 1KI8A 5FH9A 4JVMA 3H1TA 2WJHA 4LJ9A 5FBRB 2XAUA 4EPYA 3ND9A 1II0A 1XMJA 4PXAA 1DAMA 4Q7LA 3I5YA 3VR4A 1W0KD 3AF2A 1NLZA 5CM9C 5FTKA 4RZXA 1X1SA 4XSGA 3HU3A 2GCNA 4TL7A 4GMXA 1TL7C 2CCGA 1IJEA 2FZLA 4DXAA 1E2IA 3E1SA 5H1YA 2YZ2A 2ERXA 4HDOB 2ZJZA 1H8HA 1UF9A 1L7VC 3QENA 4TMWA 4KFRA 1F6BA 3LLMA 3HR8A 1TU3A 3IIMA 4MGIR 5E7MA 1OH5A 3EARA 1JJVA 1GITA 1E3MA 2XTNA 2EWVA 2GZAA 2G0NA 4S35A 3K0AB 4KSBA 2H92A 2ZANA 3DMDA 521PA 4M1KA 1QDEA 1WRBA 3PUYA 2EVWX 3QKSB 2R44A 1OYYA 2CBZA 3B85A 3WMGA 1D2MA 2V3CC 3TKLA 2ZJYA 4IXNA 4IVPA 1K5DA 3OIYA 4DHEA 3ECCA 3R8CA 1XD2B 2VTKA 4D0LB 3T12A 4ABYA 5DNYB 1ZMXA 1G291 4JLBA 2ZI3A 3IPXA 5E95A 1Z6YA 2W0MA 2WKQA 3LY5A 4R7ZA 1G7TA 1W47A 4MYUA 2GJSA 4HYYA 3P27A 1E9FA 2FFQA 5JSZB 1CJMA 1KSGA 3GLFE 2VYFA 5H68A 3ZGXA 3CBQA 5DIFA 5IDVA 3TSZA 1XB2A 1VTKA 3IO5A 4AYXA 3BH6A 1CIPA 2GF0A 4AI6A 1Z28A 1TTTA 5HR5A 2QI9C 1MO3A 1ZU5A 4GI7A 1GL6A 2QEQA 4TT3D 1N3BA 3IPYA 3CRMA 3P4XA 2HUPA 4FCWA 4QNMA 1ESNA 4G5OA 5EP3A 5FOTA 1F2TB 2ANBA 2QN6A 2WOJA 4PZLA 2FDCA 1CJUC 3L0OA 2J5XA 1M6NA 3CM0A 5SZKB 5F98A 4C0QC 2FFBA 1GSIA 2C5LA 1ZM3A 4E22A 4W9MC 2CHQA 3K0EA 1JR3E 2IBMA 4UNRA 3SYKA 3R9XA 2PJRA 3UMRA 1ZIPA 1UBFA 2W6ID 3B82A 3UWOA 4B34A 3CW2A 4NYMR 2QE7D 3DKPA 4JYCA 4EJSA 2VSXA 1E1RD 1ZYUA 3EXAA 1YZUA 3PUXA 4NCKA 2N42A 2GRJA 3CZQA 3EC2A 1Z6GA 3QY0A 4OHWA 3TSWA 4ZDKA 1OKKA 3I62A 1JEDA 1SZPA 2IYSA 2O8FB 1ZD9A 4NE2A 4JJZA 3THXB 2VEDA 2ZEJA 2IYYA 2F3TA 4FD2A 4H1VA 2DWPA 4ZCIA 1NMZA 2PEYA 4V03A 3LW8A 5AUPB 2RGGA 3GLFA 3H86A 1QHHA 4OI2A 4Y0AA 3SJZA 3EAQA 2QAGA 4K8OA 1RRPA 1XXHE 5B64A 3DOFA 4GBMA 2XITA 4U02A 1IAQA 3QEOA 3SJCA 3SQWA 2J7PD 4V0LA 1TUEA 1W4CA 4EQ6A 1SULA 4MRVA 1OW3B 4TL6A 1DPFA 1ZCBA 5F2EA 1KK1A 5UKDA 1T0JB 3TQCA 2BCJQ 5JI3E 4PO9A 3DHWC 2CLCX 4IOJA 4A2QA 1FZQA 1MABA 4C0SA 5HZHA 1OXTA 1UKYA 3W3AA 1NL3A 2DHRA 4PC1A 3WP0A 1KSJA 4DEXA 3I5XA 2NZ8A 4L16A 2P5SA 1RYHA 5LB4A 2HF8A 3ASYA 4GDFA 1KI1A 4P4UA 1JR3A 2PZGA 3BB1A 2BCGY 3QXJA 6Q21A 4C7OB 1JBKA 2H57A 2C2HA 1XZQA 4DLXA 4A8JA 2R8RA 3OFNA 1GVNB 4ZI3A 1X8JA 3GP8A 2FN4A 2RGDA 1OFUX 2R2AA 4M8NE 1W46A 2EYUA 4OHXA 2NPFA 4Q1DA 2RKOA 1PLJA 2GNOA 5CJ2A 1R0ZA 4OL0A 4B71A 3GJ6A 4G5RA 4HLUC 3TVDA 4M21A 4IOKA 721PA 4MQBA 1E0AA 1GRQA 2YWFA 1GKYA 1ZIOA 1KJWA 1ZUIA 1TPZA 1OB2A 4LV8B 4DSNA 3O8CA 3OEHD 4AD8A 2LWIA 3HR7A 3FHOA 1IXZA 4Z1MA 1OXXK 4DWJA 3QBTA 3VKGA 3BK7A 4LYFA 4JVSB 4FWTA 3TUJC 1ZUNB 1XTSA 4C0AC 1GKUB 3S1AB 2LCFA 4D4KA 1OIWA 2FF7A 3U2QA 1NVUQ 3OE7D 4ERNA 1Z63A 2D7DA 1JPJA 2ZROA 2FGJA 4W5JA 4CRWB 1KI6A 4JKIA 2GWHA 1I4TD 4LV6A 4V0KA 1TF2A 1KMQA 3QQ5A 3QUSA 3VU9A 4XWKA 4E5UA 1NVXQ 3PEWA 3WMEA 4EIWA 2XOKA 4MDEA 2AWOA 2KBEA 4PPGA 3GLHB 3KZ1E 4GNKA 3QKRA 5FBQB 4RD0A 5FR1A 1G3MA 4WXPA 2HJVA 2G9NA 2GJAA 2ZE8A 4EFMA 5AJYA 1VHLA 3VR6A 2QNRA 1UKZA 5HKKA 2OFOA 1B23P 1FL9A 1UBEA 2OE2A 2H5EA 4EPVA 3PEUA 3MWKA 2KSQA 1DVRA 1Z08A 4MGZR 3T1OA 5JHHB 1SHKA 2BKUA 2BM1A 4HLCA 4Q01A 5D3MB 3LNCA 1E0JA 1XF9A 5TDHA 2N46A 4PC6A 3SDZA 4NPHA 2OG2A 3W34A 1U8AA 3WNCA 4DB2A 3KQKA 1X8KA 2YJTD 1OXVA 2JA1A 2WKRA 3ZZUA 5C2JB 4Q7KA 3EC1A 4QGHA 1KI3A 3PEVA 4ZCLA 1XTRA 3A1VA 4YDHB 2K5UA 2OLJA 1AJEA 1DAFA 2F3RA 1WCV1 1YZNA 4MRPA 4GP7A 5BN4A 1KHTA 1Q1EA 2A5DA 1J99A 3DO6A 5KNCA 2V55B 1FTNA 2OAP1 3DVLA 3SNHA 1E2DA 3QXSA 3ADDA 2VO1A 2XZLA 3MG9A 2H8KA 1GFIA 4JSTA 2QMHA 4PFSA 2QM8A 1XRJA 1TX4B 2PZEA 3QKSA 1OH7A 3OAAA 1U2RA 1X8LA 3JVVA 3MCAA 2VH5R 5DISB 3TK1A 1N6KA 3NBFA 5FPKA 1GNQA 2RCNA 4Q4HB 4Q4JB 1CR1A 3VTKA 4AKIA 1E2PA 3IILA 5G53C 3LLUA 3NHAA 4Q4AB 3CLVA 1R10A 4TL9A 1W36D 2JIZA 1AZTA 4B3BA 1R0YA 4QHYA 2EFHB 3QKTA 3ZS9A 3BC1A 4Q9LA 4DSTA 5EXXA 1NVWQ 3QG1A 5CLQA 2ZRMA 3NDBB 2R6AA 2BEKA 4KVAA 2O0JA 1GAJA 1OV4A 3BFKA 3CRQA 4DSOA 1NVVR 3PENA 3BORA 2GKSA 5KSYA 4DB4A 2MSDB 5TVKA 4CEIA 4Q02A 4BRWA 4ZIRA 1F2TA 2ZXUA 1U9IC 2RGNA 3HYRA 3OF5A 4TMZA 3TVTA 1YE8A 2AD5A 1KK3A 4PZYA 4AKGA 4CIDA 1XJQA 3ZIAA 3FKSA 4YXWA 1E0KA 1P7CA 5C46F 1E9DA 1OKKD 5LPNA 4V0NA 2F43A 4O25A 1OH8A 1XEXA 2PT5A 1TMKA 1ZP6A 4DEYA 3KKMA 1A5TA 4ITRC 2EW1A 4KFTA 3K0CA 4TLEA 4KU4A 1GKIA 3DDCA 4BFXA 4AC9A 2VHUA 3AF0A 1J70A 4DUGA 2ASEA 3EA5A 3CH5A 3DEFA 3GFPA 3LRPA 4AY2A 1Z6AA 4B3DA 1AQYA 4QXAA 3TR5A 4B48A 1VIYA 2VP2A 3EWAA 3ZS8A 1KDRA 1IONA 3BWDD 4NKRA 3ZVMA 3LQRA 3MAAC 4GOKA 1RPZA 4URUR 2QT1A 3MMPA 3QPVA 4KO8A 5BXQC 5K8TA 2QRZA 3FOZA 2IA5A 1NY5A 1E2FA 2ZRJA 3K0FB 4KODA 3TMKA 1R6BX 3OIWA 3NXSA 1W49A 2NOAA 2QAJA 3DKVA 2I1QA 2H16A 2P3SA 4LOAA 3K9LA 1AS3A 2CXXA 2QT0A 1JR3D 3GJ8A 2CLSA 3P26A 3M1IA 3EIEA 2GEDA 4E07A 2IS1A 3AF1A 1J7KA 1CJVC 1H8EA 2NTYC 5LD2B 4KFUA 2OV2A 2IHYA 3GJ0A 4HSEA 4NL4H 4QNRA 1X1RA 2QROA 4CDGA 3B13B 2IYRA 1W2GA 3DM5A 4HAVA 4Q1FA 2Q21A 3OFND 3TW4A 3ZVLA 5L3QB 5JRZA 3NG1A 1XFAA 4ZKDA 3CNLA 3PQCA 1SVLA 1VDZA 1X3SA 3NWJA 2NO1A 3GLHE 1EWQA 2ZRBA 3K09A 3AVTA 2IC5A 2ZVQX 5LDDC 1KK0A 2DFLA 3HWSA 1G5PA 3X1DA 1CULC 4GZMA 2WJYA 5E3HA 3NVAA 4Y0VA 4ACBA 1YRAA 2BMJA 4A82A 1GRRA 1E2MA 2KBFA 4NCJA 2OEPA 4TLCA 1W5TA 1Z07A 3SFZA 3WRXC 3CX6A 4B74A 2BWJA 4Z1MD 1IHUA 3P1JA 1SHZA 4DKXA 1VYTA 1O3YA 2OFXA 3N70A 2REBA 4IRUB 3KQUA 4GOJA 4DLZA 2IYWA 2WVJA 4MKIA 4JBYA 2QZ4A 3BGWA 3H0KA 1HT1E 4L9SA 2WAYA 3KUDA 5P21A 3UMFA 3T1TA 2BBWA 1P5ZB 4NTZA 2R62A 5AK0A 2GVDC 3QF7A 4N3NA 4TQAA 1SGWA 1ZNWA 4G0NA 3U3OA 2PCJA 4A36A 1W36B 2QMOA 3TAUA 2ZRFA 2XOKD 1YHNA 3NKVA 1N6RA 1P2TA 4BRUA 3I3SR 4TT3A 3EPKA 2IHBA 4BFSA 3VKWA 2XNSA 3CF0A 1JAIA 5KDLA 5HKKD 2D06A 1VCMA 2A78A 1HQYE 3AVQA 4DLUA 4D4LA 5GJCA 2OFWA 3AKEA 2OXRA 3RDPA 3B1XA 4HLQB 1M8PA 3UK6A 2ORWA 3L0PA 4BFWA 4EJSB 2ZE5A 1IOZA 4NYJR 4Q1BA 4Q47A 1KGDA 2ZYTX 3GLHA 4BEBA 1DOAA 2ZJ8A 2X2EA 4F92B 4GMDA 2YOFA 5LBIA 3UXMA 1YRBA 1O87A 1P2UA 2IS2A 4LPSA 1AGRA 4BZPA 3T06B 4QGAA 1IXSB 3X1XA 5E4FA 2JLQA 1XPUA 5DGXA 3NEYA 2QTHA 1AQUA 2QE7A 1LB1B 1II9A 1EGAA 3B60A 3B2EA 2HCJB 1BOFA 1WBBA 2QAGB 2E87A 1KKLA 2B92A 1BYIA 3QXCA 1DAKA 5FOWA 2FEMA 3E5HA 4RY2A 1Q44A 1GUAA 1WA5A 1JAHA 4NCIA 4B76A 3U4QA 2IS4A 2DFKB 1US8A 2AL7A 1SVKA 3RAPR 4IXMA 4KBFA 3HU2A 4UXIA 4A0GA 4UXJA 3OAAD 1G8GA 3LA6A 4A6XA 2ZQ5A 4BFTA 3RRMA 4Q4LA 3CWZA 1MABB 1ZNZA 3AGPA 2CE7A 3MGCA 3K53A 4JYBA 4Q00A 4ZO4A 1RRCA 4XH9B 3B6EA 4FMCF 4X8OA 1G16A 2J7PA 5J4YA 4LY6A 4M9SA 3A1SA 1A2BA 1DO2A 3LWNA 5JJLA 2VP6A 4LC1A 1E98A 2JIZD 3VMFA 2OCPA 2F6RA 1B0UA 2Z6VA 3OHMA 3VR1A 3AVPA 4KCGA 1IQPA 4A8JB 1DAIA 2VQSA 5IT5A 4B3XA 2NG1A 3IO3A 1EFRA 3BXZA 1T3HA 4Q4HA 2ZSBA 4LHXA 4TTRA 4B43A 3CR7A 2AK2A 1JXOA 4M1MA 3TRFA 1G19A 1NJGA 5F9HA 4US1R 4D25A 2ZM5A 1CRPA 2IWHA 1HEIA 3PFIA 4TYWA 4D82A 4Z8YA 1XMVA 3R7WA 5JLJA 5KOYA 1P9WA 2O8DA 1Q3HA 3ADKA 4MGYR 1EWRA 1E6CA 2Z4RA 3ZIAD 3FKSD 4YXWD 2DY1A 1E9EA 4PSVA 3A6PC 1SXJE 2FJUA 1OIXA 2PCLA 3X1WA 1G41A 2JLWA 3VKHA 2F1HA 3IEUA 4D2IA 2J46A 2A2ZA 3QVUA 5JJIA 2WIAA 2MMCA 4BE7B 2ZJ2A 1N5LA 2PX3A 4LRWA 2ZUBA 3LBHA 1Q1ZA 2QY9A 1XEWX 2H18A 1ZUHA 221PA 2DBYA 1S8FA 3R9IA 4DUGD 3LAWA 3IEVA 1JQJC 1RJ9B 4IFEA 1VHTA 2ZR0A 3GD7A 3ZQJA 1KI6B 3W3ZB 3H84A 1G3RA 4M53A 1OYWA 1EXMA 2IUTA 2BBOA 1E96A 1S1CA 1E2JA 1QHNA 3WY9A 3KXLA 1VCNA 4N0EA 3VU9B 1KI4A 4XD7A 5C18A 1GZSA 4FXPA 4XIGS 1OXUA 3U60B 3CO5A 4KAXA 4N0DA 5AJXA 4HZIA 3J81k 4RVCA 1TQ4A 3ZVRA 5F9FA 3QKRB 4LBVA 4FINA 3RWOA 3RYTC 4I1VA 4DDVA 4B2IA 2FE4A 1XJ0A 4C3ZA 4JT2A 4W5HA 4WZBE 3CRW1 1QHXA 3K09C 4OQFA 5A5GA 2HLDA 4OI0A 3IQWA 4GZLA 3PEYA 1P2VA 3UATA 2RGEA 1GG2A 4DLRA 5FUXA 2JLSA 5IK2A 5GJVC 4W5WA 5B58C 2XZPA 5FL3A 1H8ED 2O0KA 3MWJA 3G82C 3VAAA 1UEJA 3K0FA 2AXNA 3FGNA 2Q6TA 5IHPA 2UKDA 1XD8A 1ONBA 2DR3A 3GEIA 3EPJA 2IYTA 3P20A 5B2ZA 3M4YA 2EFEB 2C99A 2V54A 5FOSA 1S3SA 2B7CA 3B9QA 4LK2A 3TLXA 1GM5A 1HTWA 1SXJA 3BFVA 4LZZA 3ICEA 1G8HA 4PZZA 1UM8A 4Q19A 2ZI9A 1CLUA 1R8SA 2VP0A 3AUXA 1FOEB 2ZYWX 2EU8A 4DRZA 2GJ8A 3AKYA 1D8TA 4IJMA 4OKSA 5JWHA 3WNDA 5KDDA 2BJVA 1MT0A 2KB0A 2C77A 2YC4C 5L3QA 4A92A 4B6FA 3WYFA 1U8ZA 2ZU0C 3X2SA 5KSOA 5BWMA 3ZLJA 4ZDWA 3AVWA 4IEIA 3QNUA 2J41A 4HAUA 1GNRA 2GBLA 4MGKR 2Y8EA 4CF7A 1YVDA 3N2IA 3D31A 1LTQA 2PL3A 2XJ9A 2PH1A 3FKQA 3LD9A 1UBCA 3QF4A 1G5RA 2GVZC 4BZXA 1DO0A 2B7BA 1KI9A 3CWQA 1ZINA 3KDSE 3L0IB 1ZC3A 4MITA 1TF7A 4G01B 4QJ3A 1II8A 3IGFA 2FSIA 4QGGA 2WWWA 3C16C 4IKEA 4DCVA 3I61A 1XTKA 4CEJA 4P3YA 3CX8A 1UEIA 3HU1A 1Q20A 1Z06A 1Y63A 5TY0A 3RC3A 3EZ2A 4HDQB 3TH5A 4IEEA 3VHLB 5HZKA 1DAGA 1WMSA 3QG5A 3GCGA 4P33A 3VR2A 2GILA 4CEIB 4A0HA 2ZSDA 2FPLA 4PO8A 1KDOA 2DB3A 4ZIRB 1IN5A 4QG7A 2BEJA 1KDTA 1YZGA 4IDOA 2BVNA 1BH2A 1KI7A 5BQ5A 1PZNA 1R5BA 5FPHA 3A37A 3HJNA 1W1WA 3QXHA 1DAEA 4RD1A 4YMTA 4WIAA 4M1WA 1G21E 3LX8A 2F43B 3RS7A 2ZRDA 1M2OB 3A58B 3EPHA 2JATA 1CR2A 1XEXB 2RHMA 5EZ5A 3RNLA 2B8WA 3RS5A 3TAHA 4KITB 2CK3A 4JIMA 2WHXA 1LVGA 1E9SA 3TBKA 1VG9B 3UG6A 1D2NA 2JLZA 2J0SA 1JEEA 3L2OB 5KSPA 1N0UA 1DELA 2PLFA 1IN4A 3EA0A 3SR0A 1N0WA 4XVRA 5FOUA 1NF3A 5JEDA 1GP2A 2VLIA 3F8TA 3FWYA 1A2KC 2VSOA 3LBNA 4HB4A 4TSFA 5G3YA 1AZSC 5CIQA 2UZ3A 1G17A 4Q9JA 2FU5C 3ZYCA 1Q22A 4DIDA 4FW9A 3Q7PA 4ZI2A 1K5GA 3KKNA 1HE8B 4Q9HA 3BE4A 1HH4A 3P32A 3ZZTA 5KPDA 3BH0A 3NBZC 4WW0A 5J40A 3RSLA 1EFTA 4PAMA 5FPTA 3QSYA 1Y3AA 4JT4A 4Q48A 4WXRA 4IVRA 3WP1B 1CBUA 4PQRA 2JDIA 2VRWA 3SE0A 2EYQA 4TMVA 1SVMA 1QZXA 5F3WB 1KY2A 2GAOA 5CM8B 3UANA 5EUQB 2MSEB 4PR0A 2BHRA 2ZJAA 3RWMB 1E9AA 1NVVQ 3SJAA 2CL7X 4TMTA 4AYWA 1P4SA 4C0KA 3SOPA 2IXGA 1XWIA 3T34A 3BRWD 4DCNA 2WMOB 2VSFA 4C0BA 2BC9A 1NN0A 3C15C 4DCTA 1X6VA 4QHSA 1TUIA 1XPRA 4LHYA 2FSGA 4NU0A 4JL6A 1EFRD 1PJRA 1L8QA 1LF0A 4URWR 4MRNA 2REXB 2OO7A 2OAQ1 4GT1A 2QTFA 2AFHE 3OIVA 2AKAB 3W5JA 3B78A 3BOSA 1J8YF 4B3CA 2IK8A 4JLVA 2IT1A 1P62B 4KJZA 4UKDA 3EX7C 3SC3A 5H70A 4WZ6A 2CEAA 2X1VA 4AK9A 3V9PA 1AS2A 1TF5A 3WXMA 2FNAA 2GETA 3CIOA 2IXEA 4AYTA 5C1BA 3WBJA 2ZRNA 2OXCA 4LHWA 4CEHA 2HXYA 2ZUDA 1G9XA 2VHJA 2IF2A 4MUBA 3RRNA 2G1JA 3KJHA 1UPTA 3SYLA 1IXRC 3EZ9A 2Z83A 4HB2A 3PJRA 2HJGA 1F3OA 4A0FA 1F2UB 3A1WA 3O8RA 2A5YB 4XWAA 2GAAA 4TYYA 4UNSA 2C78A 3KQHA 4Q7MB 2IXFA 2YWEA 3UIEA 4YMUA 4XD7D 1L2TA 3MWYW 2WBLC 2WZQA 4RFVA 3NH9A 2GJ9A 4DLYA 3T35A 1P72A 3VR3A 5SZIA 3KFVA 1J8MF 1J2JA 1TNDA 1RJ9A 2JEOA 2I1VB 1JALA 2G1KA 3EZFA 3B7GA 2ODNA 5KO2A 1D5CA 4ZDJA 2ORVA 2GZHA 2HLDD 4JLMA 1NMYA 3VQTA 3N5CA 4TWZA 5LD2C 3MWLA 1P73A 4FI3C 4M1OA 4IFBA 1OJLA 4RCYA 5J4HA 2LKDA 2W6JA 5J5CA 4BECA 5IK2D 1T6NA 1XTQA 2CNWA 2J7KA 3W90A 3UPUA 5CLLA 2BMDA 2GBLC 5AWFC 1VPLA 1Z3IX 3THOA 4A4DA 4D4JA 2J87A 2ZYUX 3H4MA 3KTAB 5DN6A 3SYNA 3B8HA 1SXJD 3LXRA 1KAOA 2C04A 1ELOA 1ANKA 4LHZA 4BFUA 2YV5A 2G88A 1E2NA 4V02A 1V43A 2C95A 2D2EA 3HPQA 2GESA 1E1QA 1LS6A 4PC3A 5JMTA 4L5BA 5JECA 5TB5A 5FOXA 3KJEA 3VX3A 3WHLA 1Z0JA 2J59A 1NNEA 3U4QB 2C9OA 1XP8A 2REOA 3FTQA 4RD6A 2O8EB 1T5IA 1US8B 3SFVA 3VFDA 1OH6A 4DJTA 3FYHA 4NONA 4P4TA 3SN6A 4OK6A 1WBDA 3E70C 3FHCB 2WSMA 1E2HA 2WJGA 1MKYA 4LPKA 4XVUA 1Q3TA 3GLGB 4JMPA 2ZTSA 1W36C 4DDTA 1ZM2A 4R2HA 1Q1BA 2BM0A 3CZPA 3RABA 2IYQA 2GJKA 5B57C 1GL7A 3T61A 3GFTA 4M9QA 2QA5A 2IYXA 3PVSA 1SVWA 5KNBA 3EZ6A 1N5KA 2CJWB 4RFSB 2PLRA 3Q85A 1P61B 1ZM4A 2WWYA 2O8CA 3THWB 4NYJQ 2P6RA 4DZZA 4EJSC 3AP3A 4UXHA 3U7HB 2P67A 1OT3A 5E7IA 4PQFA 3I1FA 4LUCA 4KBGA 3CKLA 1KO7A 5JRJA 2O8DB 3R7WB 1BS1A 4M4SA 4C2TA 3TR0A 2YWGA 3HPRA 1T5LA 3T1QA 3U7GA 3W8RA 3AVXA 4IDNA 4POAA 3RANA 1Z6XA 4Q03A 3LX5A 1CJTC 2AD1A 2WSSA 1C1YA 2XB2A 1HV8A 3C14C 4A0RA 2QAGC 2RHDA 2CK3D 2VHTA 5DYIA 1EFHA 3AP2A 4II7A 2GEUA 4ZPXA 3ZD7A 3BD9A 3LH5A 4ZDIA 2WWXA 1S0UA 4Z54A 1Z22A 4RZ3A 1ETUA 3PV0A 2GDJA 1WF3A 4TSFD 3TUZC 2OESA 1NSFA 2Z5FA 2QSZA 2ZRCA 3KB2A 4JL5A 4MKHA 1EX7A 1YR9A 2NGRA 4AIIA 1T8UA 4ON9A 3QPWA 4LYAA 2AR7A 2WOOA 2MMGA 2X77A 2JASA 4EAQA 2ONKA 5GVRA 1GWNA 3CRRA 2DYKA 3EIHA 3WHKA 1IY2A 3ASZA 4RKEA 3K70B 4M9XA 4OI4A 2QP9X 5EE1A 4TYQA 2CCJA 3KJIA 2PEZA 5CB6A 2JLUA 1G3IA 4Z51A 2RGXA 1R2QA 2GF9A 2JDID 4JLJA 2DPXA 3LVRE 4U00A 2QPOA 3U3MA 4ASUA 4LDJA 1LY1A 1T91A 4ZKEA 4A6PA 3EIQA 4YMSA 4A8JC 1UDWA 3CF2A 3K9NA 4MDFA 5C4GB 1FX0B 2NQ2C 2XX3A 2WWHA 1V5WA 5KTYA 1HURA 2A5FA 3FB4A 1OFTA 4TZ6A 4URZR 1Z2AA 1VG1A 1G8PA 4JBXA 1E4YA 1X86B 4CZ2A 3NH6A 1U81A 3SBEA 4BFYA 1XCMA 2P5TB 3MJHA 4TLDA 3REGA 1SXJB 4NP6A 4D26A 1NSTA 2HYDA 5EE0A 4I4LA 1CS4C 1AKEA 4M22A 4B35A 2NZJA 1XMIA 1GIAA 1KJZA 2ZRAA 1G7RA 2J0QA 4PQYA 5BYJA 1NP6A 4DCUA 2GCPA 3LV8A 4YQFA 4Q21A 3FMOB 4FMCB 4YMVA 4X8HA 2R9VA 1Q1QA 3Q72A 2OLKA 2IEYA 4R9UC 4LYHA 2ERYA 2R6CA 4JLOA 3QF4B 2O52A 1OHHA 2L0XA 3X1YA 4HLDA 1XEFA 2AWNA 3Q7QA 4D0NA 1WB9A 5FL7A 2V6IA 3AVOA 4TLBA 5TARA 3AVVA 4PHHA 1II8B 4HUTA 1BIFA 3Q9LA 5HE9A 1RE0A 4HEJA 3RRYA 4IW3B 3SZRA 3D6TB 4CEJB 1G6OA 4DLSA 4Q7JB 1P3JA 1ZCAA 2XB4A 4JJKA 5JZVA 1CKEA 4PHGA 3KQNA 1F2UA 1QG2A 3SEAA 1AN0A 4RD2A 4IDPA 3GPLA 3GJXC 3IDQA 2WJIA 2WKPA 1YQTA 3K8YA 2HF9A 1JXMA 4OYHA 5FBLB 1CP2A 1KJYA 1Z0KA 1FUKA 4IDQA 1DADA 3NC1C 3IIKA 2AKYA 1W0JA 2W6JD 4QBFA 3W6OA 1SKYB 2XNDA 3GLGE 1QHGA 3TE6A 2PMKA 2GXUA 821PA 2H17A 1U0LA 4KHZA 2OCBA 1S9DA 2ODBA 1QVRA 2QL6A 3OZXA 1KTVA 2V1UA 2CNWD 1D9ZA 1G3QA 3O8BA 1SVSA 4OK3A 5KUTA 5J47A 3QBVA 5CITA 1OLOA 5DN6D 4JVLA 2H7VA 2J0UA 2O5VA 1S3GA 4WVFA 2OT3B 3BS4A 5JHGB 1G20E 2B6HA 5CDFA 2Q3MA 5FTNA 3BB3A 4A15A 1QG4A 1D6JA 1E1QD 4M1SA 5KYKA 1EK0A 3IHWA 3BERA 4NYIQ 3IHLA 4A2PA 2V4ZA 4FCTA 3ZH9B 4JLAA 1Z0FA 1N5JA 4C9BA 3V00A 2HT1A 3UWKA 1G1MA 3KTAA 3L43A 4CW7A 2CVFA 1JB1A 1QBKC 2WAXA 4NDZA 1GILA 3D8BA 1QF9A 5CB8A 1A7JA 4TN1A 3KFXA 1NMXA 4KV9A 2ODEA 3RC8A 3R20A 2PX0A 2YINC 4M0LA 2W2VA 2RGAA 4CVNA 5FI1B 3A1UA 3A4MA 2C9YA 5GJWC 1TADA 2O8EA 1DTSA 1YU9A 2FV8A 1FQJA 2QBYA 1FFHA 1ZVQA 5CYPA 4LBWA 4G5QA 4HAXA 4OHZA 3G5UA 4LCBA 2UVQA 1LFDB 2D3WA 4YONB 2YWHA 5C4MA 2X19A 3IQXA 3TUIC 4WAUA 2WJJA 2ZVPX 3LO5A 4XTCS 2IL1A 4TTQA 4XJXA 1XBTA 3GLGA 1KAGA 1SVIA 1W5SA 4XWOA 4JVNA 2RGNC 421PA 2F7SA 5FR2A 1N6OA 4FIDA 1TU4A 2AFIE 1NBME 3PUZA 4MYTA 1JI0A 3BIFA 2NO9A 3W6PA 4O3MA 4DSUA 2YOHA 2ZI6A 3KKQA 4NMMA 1IJFA 2VA8A 2Q3HA 2YNMA 3JZAA 3A4NA 1ZNYA 3TGPA 3WMFA 2CJWA 4QJ4A 4RFSA 1YZKA 2W0SA 5DI3B 2JLXA 1G6HA 1G8YA 2OM2A 3K0CC 5ANRB 3THWA 1PUJA 1WDTA 2C98A 4X8LA 1W48A 2P0EA 1EX6A 3ONWA 1DG1G 4HB3A 4PSAA 4CEHB 2WSSD 3QOFA 1VCOA 4HI0E 4B33A 5IRCD 1VG8A 1AIPA 1WQ1R 1C4OA 1XZPA 5G40A 3CPEA 3I8XA 2JAQA 1VECA 1DS6A 2WWIA 4X8MA 3KKPA 1F48A 1RC8A 3AF4A 3I92A 1MO6A 1XU4A 3QJYA 1I4LD 2C96A 1DARA 4HAYA 3KQLA 2CHVA 1G5TA 1W44A 3PG5A 1KDPA 1DBSA 4F4IA 4OI1A 3I8SA 4DT1A 2JLYA 1CR0A 1DAHA 5G41A 1K6MA 4FMDB 4MRRA 3AH8A 3ND8A 2FSHA 4LYJA 1NRJB 3RSOA 4D4MA 2AHOA 2ZR7A 5FTJA 1KYIA 4Q1CA 5BN5A 2GXSA 3VHXA 1KO1A 4KSCA 4LJ6A 4EDHA 3L8YA 1FQKA 2D62A 2D2FA 4ASUD 4M9ZA 3ADCA 1CRQA 2VL7A 2BV3A 2OBMA 3HDTA 1G4UR 4UJ3A 3KX2A 3B1ZA 2TMKA 3FFBA 1XNJA 3LBIA 3THYA 121PA 1R8QA 4OQXA 4BFVA 3K9GA 1NBMA 3G0HA 1VCIA 5J4VA 3SBDA 4P31A 3EPLA 5EXSA 1KNXA 4HAWA 4B75A 3KXIA 2B21A 2ECKA 5FPSA 2DFTA 3R8FA 2QQ0A 2V6JA 4MA4A 1NN3A 1H65A 2F9MA 2HV8A 3B9PA 4TTPA 1FX0A 2ANCA 3Q5DA 2NO6A 1XJCA 3WYAA 1GOTA 2BDTA 2ORIA 1R4AA 4HB0A 2A5GA 1UKVY 2G77B 1EG7A 2QM7A 5J4LA 3ADBA 4KYIB 4HZUA 4YDSA 4LBZA 2FZ4A 2QMUA 4URVR 1AA9A 1RW4A 4HLUA 2V1XA 4B73A 1M7HA 1SKYE 4I99A 3GJ4A 4KLZA 2VP4A 3AQ4A 3FVQA 1R5NA 4MKFA 1GNPA 1W7AA 3IUYA 2VF8A 2Z4SA 4TYNA 4D81A 2OCAA 1DE0A 2RGBA 1ZM7A 5GVSA 1OHHD 1KKMA 4QBIA 4Q9IA 2BBSA 2ZS7A 3PIRA 1IBRA 3DPUA 5SZJA 1U0JA 3K9HA 1EFUA 4JLNA 5FL7D 2CVHA 1R0XA 3HYTA 4DIEA 2UZIR 4LC0A 3ZZ0A 2RB4A 5EUMA 1I2MA 3PXGA 4NYIR 4OQLA 3MD0A 1WP9A 4KXFB 5FUWA 4PPNA 4ZCMA 1FP7A 3IKJA 4OHVA 5CYOA 1ODFA 1NKSA 4FMBB 4IOLA 3TJZA 3W8NA 4B6EA 4P4SA 2BMFA 3NIBA 2O8CB 1CTQA 3AF3A 2YHSA 4KI0A 2QU8A 4DC9A 3VX4A 2ZRIA 1KO4A 4R2IA 5JBQA 4C2UA 1OPXA 1TAGA 4PHFA 3RHFA 4Q9KA 2JJ1A 4GL2A 3I32A 5AJWA 1CU1A 4D80A 2YYZA 1Z83A 3KUCA 5L3VA 1VYUA 5L3RA 5K8UA 1W0JD 2FPMA 2G6BA 2XNDD 3KL4A 1A1VA 1VIAA 1W2HA 1QHYA 2BOVA 2G83A 5KU1A 2BMEA 2XXAA 1VMAA 1M34E 2IYZA 3PR1A 2RGCA 4L8GA 1KZ7B 3QEJA 1FW6A 2I4IA 2F1IA 2XTZA 1E79A 1F60A 4FMDF 3SHFA 4F4CA 1CEEA 1EFCA 3MSXA 1U99A 1W4BA 4DBLC 2J0VA 3MFYA 4XOIA 1CF4A 4XTRA 2QORA 1AKYA 5L3SB 2Q0HA 4L9WA 4B2PA 1NI3A 2D74A 5EE5B 3IBYA 4A9AA 1Z0AA 1VYVA 1PLLA 3FMIA 1L4UA 5FTMA 5HCNA 4BLOA 4F93B 3I72A 4F7WA 4OQNA 1Z5ZA 3CPJB 2Q3FA 1MOZA 1P75A 4PPFA 1JJ7A 4URYR 3T15A 2QUZA 3CNNA 3RLFA 1UADA 4PO1A 5CK5A 1IM2A 1JECA 2W00A 2J45A 3B1YA 2O8BA 2FA9A 2A5JA 3CF6R 1XD9A 3L8ZA 3AUYA 4EPXA 5EP1A 5KDOA 2G0TA 3OESA 4EFLA 3A36A 3AVUA 2P6UA 2FFAA 3GMTA 1XCPA 1AK2A 2IYVA 1NIJA 1NG9A 3A1TA 3PUVA 4KLNA 4EPWA 3QI2A 5HPYB 1XEWY 3Q8XB 3FHTA 4QOSA 1FUUA 2ZRKA 2R6GA 2PJZA 4D6PA 4O2LA 4UJ5A 2JLRA 2OUKA 4BPBA 1MR3F 5DSZA 4RZ2A 4ESHA 3SHWA
chains in the Genus database with same CATH superfamily
3L1VA 4I8IA 4R8MA 4JHLA 3DFZA 3NBAA 5DWQA 2RARA 1U28C 1M34A 3U44B 1QVAA 3F3YA 5KYXB 5JS1A 2ILTA 5K3FB 1CQXA 2B82A 1BMTA 1A9XB 4TWBA 1TJYA 3HNPA 4GPZA 1KZYC 4H7DA 2AZ4A 2F8SA 1RZUA 1B2LA 1TUBB 1QP0A 1TYZA 3AR5A 2FZVA 4KOEC 3T1HB 3EGDB 3W9YA 1P19A 1K2VN 2YNMD 2YZ7A 3I01M 1GTMA 1UBGA 2XUGA 5IF9A 2J5BA 1QOPB 1QAOA 1QE5A 3UGKA 4E88A 3TW8B 3AHIA 1U9IA 4YAJA 2NIPA 1LDBA 1YQEA 3E03A 1U0EA 4KOAA 4RDXA 5JFGA 3VM6A 4KDEA 3HH8A 3R3YA 4D4GA 3D2BA 3GT3A 4RABA 1KSFX 3ANNA 3CB4A 4YO8A 3FR7A 5BO5A 3W5IA 3RBVA 4B3FX 1N2BA 2VPWA 3PCTA 4FQ7A 3TDKA 3SSOA 4NENB 5IBCA 4Z9AA 1PZMA 2XUPA 4OATA 5AR1A 1VL5A 3SR3A 4XXHA 4U2EA 5KPJA 4B47A 4NIMA 3I9LA 4GEGA 1I10A 1WCIB 4ZEVA 1I7QB 2VTBB 3K70C 5I9TA 5LXTF 2OKGA 3H5NA 2VBCA 1CUDA 1IAVA 8ATCA 3DZBA 2CDRA 4DCSA 3VHRA 1YRLA 3OLZA 1JT2A 1KQPA 1S2MA 2YN4A 4MQMA 1VOTA 5ELLA 3BUSA 1O1YA 1YS2X 4NK5A 1IFXA 1Y1KE 2FMTA 1YJAA 1QYRA 1MJFA 5F35A 4MO9A 1O03A 5FB3A 4EO4A 5JNRA 2FN7A 2BFCB 2C03A 2JCSA 1JLHA 2LDBA 1NDQA 3AOEC 3BMXA 4GP6A 3UG7A 5JCZA 4E5DA 1ZAKA 2XRMA 4JLPA 4IIDA 1Q7RA 4RC9A 1WW3A 3G49A 3UBMA 2P2DA 3EFOB 4PAQA 1D5WA 1U1GA 3AB3A 3USZA 3GFFA 4AWXA 3IH5A 3FDFA 4ZK6A 5ES4B 5ICCA 1Q16A 1RWXA 1X7ZA 1GUBA 2NM0A 1SXJC 4JA2A 1PYDA 1SIBE 2R48A 4G0PA 4LCJA 3OT5A 2TECE 1T35A 1JMVA 3ZGLA 4HY3A 5JQGB 2AEEA 2FMXA 2WJVA 2Q2QA 4PSUA 1MB0A 5EJ2A 4F06A 4D4HA 2PRZA 2J0UB 5JWOA 1E2EA 3DPIA 2P62A 3AY0A 1ORRA 3L7CA 4BV3A 7YASA 3OUZA 2WPDA 4L15A 1HPLA 4ZQHA 2KWIA 2AQIA 7ADHA 2A58A 3D0KA 2ZITA 3ESBA 3GCZA 4HS4A 3ZTTA 1ICEA 4LRYA 2R68A 3L7KA 4NBSA 3WA7A 4JUCA 4KVFA 1VBMA 1TTQB 1XX6A 3JWPA 1JMKC 1V4VA 2UDPA 4N0PA 4EGFA 2IUYA 4LGCA 3FTPA 2YIJA 3C6BA 3GPDG 5LOVF 4CMKA 5GJBA 3U3KA 4UUAA 4QHTA 1WZUA 1JNYA 2O7NA 3E53A 3A6LA 5HZMA 3AERA 2O2XA 3MYYA 1POWA 3P7MA 1JPNA 1GRNA 1OI7A 2NT3A 4JB8A 1R00A 4TZTA 5HIMA 1A9QA 1Y4AE 1E63A 2G08A 2X86A 1P1RA 3L6DA 4YV0A 1IN7A 1OXKB 4F60A 4UHEA 1KH2A 1T2VA 4Q34A 1ZCJA 4RPIA 2PD6A 2DFNA 4B2LA 4R2KA 2OBNA 3ZXSA 3EASA 4MQFB 2AN9A 4FWIB 4HDMA 3UWSA 4Q24A 2PANA 4FZ5A 3R9WA 2DG2A 2QBYB 5KSZA 2C8VA 1YASA 5JSQA 5H3LA 3D2LA 2ZU6A 3G5LA 3M9WA 3R3VA 1J1UA 2V7BA 4PTLA 1H8HD 1L5VA 3UV6A 1MG0A 4PIPA 4GRAA 1QO0D 1U7TA 2HJ9A 3B38A 2Q1XA 3KKEA 1N3LA 3JWJA 4B46A 5U1PA 4PQGA 2HPHA 2HYIC 4CKZA 1DEKA 4CL8A 2OMEA 1CR4A 5DW3A 3NHPA 2N9UA 4RD3A 3DCYA 3EQ9A 4IJ5A 4RCZA 1PFKA 1N6IA 4J4BA 3SYRA 3LC2O 2ZAYA 3ANSA 3DDUA 3V4OA 4OHYA 1YMQA 4Y1RB 1V5EA 2LNDA 4TYPA 3WGMA 1CUXA 3ZGVA 1OFHA 1Z4IA 4TWJA 2NPIA 1NT2A 3DT8A 4NHOA 4MW0A 1T1JA 2X5OA 2V96A 1V6SA 2BRUC 4P2GA 1QZTA 3SHTA 2WV9A 5CIWA 1E58A 4NFHA 2W2KA 3K0AA 4IDHA 2M6KA 3D7KA 1P0PA 3JYNA 5B2FA 5K0BA 4WCDA 3HLTA 4MGEA 1JSZA 2Y99A 4NBVA 1PT7A 1H4TA 1RBZA 1EE9A 4J16C 3E3AA 2FUEA 3C5EA 4PCLA 4RPCA 2VNKA 5F77A 3RUCA 3T7KA 4D3ZA 1PWYE 1STOA 2IXDA 1MFPA 5JBNA 1PNTA 4JUIA 2CKDA 3QV2A 4LS3A 1A88A 3D3QA 2OCYC 3VBCA 2B1GA 2XVMA 2FPXA 5BN1A 1SQ6A 2GZ3A 2D4AA 4A2WA 4N6GA 1EZ1A 1G5HA 4O29A 1JR6A 4AMVA 3LYUA 1T34A 4PINA 2GM4A 4X1OA 5DI3B 5ALOA 4GICA 3IBFA 1BDHA 3EVGA 4US0R 1BKDR 1C7IA 3ZIUA 1ZVJA 1PVOA 3RAJA 2HQBA 2IZ0A 2W83A 4IMJB 1H6AA 2OHXA 4FC6A 4WA7A 5EVCA 2H4XA 2VAVA 3LYHA 4BEVA 2HN9A 1NNI1 1RWNA 2PZAA 3VHXB 3ZDFA 2GEVA 4OQMA 1XGKA 5F5NA 1FU7A 4ESEA 1YR8A 4P9NA 2OV8A 4A8TA 1ML4A 3Q5EA 2J9YB 1QFXA 1CZNA 1K86A 1OILA 1E94E 1QGUA 5DRYA 4LJYA 4MV3A 1JA1A 5JS7A 4DM3A 4FBGA 4F3YA 1U94A 1ZOIA 3A4YA 4NH0A 2JBHA 3DVRX 4Y67A 2VUHB 1DBPA 3QVVA 1YZQA 5IMSA 1LSSA 2JKZA 3X43A 3IAM1 3U5ZB 2I2WA 1X80B 4IQ4A 3CRVA 4OH7A 1FNCA 4UEJA 3KUUA 5A9TA 4J1QA 3PWKA 4DLWA 4ZO6A 4W5RA 3OQMA 1JLRA 1V5GA 2DH6A 4RTMA 1RHQA 4GPTA 1K98A 4NOJA 4PBRA 4U9IS 4D5GA 5LYJB 2VHQA 2C9CA 5JS8A 4PYNA 4IF4A 4QDZA 2H4YA 4YAKA 4TS4A 1A9RA 4KIFA 4ER7A 1TMGE 4YLGA 1SUSA 2YYYA 2OOKA 3KPYA 1HZZA 3CO0S 1T8TA 5SY9A 3F1LA 3NASA 4K88A 2JJQA 4LOJA 2YC2C 4V0OA 1QIJA 2JCBA 1G60A 2O2DA 1Z26A 2H9IA 5JXHA 1D2RA 1Q6ZA 2BGTA 2ZT8A 2FX3A 4IJVA 4OQZA 5EERA 2RAPA 1NBWB 3MTGA 4DLTA 3P2YA 4EB8A 1YA6A 3KAJA 2IOQA 1R8YA 3HKEA 3ZHUA 2XCSB 3C3JA 1AF4A 4ER5A 3CURA 4FN5A 2QVZX 4JLSA 1V4BA 5AUNB 3U5TA 3A2MA 1G8FA 4NECA 5BR8B 4CG0A 4QA9A 4DDWA 2C1EA 3H9JA 3MTAA 1ZN7A 3LC7O 2X8AA 3GLIE 1Y8RB 1V1MB 2JJ2A 2P9JA 4YJ2B 1RP1A 4D46A 1N2IA 5CTJA 1LH0A 1U0SY 1O9HA 2BFFB 1UC9A 4N9QA 1IY0A 3CCCA 1BX1A 3I76A 1ONNA 1WD7A 3B52X 4LWZA 4MWOA 3S7TA 4CLDA 2AEFA 4RMIA 2V9CA 3HZHA 4FGJA 1UOPA 2NSHA 1ZH8A 3R5XA 4WN9A 4X94A 4OJNA 1GPBA 3DMFA 1E1KA 1ZC4A 1H3EA 1UK7A 4NBNA 3D7RA 1E32A 3A3NA 4FYPA 5BORA 1WB5A 1U0BB 5DHSA 1Z7YA 3H7AA 1QNFA 1TQDA 1W4RA 2YJ6A 3PQ4A 3AR4A 3R3HA 3MTEA 3WGZA 4M1TA 1H3FA 1P0QA 2PFSA 4CHGA 2IOFK 4TMKA 4CIXA 4E08A 1UPUA 3NPAA 4WBNF 4E13A 1EP9A 5HKLA 3VOTA 4DNFA 2PBFA 2C7VA 4O2AA 4P3OA 5KKAA 4IHQA 4F3CA 2WTAA 3EISA 2JFXA 1EFVA 1MC4A 2GA8A 1H6DA 5EMKA 4LSGA 2GEFA 1LEHA 1U9ZA 3LMKA 4NBUA 1UK9A 2OZEA 4ZOLB 2QOEA 4IUBS 3N2EA 4J94A 1JQLB 1LI7A 1RKBA 2ZS8A 2KE5A 2CF6A 2FH5B 5A3SA 5EXPA 1WY7A 3A14A 1P1KA 2X6QA 3PBKA 2K2WA 1FUEA 3H5WA 1JG4A 3E18A 1E9VA 3CEJA 3A0UA 3JAWB 1GDTA 2X8BA 1OOEA 2HLNA 2WTNA 4KLCA 4MMYB 1KGSA 1OWPA 3WGIA 1UH5A 3WK6A 4NS4A 2BHLA 2DKFA 1JDVA 1FLVA 3LT4A 4QEZA 5I7HA 2W58A 1DRWA 2PX2A 3NEJA 2WPDD 4HYEA 5DYNA 3SVZA 3CZMA 1E6UA 4IG4A 2EHJA 2GN4A 3CXUA 4F12A 3T3HA 1JKXA 4ENRA 2FFHA 4CGZA 2YVUA 3QWFA 5FUYA 3AEXA 4IIYA 4D3DA 1RMQA 4UNPA 4ZV7A 3GLIA 4IX1A 4HWSA 3PI7A 4ALKA 3JD2A 4EMBA 4ZGWA 5A9SB 4JDPA 5BOVA 2X3FA 1Y6GA 1MDBA 3PX2A 5PGMA 3KSMA 3MJSA 1IPEA 3RUAA 1SU4A 3WYBA 2G07A 3P9PA 2UZ4A 2QPAA 1ZUNA 2EATA 1VKNA 3NWPA 2LP4Y 3G5AA 4CUKA 1FC0A 2Q3JA 4KKXB 2JD1A 5DLEA 1P5RA 3LUJA 4IHAA 1FYWA 3MT9A 5ESDA 3RSQA 3KKLA 3H2IA 4JHXA 3AUFA 3GX1A 4RTPA 4KW7A 2HA0A 2PWZA 1JLLA 2QYOA 2YQ4A 4CCSA 5K09A 4DBZA 4DM4A 1KK2A 3N86A 4EUHA 3GUUA 1WKBA 3P9XA 3KT6A 1SKQA 1Z0ZA 1PSWA 3QIAA 3LOUA 3GEMA 4QGFA 2ABWA 2C4NA 4N8DA 4UU1A 4C14A 3TQTA 2RH5A 2F1KA 4ALMA 2QD3A 3P45A 4ZRNA 1QGYA 1M34B 1GL9B 2DQ4A 1OXBB 1NE2A 2YVLA 3AM5A 4X63A 5IH3A 3VR6H 4F1WA 2O2IA 3PKZA 1DMSA 2ZSFA 3BGVA 2KW5A 5K0LA 2X76A 4CHTA 1DG3A 1O4VA 3CBGA 2YMLA 4HWKA 3ODGA 3UT5A 4X64B 1SQ5A 4JFAA 1E9RA 3OQVA 1E4VA 2FPKA 1QYXA 4EJ2A 1LQ2A 2V7GA 5ALDA 2XIJA 4EFNA 3HCCA 4OFZA 4BC1A 4YY3B 2J67A 4FCVA 1QHHB 2Z43A 3JZMA 2FVYA 2WICA 3PFFA 4I1RA 4D41A 4KZPA 1FMFA 3FUTA 2CYBA 1PI3A 2DHCA 2WC1A 3C97A 4TTTS 3ID6C 3QE9Y 4LXGA 3FUVA 2OHHA 3ILHA 3LLSA 4QRHA 2X2OA 1Z6TA 3PHHA 4KWHA 5I7VA 2DWCA 3USCS 1QZUA 3VNUA 5EE9A 1BEZA 5TMPA 4XWKA 3OOWA 5HOQA 3KHKA 3UPDA 1FP6A 3TW6A 1QIKA 3R0JA 1FA9A 3WBKA 1YHYA 2C2WA 3G8BA 3VKUA 3IUNA 5BVHA 1OZFA 4BUJA 1RI1A 3QE4A 3WKDA 2FMFA 5AM3A 4AVYA 2CMKA 2QB5A 3DMPA 3UCEA 5CDGA 1T24A 1EIWA 2BKXA 5FX2A 3ZUGA 5KKNB 1HEUA 4EPTA 4Z9YA 2EQ5A 1T9CA 2QPTA 5HZGA 3GH3A 1YA4A 4JQZA 4YRQA 3T0GA 3ZDQA 4ALNA 2ZRGA 3G6WA 5HQJA 5CFOA 1IQUA 1GHTA 2VHXA 2VJLA 2ZSEA 4Q5IA 4F1KA 3CVVA 2Z95A 3N7AA 3BK2A 1NG1A 4KPUA 4YHBA 3FSEA 5LLSA 2AJCA 3MWGA 4MYCA 2AN4A 2WA1A 3ZPXA 4PYJA 3K72B 4MP8A 2CN1A 3COSA 1OZGA 1T9GR 2ZREA 4GOXA 3RUFA 3ZXXA 2ZI4A 2VDRB 4GWLA 1IIRA 1JFRA 3UH1A 3T54A 5DH9A 5JCPA 2EQBA 3K1JA 4PHTA 4XSHA 3OTWA 1PJCA 2H1IA 4EFDA 3BEOA 2R751 3K5IA 2PA0A 4MLPA 2ZRLA 1GT6A 1KPIA 1PDOA 5DTIA 1OBOA 5TSDA 2YUTA 1CZLA 1N2XA 2OSBA 2VPPA 1X7ZB 4NCHA 2B4KA 1P2DA 3WAGA 3LK7A 2ZS9A 3ZV4A 4BVLA 1J2YA 2O6HA 4O2RA 4WK2B 1QKKA 3IBGA 4HRXA 4NE7A 5BYAA 3LLVA 5CU7A 2Y0CA 3V42A 2R6DA 5C1DA 1H0SA 4XUDA 5I4KA 2O6LA 2GYVA 3GCXA 4LV5B 3AKDA 1KSHA 4DLAA 2TMGA 3LIPA 1ZD8A 5C5EA 3SC6A 3C98A 4ID3A 2EJWA 3T3NA 1IVSA 2G71A 1QP7A 4AWAA 3GJ5A 5A5VA 5JZOA 4BVBA 2XMPA 5CR9A 4JI0B 3NEPX 2H6EA 1R8XA 4JOCA 2JI6A 2R85A 4G0ZA 4ZCTA 1IRXA 2H06A 3SHOA 2B30A 3AERB 4H7EA 3OJFA 3QOWA 1NKTA 1W34A 1GYRA 1ZJ5A 3P9SA 2HADA 2O3JA 2V6GA 1DKNA 4ZC8A 2GK4A 3WICA 2BGIA 4R9SA 4W9NA 1G8KA 5J2UA 1GADO 2W11A 5AH0A 2JJ2D 3DE4X 1KYWA 3LHFA 2HWWA 4B3JA 1HQDA 2YN2A 5AW3A 4Z7JA 1DV2A 3OU6A 4LGYA 5FH9A 3GAMA 3B1KA 2BFOA 4LJ9A 3HJRA 2XAUA 3KM0A 1GARA 5FBRB 1N9GA 4EPYA 3RT1A 2ZTUA 3TM5A 3FB1A 1JYEA 4FBMA 5IBQA 1CY2A 4FYIA 4UHFA 3FJOA 3QVXA 1Z5PA 3PXUA 1WZ2A 1SZCA 3HRHA 1WX1A 4RZSA 1XZDA 2GZ2A 4EY4A 1B8OA 1E7MA 2ZTVA 4KVZA 4EVIA 4CV1A 4Y9UA 2FZLA 3GO4A 1KY5A 5I7AA 5H1YA 1RWKA 2D0PB 3AEKA 5EJIA 2OENG 4KDFA 3IUQA 2BE7A 1L7VC 1WXDA 1ZLYA 3F1KA 4F7DA 1PGPA 3HR8A 4MGIR 4UQLA 1OI3A 2HQOA 2C0QA 4YJ3B 4MS1A 3PQ5A 2GZAA 2ECFA 3RNOA 1XZBA 1YD7A 1LPNA 1WUJS 1EB9A 4H08A 2W2KB 3K0AB 3LPMA 5CD1A 1B0AA 3ENZA 2NQTA 4UVIA 5I51A 5G0SA 1L5HB 5AIBA 4M6WA 1PWZA 1BA3A 1WRBA 3MTQA 5BUCA 2HJSA 3PUYA 4EZBA 3RVRA 2E7ZA 2CBZA 2R44A 2WAMA 1Y1RA 3EDQA 4OLJA 5C1PA 1OVMA 2ZIUB 3AETA 3R4CA 2GERA 3N59A 2JZNA 4IX9A 1QSGA 3G23A 2ZWAA 1JEQA 4BFCA 2VTKA 4FGLA 3FPHA 4ER6A 3HJAA 4ABYA 2CDAA 4BNKA 4PRYA 1DEAA 3CLUD 3IPXA 5TEVA 1Z6YA 2WKQA 4PX3A 4R7ZA 1AQJA 1QP4A 1W47A 4CIAA 4NNPA 5D85A 1TM4E 4GYYA 1HDXA 3DZJA 1H85A 2EGGA 3QU7A 1KSGA 4J7CA 5BV7A 4IIJA 5H68A 3UJPA 1OX6A 3CBQA 4AJ1A 1KAHA 1NVGA 1XB2A 4ZGBA 7MDHA 1VTKA 3IO5A 5F1OA 4AYXA 2GX6A 5H80A 5FA6A 5C3MA 1Z28A 3WWDA 1X1AA 5HR5A 5CRIA 4DV2B 5MGNA 3CJQA 3E23A 1JYFA 2JS7A 1N9ZA 1QGUB 5FD8A 1B0PA 1CVLA 2JHCA 4A7PA 4KGDA 5TJHA 4IHJF 1OROA 4ALJA 1Y8ZA 2FW7A 5EKSA 2C42A 3ZHSA 3NANA 1Y98A 1F2TB 2WG1A 2BTQA 2FW6A 2WOJA 2IIVA 1CJUC 4QATA 4QPZA 3RRXA 3U81A 4DF3A 1R74A 1TEHA 4LXXA 2P2YA 2QX7A 2AI3A 3CG4A 2C2GA 4XCQA 1GSIA 4WSOA 5EJ5A 3VPCA 2HA3A 4BMDA 2OV6A 1PTJA 2CHQA 3K0EA 3WYEA 2PGJA 4UNRA 2FYTA 2YNMC 2NP7A 1XFDA 4KG7A 4JI1B 4RDIA 3T3MB 3TTVA 1DINA 4B34A 2W2NA 3OP1A 1ULBA 2QJOA 2RJNA 3NTQA 5IUJC 5CXQA 4I55F 4RK1A 1AO3A 1JKJA 1RT9A 4JYCA 1MVOA 4QOJA 3VGPA 4EJSA 4UPVA 2QRJA 4R2WA 3RFUA 3EHEA 5LN1A 2N42A 2GRJA 3RIXA 3HKEB 1J42A 2ACEA 3HKDA 3LL7A 3I62A 4GZ3A 4RHEA 1P7ZA 2RBGA 2WHPA 5AXDA 4E21A 2XB6A 5DM0A 3LCMA 3T9FA 2EIHA 4EI9A 5DMXA 1NMZA 5C5CA 1QV6A 5JSFA 5AW6A 1DQSA 4OI2A 3I6QA 4C4OA 2PWYA 5EJ9A 2YWDA 2I1LA 4FS3A 4MUGA 2YIMA 2XITA 2FR1A 3N2KB 2OV4A 1NMSA 4RH1A 4DY4A 3SJCA 4QECA 3F3MA 3RHTA 3LY7A 2DX7A 1VHQA 1SULA 1YFKA 3HEAA 3IEMA 4DIMA 1F8GA 5EWJB 4MEBA 2B8NA 1ZCBA 5F2EA 3ZE8A 3GDOA 2QYHA 4UE3S 2PJUA 5JI3E 3DHWC 4ZO7A 3H1BA 1VSBA 3LI2A 4F4FA 1MABA 2UVDA 2HMTA 3N39C 1XG5A 4WEOA 4AY4A 4MWCA 1OVGA 2NX2A 1L7NA 3W3AA 3EDOA 4QUIA 3WP0A 2YV4A 3P4UA 3MT0A 2NZ8A 3KVVA 1EFVB 1RYHA 2HF8A 3P9NA 1ML3A 1T13A 4RH0A 4ENUA 2PZGA 3BB1A 3QXJA 3C3XA 2W6PA 4EG0A 2QSJA 4UE2A 3JARA 1NQOA 3MLBA 1THMA 3VKFA 2H57A 1YZHA 2R47A 1XTBA 1XZQA 1MIHA 4DLXA 2HM7A 1I2AA 3AEUA 3OFNA 2ZUEA 1R0CA 3NTVA 1DCMA 1PK9A 5IC6A 1Y7LA 3TZCA 1OFUX 3ND7A 4OHXA 1C8BA 2MWMA 4Q1DA 1PLJA 4XFKA 5AXCA 4B6RA 3G9TA 2O20A 2J8ZA 2X8LA 5CJ2A 4D92A 4RWEA 3E82A 1MGOA 2FJ0A 2PZJA 2XCRB 4B71A 4G5RA 1MOSA 4AUNA 2J09A 4M21A 1U2GA 2F9FA 2FSUA 4BNNA 4EY6A 3FVRA 2XE8A 3NMUF 2L19A 4M0DA 2DMRA 1BD4A 1GKYA 2DR0A 1P39A 1KHHA 1TPZA 4YO7A 4QXQA 1V8PA 2I2XB 4LV8B 4LYDA 3RQIA 3FJYA 3CN9A 4AD8A 3O8CA 3HR7A 2UXCB 4DIFA 2R1UA 1E62A 2X5KO 1IXZA 2GEBA 2ODPA 4TLMB 4DWJA 2GN6A 1A9TA 3OKPA 3V8RA 3OCYA 4LYFA 4JVSB 2FPGA 3D5TA 1ZUNB 1K89A 1XTSA 2PKWA 4C0AC 2V7XA 4UULA 4Y3UA 3L8GA 2QL7A 2ZB8A 3ACDA 3ASUA 5B55A 5ECYA 4JX8A 4G07A 3CW8X 4RIFA 3OQPA 4X7MA 5ALMA 4CRWB 1WNTA 4WFQA 1GQRA 4MUNA 3PFCA 2JFGA 1I4TD 4O08A 4UPDA 4CMJA 1TF2A 3MHPA 1KMQA 1SZDA 4YAFA 6AT1A 3LIIA 4EB0A 2ZBRA 1JWLA 2LTAA 3FWNA 3GDFA 2GBIA 4MV9A 1L8LA 2X5JO 4KRXA 4CF5A 3PJEA 3IAS1 5ABPA 3TKYA 1VJ1A 4EIWA 1JG2A 1TA9A 2AWOA 1FSGA 2ET6A 2YS7A 5I45A 3LNTA 1DWPA 5FR1A 4YUZA 4KK4A 4RD0A 2IYEA 4Z0PA 3HMQA 1EG2A 5BPHA 4DWWA 4JEIA 2H7XA 3HYSA 5FAKA 1X7GA 5AJYA 5JXGA 3HEMA 1W93A 3G2QA 4FU0A 2QNRA 5CGQB 4ZCPA 5I5GA 3UT5B 5JNVA 1P81A 4HEQA 1NJSA 5IFLA 4RMGA 1EXVA 3ETNA 4QOHA 4FB5A 2KSQA 3ANXA 4XR9A 4OGKA 3T1OA 3LWBA 4Q01A 1TMYA 1W25A 2E3JA 3NHWA 3O3CA 2FR8C 2WD7A 3LNCA 1QFYA 2HWKA 1I4OA 1NJ5A 5D8DA 3WLAA 3HUDA 5IVHA 1NW3A 3OZGA 4HADA 4UASA 2IDMA 5DWVA 5TDHA 4OX9B 4KPEC 5JCXA 1R8JA 2OG2A 3DR3A 3H87A 3V8MA 4DB2A 1Q14A 2A9JA 4XRRA 4ECAA 5ADWA 3KQKA 2ZVDA 2WKRA 2JA1A 2Y67A 5C2JB 3K8OE 5BWBA 5MF6A 1KI3A 1GGNA 2LBPA 3A1VA 4HRVA 4YDHB 2E82A 2MSLA 3KR0A 4ZCLA 3TEFA 2AMYA 5BVHB 1WCV1 4WKBA 1KHTA 1Q1EA 1XL0A 1J99A 1O94A 3HCWA 4UHKA 1ESCA 3U37A 1FTNA 2OAP1 2YFKA 5FRDA 3RC1A 3SNHA 4YRPA 4L74A 4E7OA 2IHUA 3WL8A 1N7GA 2QMHA 1CERA 1GR0A 4YHHB 1YC5A 1MX3A 2HBZA 2PZEA 5LKRA 1ABBA 2X58A 3QKSA 1XQVA 4PFKA 2OYRA 3DLHA 1K7FB 1LRKA 1VLQA 1J0EA 2PTHA 2J6CA 3BJRA 1E60A 4HAIA 2IDZA 3GP3A 2G9UA 1NW9B 2IH4A 5DX8A 3G8AA 2X40A 3NBFA 2QRLA 1QV7A 1ZJJA 2QVCA 3AR6A 3ETGA 3OZEA 5DCYA 3ZWDA 5JXJA 3K4QA 3CH7A 3IBTA 3HGMA 1F8UA 1TKAA 4ML3A 4Q4HB 4R16A 3NKLA 3WIUA 4D9HA 5KNLA 5G53C 2FMIA 2XYPA 3HDHA 2HI0A 3NHAA 4K5QA 3GBVA 1KU6A 3BE5A 3RAEC 1W36D 2JIZA 1AZTA 5IJ9A 2ZJ7A 4QHYA 2WTMA 3LFTA 3ZS9A 4BYMA 3BC1A 3W06A 4DSTA 3KBBA 5H4HA 1CUSA 2VAWA 1JIXA 1L4GA 4YPOA 1ORVA 2BEKA 4KVAA 4FS8A 3BFKA 1NW5A 3Q2KA 3CRQA 6YASA 4O6VA 1BWQA 2PZKA 4LJLA 2C0PA 5F21A 3AR7A 5TVKA 3VU8A 2NLOA 3D02A 4CKWA 4GKAA 4NXMB 1QQBA 4YYEA 3KWJA 2IV3A 4J91A 4ZVSA 1HL7A 1NVKA 1ZS9A 2BGMA 4NCAA 1U9IC 3ND6A 4C01A 1ITZA 3HYRA 3MELA 2AVDA 1RCFA 3OF5A 4QVKA 1YE8A 2AD5A 1KK3A 2VWQA 4R0NA 4ZVKA 5KJFA 2DTDA 1GAQA 3HLYA 4YXWA 3LCVB 1E0KA 3S99A 1S8AA 3QYJA 3BA1A 5DKFA 1E9DA 4N48A 3BL8A 4NAVA 3EXEB 4R9VA 1Z74A 3QXGA 2E5FA 3OF3A 4K26A 2WU3A 1XEXA 3EVZA 5B37A 1ZP6A 4DEYA 4ONEA 2ZSUA 1TZJA 2ZK7A 3OUUA 3B6JA 3V8PA 2EW1A 3OTQA 3K0CA 4NH4A 4YMHA 2PU7A 4KKVA 2Y1XA 1VFNA 2VZEA 4LXUA 1U1FA 2P2ZA 5J2UB 3UB4A 4BLVA 2VHUA 1BCSB 4TTVA 2VAPA 4HNRA 2JGKA 4KX3A 1N1GA 2YS6A 4OSEA 1Z4OA 1NV9A 3WL7A 3ZG6A 4IV8A 1CHDA 5EJ7A 5LBTA 4AQYB 1LSOA 3DEFA 3NBUA 1CV2A 2ENUA 3LRTA 1KVRA 2WQ6A 1EJ6A 5JV5A 1Z6AA 3M4XA 1AQYA 1N9GB 5JMOA 2PYDA 5J3JA 1AMOA 2ZBEA 2HK9A 1KDRA 2WMYA 3BWDD 1WTCA 4KDRA 5K3CA 3JQAA 3LQRA 4MGHA 3M83A 5DNCA 1RPZA 1JW9B 4XIYA 4Z6KA 1JVBA 4B5LA 2BM8A 4KO8A 4PLHA 5BXQC 1MFZA 1C0EA 1PIWA 4IH9A 2ZRJA 4RENA 5AHRA 2XWBF 3TMKA 4OIMA 2VZLA 1Z36A 2YXNA 3OIWA 3W3AD 3M1LA 3TGPA 1P7WA 3DVAA 4TWAA 4YP1A 1X7XA 4KQEA 2I1QA 3F5QA 4F3KA 1XZAA 1JKMA 3KJNA 2H16A 3Q10A 2PGLA 4UBJA 3ZWNA 3K9LA 3TLCA 3O2QB 3QUQA 3GJ8A 4OLAA 1JPUA 2XT6A 4Q7EA 4IDBA 4EG5A 1HFWA 4GR4A 5HMMA 4BNVA 1CNEA 4A1OA 1FDOA 3DGFC 4GAEA 2VRCD 5LD2B 1L4MA 2OV2A 4BVEA 1AE1A 1KQ3A 4ENPA 4D45A 3H2JA 3QUCA 2IYRA 2OD9A 4HAVA 1EH5A 3OFND 3ORHA 1K2WA 5JRZA 3HFSA 5CD9A 1TO1E 4ZKDA 3DCIA 1UFRA 3JAKB 1LGYA 1SVLA 3PNPA 5C8YA 3JR3A 3CJTA 5ICGA 2A6PA 3H4VA 1P5JA 2I8CA 1SIWA 5DSXA 3VI3B 5A03A 3GLHE 1EWQA 2UUAB 2ZRBA 3AETB 3T7RA 4CE6A 2DFLA 1Y4ZA 1GQQA 1JEQB 4C2BA 4U6NA 4PLCA 5HS6A 3X1DA 1G2IA 1IB0A 4GZMA 4PVCA 3VTAA 1GFWA 3O95A 4I5EA 4NCJA 1RTKA 3E48A 3GJYA 5KVCA 2HXGA 2Z6QA 1FTYA 3CX6A 3P1JA 5E3JA 4NS1A 1O3YA 4FKMA 4A8PA 2REBA 5CT5A 4E2WA 1JVNA 2JLCA 3U39A 2HBQA 2HU5A 2Q28A 4GX5A 5J9FA 1IOLA 3KQUA 1JU3A 1C1DA 4FZJA 1Z35A 4MV4A 2WVJA 2NVBA 2QRKA 2QZ4A 3FVWA 2C2BA 3S1SA 1V6CA 3DBHA 1MPTA 1PGNA 1NI4A 2G72A 2PZMA 5TF4A 1A8QA 4WI1A 1WABA 4IR7A 3ZXIA 4N3NA 4J2HA 3RC2A 1KH1A 4G0NA 5HBRA 4BQNA 4U7PB 2X3UA 3TOXA 1W36B 2OV1A 2EKZA 3SZLA 2BTQB 3GAAA 4TXNA 5H5JA 5TLSA 1PX0A 1V5IA 3IP1A 4MUYA 3GNTA 1GY8A 1RI5A 1WXFA 3AYZB 4GR9A 5AKXA 3LOQA 3O1HB 1TCUA 2SNIE 3RODA 4B79A 2WFLA 2VPXA 4DCMA 2AQKA 3ENNA 1X2EA 3F73A 1N4AA 1LC3A 1GRCA 1OV6A 1U7PA 2XNSA 3E8MA 5L51A 1JAIA 4MKRA 2HGSA 3NHKA 3GN1A 4NBWA 3FG9A 1AVTA 2OFWA 2OXRA 2ADMA 4KQMA 2IIQA 3KP1A 1Q1AA 1M8PA 1JKJB 2G9ZA 2VXBA 4AJ2A 4EJSB 1QUEA 2VAMA 3LQKA 4Q47A 1SXQA 3GLHA 2CBGA 4MW1A 2GARA 2YOFA 4DLKA 3QJ5A 4CL0A 3BXHA 5JR3A 1YRBA 2D00A 3HKDB 4ETWA 2IS2A 5CJJA 3GFBA 1BOOA 1DTWB 1M6WA 4Y18A 1NF2A 5SY6A 2CSUA 2WHPB 2H3HA 3DZCA 3H0EA 3R6LA 3TQIA 1ZJZA 1V37A 4D42A 1E8DA 3X1XA 1XLWA 1DJQA 1XPJA 1SU7A 2EFJA 1A98A 1SG0A 1Z5WA 2JLQA 1J0XO 2XBLA 3CZAA 5DGXA 1XPUA 5DHRA 1GGMA 4CTOA 4MR9A 2J3HA 3B7WA 4B17A 2IPOA 5LR6A 1BOFA 3QU2A 2E87A 3B3FA 3EIFA 4L8VA 3I1IA 1PEDA 1R6UA 3BICA 1O94D 2FEMA 3EGOA 1ZFNA 3E5HA 3OTGA 3QXCA 4M9RA 4QTYA 4NQZA 5CG2A 4NCIA 1JAHA 2X0NA 3KVOA 4JB2A 4XPIA 1NW4A 3C6QA 3CEPB 3NGLA 3V48A 4YRKA 5KI6A 4LZJA 3RAPR 1I80A 3OJLA 1BROA 2POCA 4NMHA 4D74A 1FU4A 1O77A 1FRFS 2LR0A 4I5GA 1O57A 4D57A 3D9QX 1Y1TA 1N5OX 5F2NA 2QXYA 1VLZA 1UP6A 1D6SA 2F8LA 4FEAA 5TRTA 4O4HF 3WL6A 4EHLA 1ADBA 3C8MA 4C5BA 3CWZA 1EX1A 1MABB 2ZUWA 3MGCA 1CUCA 1NGSA 3K53A 4O4LB 1ZMRA 5CA0B 1A4IA 3B6EA 4NMLA 3ZN2A 3GLGA 3CUUA 4K28A 1DLIA 2C9MA 1TA4A 1XZIA 2FR0A 3O82A 5J4YA 2MJLA 3G1TA 4LY6A 3E3MA 4M9SA 2Y2VA 1JHOA 2KHZA 5DYTA 2JFZA 3LWNA 2CUZA 2YJGA 5EWLA 1LBHA 2VP6A 5ICEA 1E98A 3SXJA 1N9KA 5LDGA 5EIOA 2JIZD 2JRLA 3VMFA 3JARB 5C37A 3G2KA 2ZBQA 3W2TA 1N7HA 1QO9A 4TQGA 3VSCA 2Y27A 3OHMA 3TZBA 5AOCA 1E20A 1XQYA 2JFNA 1K6JA 5IBPA 3NDIA 4R8LA 3GEPA 3SCZA 2NG1A 3IO3A 2I8LA 3PT5A 3BXZA 3Q2IA 4MQLA 5AW9A 5KWIA 2JANA 2PG3A 1NMEA 3V8EA 1KTIA 1AKUA 3JALA 5IH7A 2G5GX 4QVIA 5F9HA 2PE5A 1BHO1 2EFYA 3MK31 4US1R 4XFDA 3CLHA 4DREA 2IWHA 2JZOA 4CIWA 4R8SA 3ADKA 1B93A 4D9NA 3F8SA 5L3ZA 4FFBA 4YXWD 2HPVA 3KOZA 1XZJA 4P98A 4P3PA 1VI5A 5F4BA 3UTCA 4ZZIA 1JH9A 4O4IF 2OO5A 4U2KA 2J32A 2WUWE 4YI3A 2PCLA 5C4IA 1G41A 1WXWA 5TX7A 4MRAA 2JLWA 3VKHA 2F1HA 4QARA 2C2KA 5T3UA 3QVUA 4D2IA 3HLKA 2FPGB 4JP5A 2ZJ2A 1MDFA 5F1PA 3OVMA 1OC4A 2PLNA 4LRWA 2ZUBA 3GW8A 4JH0A 3ELYA 1XEWX 3GDWA 1O54A 2W4QA 3OPYI 3C6ZA 4R05A 1S8FA 3F4KA 3IOYA 4GU5A 3R9IA 3OZRA 1KFCB 3IEPA 1JQJC 1RJ9B 1XVIA 3GNLA 2WHQA 1EE2A 4R1OA 4FFMA 2VLBA 1L5HA 1A72A 3ETEA 2GDZA 3R7FA 2W6ZA 1E96A 5WRFA 2VHZA 2A1IA 2XVXA 3H5LA 1HFJA 4XD7A 5F3DA 5C18A 1GZSA 3JASA 4FXPA 4A03A 1OXUA 4BDTA 3JWIA 2QD5A 4KAXA 2FF5A 3FIUA 2VJMB 2H2GA 3JQAD 4MA0A 2HBYA 4ZVMA 1N3YA 1TQ4A 3IAFA 4ARVA 1YRWA 4I9HA 4JOQA 2PR7A 3RYTC 4RTRA 4I1VA 4B2IA 2CNBA 4C3ZA 1FFAA 4W5HA 1Y1QA 3T5MA 1QHXA 4H6XA 4RL4A 2FUKA 4AS3A 2REQA 5JU6A 1N5RA 2HLDA 5D6NA 3COVA 4CPDA 5EIWA 3E22A 1K8YB 1CIJA 3PDHA 1SY7A 2QTWB 4YJHA 5E3IA 2IOYA 1CZKA 3DWEX 5T8KA 2QTCA 1S01A 3ILYA 5JBIA 2G4VA 2WYWA 1EFKA 4DARA 2ZBGA 5LU9A 4W5WA 2WUEA 1P45A 2F90A 2NO4A 4ANFA 1GEEA 3MWJA 4J3NA 1DAOA 3E0QA 1HE5A 4YRMA 1R6TA 5A06A 3NWEA 2DR3A