1QHYA

Chloramphenicol phosphotransferase from streptomyces venezuelae in complex with atpgammas and chloramphenicol
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
178
structure length
178
Chain Sequence
MTTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQSAEGGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLDVLWVGVRCDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTHKESIECAWAIAAHVVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHLORAMPHENICOL PHOSPHOTRANSFERASE
publication title The Crystal Structures of Chloramphenicol Phosphotransferase Reveal a Novel Inactivation Mechanism
pubmed doi rcsb
molecule tags Transferase
total genus 62
structure length 178
sequence length 178
ec nomenclature ec 2.7.1.-:
pdb deposition date 1999-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07931 CPT Chloramphenicol phosphotransferase-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1qhyA00
1K5DA 2XZOA 1VYTA 2GKSA 2IF0A 3SJZA 4HB4A 2OZEA 4TLBA 1ZM7A 4A1FA 3FMFA 4RD4A 4RD3A 1E1QD 3NHAA 5JHGB 2ZIAA 4LI0A 1P9WA 1WXQA 4D6PA 1RZ3A 1RJ9B 4U00A 2V7QD 4B74A 4EKDA 5FTLA 2ZSAA 1PV4A 1L4YA 2IHBA 3U4QA 4YMWA 4TL7A 3RS4A 2GBLA 4V0NA 2A5FA 4D4LA 4RKFA 1T6NA 3GCGA 4X8HA 1DEKA 2BMJA 4DHEA 2RGEA 2VPPA 3AVXA 3UMSA 3BK7A 2QP3A 1ZM2A 2EWVA 2LCFA 3AVVA 4NTZA 1RW4A 4NONA 1EK0A 1Z0KA 4YMVA 3LX5A 2NG1A 1SVLA 3H0KA 1D5CA 4Q9IA 4TMTA 1E99A 2VHTA 4PPGA 1E1QA 1GUAA 4C0KA 1T8TA 4Y0VA 4ZKDA 3GLFE 1V43A 5AJXA 4CEJA 2GBLC 4BEBA 2GTPA 1G3UA 2GILA 2V7QA 4PO9A 3ASZA 1OV4A 1GKIA 3ZGXA 3V4RA 1NF3A 2CJWA 3B1YA 1ZYUA 3AP3A 1JPJA 1H8HA 3VR3A 2PH1A 1XP8A 2WM9B 3OIVA 5C4MA 1XPUA 3SZRA 1DG1G 1IOZA 5BYKA 4NCKA 1Z0JA 3U7EB 5SZIA 3AVUA 1BMFD 1ZCAA 5FUYA 1E9FA 4Q03A 2BM0A 221PA 1U8AA 3RANA 2AR7A 2HJVA 3CX8A 4ESHA 1TX4B 2XSZD 3N2EA 2OBLA 3GLHE 4LV5B 4KAXA 1SXJB 2AL7A 4Q5IA 1Z6YA 4M1MA 3P4YA 1G8YA 1TQDA 2ASEA 1VMAA 1KI6B 4GI7A 3QEJA 3R8CA 2J7PD 2OT3B 3DMNA 3KKNA 1HT2E 1G21E 1GITA 1RIFA 1R5OA 1U99A 4FMCB 4BZXA 4EPYA 3L2OB 3QXHA 4KODA 1DG3A 1U98A 3SHFA 1NNEA 2IT1A 4EFNA 3GJ7A 3KTAA 4C0QC 5JEDA 1MT0A 4N1AA 3GEHA 1IAQA 3DOFA 4AKEA 5IF9A 2OSBA 3MWYW 2ZJAA 4QHTA 3LVRE 4E22A 3SYLA 3UK6A 5FUXA 1NSTA 3IPYA 4QJ5A 1BMFA 2ZS7A 4I99A 1XJQA 1VG8A 4ZCMA 1DPFA 2XSZA 4DKXA 5J4VA 4LSGA 3R9WA 1E69A 2IL1A 1Z63A 1I4TD 3VNVA 1P61B 3PUZA 3KQNA 3SNHA 2J7PA 2YWHA 2B21A 1G64A 4NZYA 4D26A 5BW8A 5B2ZA 4WXRA 4MUAA 1YZUA 3GFOA 2GJKA 2REXB 4JSYA 5L3VA 2IHYA 3PV0A 4PSVA 1T0HB 4PPQA 2Z4RA 2JASA 2RGGA 4UQOA 1ZMXA 3RAPR 1E98A 2B8TA 2ORVA 4TLDA 5KO2A 2IYSA 2RCNA 1YZKA 5K8TA 3CM0A 1UFQA 2J0QA 1FOEB 1OH6A 4GOXA 4HZUB 4V0ME 4XVUA 2QRZA 3K70B 1EGAA 4URWR 2VA8A 2YWFA 3I61A 3GQBA 5CIQA 1TUEA 2BIFA 1LB1B 3U3KA 1ZJ6A 3A1UA 2R6AA 3BERA 1NVUQ 1OPXA 1S4QA 4X8MA 2CVFA 5CJPA 4CZ2A 4RZXA 5CYOA 2GEVA 3EXAA 4Q4HA 4LJ4A 4MYTA 1G5RA 4XSHA 3ZDQA 3CKLA 3RS5A 3U3JA 4DB4A 1E0KA 3FMOB 2B8WA 1OYYA 1DOAA 2GCOB 2BBSA 2W0SA 3MUFA 1E4VA 2NO6A 4AG6A 4Q21A 4DCTA 3S1AA 2F7SA 2FMXA 1WBDA 3LA6A 4HUQA 3MLEA 1MRSA 3BRWD 3NC0C 2ZVQX 4Q9JA 5GJWC 1AGRA 2ZSDA 4LV6A 1NKSA 1XZQA 3BGWA 4DIDA 4GL2A 2V6JA 1E9EA 2CCJA 2UVQA 1G6OA 1TL7C 2PT5A 1IXRC 1AGPA 1EFUA 1ZD8A 3W6OA 3W9YA 4A8JB 1NIJA 1I4LD 3SN6A 5AJYA 4CVNA 3AV0B 2VHJA 4O25A 2P3SA 3K8YA 4LJ5A 1G5PA 1L2TA 1N6RA 2JLUA 1FMLA 4X8LA 3CBQA 2XGJA 4E09A 4XVQA 1E32A 2HCBA 2IXEA 1BH2A 1KNXA 2WJGA 2ZU6A 3WHLA 2HEIA 1Z22A 4LJYA 2F9MA 4V0OA 2ZE5A 4TLEA 2RAPA 1R7RA 4C9BA 1KI3A 1CKEA 1T8UA 3QY0A 3HYTA 1TF7A 4LWZA 2FH5B 1G16A 2DWOA 4B6FA 2CXXA 1Z6AA 4Q9KA 1MH1A 4LRWA 4ARZA 1T91A 5CK5A 4RD0A 3X1WA 3KQKA 1KSFX 1S3GA 3NBFA 3VU9B 1R8SA 3I32A 2O8BA 1UADA 1XCGB 2GRJA 2IEZA 3CPHA 2BC9A 3C7KA 3Q7QA 4ZKEA 3R9XA 2VIIA 5C2JB 3KZ1E 2ZRNA 3PENA 3LLMA 4JVNA 4TLAA 3LNCA 3CB4A 3TUJC 3B9QA 1G41A 1GRRA 2C96A 2WTUA 1GRQA 1MR3F 1TTTA 2ZS8A 1NLFA 2ZRBA 1W0JD 1W36B 4LZZA 3E2IA 2WAXA 3LBHA 1E2PA 5GJVC 1RRPA 1W4CA 2FSGA 2ZRFA 1XBTA 3NEYA 4P32A 1D2EA 4A2WA 4LPKA 1KMQA 3GLGE 3KQHA 1Z47A 3FE2A 3T5DA 2FEOA 3I72A 4LHYA 4PHTA 4Q7LA 1Z6TA 2QAJA 5H1YA 5B30A 4U7DA 5HPYB 4QKQA 3U7FB 1M1YE 4Q18A 3THWA 1Z0DA 3T15A 1R4AA 2ZVPX 4YLGA 1CJUC 1XDBA 2J3EA 4KSCA 1J70A 1UBFA 1YR8A 2EYQA 3M4YA 4L15A 1X86B 1W0JA 4QJ3A 2ZRGA 4B32A 2AWOA 4MKGA 1P72A 1J99A 3H84A 2QP9X 3FGNA 1FQJA 5G40A 4A6PA 3R8FA 1F60A 2O8FA 1YZLA 4O3MA 4R2HA 2QUZA 3ECCA 3Q72A 3D3QA 2QMUA 1KI8A 1SZPA 2FX3A 1TF5A 3REFA 1D6JA 1KSJA 1OW3B 2QMEA 1GOTA 1N5KA 3HDTA 2CDNA 5DIFA 2BV3A 3THOA 1OE0A 3PJRA 3FDIA 2ZM5A 2YNMA 2PT7A 3A36A 2A9KA 1CR2A 4URXR 1UEIA 2FZLA 2J1LA 4QHYA 5FOWA 1KNQA 1GKUB 3G5UA 2EYUA 3PEWA 1II8A 1N5IA 4UNPA 5JWOA 3CO5A 1UKVY 3MSXA 4KSBA 2A3RA 5DSZA 4B3CA 3MWLA 2O8CA 4WZ6A 1CRQA 1NMXA 3AVOA 4R9UC 4DUGD 1HA3A 3BORA 1NVWQ 3U4QB 3IQXA 3T06B 1A7JA 4UNSA 2OXRA 2QEQA 1ZM4A 3QSYA 3EA5A 3JZMA 1NBME 4OHXA 1QBKC 5JFGA 3FHTA 1XU4A 1I2MA 1E94E 1P73A 2H8KA 3CPEA 4XIGS 3HPRA 4ABYA 2QAGA 1E1RD 3KDSE 1S9HA 2EQBA 4PAMA 1N0VC 5AK0A 1GAJA 1EFCA 2HXYA 1QHHA 1SKYE 3SOPA 2YWGA 4PC3A 2LKCA 1JNYA 2FPMA 1DAKA 3SHWA 2VSXA 3PUWA 4CEJB 1T5LA 4V02A 5GVSA 1NIPA 4JLDA 3BD9A 4I1VA 2QTVB 3QF4A 2CJWB 2WWFA 1J8YF 5CM9C 2OM2A 1M74A 2NTYC 3SS8A 3W90A 4A9AA 2QAGC 2QG6A 4HAWA 4Q1CA 4CEIB 2O0HA 1K8RA 2C9YA 4NU0A 4Q1BA 2ZAMA 1FW6A 3SC3A 3SBEA 4OQMA 4UXHA 4IXNA 1E1RA 1Q22A 4C0LA 4PO8A 2FPLA 2ZYWX 5FUVA 4BFUA 1NJGA 1OFHA 1A2BA 2ZI4A 4DZZA 2ONKA 2W6JD 1G6HA 4JLOA 3QVUA 3G0HA 1CS4C 2QRNA 3EZ2A 3ASYA 1Z28A 5JMTA 2V1UA 4C2UA 3T1VA 2ZETA 1RRFA 4YMSA 2QPTA 4DDVA 3F5FA 4JJKA 3KTAB 4KCGA 5CM8B 1ZUIA 2W2XA 1O87A 2QU8A 2WWIA 4KLZA 5CK4A 1AKEA 3IO5A 2FU5C 2ZE7A 3GLIE 3DOEA 3T1TA 5CLQA 3EPJA 2FJUA 5JS8A 3NDPA 4EFLA 5FTNA 1IXZA 3Q7PA 4XWAA 1N2CE 4DWJA 3DEFA 4IFBA 4GP7A 2OBNA 3CH5A 5JRJA 4R2IA 4BFTA 4RFVA 4AK9A 3W8RA 2Q9CA 1QRAA 1R5NA 2IYWA 4QGGA 5EP4A 5L3QA 2JLSA 4JS0A 1FMJA 1ZUHA 2FFBA 2GJSA 2W0MA 4JLBA 1JR6A 4Q47A 4IEEA 4M1TA 3C5CA 4JBWA 1GNQA 1HE1C 1SXJD 2FPKA 1P2VA 2R9VA 3Q85A 1Z6XA 2IA5A 3UIEA 1SVOA 3U60B 1VHLA 4B43A 1IY0A 2BM1A 5EZ6B 4S35A 4XOIA 1ZP6A 4W5HA 2BBTA 5FBVB 2BCJQ 2CNWD 4B2IA 3PITA 3GLFA 1LW7A 3THXB 3B6EA 4M9QA 5JCPA 3RC8A 4AYXA 4DLUA 2CBZA 3VNUA 1YJ5A 3UWOA 3CWZA 1JJVA 4Q4HB 4BZPA 1I2DA 2J45A 3KQUA 4TSFA 3SYKA 2GJ9A 4BECA 1SXJA 3S1AB 1D9XA 1FTSA 1Z0FA 1DAGA 2W83A 3TBKA 1JBKA 3LLUA 3LVQE 3SJBA 4E5UA 4LC0A 5HZHA 4IFEA 2CEAA 1GDDA 4BRWA 3GLHA 5KNBA 2DBYA 1W2GA 4KVAA 1X1RA 2ANCA 4PC2A 4NCJA 5E95A 2QM7A 2NPFA 1UBCA 2JLQA 1HY3A 3MG9A 5EXXA 3I8SA 2JA1A 5EE0A 3U44A 4N3NA 2ATXA 4F4JA 2IWRA 2ZR9A 2QA5A 3IHLA 1SXJC 3K70D 4JKYA 3IEVA 3VAAA 1ZNYA 2C04A 4RZ3A 3WMEA 3DKVA 1GVNB 1RKBA 3QXSA 3CRVA 3RS2A 2CCGA 3PUVA 4B2PA 5E7MA 1AJEA 4FMBB 2F1IA 1Q57A 3W5IA 3ZQ6A 2GZHA 3AM1A 4OI2A 1EX7A 3SYNA 4ARZB 1SKQA 2VQSA 2G77B 1OB5A 2WVJA 2PX3A 2O8BB 5DLQC 3WRYC 3QKRB 4LHXA 3B5JA 4CW7A 4HZUA 2IS6A 3TUZC 1M7HA 2IC5A 4LJAA 1IONA 4Q1AA 4DLTA 4QBFA 2EVWX 2IYYA 1FUKA 4V0MA 5JCZA 5DI3A 1UBEA 1XFAA 4WIAA 4JLVA 1G7CA 1GWNA 4XTCS 2GNOA 3AGQA 2WWXA 1E2KA 1RFLA 1AS3A 4PHFA 1QF9A 4ZV4A 1MABA 4DT1A 4TMKA 3U7HB 1M7GA 2BJWA 1OXTA 1WCV1 2N46A 3K70C 1G1MA 1NG1A 2AKYA 4LHVA 4V0LA 3HR7A 3GJ0A 2BWJA 4Q1FA 1ZAKA 1R10A 5EXSA 1E9BA 2KBFA 4ESVA 4TTQA 1ZM3A 5HR5A 1E2FA 1YZTA 4KO8A 2W58A 1AZTA 1JALA 2QORA 3THWB 4JLMA 1T5IA 2PLFA 2OFXA 2ZSEA 3BOSA 5DE3A 1XMSA 2PEYA 2UKDA 4B2LA 2OXCA 5G41A 2C77A 1HQCA 4D4JA 2RGAA 3NWJA 2J0UB 1F6BA 2NGRA 3K9LA 3PEUA 4Q02A 4DCUA 2V6IA 4AY2A 3QENA 4MRVA 1UKZA 4LGMA 4TWZA 4QGFA 3AP2A 3EWAA 4A36A 1Z29A 3H4MA 2Q0HA 3RSLA 3K0CA 3GJXC 1TQ6A 2H57A 5H8WA 3WYFA 4LJ9A 2P2LA 1Q0UA 3MJHA 2ZYTX 3AUXA 4BLQA 2GVZC 3ZVMA 3GMTA 1RE0A 3O8DA 2RHDA 4IHQA 1XCMA 2EFCB 4MGYR 1U8YA 2H1LA 1KSGA 4PPFA 5EJEA 2ZE8A 4AKIA 3W8NA 2GAAA 3UATA 2XTNA 2FA9A 3OZXA 3I62A 2R65A 4BLSA 4F91B 3FVQA 3O8BA 1W4AA 1XB2A 2BJVA 3K9GA 3RRYA 1XWIA 3K0CC 4G1UC 4CF7A 1IJFA 1W5TA 2ZTSA 5KTYA 3MGCA 2BBWA 2OCPA 3VR1A 2O8CB 1QHNA 2OEPA 4AURA 2WJHA 3BFVA 3U6BA 4M0LA 3WXMA 4HAYA 4B3DA 1LF0A 4QM6A 3OE7D 4DEXA 1OH8A 3B78A 2JLWA 2AWNA 2QAGB 1G291 1E2QA 1KAGA 4TYWA 1E96A 1IN4A 1R0XA 1QHHB 1XX6A 1XTRA 1ZU5A 2P65A 3KXKA 4IDPA 2IYLD 2AN9A 3KB1A 3UG6A 4XWKA 2G1JA 2OCAA 3SFZA 5BN3A 2BEJA 2QMOA 3GLGA 5G3ZA 1F48A 3LXRA 2B7CA 1XZPA 3IBGA 4L16A 5GJCA 4FIDA 3ADKA 4QHSA 3AGPA 4NDZA 3AF2A 3EA0A 1RC8A 1UPTA 1Z8FA 2QL6A 2IYZA 3OEED 1E0AA 3QF4B 2GK7A 4JZKA 3UG7A 1MV5A 4TZ6A 1DO2A 3L8ZA 5DHFA 1AK2A 2VSOA 3QG5A 1E2DA 5EE9A 1C9KA 2BVNA 3RVBA 1CJVC 4HZIA 1QHIA 2VSFA 3OE7A 3LDAA 3A1SA 4P4SB 1S96A 3KFXA 4FCWA 4BLOA 5HE8A 4OL0A 3E1SA 1ZD1A 4B3BA 1MKYA 2YOHA 4M1SA 3M0EA 3QJYA 4DCSA 4LY6A 1F3OA 1TU3A 2JEOA 2VHUA 2HF8A 2KB0A 2ONJA 1N25A 3RABA 4S2EA 3IUYA 2CHGA 1N6OA 1XCPA 2NIPA 1WE2A 2XOKD 3OEEA 121PA 2F6RA 3Q3JB 5KSPA 3U3MA 3ZD7A 4G5OA 4FW9A 4U5XA 1T3HA 5DYIA 1QHYA 4RD1A 2P0EA 4QNMA 5M04A 1R0ZA 1HUQA 4K81B 4IDNA 1G7TA 1UJ2A 3BFKA 2J0VA 4LYHA 3U5ZB 2NMVA 4FINA 1H8HD 3OF5A 5L3QB 1Q3HA 3B1WA 2XB2A 1NI3A 1WDTA 1ZNZA 5JECA 3RWOA 2IBMA 3AVYA 3EWSA 1QHGA 1E9DA 3IIKA 4H1UA 2WIAA 4HAZA 2WHXA 1Z83A 1YZQA 2GF9A 1IM2A 2XOKA 4KITB 2L0XA 2PCLA 3IPXA 3MFYA 5EQTA 2VBCA 5JJIA 3CW2A 1KJWA 3RWMB 1YU9A 5CDFE 3RS3A 1YVDA 2AXPA 4HDOB 4AI6A 4TL8A 1CRPA 4HAXA 5A0FA 1C1YA 4YDSA 1WP9A 4C3ZA 5GJBA 3REGA 3GLFB 4IW3B 4POAA 4US2R 4NYMQ 4EJSA 4CEIA 1Z0AA 1ZINA 3N70A 5EUMA 3K0FB 3EARA 4OHYA 3JZAA 2FNAA 3ADBA 1COWD 3CRW1 4HB3A 5B64A 5TY0A 1JEDA 5JZVA 1I4DD 2O0KA 3GJ8A 1J7KA 2VTKA 5IHPA 1TAGA 3CH4B 4OI4A 1JQJC 1NN3A 4A82A 2OESA 1CULC 3KQLA 3BXZA 3QXXA 1ZIOA 2VF7A 4LUCA 3GLHB 4EJSC 1RYFA 4QRHA 1SULA 4PANA 5C4GB 4AYTA 3P20A 4L8GA 5KSOA 3B8HA 2QT1A 4NKRA 5AUQA 4EPRA 721PA 1HEIA 2QSYA 3U44B 4PC1A 1UDWA 4YDHB 1COWA 1G20E 2ZI5A 4D0LB 1KHTA 4DLVA 4LCBA 2D06A 5KPDA 3GLIA 4C4PA 2YJTD 4KFSA 4R98A 4GT1A 4JLKA 1IJEA 3ETLA 5G53C 4G3XA 2CHVA 1VIYA 1SHKA 2AFIE 2BKUA 2FGJA 3AP1A 3PEVA 3ZJYA 1BIFA 2QM8A 2ZRDA 2DWQA 4Z51A 5KDOA 4ACBA 3F0TA 1H8ED 4Q4LA 2IYQA 4QNRA 5FPHA 4OQNA 3AVQA 4UNRA 3L43A 1T3SA 3EC1A 3LW8A 4V03A 4RCZA 4LBVA 5E3HA 3C8UA 3W34A 4JT4A 5G3YA 3RLFA 2PMDA 3CX7A 5FL7A 2ZJOA 3K53A 3MD0A 2ODEA 4PZZA 2Q3HA 2FSIA 4D80A 2J7KA 1NY5A 4ZO4A 3THXA 1XD2A 4I1SA 1SVWA 3EIHA 5DI3B 5LB2A 5HKKD 3HU3A 1HV8A 2X19A 3TSWA 4A6XA 3R7WA 2VH5R 3T1OA 4EFMA 4ZDJA 4IDHA 3RS0A 4PO1A 4AKGA 4ILEA 3TE6A 2JLVA 1S0UA 1ZBDA 4U02A 4NCIA 4TTRA 2IWHA 1D8TA 1JXOA 1MABB 1BO6A 1H8EA 4A0RA 4DT1B 1SQ5A 3KUDA 1OXVA 2N42A 1AS0A 2ZREA 3NVAA 1RPZA 2XB4A 1TUIA 4FMDB 2GCNA 2RHMA 4TN1A 5AJWA 3F3YA 3QE0A 1QG4A 4BFXA 2VF8A 2AKAB 1RYHA 4HSEA 4IJMA 2FSHA 1GP2A 4JMPA 2ZRAA 3I4LA 4IVPA 4IOKA 1CBUA 1L8QA 4TMVA 5BQ5A 4CGZA 2X77A 1NJFA 1DAIA 4KBFA 1E9CA 2G9NA 5HKKA 5AUPB 1PUJA 5C1BA 4WBSA 1ZVQA 3N5CA 4A92A 5FBRB 5JJKA 3PR1A 2B6HA 2R44A 2ZYUX 3A1VA 2RKOA 3KKOA 3KL4A 2MSDB 4RCYA 1FQKA 1KYIA 3ZLJA 3PUXA 4BFWA 5B57C 4W7SA 3TKLA 1EWRA 1P60A 1NRJB 2JJ2D 2IS1A 4OHWA 4DLXA 4UJ5A 2DFLA 5SZJA 5FI1B 3HYRA 2QE7A 4HLQB 2Z6VA 1HTWA 2WWHA 1F2UB 2V8OA 1M6NA 4OK3A 4P33A 1XXHA 4OK5A 4WW0A 4WZAE 3NBXX 3FB4A 3L82B 3RSOA 1AZSC 1ZUNB 2VLIA 5J40A 3VMFA 5KDLA 3QKRA 5LDDC 5JSZA 3EIQA 3NTUA 1OKKD 3U3OA 1OIWA 3QF7A 4UNNA 1G19A 2PBRA 2IK8A 621PA 1OIXA 3IGFA 3LXXA 5KU1A 1EWQA 1Z2AA 5DO9A 1YRBA 2FG5A 3K9NA 2ZQ5A 4MRNA 3HR8A 1W46A 4JBYA 4M8NE 5HE9A 2JJ2A 4KBGA 4LC1A 2A5JA 1PUIA 4F93B 5P21A 1N6LA 2WSMA 3LRPA 2RGNA 2RH5A 1NKTA 5FOTA 1MOZA 1IN7A 1ESMA 1U2RA 4GNKA 4JLPA 2WPDD 2GXUA 4BRUA 2X8AA 4FXPA 3KKPA 1LNZA 2IYXA 4M1WA 1P2UA 3HP1A 5FBWB 3BH7A 1D9ZA 1OKKA 2GJ8A 3GLGB 3EPHA 3R20A 3CF2A 2QI9C 2J41A 5FOVA 5D3MA 1NLZA 1E2LA 5HCNA 4B35A 2J0UA 2RGNC 4IOLA 2H18A 4EDHA 1OFIA 5J5CA 1JECA 4PSKA 3AKYA 1G3MA 2AXNA 3K0AA 4OQFA 3TQCA 1P2TA 2IYVA 2DY1A 3QKSA 3RS7A 4GBMA 3FFBA 5HTKA 1UKEA 4D81A 2WPDA 2OHFA 1CP2A 3DHWC 5AJZA 4HI0E 2GZDA 3HU2A 4M1KA 2NZJA 2AK2A 2OILA 3T35A 2BMDA 4MUBA 1KK2A 3X2SA 2KJQA 3FMPB 4A2QA 4KFRA 4LJ8A 3WYGA 3ZZTA 4WVFA 4ZCLA 3FHCB 4HDCA 1JB1A 3BIFA 2WZQA 4KLNA 2GCPA 5FUWA 3AB3A 1W48A 4Z54A 5L3SA 2ZRMA 4BZQA 1NVXQ 4KI0A 5TARA 3A4MA 3CNOA 1KO1A 2GETA 2CE7A 5AUNB 3NHBA 1N3BA 3TK1A 2VO1A 3GEIA 5D3QA 3ONWA 3LO5A 4C0BA 4F4IA 3LW7A 3PFIA 1KKMA 1CR4A 1VCNA 3SJCA 1TEVA 1N6NA 3E5HA 2G3YA 1DE0A 3KXIA 4DLYA 4YMTA 2DB3A 3CF0A 2OCYC 3G82C 2YV5A 2D74A 5KPJA 4P0TA 4NHOA 2CLCX 2PLRA 1SKYB 1EXMA 1XTSA 2CHQA 4DSOA 3W3AA 5IRCD 3IQWA 1CIPA 2V4ZA 1SVIA 1W49A 3BB4A 4DIEA 3EZ9A 4MRPA 3BAFA 3VR6A 1ANKA 1E2EA 1Z08A 4LYFA 1KY3A 2R62A 4UKDA 4EJSB 4GOKA 2ZSBA 2PZGA 3VKGA 5J4YA 1U90A 4P4SA 1AQYA 1N6PA 4DRZA 2DR3A 3PIRA 1NMZA 1RRCA 4ZCIA 3H2YA 1EFTA 1OLOA 2D3WA 2WKPA 3U7GA 3F8TA 2CVHA 2RMKA 1KDRA 3L0IB 4IKEA 4YXWD 2WV9A 4M9SA 3NBZC 2UZ3A 4B33A 3IKJA 1FZQA 1K5GA 3K1JA 1OJLA 3A1WA 4L4UA 4PQFA 3VX3A 1M2OB 4Q9LA 4QC2A 1G3QA 2P67A 2JLZA 2XXAA 2ZI3A 3CRQA 1KJZA 4JL8A 2ECKA 2ERYA 3K09A 3KFVA 1GFIA 1VCOA 1Z6GA 3GLIB 3DDCA 4JL5A 1XRJA 4B3XA 2J9RA 3BC1A 2ZR7A 4RJLA 2YZ2A 3OFND 5SZKB 1KK0A 2GZAA 2PZEA 4MYUA 3P4XA 4YXWA 4BLRA 5KHOC 2V9PA 4ASUD 2ZJZA 4KVGA 4MQBA 1DBSA 2SHKA 4DDWA 4TYYA 2XZLA 1JPNA 3IHWA 1FP7A 4I81A 3L0PA 1KIMA 2YHSA 4TSFD 1RRGA 1XEXA 3P1JA 3TMKA 4F38A 2YOGA 3K09C 3LQRA 1Q44A 3A1TA 3MWKA 3QEOA 3WMGA 4DLSA 2ZRJA 3LV8A 1GSIA 4CYMA 1CR0A 1U0HC 4UNQA 1E2HA 2ZUCA 5F9FA 4AD8A 4B3GA 4EQ6A 5CDFA 4OK6A 2AFHE 5FOUA 5JI3E 5J4HA 1GL9B 2A2ZA 3K0SA 1G8FA 5E4FA 1XD2B 4NYMR 3K0FA 3IDQA 3OFNA 1C4OA 1IHUA 3R7WB 2ODWA 4NYJQ 3ZD6A 3W6NA 4ASUA 1LS1A 4DJTA 4I1OA 5IT5A 2KSQA 4CT5A 1HQYE 4QL3A 1KI1A 4GMDA 4WXPA 1OH5A 2OV2A 1KDTA 1VG0B 2XEXA 2Q9BA 4P3YA 1US8A 5FPSA 4PXAA 2WICA 3SR0A 4DC9A 2P6NA 5E7IA 2VP6A 4LYJA 2J59A 4ZI3A 2ZXUA 2IUSA 2VL7A 3NC1C 3AUYA 3SE0A 3TRFA 1OXUA 3QBTA 1WRBA 2G0TA 2YOFA 5BYJA 3WYAA 1XPRA 2RGXA 4RFSA 1Q1BA 1N5JA 2AX4A 3CX6A 4TT3D 3GJ3A 4C30A 4DCVA 4WZBE 1R5BA 1P3JA 3WBJA 4A0FA 4RZUA 1EG7A 3UWKA 4C0JA 1KDPA 1CJKC 4GSYA 2K5UA 4RSGA 5C46F 3C15C 2BEKA 4FCTA 4OI0A 2FDCA 2ZU0C 2ZRHA 1KI7A 1CEEA 3KJHA 1GIAA 3U2QA 4TMZA 3SDZA 2QQ0A 3CZPA 4JIMA 3SQWA 5DN6D 1AN0A 1Q1ZA 1FP6A 3NXSA 5KUTA 2Z83A 1XXHB 1E0JA 4Z1MD 3BB1A 3EPKA 1KTVA 4OJQA 1MO3A 4D0NA 5K8LA 1X6VA 2H92A 3T61A 3QOFA 5FPYA 4EUNA 1VYUA 3Q5DA 1U8ZA 2IUTA 4H1VA 1IBRA 4OYHA 3UKDA 5JSZB 3A8TA 4TT3A 2QZ4A 2NOAA 3M6AA 4HYYA 5BXQC 3TW8B 5CLLA 5BWMA 2F1RA 4JLNA 3CNLA 4BPBA 4MKFA 3WY9A 4C0AC 3DVLA 2G83A 2KE5A 4M4SA 4DBLC 4URUR 5TXGA 1X3SA 3B9PA 2QY9A 2ZI9A 5EZ5A 2RGBA 3C14C 3TVDA 3I8XA 1AA9A 2QPOA 1G8GA 5DN6A 1IN5A 521PA 5FPKA 2GXAA 5LBIA 2FV8A 5H70A 5FH9A 3T34A 4Z1MA 3T5GA 4EIWA 1ODFA 1P2SA 2D62A 2VP0A 4JSTA 1XMVA 2GDJA 4Z8YA 3T12A 1G4UR 5KSYA 2XITA 1Z3IX 1GKYA 2OBMA 2REBA 4ZDWA 1DO0A 2D7CA 2ZI7A 1KOFA 1N6KA 4HATA 3WMFA 1X1SA 1KI9A 2X2EA 3OESA 3QKTA 2A5YB 3BBPA 4JKIA 5AJVB 5CB8A 2PX0A 3P26A 3O8CA 2I4IA 1OXSC 2GEDA 1P9RA 2ODNA 2LKDA 1BYIA 3TNFA 3THYB 3ZIAD 4QGHA 5D3MB 5DI9A 1ESNA 1KK3A 1N0WA 2Y8EA 1CU1A 4BE7B 2JLXA 5C18A 5LD2C 1CXZA 1MRNA 4KXFB 3K0AB 1W7AA 4HAUA 1E0SA 2WOOA 3QKSB 2QNRA 4US1R 5CITA 3RHFA 4K46A 4BLPA 5F98A 4DVGA 2QSZA 2VHCA 1QDEA 2FFHA 2Z43A 3KJEA 3QBVA 2PJRA 4Q19A 4TQAA 4FMCF 3RRZA 2HF9A 3IO3A 4MITA 1S2MA 4A0GA 1E6CA 1AQUA 1F2UA 4Y0AA 2HUPA 2D4HA 3Q5EA 4FN5A 3WHKA 4AIIA 8OHMA 3LBIA 4HEJA 3ZIAA 2DCUA 1T9HA 2BMEA 4B76A 4DEYA 4ZI2A 2W2VA 2Q9AA 5L3SB 2EW1A 1LY1A 3WNDA 3B85A 1B0UA 1E9SA 2O0JA 1NSFA 4NL4H 4LBYA 3B1VA 4IXMA 4YC7A 1T0JB 1P62B 3FYHA 2QQEA 3O47A 3LFUA 1GZSA 4TYNA 2G88A 1E2MA 3EASA 2NO7A 3WNCA 3J81k 2VP2A 2BOVA 4M9XA 2QGNA 1NG9A 5IDVA 1E79D 1W47A 2REOA 4IEIA 3OHMA 2JIZA 1G7RA 5A4JA 2CK3D 4OKSA 1VKJA 4PTLA 1P75A 3TVTA 2WMNB 2XAUA 1M7BA 4B6EA 4LV8B 4EPXA 1MO4A 3TSZA 1OIVA 2H7VA 1VCIA 1PLLA 1EESA 2FGKA 1X8KA 2Z5FA 2B7BA 2WWWA 1HT1E 2ZI6A 5J47A 3LQQA 3KJGA 5DGXA 3B82A 4FI3C 1XEWX 3ZS9A 1LS6A 2CCKA 1XD8A 3A37A 1W4BA 2IS2A 3FOZA 1SHZA 4G5GA 2IUUA 1DAMA 2WJYA 3BWDD 3D7MA 4UJ3A 5CYPA 3QUSA 4Q4JA 1E79A 1VECA 3VKHA 3CF6R 4PHGA 1JQLB 3SQXA 2CK3A 2F55A 4PX9A 1GTVA 4O0MA 2AK3A 4JL6A 1XF9A 4QJ4A 1WQ1R 5FTKA 4RD2A 2O8DA 3UMRA 1NBMD 5AWFC 4TZ0A 2WWYA 1DAFA 4IDQA 4TL6A 4TQUS 1E9AA 4NMMA 2MSCB 2HYIC 1AM4D 3TLXA 4JYCA 2XXAB 3RRMA 1Z06A 2P6RA 1SGWA 2PJZA 4JVSB 1GL7A 3AF1A 3VFDA 3IIMA 1RVDA 2A30A 4GRAA 4LBWA 1Q12A 3D8BA 3EZFA 1WB9A 4M53A 4B71A 1OSNA 2DWPA 3VKWA 2PMKA 2DFNA 2GF0A 4XWOA 1A1VA 5ANRB 1FTNA 2XZPA 4N0DA 4TYPA 3A6PC 4O2LA 3BS4A 4QG7A 4M2LA 3GJ6A 2H17A 2QROA 1KO4A 3K0EA 4KHZA 2WKRA 4CIDA 1NBMA 3L8YA 1E2GA 2C95A 4XTRA 2N1BA 4HB2A 5FTJA 1XEXB 5FOXA 2C99A 1UEJA 4NCHA 4BWYA 1OFTA 1CF4A 1MO5A 3TAHA 1SVKA 2WJVA 5A5GA 1TU4A 3RDPA 1DTSA 1XD9A 2HT6A 2YYZA 1TPZA 2TMKA 2P5SA 3EIEA 4EQ6B 3V9PA 2C5LA 2AHOA 4A4DA 2ZRIA 1D2MA 1KKLA 3E70C 4PQRA 1H65A 3CONA 1W4RA 1WMSA 4MYCA 4BASA 3C16C 5FR1A 3AVTA 4F7WA 4OHZA 4RZ2A 1G4AE 3GFPA 3U3RA 4J0QA 1E9RA 4CEHA 2O8EA 3K9HA 1Z5ZA 5KSZA 4HDQB 2FSFA 3W5JA 4PAQA 1US8B 1L4UA 4Q66C 4DSTA 2XNDD 1U0LA 3OIYA 1P9NA 5BN5A 1IY1A 4PPNA 2GXQA 3CZQA 4OBEA 5TV2A 4HB0A 3AEZA 2IYTA 1QHSA 1SXJE 5FL7D 1T3LA 4RKEA 4BFYA 2VRWA 3CR7A 4KU4A 4RFSB 3EC2A 4MYHA 4NCNA 3B1ZA 2NZ8A 4M9ZA 4JYBA 1G7SA 2JLRA 5FL3A 4C2TA 2HLDD 1G5TA 4P31A 3I3SR 1MO6A 2V55B 3OEHD 3LX8A 1PLKA 4N0EA 3FKQA 4Q1EA 3SU8A 1LFDB 1L7VC 2MSEB 3FHOA 2PCJA 2XNDA 2IW3A 4Q7JB 1Q1EA 2PL3A 5KDDA 1FL9A 3X1ZA 1G3RA 2ZJBA 3HU1A 4HAVA 4RD6A 5TDHA 3VR2A 5EXPA 1AIPA 1B23P 1U9IA 4LOAA 1E2JA 2C78A 3CLVA 3FTQA 1SVSA 1ZRHA 3MMPA 4B47A 1A82A 1DAEA 2ERXA 2XJ4A 3DPUA 1ZW6A 1G17A 3RYTC 1IN8A 5B58C 4OQLA 4MDEA 3B7GA 4Z8XA 3TGPA 2HLDA 1VG1A 4QGAA 2HYDA 3ZVNA 3OEHA 4MRRA 5EE1A 4XJXA 4NYJR 4D4KA 2QTHA 4NYIQ 2F1JA 3LBNA 4GZLA 1F2TA 4IVQA 1U9IC 2ZROA 3LWNA 2DHRA 1YR7A 3VQTA 5L8VA 1II9A 3TJZA 2ZJ8A 4URVR 2IS4A 2IYUA 4LPSA 4W5WA 5JEEA 2Q21A 4KYIB 1R6BX 5TMPA 5JS7A 1U81A 4ZIRB 1VPLA 1E3MA 3ND8A 4H9GA 4KJZA 5LD2B 2XX3A 2ODBA 4DSUA 1XJ0A 3RRNA 4ERNA 2EFEB 1R0WA 3DO6A 2YWEA 1ZCBA 4BGDA 1KMHA 1II0A 2QE7D 1ELOA 4WOPA 2C2HA 1OH7A 3NKVA 5EUQB 2C8VA 1KGDA 5FBLB 4AYWA 2Z4SA 3SI7A 3LAWA 5FI0B 3AQ4A 2QTFA 1NY6A 2V54A 2CE2X 3ZVRA 4GFDA 3PG5A 3QPVA 2A5DA 2PZFA 4P4TA 4QBGB 2FN4A 1N6IA 3L0SA 1QG2A 3PCRB 4OJKA 4V0KA 4YMUA 2OUKA 2R2AA 2ZSFA 4ITRC 1EX6A 1JR3E 5DHAA 3ZZUA 4GMXA 4LJ7A 1DADA 4KFTA 3DM5A 4GZMA 2I1VB 2WMOB 4LX0A 1LV7A 1YE8A 1ZU4A 3VHLB 4TTPA 2H16A 3I73A 4DCNA 1Y63A 4QOSA 3GP8A 1FPMA 4LHZA 2GVDC 5EXTA 1W0KD 3GJ5A 4M1OA 1VTKA 2EFGA 3KX2A 2QN6A 4C7OA 2F3RA 2IYRA 3A4LA 3GEEA 4Q4AA 4M1YA 1LVGA 3TUIC 4I4LA 4PSAA 3CPJB 1V5WA 1NVVQ 4FWTA 3TAUA 4D2IA 3ZVLA 4PFSA 5FTMA 5KNDA 3WBKA 3DMDA 2IX3A 1XJCA 1GL6A 1KSHA 3SFVA 2NO1A 4B3FX 5JWHA 3T1QA 3CWQA 1ZNWA 2RB4A 1KI4A 1EFRD 2VEDA 2JAQA 4LBZA 1CR1A 2DYKA 3NEJA 4JBXA 3ZH9B 1OT3A 1W0KA 1ETUA 1NN5A 2QBYB 1CTQA 1ONBA 1GILA 3IIJA 5F3WB 3QPUA 5DYGA 2YC2C 1IN6A 1GNRA 2XNSA 1HURA 3WP0A 4Q48A 2RGDA 2I3BA 5JBQA 3EG5A 3NBYC 3GFTA 3THYA 2ZJ5A 4GDFA 2ZJYA 3M1IA 4NH0A 2YC4C 2JGNA 2QENA 3AF0A 2R6FA 4NPHA 2Q3MA 5J4KA 4DLRA 3UMFA 2WAYA 3B60A 1DVRA 2QT0A 2FFAA 1EFRA 2WJIA 2OAQ1 5JRZA 2GAOA 2P6UA 4Q4JB 2GESA 1NLYA 4JLJA 4G01B 4G5SA 1QVAA 1NMYA 4QBHA 4TYQA 3B13B 3BFXA 4LHWA 1XTKA 1E2IA 1KAOA 1KO5A 2D2FA 4R7ZA 4BUJA 2O8DB 2O52A 4HLDA 4WAUA 1FX0A 4XVRA 1WBBA 2I1QA 3EZ6A 4QBIA 3VR4A 1XMJA 4KV9A 4HUTA 2G0NA 2XJ9A 4GP6A 2GA8A 5KOYA 3AVWA 1P6XA 2DFKB 3B1XA 1ZIPA 5K8IA 1D2NA 2VP5A 1GG2A 3U6KA 2HCJB 3ADCA 5FBQB 1VHTA 3ADDA 3OAAD 3D31A 1NP6A 4MDFA 1W1WA 4BFSA 2WJJA 5EP2A 3I5YA 3PEYA 3KJIA 2C98A 3X1XA 2GWHA 3NIBA 1M34E 2O5VA 6Q21A 2GK6A 3C41J 1Z2CA 5EP1A 1LF5A 1TQ4A 3PQCA 4LK2A 1XPOA 2KBEA 3P27A 4KYUA 3PXGA 1YRAA 1TQ2A 1FNMA 4M21A 4URZR 2ZR0A 2CMKA 1BYUA 1Q21A 1TADA 4EAQA 2OLKA 3EZ7A 3OAAA 3QKUA 4QM7A 1HE8B 2FEMA 2ZS9A 3H1TA 1TF2A 2F9LA 4L9SA 2J46A 5E7JA 2ZRCA 1R2QA 5FR2A 2O8EB 4TLCA 4CEHB 1J8MF 3ZQJA 3FPAA 3QXCA 2ZRLA 3TQFA 1XTJA 4NE2A 1CJMA 2CL7X 2W2TA 3TIFA 5TVKA 4E03A 5EE5B 4LDJA 1S8FA 2R6GA 5KNCA 2FWRA 2EFDB 3JVUA 4DUGA 2OAP1 4BEJA 3UPUA 3B2EA 1S1MA 4ZDKA 2R6DA 3ZS8A 2NO9A 2EU8A 2GEUA 1YHNA 2KI5A 2W00A 4BFZA 3DZDA 1K6MA 1UBGA 2F43A 3UXMA 3GPLA 3HWSA 1BKDR 2JJ1D 4Q7MB 4CDGA 1A2KC 1P7CA 1ZD9A 1ZC4A 4EPVA 2MMCA 3O8RA 1DARA 3AF4A 2ORWA 1VIAA 3EPLA 1Q1QA 3KXLA 1VYVA 4E07A 3CNNA 3I92A 4LJ6A 4O2RA 3VTKA 1G8HA 3FFAA 3KB2A 4QXAA 2VP9A 2XTMA 3HPQA 3CR8A 3LD9A 1S1CA 1JEEA 4II7A 1YZNA 1N0UA 3X1DA 4UXJA 4D82A 1U0JA 4ON9A 1LTQA 1RJ9A 2E87A 2HDNB 3PVSA 1AKYA 3CIOA 5EE3A 3TSOA 2J0SA 2E1RA 2GJAA 2JJ1A 3AF3A 3AH8A 1YQTA 2C9OA 2AD1A 4A15A 4TQ9A 2JATA 2R6CA 3CUEF 2DFTA 4W9MC 2W6JA 1TMKA 1G18A 1JAIA 3EX7C 4FCVA 4K8OA 2VYFA 4YONB 2H5EA 3RC3A 2GHIA 5FPTA 4G0NA 1JJ7A 2G1KA 1FNNA 2NQ2C 1QHXA 2XTZA 1F2TB 2OG2A 2OO7A 4US0R 2OFWA 1G8PA 4WA7A 4NP6A 3MAAC 4IOJA 2FZ4A 4EPTA 1O3YA 5LPNA 5JJLA 3QPWA 1U94A 4DLZA 2R8RA 2WKQA 1T4GA 5JWRA 2EFHB 3VHXA 5UKDA 3SEAA 4W5JA 2Q3FA 3KKQA 4TMWA 3SJAA 2ZEJA 3GD7A 2Q6TA 3NDBB 2F1HA 4IOMA 2CL6X 2VHQA 1HH4A 5KYKA 1KMHB 4CRWB 5JLJA 4MGZR 1G3IA 3C4JA 5FFMA 1OF1A 1QZXA 4XH9B 1KZGB 4HLCA 4MA4A 2NO0A 4Q00A 1KI2A 2ATVA 4A0HA 2ZITA 2YVUA 4PQYA 1XEFA 421PA 1YR6A 2G6BA 2ZRPA 3WNBA 2ORIA 4DSNA 3BH0A 2ZUBA 1J2JA 2OFOA 4L5BA 4RY2A 4AKHA 1KZ7B 1S9DA 1X8LA 3BJIC 1KI6A 3QQ5A 4HUQB 3RNLA 2P5TB 4JLAA 3FMIA 1UKYA 2KWIA 1NN0A 2CLDX 1VG9B 4DB2A 5J4LA 4HLUA 3AKEA 5GVRA 1UF9A 2CNWA 2BCGY 2A5GA 4MRSA 2BDTA 5H68A 3WRXC 3CRMA 4B44A 4F92B 4DDUA 1NN1A 4IVRA 1E2NA 2IXFA 1X8JA 2FOLA 2W6ID 4OHVA 1OXXK 1AS2A 4PC7A 2YINC 1OFUX 3H86A 1VDZA 4Q9HA 3TH5A 2ZANA 1OYWA 1P4SA 4OI1A 1DAHA 1UAAA 4GOJA 4DXAA 3QVVA 3LH5A 3AVPA 4B75A 2HV8A 3QI2A 3MRSA 4C7OB 3EW9A 3SBDA 4HLUC 4Q4AB 2ZYVX 4LYAA 1BS1A 1KDOA 2CLSA 3BB3A 4PZLA 1VCMA 4NBSA 3V4FA 1XXHE 2RGCA 3C5HA 5EP3A 3TW4A 3I5XA 4PC6A 2UZIR 5K8UA 3GJ4A 4PHHA 2BBOA 1PJRA 4URYR 5JI2E 4PR0A 2MMGA 4AWXA 3FKSD 4NYIR 3NG1A 2JJ8A 5CB6A 5F2EA 1DS6A 2ZE6A 4DLWA 4MGIR 2W6IA 4B48A 5ELXA 4TMXA 4IDOA 3MJRA 1A5TA 4YQFA 4ZIRA 4F4CA 5HCIA 2JCSA 4B34A 4MKHA 3R9IA 3PUYA 1JR3D 3FWYA 4KFUA 1CLUA 2JDID 2JLYA 1GM5A 2WOJA 3ZZ0A 4C0HA 1KO8A 1KY2A 2ZAOA 4Q7KA 1F5NA 5SZHB 2BKEA 1NL3A 2D2EA 3Q8XB 5DNYB 1Q3TA 3KKMA 3QG1A 2F3TA 4GPTA 2GCOA 2ZJ2A 3AKDA 2C03A 1YR9A 2J5XA 3QNUA 5L3RA 4D25A 3FKSA 4IRUB 3HJNA 4Q1DA 2OE2A 4MGKR 1HYQA 2QP4A 5IK2D 1GRNA 4RVCA 2EWWA 4B73A 1JI0A 1R8QA 4C0SA 1ZC3A 4I1UA 4BLTA 2PEZA 3MWJA 1WF3A 1JR3A 3AKCA 4TL9A 2JDIA 2Z0MA 4FD2A 1IY2A 4A8JA 5AUOB 1IQPA 1FX0B 1ZM9A 3OIWA 2WSSD 3I1FA 1PLJA 1N5LA 2JIZD 4OQXA 1YKSA 4P4UA 3ICEA 2GXSA 2IEYA 2IF2A 3A4NA 2O8FB 4UXIA 3ZYCA 5GADl 3TR0A 2DPXA 2HT1A 1FFHA 3DM9B 2ZRKA 4G5RA 2B92A 1W36D 4QFMA 2ZPTX 1A4RA 2WBLC 2ZUDA 1N6HA 1NVVR 5IK2A 5CIWA 4A8JC 1XMIA 3JVVA 1EFHA 1UM8A 2WWGA 4JT2A 1OHHD 1KK1A 1Y3AA 3QXJA 2FF7A 3QIAA 2V3CC 4Q01A 1CJTC 1YZGA 3VU9A 1E4YA 3P32A 1PZNA 1JXMA 4BFVA 4R71A 1II8B 3L0OA 4X8OA 2WSSA 2QMHA 5BN4A 4JVLA 3KUCA 4AC9A 2AD5A 4XSGA 3BH6A 4FWIB 5HZKA 1FUUA 2J87A 2QBYA 3VR5A 1UDXA 1ZNXA 2CL0X 4JJZA 2NPIA 2OLJA 3IILA 2A78A 1KO7A 2BMFA 5TB5A 1XEWY 3EAQA 5LB4A 3UANA 4JVMA 1OB2A 4D0GA 3U61B 2D7DA 2FFQA 3TR5A 3A58B 5CJ2A 1OHHA 2BHRA 3OIUA 1Z07A 4BQSA 4EPWA 3IEUA 3Q9LA 5AR1A 3V00A 5DH9A 1XTIA 3DL0A 2QPAA 4ZPXA 1R0YA 1PVOA 1BOFA 2IXGA 1P5ZB 1DELA 5DISB 1GNPA 2FE4A 1SVMA 2LWIA 3NH9A 2X2FA 4FMDF 1Z0IA 2VP4A 4CT4B 4ZDIA 2C9CA 4ACAA 5F9HA 1W36C 1G9XA 4PAOA 5FOSA 1TEXA 1TNDA 4XD7D 3WP1B 3W3ZB 1M8PA 2ANBA 2V1XA 3W6PA 3X1YA 1Q20A 1WA5A 4D4MA 1XTQA 2X1VA 4MH0R 1XNJA 4AG5A 2YKGA 2A7QA 3IBYA 3DKPA 3BE4A 1IXSB 1QVRA 2F43B 4G5QA 4DDTA 4L9WA 3MCAA 2QGZA 5JHHB 3ND9A 2HXSA 3LY5A 4A2PA 2OCBA 3NH6A 1S3SA 3ICQB 2HJGA 3DZ8A 4MKIA 3VX4A 4PZYA 2E9SA 1KJYA 821PA 1W44A 3N2IA 4M22A 3D6TB 4XD7A 1W5SA 2WIBA 1W2HA 3CRRA 1JAHA 1J90A
chains in the Genus database with same CATH superfamily
1K5DA 3AFGA 1WW3A 3OT4A 2P1ZA 5I9NA 3SJZA 2OZEA 1JTEA 5LU8A 3F98A 4S1WA 4DNOA 5HX7A 4FP9A 4XW2A 4I66A 3TKAA 1P9WA 1NZFA 1H4SA 1GUZA 1RJ9B 2O0MA 4J07A 4RCVA 5FTLA 4C4XA 3U4QA 4G8DA 4FQ5A 1VZ3A 5HILA 2O1XA 3AILA 1NQ5A 3VR3D 4CCYB 5J5VA 4XEUA 4L0DA 3LQ2A 4XWTA 1BVUA 2R00A 3LOPA 3G8YA 4KX3A 1V9CA 1KZ9A 1TA4A 2BMJA 4DHEA 3KQYA 1XTUA 4P86A 1L4NA 1P4JA 1XXLA 3OMWA 3AVXA 3ABZA 4Z9FA 1CVIA 2QP3A 3DLPX 3OFKA 3UMVA 3WK6A 2PVPA 2LCFA 1T4CA 3D0OA 4X60A 1RMQA 3S70A 3WNZA 4C3UA 3EFOB 1N7HA 5D6NA 4I2NA 1B6SA 4YMVA 1FYWA 4FOSA 1PFYA 1DKLA 1MB0A 4Z4EA 3JPWA 5BWOA 1J56A 5IC5A 2VHTA 4CEJA 1O94C 2H63A 3GLFE 3MOSA 2VUTA 2GBLC 3UWDA 4BEBA 2BUAA 3VHXB 2GTPA 2GILA 4B4KA 2PK3A 3AUSA 4QXPA 4Q15A 1UL1X 3MTEA 1DTEA 2CJWA 2BJHA 3EYWA 4ZYXA 1I51A 1NOIA 4LZNA 4W82A 4LISA 5JY6A 5K7SA 1XPUA 1DG1G 3HJHA 3FG9A 1Z0JA 1WQ3A 2C5SA 4XJTA 5SZIA 3ZV5A 1ZGAA 1BMFD 4H7DA 2ISCA 5FUYA 2GF2A 4BNKA 2PNJA 3ANYB 1ESCA 2FG6C 4QVKA 2HJVA 3ABRB 3KNZA 4LV5B 3GLHE 3V7YA 2JVIA 1Z6YA 1XU7A 4MWZA 1M5UA 4ZREA 1G8YA 4ZU3A 3C6XA 4GI7A 3KQPA 1JKIA 3SDSA 1E20A 2OT3B 1ITZA 3IR6A 3DMNA 4KPGA 3B53X 1K2WA 2VJAA 1T9CA 5AKGA 4ZHQB 1U99A 3I2GA 1R5OA 4UFOA 4EPYA 4UTPA 3TQQA 1DG3A 1U98A 2IT1A 3BGSA 4MINA 4YUXA 1B8NA 4XAQA 2R60A 1TYEB 2MDTA 4HMOA 1IAQA 4FEEA 4P4LA 2PIAA 4YMGA 2YXBA 1WMFA 1YDHA 4IJWA 3SYLA 2CUZA 5FUXA 2PO7A 3IPYA 5IBQA 3ZW8A 2XBMA 2IIBA 4I99A 1KPGA 3KKKA 1XJQA 1FFAA 3WQHA 4P8RA 4ZCMA 5IEJA 5L7WA 1XYVA 2RBEA 3STWA 2XSZA 3A9WA 1CUWA 3AEUB 3K4HA 3AUAA 3BMXA 1NXQA 1Z63A 1PJ4A 4U9UA 3SNHA 1FA9A 2ESRA 5AM2A 4L0QA 4IYJA 4UATA 1G64A 2NU8A 4NZYA 1NUHA 3KLOA 1A95A 4M99A 4HF7A 2Q1TA 3GPDG 3OCWA 4MUAA 5LIRA 1YZUA 1I7SB 1UZAA 4IAOA 1P7VA 2P62A 4D46A 2NSLA 1QQ6A 2G72A 2CY0A 4P5DA 4JC8A 5AMXA 3PV0A 2WK1A 1X9GA 4YAJA 1T0HB 2E6UX 4N0QA 4FWBA 4D98A 3FSGA 1HE5A 5F1PA 4RTKA 4CDMA 2RCNA 2VT2A 4IEFB 1YZKA 3VV2A 1RP7A 1G55A 4AJLA 1PL8A 1IYZA 1DX6A 1I2AA 3R7SA 3AXTA 4XVUA 3N8KA 1Q0LA 3U7RA 1YMUA 5EGSA 3CO0S 4GHWA 2VA8A 2VP3A 5FA5A 5K0BA 3I61A 4P1ZA 2FK7A 1LB1B 3WI7A 1XVAA 3GRVA 3L1IA 5L40A 1GQSA 4TWBA 4BO6A 1CNMA 1S4QA 1FRFS 1GZHB 3I5MA 3LA8A 1H85A 4HCJA 4IG9A 4L9AA 1LSSA 5TMDA 4LZWA 5JADA 2DTXA 2GEVA 3EXAA 4LJ4A 2A9FA 4KNWA 4Q4HA 4XSHA 2VPYA 3CKLA 3O90A 4NENB 3A11A 4ZQFA 3U3JA 1E0KA 2ZUWA 3FMOB 3I9V1 1SC4A 4MVCA 1S5PA 3PTAA 2W0SA 4WGFA 4ZVOA 4AB1A 2VAXA 4RX1A 6PFKA 2NO6A 4Q21A 1MF7A 1NM5C 1Y1KE 4H3VA 1VGQA 1MVNA 4ZEVA 4G4SP 1MNQA 3JQ7A 3LA6A 1QJ4A 3MLEA 3OU6A 4PSDA 1COZA 1HRDA 2YWBA 1U1FA 2H1VA 3PC6A 1P1IA 3SKYA 3AK4A 4Q9JA 4Y3UA 2OG1A 4JGGA 1FYEA 5H7XA 4LV6A 2W6MA 1NKSA 1YMVA 1XZQA 3BGWA 4CV1A 4DIDA 4L72A 4UHDA 4S04A 2P9TA 5GADl 5J2TB 3EVBA 2HFKA 2BHSA 3T3IA 2AI2A 1ZD8A 3KOMA 2OGZA 3HXPA 1Y82A 3ACDA 1H2YA 2FHSA 4EUSA 2R0QC 3ZQ4A 4BQEA 2J5RA 3PGJA 4WN9B 2M2IA 3W4IA 2XGSA 3G0IA 3I9JA 1L2TA 1N6RA 3RC1A 2QUHA 1RQGA 4M38A 4UD6A 5LC1A 1EDZA 3CJTA 3N74A 4KLAA 1XAJA 1KXJA 2HCBA 1B3BA 2IXEA 4AN0A 1EVEA 4LQ4A 1EHYA 4BO1A 1Z22A 2PMBA 4DIFA 1YZHA 2ZT7A 1Q77A 4MK4A 4FGLA 3BRWA 3BCRA 2YXLA 4DMMA 1DUVG 4B4UA 3G13A 3QY0A 3CLKA 2PGNA 5DLDA 2Q8NA 4LWZA 2C2XA 4K87A 4BB9A 4Q9KA 1JFVA 4F6CA 2ECOA 4LFBB 3NNSA 1QONA 4BX8A 4AZVA 2CFOA 1ZVKA 2WRZA 3IUPA 4FFSA 3I32A 5HCUA 3U9LA 4CM3A 3CSSA 2NU7B 1SIWA 4YAWA 5BN4B 3Q7QA 4UU8A 4ZU1X 3M6MD 3G2PA 2MR5A 3P9KA 2AJBA 1OTHA 2IP4A 2NM0A 3TUJC 3CB4A 3U37A 4YNBA 3RBXA 1HORA 1BEUB 2C96A 2FYTA 4MPJA 4JEHA 4Y7CA 1GRQA 5HKOA 3DE7X 3O93A 4L0MA 5KQLA 1A8UA 3AM3A 3O3NB 1JN0A 3SWWA 1WLYA 1OWMA 3TLGB 1VE9A 1DOHA 2IZZA 1E2PA 3LBHA 4FFPA 5GJVC 3F8WA 1P6UA 1W4CA 1ZZEA 2ZRFA 2PN1A 4LI3X 1P4HA 3JQEA 5I8ZA 3AZOA 5FNZA 4A2WA 4L5IA 5DXJA 1BCRB 3R4CA 2ZIZA 1GRCA 5T57A 1QGED 1Z6TA 2QU7A 4XI9A 3ROXA 3QVSA 5JAZA 1RE1A 3WZLA 4IDDA 3HKCA 3GDHA 4QXMA 1BGWA 4JWKA 3THWA 1Z0DA 3FPFA 2QXYA 3LUJA 5AK6A 2AYXA 1B3RA 2ZW9A 2V65A 4YLGA 1GZ7A 1QCZA 1EHIA 3PXEA 2O20A 2I0FA 1B15A 1J42A 3EOZA 2EYQA 3PXDA 2NQTA 4L15A 4EOGA 1X86B 1W0JA 1TD9A 3BGOS 4IDBA 1X9IA 2FW8A 2Y9PB 4B32A 4QJ3A 3OE4A 2IHNA 5HJ5A 3M6IA 5JSHA 1NC3A 2HY7A 2YQZA 4CKBB 2QP9X 3FGNA 1SRRA 2H85A 2PX8A 3THRA 1C0PA 4CI0B 1K4YA 5CPFA 2B5VA 1KA9H 1QH8B 1R3UA 1V6SA 2ZPAA 3L5KA 4EHLA 4OJMX 2FPXA 3PC7A 1O9GA 2FX3A 4IIJA 3WICA 4JOQA 1TF5A 4LYEA 2CYAA 3QBDA 1HG0A 3IRUA 3PRHA 1N5KA 3HDTA 3VC2A 4YT2A 1NASA 4RJJA 3NVKI 4B17A 2BD0A 1A4IA 5DIFA 1FVFA 3THOA 4CHGA 4G4SO 1K5HA 1N3LA 2A9KA 2YVAA 5JD3A 4URXR 1UEIA 2FZLA 4QHYA 4TXLA 5FOWA 2JFZA 1PDOA 1NUAA 2VTDA 3G9XA 2Q3LA 5FF9A 5GONB 1QGYA 1EUCA 2VK2A 3PNKA 1M34B 2EYUA 5CTAA 1II8A 1HOXA 2ZQZA 1PKXA 1L1QA 1UC8A 2EOAA 3CO5A 1QV9A 1Z13A 3QU4A 5KAMA 2E85A 2Y1OA 2GUWA 1O0CA 4AO6A 4DV7B 1ZJZA 4K26A 4KSBA 3ROGA 1UZUA 3MWLA 5GGYA 1CRQA 1NMXA 2SKCA 3AVOA 3H5AA 5I7UA 3EHEA 2AMYA 4MV0A 3BORA 3NBUA 2C2YA 2JBHA 3KUXA 3T06B 4KREA 1A7JA 3Q3IA 1JJBA 1XTBA 4LJLA 4RORA 1NURA 2NU6A 2K87A 2NT3A 2XA1A 4OHXA 5JFGA 1KQ3A 1XU4A 1EX9A 2GM5A 4XIGS 1DFGA 3WK8A 5G0VA 1OX5A 2EQBA 3JCZA 1N0VC 2NVBA 2HH9A 3P0HA 2C2WA 4PLGA 1UXOA 2P9EA 2HXYA 2J3HA 3DUFB 4OXRA 5CT4A 2J85A 3SOPA 1WVMA 3TL2A 3DJFA 4MTCA 4Y6GB 1C4XA 3TO5A 5AM1A 5CBPB 5D84A 4B7UA 5K8JB 4CTOA 3SHWA 1W85B 2VSXA 1NNLA 3K92A 2JIPA 4RKQA 5IXSA 1VMDA 3QPAA 1WUYA 4YRIA 3HJFA 4EF6A 2JG3A 1NJ1A 2BP7A 2W4MA 5DT2A 3TAXA 2QTVB 3OKFA 2AC4A 1XJ5A 3EZGA 1J8YF 3LQ4A 2OM2A 3SS8A 2NTYC 2QX4A 3B3JA 3C6QA 2QAGC 2Y67A 4I7EA 4AJIA 3HWRA 1EXNA 2O0HA 2RG7A 4CCSA 3AY3A 2C9YA 3ZY6A 4Q1BA 4OUDA 3HEAA 3PX2A 5C1IA 4IY1A 4UXHA 3S2IA 3UPTA 4DV6B 3FNQA 4IXNA 4GOND 5AK0A 3VPHA 1Z6ZA 3EZYA 1J0CA 4LNUA 4PO8A 1S7GA 1J20A 5C5IA 3VNRA 3ER9A 4K9DA 2ZYWX 1NJGA 1A2BA 4DZZA 5LL6P 1F9EA 3MJ4A 5IYZB 2Y1EA 3IQDB 1G6HA 3K96A 4JLOA 3HWWA 3G0HA 3UQYS 5BMVB 1CS4C 2QRNA 3EW7A 2IZ7A 3ASYA 1Y3DE 4GF5A 2V1UA 3H04A 3NANA 4C2UA 3KP1A 1RRFA 4RLQA 4YMSA 2OBXA 3E9CA 4BVHA 3CW8X 2HNBA 2ATCA 3P45A 1K3FA 3TZHA 1VLLA 4KCGA 5CM8B 3NWPA 1ZUIA 2AHRA 4ASUD 1FJGB 1YB7A 4DR1B 2FU5C 2ZE7A 4MJLA 3DOEA 5BNTA 2WWTA 5KB3A 5KBYA 3AFOA 1MMFB 3UAYA 3IQGX 4ZN6A 5TNXA 5IJZA 4A1OA 2QTRA 4CCAA 2HO4A 4DQLA 2C2ZA 1LKZA 1S3IA 3HKBB 5ESDA 1R9JA 3CH5A 3SE7A 4KO2S 1F9AA 2EKDA 4R6WA 3A9TA 1OC4A 1M83A 1JI3A 2Q9CA 3O21A 3MINA 1JXQA 2C1ZA 4JS0A 3OZTA 4MP8A 3GGPA 4P58A 2EBUA 4Q6WA 5E6SB 1SKAA 2FFBA 2Y66A 3SXPA 4QLOA 1Z4JA 1VSTA 2VUSA 1B8VA 2VEOA 2W0MA 2XBLA 4Y1FA 4M7WA 3UK0A 1JR6A 3S5UA 4JBWA 5JNVA 1GNQA 1HE1C 1SXJD 3G85A 1WZIA 3DVAA 2EGHA 4BV3A 1R66A 2HGSA 1PP4A 1ZGJA 1ECPA 2P9HA 3RYFB 2IA5A 3UIEA 2BE9A 3OBBA 2BHLA 4ZOLA 1A27A 3N53A 3TD2A 4CV3A 5IN4A 4JROA 1LW6E 3RRBA 4CF3A 1XZDA 5FIUA 3S0JA 4S35A 1ZP6A 1T0BA 1N77A 4ZZ2A 4RH0A 3GQBB 3HCPA 1SOMA 4ND6A 3F5SA 4OXIA 3TTSA 5KQPA 5EYPB 2VXCA 3AL3A 1YNSA 1Z35A 2TECE 5KEIA 3A31A 2CBZA 4RA9B 3VNUA 3ZTYA 4F2PA 3Q2KA 3GGJA 4XIFA 4AF8A 2Y1GA 2C59A 1PQWA 3H11A 2V7XA 3HV0A 3LKZA 3INYA 4FPXA 4YRNA 2I6QA 5MN6A 5BOSA 2FUG6 3KG2A 4TSFA 1YI0A 2HA2A 5THXA 1LLUA 4KG7A 4OIMA 1LPBB 3SYKA 4UTVA 1UMKA 3JVEA 1DAGA 2RK3A 3L4BC 4OGWA 3BL8A 3LLUA 3LVQE 1C81A 1IZYA 3C74A 3IAM6 5HZHA 4FK8A 3AJDA 1FP4B 4IIFA 3LHKA 2UZAA 4PG6A 4BRWA 1ZR2A 1X1RA 2ANCA 3F7OA 3U81A 4O2AF 1PKEA 1CNEA 4TS9A 5CCBA 1V8OA 1VBNA 1ZVMA 2W2OA 5PGMA 1I94B 1CZKA 3QPCA 3UXHA 2F00A 1C7RA 1X1AA 4OH7A 5FLKA 5KYXA 4B87A 3U44A 4GW3A 1X13A 4BQNA 4YRAA 1P4AA 2ATXA 1G38A 3TNDA 1XL1A 2E1PA 4YJHA 4WESB 2X58A 2W2MA 3SS9X 4I55B 2I9PA 3WMEA 3HE3A 1EFKA 3MYRA 1I24A 3QXSA 1CZOA 3CRVA 3QHAA 2CCGA 3OJOA 3VBEA 3DFKA 2Q0QA 4D44A 1JA0A 5E7MA 3UB2A 4K88A 3ITDA 3SMVA 1H6DA 1Y1QA 1Q15A 1ZJ4A 3D43A 4KR2A 3WGLA 4J75A 1QH1B 1MU0A 2QD5A 4QOGA 2DZDA 2GZHA 4AS2A 2HPHA 3OZ7A 4XLZA 5FA8A 1P19A 5U4XA 5K8VA 5KTRA 2PT9A 1IJBA 3IPCA 5DGHA 5EZSA 5AW6A 3MWGA 4E2WA 2DKFA 4U2KA 4I8DA 3S7ZA 3WNVA 2WVJA 2PX3A 3G2JA 3KHTA 3HXQA 2O8BB 4KWHA 5DLQC 3SZGA 3TX2A 4LHXA 2C4TA 3FCXA 4IKPA 1Q91A 5FEUA 2AI3A 3DMYA 3R9XB 2JJQA 2IC5A 1PTJA 2D2IA 3IULA 4DLTA 1LC0A 2V98A 3QOXA 3N6XA 4OHBA 3H2BA 4DQKA 5LLDA 4GXRA 3L8HA 3RHSA 4H1HA 4FFNA 1A50B 2OD7A 2C0QA 1PIWA 5HM6A 2CBXA 4I4CA 3DCIA 5L95A 2ZWVA 1SNYA 3IOCA 2WWXA 5GOTA 3CF4A 3LNTA 3NZEA 4PHFA 1IBKB 1EEHA 4DT1A 3ASVA 4TMKA 4HVAA 2Y1KA 1NWHA 4D99A 1R0BA 1WCV1 4OLAA 3DE6X 4Q9DA 1PJ8A 1HM5A 1T2CA 5AO9A 3AI2A 3C7CB 4OYYA 3BVPA 1B1AA 3HR7A 2O7VA 2BWJA 4Q1FA 3VPCA 3N75A 2I9KA 1E9BA 3RJMA 1UFOA 1ZRSA 2KBFA 2I29A 1ZM3A 1ULTA 3GOQA 4TTQA 2EXXA 4YCAA 3RTGA 4NV3A 3FPBA 4RF3A 1AZTA 1I0IA 2FRXA 3CX3A 2QORA 3WA6A 2A14A 2A9VA 2I54A 1ZJJA 1FLVA 5GV7A 1NBWB 3CCFA 4B2LA 2YVQA 1PFQA 2NZVG 2C77A 3RVMA 3N3BC 1HZZC 4AY2A 4YPOA 2BUCA 1CQJB 3I0ZA 5CFPA 1GA6A 2FSVA 4TT8A 3HXKA 1VXRA 3A2LA 4C20A 1CZHA 3ZYZA 4A36A 2PIDA 4TRNA 5HK8A 1VE5A 4XLLA 3K0CA 3RSLA 1BHSA 1DCMA 2QVLA 4L6AA 2H57A 1S2GA 2XIJA 4O0LA 3WYFA 1FMFA 1ZVJA 2GD0A 4LJ9A 4AX4A 3MJHA 5IS2A 1E1YA 4FDAA 4MVJH 4YJFA 2HAEA 4ZVPA 1RE0A 2PKEA 5EZYA 2PZ8A 3GX1A 1XIVA 1U8YA 1YRQA 2H1LA 3ROFA 4Z7QB 2ZE8A 4MS1A 2QYHA 1CEYA 5IAEA 3OZXA 2FA9A 3LKDA 1BEEA 1YASA 4X20A 1XB2A 2XVYA 2VT3A 3H18A 5BSTA 1EFPA 2JBWA 4X63A 3BRCA 2OHHA 2OQRA 4JBLA 5LZ9A 2XTAA 4REQA 1GFWA 4CQJA 4XUGB 1SCJA 4F2DA 1JWAB 1W5TA 2ZTSA 5KTYA 2L19A 2BBWA 3VA7A 2XZDA 1QHNA 1NV9A 3VU8A 2ILTA 1ZO8A 4K6KA 1D04A 3M34A 3NHMA 4TWRA 3TI7A 1P0CA 4QM6A 5AHKA 1NDHA 3I8OA 4MLZA 2Q1UA 3L6DA 2QAGB 1G291 1E2QA 2DKOA 2R6ZA 2XEDA 3SF8A 1WMBA 1E96A 2OB1A 4PE5B 3WLAA 1QHHB 3FR8A 1WKCA 3NDRA 4GEKA 3ZWKA 3USES 1ONNA 2IYLD 3HCBA 4N40A 2AN9A 3FFTA 5ES4B 1KWGA 3GZJA 5J59A 3QVMA 2XPCA 4MQ5A 3I2IA 1IEWA 4O4IF 3TBFA 3V8QA 3WKDA 1F48A 1RLOA 1TYCA 2HMVA 3B3GA 3CEPB 3IBGA 3LXRA 3QITA 1WABA 4FIDA 2XD4A 2I76A 3EA0A 3A3OA 3RU3A 4MVJD 3SJUA 4D8UA 2VDRB 2CZCA 4ZEXA 2PFSA 1BMDA 3UG7A 3E8SA 3VC7A 5DHFA 1NXVA 1WY5A 2F3UA 3N8HA 4TV8B 2PL5A 4P3OA 5A5EA 1VHJA 2PJDA 3HCWA 1N78A 3HGTA 1C9KA 3I4CA 4IICA 2MWMA 3EEYA 3RYHB 4XVCA 1QHIA 2VSFA 1KMNA 3GT0A 1NU8A 3E7XA 5COAA 2HHHB 1GUFA 5HE8A 3E1SA 5SY6A 5TQ0B 1RPAA 3HBMA 4XM1A 1NOKA 5CFQA 3AL0C 1GSHA 3FIJA 1DV2A 3FNFA 5DXFA 4DCSA 5AI6A 4LY6A 5BR4A 4N9WA 3QRWA 3P9CA 1OAAA 1EE1A 4GP9A 2GFHA 2HF8A 2H2DA 2KB0A 3AUTA 1N75A 2QVCA 3B6KA 3ONDA 5CVEA 4MI1A 2ONJA 2VWGA 3SGLA 5BUZA 2VSNA 5KAPA 3JD0A 3KT6A 3U56A 2CHGA 1N6OA 2EATA 1U9CA 1TM1E 3C1UA 3KCQA 5KSPA 4NQRA 3UJNA 4FW9A 1F5SA 4E4YA 4JC5A 4S0XA 4ALNA 1YBFA 5DYIA 2DX7A 3V6LA 2P0EA 4QNMA 4G37A 4DV4B 3IVXA 1Q0ZA 4BKUA 5M04A 1HUQA 1GSAA 2Y76A 1G7TA 2UYYA 1GGHA 4K9QA 4RF4A 2F48A 1QSGA 3QJ5A 4B7XA 2VBGA 4OREX 4LYHA 2NMVA 5GPBA 3OF5A 2YIMA 3IP6A 4E3WA 1U3CA 1ENYA 3OZVA 4MMXB 2VLBA 4O4JA 2O7SA 4FKZA 5L3QB 1NI3A 2VNHA 1GQOA 1WDTA 1ZNZA 2PO5A 2YDYA 3HSKA 4C1BA 3EWSA 5A62A 3AVYA 2ZSKA 1QHGA 1D8AA 4NV1A 5SYAA 4ROTA 3LZCA 4S1PA 1RM0A 2FUEA 5G0WA 1IY9A 3P2YA 4EARA 3DTYA 2FWJA 4H1UA 4ZQGA 3E1KA 2WIAA 4HAZA 5F23A 3MMNA 1Z83A 1YZQA 1XZFA 5IARA 4UZSA 2PCLA 5TMEA 2X0IA 1VC2A 1OREA 4M0DA 3T5BA 4DMRA 4UTRA 3C3YA 3CUVA 3EQ6A 5CDFE 5JSUA 1USKA 4B3RB 4AI6A 4RULA 1CRPA 4PLHA 3JQRA 5C5EA 5LR6A 3U40A 3PRJA 5A0FA 1I3LA 1KJ9A 1N5DA 1Y34E 2WZBA 3B6MA 3EN0A 4PAWA 3DR5A 3WO0A 5A4IS 3T8YA 3REGA 2DR2A 3CEJA 3GLFB 4LDZA 2FRVA 3EMBA 3R23A 4US2R 4EJSA 5K2OA 2WB2A 1ZINA 3N70A 2VJDA 3SX4A 3EARA 3GJTA 3LUFA 4A8PA 2C7PA 2FNAA 3PXAA 3ADBA 1YHZA 2G4LA 2ZBVA 2ZP1A 4YUWA 1LX6A 2Z4TA 2G70A 4HMQA 5B7GA 1KYXA 4FHCA 4BV2A 3HDVA 2Q8PA 2XMZA 3SYMA 2H07A 1JQJC 2OGWA 3SNKA 3PA8A 4MROA 3K3PA 1JLLA 4RSHA 2P7IA 1EWYA 1HRKA 4QQRA 4G1CA 4YCDA 5BSRA 2QJRA 2VF7A 4DXDA 1B16A 4LUCA 3V7NA 1YQ9A 2IYPA 2VHXA 4Y30A 2YDXA 3GLHB 4LXUA 1QIFA 4KWEA 3TPFA 3CT4A 1RYFA 1GTZA 4KXNA 4EL0A 1SKUA 3TOZA 3SXUA 2EL9A 2BR3A 3P20A 3GDGA 3RH0A 4L8GA 1I6KA 1FU7A 1XF1A 3AM4A 2OXTA 1UFRA 3GBSA 4EHHA 3GQVA 721PA 2QN3A 4Q37A 2YJ6A 5EMKA 2B9EA 2PUHA 5JCOA 1G20E 3A6LA 2CFSA 4IQFA 1XUOA 2YXNA 4LCBA 1NRXA 1Y1PA 1PL6A 2VYND 3NJRA 5GM2A 2IU0A 3TTXA 3HEMA 2YJTD 1V8FA 3IAFA 1UOQA 5FO0A 4R98A 4N7JA 3UHOA 4ZVRA 4ISCA 2HQRA 2WC1A 3ETLA 5D00A 3WLSA 2Q5LA 4G3XA 1VIYA 2V7VA 3IXLA 4K7JA 1CUJA 1THZA 2R7MA 3CVWA 3ZJYA 5DTQA 4Z51A 3GP3A 1V1RA 4ACBA 4B7AA 1RM3A 1MIOA 1TZBA 3FD8A 3KPWA 4Q4LA 4QNRA 3ZEIA 2EBHX 3LYHA 2DPHA 2MT9A 1LSUA 5E3HA 4LBVA 1O54A 4GX1A 3A26A 4WOJA 2NTJA 3AWIA 2M6SA 3GYBA 5G3YA 1GPUA 1C30B 2J07A 3CX7A 4HDSB 4ALLA 3LUAA 2HJRA 2D5BA 4BUZA 3MOGA 3OLXA 1ECJA 1GV0A 1OX4B 1TT5B 5TSDA 1C3LA 3HRIA 4M8KA 4ZVVA 4F12A 1M3SA 4EKNB 2J7KA 4RXTA 5ALFA 4LXTA 1F14A 3SAJA 5KWEA 2FDRA 1FSZA 3D8TA 1C7EA 1K6XA 4WH0A 2VTBA 3THXA 2ZJFA 3ZDAA 5KX5A 4CPDA 5DI3B 5ADUS 5JPDA 2DPGA 3TSWA 4A6XA 1D6NA 4EFMA 4B31A 3FX2A 2IQ5A 1Y6GA 4AKGA 2GZ3A 1QGAA 2PD4A 4NCIA 3IA7A 4R51A 1D8TA 4A0RA 1H8EA 4CIXA 4DJFC 1SQ5A 1HNWB 3WGKA 4QU8A 2JD0A 3E23A 1W4ZA 4YO7A 2Q07A 1FLAA 2XB4A 1JDUA 4RTRA 2RHMA 3P7MA 3UF0A 2ZUEA 2YY7A 2NX2A 3F3YA 3QE0A 3UJ7A 1NMSA 4CM6A 1H1LA 3Q3CA 3P9NA 2AKAB 5MHTA 5FNVF 2IIPA 3O3MB 3EG9B 3RCBA 1VBMA 2ZRAA 3C98A 3I4LA 4IOKA 1SXGA 1L8QA 4TMVA 3VPDA 1T4DA 3CKKA 3E03A 1JFTA 4J4BA 5AVOA 1DKMA 1ZN8A 2G9NA 4KBFA 4FW8A 4P7FA 3SQMA 1K89A 3MMXA 1O1YA 4J1SA 3ST7A 5BW4A 5C32A 2EJWA 2VNJA 4N3CA 1AY0A 4UHEA 2DPLA 5KHLB 1QU3A 3PR3A 3F71A 5A9SA 1J23A 5JJKA 3Q2IA 5DGIA 4MEAA 4WINA 3VZSA 1R4ZA 2H00A 4K9RA 2UXDB 4R8MA 1DXOA 1PFKA 2BDEA 1P77A 4XXHA 3U09A 1PWYE 1GGJA 4JU9A 2FLKA 4NAVA 3TKLA 4XB1A 2BFFB 1EWRA 2FOXA 4Q3CA 2D2VA 4BX0A 2AJTA 5B2EA 3B2QA 4IWXA 5FI1B 4FBLA 2QE7A 4L27A 4D9FA 1HTWA 1JLRA 2V8OA 1FDUA 1M6NA 2G9ZA 2QHXA 3K0KA 2CXOA 5ECGC 4DUYB 5C7IO 2JKYA 3FB4A 3L82B 1ZUNB 3V8VA 1RAAA 2PT6A 2DERA 3FGOA 1LDYA 1AK9A 3GEDA 4G1VA 3NTUA 4E2ZA 2ADOA 1HDCA 4JX9A 5KTOA 1B2LA 2OO5A 2PD6A 3EBPA 3LJKA 4FS8A 5JYCA 1OIWA 4UNNA 1W34A 4L74A 4TTTS 2IK8A 3QWHA 5BPHA 3DAGA 1OIXA 5KU1A 1C1HA 4E0BA 2CLOB 5E9AA 1Z18A 3K9NA 4U9IS 2BKXA 2IXBA 3KXPA 4X90A 3HR8A 1Y7IA 3EUAA 4Q4DA 5HE9A 1Y33E 2AXQA 2PMCA 5EOVA 1PUIA 5J1TB 4DFDA 4F93B 3WK7A 5P21A 5K0GA 3HXTA 2WSMA 1T5BA 5DP2A 1ADGA 3UJDA 3T9CA 4P54A 4FYVA 2JGDB 3M4JA 2G7ZA 2Q29A 4FXPA 1LC3A 1DJQA 3DFIA 3KKPA 5DTRA 4C2AA 1AO0A 4ECAA 5A1TA 4JGIA 3BH7A 3VR6H 4XPZA 2F1OA 2GJ8A 2LNDA 3F47A 4MS3A 5CAEB 3MTBA 3R20A 2HJ9A 4BAGA 3ZDBA 3TM4A 1K8ZB 1W25A 2HSEA 3A6EA 3HN7A 3H99A 1U28A 4KWCA 1SBYA 2Y93A 5DV9A 3RROA 1AHPA 1NLZA 2XDQB 5HCNA 1SU8A 1LCIA 2YMMA 5ALXA 3D1JA 1LV8A 1MN6A 2H18A 4MDYA 3HTXA 3AKYA 4E6PA 5KOHB 3KVVA 4WJZA 1GSOA 2DY1A 3BYZA 1T2AA 3QKSA 4OMDA 5T41A 3UT5B 4HEA1 4AQYB 3MT7A 4OQPA 2HA6A 2C7RA 2QUKA 1P8AA 1FRZA 3L7MA 1JBEA 4EVQA 4RY0A 2WPDA 1UH5A 4TS3A 4JJ6A 4ZZ3A 4N8DA 5IKEA 1XP5A 4RH1A 2GZDA 4KN5A 3OQIA 1RBYA 2A35A 4R84A 2ACWA 3U19A 3T35A 4HVTA 1XQVA 2BMDA 2NZYA 3BJEA 4MUBA 3S2YA 4TM7A 1EJ2A 1JHOA 3WYCA 2W22A 2KJQA 3JVIA 2A1TS 3M6LA 3LE8A 4LJ8A 5E2IA 1GPBA 1USIA 4BVBA 4WVFA 3VKFA 1WIWA 4HQOA 3PE6A 2ORYA 3SIWA 2GZ1A 2GM4A 2PD3A 1DIBA 2GBFA 3DAHA 5FX2A 1Z36A 5L3SA 3O8OA 5TARA 4KI0A 4YMHA 5L4NA 3QTBA 3CNOA 4MI3A 1KO1A 2Q41A 4UFNA 3T7DA 3VZCA 3RHZA 3VR6D 5AUNB 1Z0SA 4YRPA 3BHIA 4RQAA 2PZBA 2WHRA 5D3QA 5HFJA 4P38A 4A73A 3ONWA 5K20A 4QUIA 4F4IA 3D64A 2ZIWB 2QX8A 1ID8A 1VM6A 3F6BX 3PFIA 3LHFA 3SJCA 1Y89A 1TEVA 1XFDA 5CRIA 4AULA 2PXXA 5C5CA 5DM60 5K5EA 2G3YA 3USZA 4EHNA 4EI9A 2OAGA 2CL5A 3RLIA 3VYWA 4YMTA 5H9VA 4AZSA 5KYVA 3OJ0A 3MQ2A 3ROPA 1EWKA 3ZW7A 1TAUA 4L8YA 1PTKA 3GCZA 4OXXA 3W3AA 2MSLA 3IQWA 1PS9A 1TUGA 1IWBB 1SVIA 1TTHA 2AA3A 2QV0A 3OLZA 5IKXA 4UVIA 3W2GA 2WVAA 3PFBA 1SG6A 2UV8A 1MC5A 4IIXA 1KY3A 1YB6A 4LYFA 3FROA 2WWVD 2FPUA 3PEFA 4GOKA 5BSHA 5BSVA 3DEZA 3CCBA 5HUQA 3V4OA 1J8VA 1K08A 2SKDA 3C48A 1ZSYA 3WXBA 3H19A 4DRZA 3I9OA 4MWGA 2N1MA 3PIRA 4NU8X 1M1XB 3FJYA 5KI6A 1RRCA 4ZCIA 4Y0NA 1Y5MA 2D3WA 2WKPA 3NJ8A 4B6JA 3QOYA 2BTEA 1WL8A 1N2OA 4O2AA 2FZKA 3PDIB 3V32A 2WV9A 4YRSA 4N65A 2QTLA 5H80A 4LQCA 1WXIA 1MDBA 2O57A 3IKJA 4A5SA 2CN1A 4ANFA 4DXHA 3KSZO 4IHJF 3TEFA 3A1WA 4K9NA 1JKJB 3PNPA 4RF5A 3O3OB 4L4UA 4YEDA 4OY3A 3VX3A 1M2OB 2VAVA 4H3KB 4Q9LA 3O92A 1C8KA 1JT9A 3V8NA 2ZATA 2JLZA 3R0VA 5A6SA 3F7MA 3BD7A 5CB4F 5D1NA 4JL8A 4I4NA 1KFJB 3KFVA 2IYEA 1J39A 3DXFA 2DR0A 3L8GA 3MERA 4GC5A 3MJVA 1T8WA 1NXOA 1K98A 2FETA 3ABIA 5I9BA 5KREA 2AXEA 4TZKA 1WCIB 1X70A 1XRJA 1ZD4A 1XKTA 3B5EA 3DL7A 1K2VN 3R5HA 4S12A 2X6TA 2ZR7A 2YZ2A 1QUFA 5SZKB 1KK0A 2GZAA 2VJKA 4XGKA 3IS3A 1UBMS 3KYDA 1XMOB 3GLUA 5HTOA 5KHOC 4BLRA 3GAZA 3ENKA 1SBZA 3PWKA 2XA9A 4KVGA 4TYYA 3PIDA 1IOVA 3PNMA 3N28A 1JPNA 3FUCA 2AC7A 4L4XA 4TSFD 3R1IA 2QIOA 1RRGA 1XEXA 3KOUA 2YOGA 3LQRA 3CVYA 3L0CA 1Q44A 1R9NA 3DKKA 2IE0A 2V5VA 1X7DA 4V24A 4UMVA 3DL2A 3L92A 3LV8A 2GH1A 4QOHA 4ZT2A 1JDSA 3PGKA 1PHRA 3GP5A 1I14A 1W0CA 4A91A 1NXTA 4EP1A 4NZPA 2AFHE 3W8DA 5JI3E 1SXPA 3ZGNA 1LGYA 4E31A 3F78A 4FFBB 1XD2B 4C03A 4R1UA 2CNNA 3IDQA 1GN8A 3K0FA 3R7WB 3RSHA 2ODWA 4NYJQ 4EBBA 1U4NA 3SLRA 2BSXA 3V4VB 4QLAA 2X1LA 1UMCB 3F2IA 4P3PA 2QLJA 2JZCA 4TZTA 4WK2B 4ZTBA 1DXYA 2P5YA 3P9SA 3Q0TA 4J43A 4UQLA 1LS1A 1PR9A 2FXIA 2MU1A 1X7ZB 4QJBA 2A1IA 5A6VA 4CIAA 4QELA 4XVHA 5ICSA 1KI1A 5DYNA 1RJEA 4GMDA 3D7RA 1KDTA 4FJ0A 1JU3A 3DQZA 3NATA 2HEGA 3ORYA 4N82A 2Q9BA 4NJEB 5CXSA 2LCQA 1US8A 2P4UA 3GEBA 4KW7A 1F51E 2C7OA 5C7LO 3FOWA 1OVGA 1NLUA 2FUNB 2FW6A 4B4WA 1OBFO 3WIEA 2ZRQA 1RZVA 3EDQA 3NC1C 3LPNA 4GIBA 2Z5LA 3TRFA 5AVVA 2PUGA 1PT8A 3KWMA 1NW4A 4PGGA 1UP7A 3A6GA 2QZJA 3FPGA 2G0TA 5T4HA 2AOTB 1YGYA 5TQVA 3WYAA 2OWEA 2NADA 3TSCA 2BFBA 2KS6A 5KYNA 2XT9A 4ZTZB 3TL3A 4PRLA 1MG0A 4TT3D 4U2GA 2BGGA 3LO8A 3NOOA 4O3FA 1X8XA 4MQMA 4PINA 3J81A 1EG7A 4MV1A 1GCAA 4C0JA 2D1QA 3GZTB 4GSYA 4DTCA 8MHTA 1Q83A 4DRYA 4F3KA 4UFPA 5LYYA 4FCTA 2EAUA 2YY6A 5HFNA 4ZEMA 5C3MA 1ML3A 2ZU0C 2ZRHA 3LS2A 1KI7A 1CEEA 2JW5A 4FUQA 4D45A 3CZPA 1CVRA 1AN0A 1Q1ZA 1FP6A 3CH6A 3I01A 4R8RA 3TEMA 4GSKA 5KUTA 5CX1B 1KTVA 4EY7A 5T67A 4D0NA 1PD1A 3CLSD 1U1DA 1X6VA 4PXSA 4F85A 4ZYZA 3EGCA 4W9NC 5HNKA 1VYUA 3PLAE 1U8ZA 2IUTA 5JSZB 1IBRA 5IPFA 5LSAA 3PC4A 2BR4A 3NAQA 5DSXA 4A6EA 5BXQC 4X84A 3QE9Y 1ABBA 3M3HA 3A0RB 3ZX4A 1OFUA 1P31A 3DULA 1H9CA 2B99A 4C0AC 2NSHA 1N8NA 4HEQA 3ZZMA 5IDXA 2JFQA 3PQ2A 4WJLA 2C4UA 1PWHA 2AB0A 2AQHA 1W73A 1X3SA 1EU1A 3B9PA 4YP1A 1BVRA 3ET4A 3VSEA 2QY9A 2PL9A 3DGEC 3TG2A 3DUWA 3LHIA