1QI2A

Endoglucanase cel5a from bacillus agaradhaerens in the tetragonal crystal form in complex with 2',4'-dinitrophenyl 2-deoxy-2-fluoro-b-d-cellotrioside
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
302
structure length
302
Chain Sequence
SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRESAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into ligand-induced conformational change in Cel5A from Bacillus agaradhaerens revealed by a catalytically active crystal form.
pubmed doi rcsb
source organism Bacillus agaradhaerens
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE B
total genus 122
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 1999-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1qi2A00
2C7FA 3RJYA 3WSUA 3MMUA 1I75A 1W9DM 4UOZA 5CLWA 3CZKA 7CGTA 1BLIA 4UQCA 3N18A 2WCAA 4UCFA 5DEZA 1UQZA 5IHRA 1HKJA 3VGHA 5GQBA 4AD4A 2ZUNA 3L4VA 3FXYA 3OZPA 3VIKA 1LLOA 4D1IA 3AZSA 1PX8A 4YN5A 2WBKA 3W0KA 1B31A 2DT0A 4C7DA 4PTMA 2BHZA 2W92A 4AZ5A 3AI0A 3WFLA 1TG7A 2J75A 1HT6A 3AMCA 3W25A 4PSPA 4A3YA 2XJ7A 4J3XA 4PTWA 5BCAA 2JF6A 1JDDA 1VFOA 1WZMA 3MO4A 4CCDA 4CVUA 4PMDA 2J25A 2GK1A 3AHZA 2X8RA 4AC1X 2OLHA 1W1PA 2IXUA 1UQYA 5DF0A 2CIPA 4P7QA 2WMHA 3VD9A 1K9TA 3LMYA 2W66A 2YL8A 1KR1A 4MAVA 3VGFA 4HZ7A 4YPJA 4JFSA 4UZUA 3RILA 3PTQA 1IZKA 3W6LA 1JZ5A 1EO7A 3VX0A 4WJXA 1C8QA 2WMGA 1JF5A 4TX8A 1HX0A 2Y8VA 3KL3A 1HP4A 2QMJA 2ZXQA 4CD4A 2VCCA 3WQWA 4W89A 4EKJA 1GQIA 4AWEA 1J0HA 2XGIA 4ACYA 1L0PA 5A6BA 1GOKA 4GI6A 2D0FA 1J18A 5TD4A 4PBGA 1ECEA 3T0BA 3VKKA 2GK1B 1C90A 1OT1A 1V0MA 5GNYA 4GI8A 4W85A 3QR3A 5M3WA 5DT5A 3WNPA 4J7RA 1VFMA 3BAXA 4CGTA 3VDAA 3VIMA 3ARTA 1B0IA 3WF1A 2BVTA 1E4MM 3PZMA 3ZJ6A 3WH8A 1MXGA 2WWCA 5CXPA 4IUGA 5D9PA 2O9TA 4CU8A 1HIZA 5EFDA 2EQDA 5CGMA 2BV9A 2X0YA 5DFAA 5D9NA 1BYAA 4GQQA 1KGUA 3AIWA 2XVLA 3UESA 1B3VA 1GOMA 4PYSA 1ZBKA 3AYRA 1CGYA 3ARPA 1EQPA 5KZ6A 4J3TA 4W7UA 3POHA 1EGZA 3EMQA 2WMKA 1OM0A 3GXFA 3SCSA 4CU7A 1E9LA 2O92A 4U5IA 2OSXA 4WKAA 2QV4A 3WEZA 2BXZA 2V38A 2WYSA 5A6SA 3QHMA 4W93A 1WZKA 2A3HA 3GBDA 3HU7A 5JUVA 3AS2A 4W7WA 2DSWA 3RCNA 5IFTA 2PWGA 4LQ1A 3D3AA 3KL0A 3GZAA 2WHMA 1B3WA 5A8PA 3ZO9A 3SCWA 1HKKA 2VRQA 2XSAA 2VMFA 1QNRA 4FF5A 4XZWA 4UFHA 2ZX7A 3KWXA 3U7VA 1BFNA 4JKKA 3WNLA 1OBAA 1O6IA 4CD5A 3QOMA 4S3KA 3BAWA 3WUGA 2XYLA 4LX4A 3BLKA 1PPIA 1OSEA 2ZXDA 4TOQA 2CCRA 2JIWA 3BAIA 1KFWA 4ZFMA 3VOCA 3DYMA 2VUYA 2YDSA 1HVQA 1OGGA 3PN8A 2DT3A 1WAWA 4JFVA 3SCRA 5C70A 5I23A 3IAPA 1ZB5A 4HPHA 2XVGA 2WMJA 3ARUA 5A2BA 4LYQA 2EBNA 4U3AA 4EE9A 3HMCA 1QBAA 4D1JA 1NARA 3AHYA 4UNIA 4AD3A 6A3HA 1DWFM 1ODUA 5I0DA 4P8VA 4PUEA 3DECA 4QAWA 1LWHA 2D3LA 2J62A 4DUWA 2X09A 3WD1A 2PB1A 3GNPA 3AFBA 5HPCA 4GPNA 1GJWA 2GUYA 1MYRA 4EAMA 5ECUA 3NSXA 4DWSD 3OBAA 3O6AA 3MV01 1WZAA 1H2JA 2FHBA 3ARXA 2VL4A 2Y4SA 4MTVA 1H0IA 3WUEA 2J74A 2V3DA 5CPQA 2XIIA 3UR8A 1C8XA 1UWQA 4NZCA 1WE5A 3WMSA 1WKYA 3OLEA 1UKSA 3T0AA 3GNOA 3L4YA 4GZIA 4NRSA 4CN4A 1E4IA 8CGTA 2ZOXA 3BCDA 4MDOA 4QLKA 2C0HA 7A3HA 3SUWA 1GQLA 3AQUA 3AROA 2DQXA 1KXTA 2GJXB 2Y5EA 2BY1A 2VTFA 4QDMA 3EDKA 4E8CA 4EANA 1BPLB 3VPLA 2JE8A 1V3MA 5ABGA 1ISVA 2X0HA 1CXIA 2AAAA 3BMVA 2ZX5A 1GCYA 2WSPA 3RO8A 1V03A 1V3HA 4KH2A 2VR5A 2XG9A 2WVVB 1J9YA 3W28A 3FHQA 1PZ2A 3T2OA 2VQUA 3CZ8A 5EB8A 3NIYA 4AZCB 1KXVA 3MANA 2PWEA 2F61A 2ZWYA 4F9DA 3WEOA 2E40A 2GDUA 4JAWA 1W9VA 2FGLA 1JFHA 5A6MA 2DSVA 1QI4A 1V02A 5A95A 2DEPA 4H8VA 5I5RA 3ARWA 4OBSA 2IUZA 1EDGA 3N17A 4IPNB 2VCBA 3SUVA 4HA3A 4AXNA 1DWAM 4NRRA 5BXPA 3TA9A 1Q6GA 5E70A 3PZOA 4JZ5A 1HJVA 1TCMA 4CCCA 1D2KA 3LPGA 1GHRA 1PAMA 4OZOA 1KGWA 1FA2A 2QF8A 3EMZA 1QHPA 4HU8A 1VEMA 2FGZA 1JZ4A 3MSDA 3WD0A 3UCQA 2D2OA 2QPSA 2Z1SA 4W88A 3NYDA 1UH2A 1NM9A 1ZBWA 1E73M 3A4WA 4D6GA 4DWSA 4A4AA 1RD6A 3M7SA 4MADA 1J0YA 2VZSA 4LXFA 1B90A 2DPEA 1E71M 1UR0A 2WCGA 4TVCA 3SCNA 1E6XM 3CMJA 1K6AA 3AZRA 3CHFA 1QI2A 2XWDA 3CUJA 3DHPA 1DWJM 1CECA 4AZ7A 1Q6EA 4MPKA 4QCEA 4TTUA 3RJXA 2D0GA 3A6OA 2BS9A 2ZXBA 3POCA 4UFKA 2OYKA 1NWUA 2EPLX 1UG6A 1XC6A 3K4AA 1HL8A 4PMZA 5A8NA 3WD4A 2O9PA 3M6DA 5A2CA 3MMDA 5E09A 4ATLA 3MV11 1CXLA 1UR9A 1GOWA 1UH3A 3WNOA 4M82A 3FHAA 1CGTA 2W67A 1FP8A 1G9HA 1OD0A 4B15A 3HN3A 5FL1A 3A4AA 5A94A 1WDSA 3T09A 1US3A 1V6WA 4OJYA 3GH5A 1JAEA 1U33A 2YDQA 1ISZA 1ISYA 1SMAA 4UOQA 4Z2KA 3ZM8A 2C8NA 1LQ0A 2WPGA 5JBEA 3GXDA 3ARVA 3MU7A 3VMNA 3PBGA 3N13A 1H4PA 3WD2A 3F4VA 1NOFA 1HJSA 3L4WA 1H09A 1QI5A 3CUHA 1E4LA 3BSGA 5D9OA 4N42A 2E9LA 2X1IA 1JYNA 1J0JA 1UH4A 1XSKA 5I3DA 2O9RA 3RM8A 5ABEA 1CPUA 1KWKA 5A6BD 4MB1A 4CN1A 1BQCA 2D0HA 3AIVA 1KCLA 2E0PA 4M24A 3U57A 1BHGA 2DDXA 1EXPA 2EPMX 2RGLA 3CZEA 7TAAA 2PBOA 4D6JA 4JL2A 4S3JA 2XFRA 4P8UA 1UD2A 4U5KA 4H04A 2CKRA 1W2VA 4Z2JA 3K8LA 1VFFA 5I79A 3WH9A 3CO4A 2BVDA 3UR7A 4MB4A 3BAJA 4J3VA 2XM2A 1CYGA 4D72A 2F8QA 4ZXOA 1UHVA 4PCSA 1UD3A 2CBIA 1ISXA 1OINA 8A3HA 4HOXA 3WN6A 1WP6A 1UZ4A 1W9XA 5A6JA 1CGUA 1AQ0A 3TONA 3BXWA 2XVPA 1WCGA 1XCWA 4MAZA 4Z2HA 4FLOA 4CD6A 3UG3A 2XUCA 2J7EA 1R86A 2WZEA 3MKKA 1UR2A 1A47A 3G6LA 5D8ZA 1J11A 5A6AA 4MB5A 4AEEA 1GORA 1CZ1A 2BFGA 3TTQA 5HXMA 3VNZA 1CNVA 2W91A 3AIUA 1E56A 4PMYA 1YQ2A 3CHCA 3CLWA 1IZJA 3DHUA 4AD2A 3PZ9A 1XD1A 4LYPA 5CZKA 3GXIA 2Z1KA 4DUVA 3GDBA 5AC4A 1AMYA 4D6FA 2EPOA 4CUCA 2YOCA 3VIFA 1I1WA 3W24A 1RPKA 1SFSA 1W9BM 4TX6A 3ZT5A 4W86A 4M81A 5D8WA 4PSRA 3WIJA 3PHAA 2WKGA 4JKMA 2YA0A 4JFWA 4UR9A 1FH7A 4FMVA 3VILA 3EDDA 4X0VA 5ABFA 4MNJA 1EOMA 4TVUA 3W82A 3OLDA 1BYBA 4TVDA 4RE3A 2J8FA 1MWOA 2WBGA 3AIBA 1LF1A 4M80A 4AW7A 1AVAA 2J7BA 2WVVA 4AIUA 3CPUA 3O2LA 3OB8A 5A69A 4WKHA 1XH2A 2TAAA 3F5LA 1HVXA 1K9DA 2HVMA 4AZIA 2VURA 3WNKA 5A6LA 5DMYA 4QLJA 2XFFA 3G6MA 2CPUA 4PRWA 1E6SM 3MUY1 2WMFA 2PBGA 3LPFA 1I1XA 1WO2A 4AD0A 3SUSA 3N1AA 1GW1A 1CXHA 1G94A 3SCPA 5AYIA 4BF7A 1DHKA 1B9ZA 1MQQA 4W84A 5A2AA 3PTMA 5JBFA 4ZE4A 1BAGA 4D71A 5BXTA 3A4XA 4K68A 1V0LA 3K8KA 1E4NA 1ITCA 1F4AA 1FFQA 1MXDA 5ABFB 3WNMA 1TUXA 4FLSA 3WDIA 2E8YA 2J7GA 6TAAA 3A3HA 1V6YA 1CXKA 1PBGA 2ZE0A 2VNCA 4N0RA 1W9UA 1R85A 4JCLA 5LA2A 1E15A 1V3IA 2YA2A 3AISA 1MVYA 2EO7A 2WC4A 2UY5A 1J12A 3W29A 1QW9A 4XZBA 4JHZA 2IXVA 3VGEA 4HU0A 1M01A 1WNOA 1X1NA 1C8YA 3O9NA 3SCVA 3F5JA 4PCTA 4RL3A 2WZHA 1EHNA 1RP8A 2UY4A 2ZX8A 3N12A 3VD7A 4NSBA 3VUPA 3VDCA 4UQ9A 1WB0A 4F8XA 3THCA 2W5FA 3WKZA 1FP9A 1PIGA 4Y7EA 2ZUUA 3CUIA 1DEDA 1ZBCA 4AD5A 3WH7A 2WVUA 1E40A 5LYRA 3NDYA 1BVZA 1ESWA 2VOTA 4JHOA 1VFUA 3SURA 2J77A 4OIFA 3N15A 2WLYA 5A3HA 3SIMA 2WANA 4TXEA 1QI0A 3II1A 3AMDA 5IDIA 3S6TA 4C7FA 2BVYA 1MQPA 5CJ5A 3THDA 3ZIZA 1TVPA 3BAKA 2XPKA 4CD7A 1JXKA 2BHUA 2FH8A 3OIHA 5CPTA 2EXOA 1FHDA 2CESA 1XV8A 5BXRA 4D6DA 1C7SA 4J3UA 3D5HA 3FN9A 1FHLA 2WW5A 3TP4A 3AYSA 4U2ZA 2VR4A 4P7OA 4MDPA 1KR0A 3U5UA 4MJ2A 3IK2A 1JDCA 4PN2A 4WSJA 2OSYA 2VRKA 2FH6A 1ISWA 4UFMA 2CBJA 1UKQA 4XUYA 3OLIA 3WF0A 4HA4A 3CH9A 4BA0A 2XVKA 4L4PA 1EHAA 3VM7A 4OUEA 2GJRA 2OWCA 2ZUWA 1QHZA 5AYBA 2ZUSA 4AZGA 4PMUA 3AXIA 4U33A 5CG0A 1OT2A 3WDQA 1GHSA 1E43A 3AICA 4W8AA 1MW0A 3WBEA 4D6CA 3WDJA 5BXSA 1UWUA 3CBWA 2A3AA 3NUKA 4ML4A 4PMOA 1ZU8A 1CEOA 1NOUA 3T2PA 2GJPA 1W1VA 1OB0A 3SUUA 3WMBA 4PEEA 3AIEA 3W53A 3VM5A 4ZENA 3ECQA 3I3EA 1VF8A 3AIRA 1P6WA 4XB3A 2AOSA 3DYPA 3UETA 1CTNA 4DM2A 3ARRA 1W91A 5A1AA 3BC9A 3WUBA 3MS8A 1EO5A 2PWDA 2NSXA 4AIEA 4ACZA 5I24A 3NDZA 1UKOA 3T2QA 2VT0A 3CGTA 3AOFA 5EFFA 2DH2A 1XSJA 2YJQA 3BLPX 4BZYA 4GZJA 3WMCA 4KGJA 2B31A 5A8MA 1QOXA 1G5AA 2CNCA 3TTOA 2J8GA 2WSKA 1V6XA 2OSWA 1M53A 4QCFA 3M07A 3QHOA 1JD7A 3U5YA 1ZJBA 4KWUA 3RMEA 2FDMA 1DP0A 1YHTA 2J7FA 3VIGA 1JAKA 2F2HA 3ZJ8A 2W61A 4MNLA 1VAHA 1XH0A 4KRUA 3AXHA 3T08A 4ZXLA 2EPKX 3APGA 2ESCA 1GOOA 4AZBA 3WL1A 3W38A 1J0KA 3CZLA 1IV8A 2JIEA 1TFVA 4M56A 1QW8A 3FAXA 1FOBA 1N82A 3AIQA 2CITA 2WM0A 1E72M 3AS1A 3OA5A 1XRVA 1GQKA 3ZR6A 4W5ZA 4JFTA 2UY2A 1C93A 1KBKA 1XYFA 1V0KA 2Y24A 1VB9A 4GZEA 2J79A 4UFJA 2WVSA 1WDPA 1CXFA 3A47A 1M04A 4OOZA 3VX1A 2VVSA 3U7BA 3SCTA 1PIFA 1V08A 2V3EA 2V5CA 1BYCA 2XSBA 2GFTA 4MJ4A 3L2LA 4WF7A 5A6KA 1CGWA 2D3NA 3GYCA 3W27A 1JYWA 1HNYA 3QHNA 1JD9A 1LJYA 4H8UA 3SCUA 5C71A 5GNXA 3FNDA 1LG1A 4B9ZA 1BGGA 1E5NA 1JZ8A 4B16A 1WDRA 1NWRA 1E6NA 1R7AA 3RM4A 3RDKA 3SEPA 5FD0A 3E1F1 1BF2A 2XIBA 1QNPA 4GQRA 1E0VA 2E3ZA 4OOUA 4MNKA 4E8DA 1Q4NX 1Q6FA 1LL4A 3M46A 2OYLA 3LPOA 3L2MA 2YL9A 1VBRA 3W4RA 1HJWA 2YA1A 2CHNA 1H3GA 1C91A 2A3CA 5I78A 5HPOA 2GDVA 4J27A 2GVYA 5E0FA 3OGVA 1TZ7A 2BXYA 2WHKA 1LG2A 3N04A 2VZUA 3WQ5A 1JG9A 1NOWA 3EDJA 2E8ZA 2WHJA 1CLXA 3WY1A 3VTRA 2QMKA 3PZNA 4U2YA 1G0CA 5FKYA 5CSYA 2VJXA 3CZJA 3VIPA 2VZTA 1W1YA 3WH6A 1CXEA 1NH6A 4J3SA 4DWSC 1OGSA 1QVBA 1LL6A 1V6VA 2D22A 1MQRA 4ATWA 4AIOA 1HKIA 2ZUTA 3W81A 4UOJA 1E1FA 3VD3A 4H7VA 5F7UA 1E6RA 3QGVA 3AHVA 4EK7A 1GNXA 2V5DA 1KGXA 3ARZA 4OBRA 1QNSA 2DIEA 5I77A 3CMGA 1PX4A 2NT0A 4CKQA 3NSNA 1MW2A 3IAQA 4RE2A 3W26A 4IISA 4JCMA 1CIUA 1VRXA 3GH7A 3BAYA 3DYOA 2D23A 2D1ZA 2JFEX 2YL6A 2ZUVA 3OLGA 3MMWA 2WMIB 3WQ8A 5JIWA 1AQHA 4P8XA 1UA7A 3VD4A 1HP5A 5FIPA 2CHOA 4TTGA 1XGZA 5BYWA 4LYRA 1KWGA 2PI6A 4HOZA 4DUXA 4W87A 3L4UA 3NJ3A 2BY2A 2QHAA 1U2YA 1UR1A 1CENA 4R5EA 4V2XA 4M8UA 2NW0A 5M5DA 1TMQA 4FLQA 3VDBA 1X6LA 2MANA 1W3KA 3K4DA 3W6MA 3EYPA 4BS0A 2CEQA 2YKKA 1TR1A 1J0ZA 4H41A 3WL0A 3BCFA 4Q22A 2VI0A 4GXPA 3ZSTA 3CTTA 3L4TA 1SR0A 4AZCA 4WSKA 3WNNA 2PC8A 1JI2A 4P7LA 4P8WA 2FHFA 1OCQA 4WIWA 4AD1A 1WZLA 1B3YA 1H5VA 4A3HA 5C8BB 9CGTA 2A3EA 3PTKA 1M7XA 1VIWA 2VC9A 3VGGA 2YIHA 2W4XA 4HOWA 4KMQA 1Q6DA 1GUVA 1O7AA 2ZICA 3T0DA 3PZIA 1E6QM 1A3HA 1HKMA 4WK9A 2WC3A 4PTVA 3L4XA 4R27A 4XV0A 4DM1A 2JF7A 2QPUA 5D9MA 1JF6A 1NP2A 5BRPA 1E55A 2G3NA 1E3XA 1B30A 4GO8A 3ZSSA 4U31A 1JZ3A 4ACZB 2WCSA 3IJ9A 3MUIA 1UWSA 4NF7A 4AY1A 1KXQA 3IJ7A 3VMPA 1KBBA 1ITXA 2XWEA 2G8ZA 4HZ8A 5JBDA 4JL1A 1JZ7A 3OGSA 4B3KA 1EOKA 2BHYA 3RM9A 1H41A 1GPFA 3WEMA 2CBVA 1XYZA 1SMDA 1BG9A 4L4OA 4HMEA 5GPRA 4QP0A 1FH8A 5CQ1A 2J7DA 1GOQA 2A3BA 4KRTA 2JALA 3VU2A 5HOSA 4F66A 4ZEPA 2VX6A 1V3LA 1RH9A 2HISA 3RPMA 4D6HA 1H11A 3VIHA 2X2YA 1WPCA 1HJXA 3VDHA 2EEXA 3IANA 3WF4A 1GQJA 3WENA 3MUZ1 4V27A 3ARQA 4TUFA 1UD4A 3CIVA 1ODZA 3I3BA 3BGAA 2E9MA 4UFIA 4HP5A 2EPNA 4V28A 3CHDA 3WDRA 4UQDA 5KEZA 4IM4A 4HPGA 4ATDA 3N9KA 1E3ZA 3J7HA 1QBBA 1ZJAA 4HMDA 5CPSA 1ZS2A 1H0GA 4J3WA 1GJUA 3GH4A 3IJ8A 1KCKA 2OYMA 3WFZA 1QPKA 4KGLA 1JYXA 2PWHA 1G01A 1PEZA 3WH5A 1US2A 3MSGA 4HA1A 1F4HA 2ZUMA 2W63A 1HXJA 3ZJ7A 5BWFA 4UZSA 4OKDA 1UWIA 1CLVA 1XCXA 1B2YA 3ARSA 2Y8KA 3W37A 3CUGA 3L4ZA 1UKPA 2GJXA 2V3FA 5EMYA 4H2CA 1UZ1A 1D3CA 4FLRA 4RE4A 2UY3A 2WLZA 5IXEA 2E9BA 4JKLA 3VGBA 4PMQA 2J47A 2WKLA 3PZGA 1JL8A 1HL9A 3UG5A 4Z2GA 3K46A 4E2OA 2DSKA 4BQ5A 3K8MA 4E4PA 3WQVA 1JNDA 1HJUA 3B8SA 4WKFA 1R7OA 2ZIDA 5E6ZA 1H49A 3WF2A 2J78A 4UFLA 1ZBVA 3ZR5A 1KQYA 3GBEA 3OZOA 4AZHA 4GIAA 3VO0A 3AXXA 4CN6A 1JFXA 2DSZA 3AHTA 2ZX6A 4GINA 3EDFA 5I2UA 1W2PA 1K9FA 1B1YA 5LA0A 4W5UA 4W8BA 4P7RA 1DWIM 1B3XA 4W8LA 3QOKA 4NI3A 4AZ6A 3HJEA 4M1RA 5IFPA 4GI9A 3VNYA 2EJ1A 2V3GA 2XHYA 3NSMA 3AJ7A 3VVGA 3CUFA 1E1EA 4P7NA 4D6IA 1BVNP 3K1DA 4GO9A 2Y2WA 2CETA 2JEPA 1W3HA 2YL5A 2J7HA 3AS3A 1OIFA 1JDAA 2DSUA 3ZT6A 4PMNA 1AQMA 3MUAA 5CGTA 2AMGA 3ALFA 6CGTA 4BCEA 1FFRA 1TE1A 3PZQA 4F9JA 5CLTA 1W32A 1HJQA 3SUTA 1FH9A 4W7VA 1PJ9A 3WDHA 3VINA 1QNQA 1C92A 4AISA 4C7GA 1JIBA 2E4TA 1RP9A 4FK9A 1NWSA 1UR4A 1OIMA 1R8LA 2G41A 1DTUA 2GSJA 3WUFA 2BNJA 3AZTA 4GKLA 4BQ4A 2WK2A 3B9DA 4MB3A 4CVWA 4U3CA 2VRJA 1G1YA 2YLAA 3ZQ9A 1EIBA 4YHGA 4MNMA 3BSHA 3CHEA 1H1NA 3VMOA 3EBVA 1OD8A 4CU6A 4JFUA 1Q6CA 2DH3A 2UWFA 5I6SA 2YDRA 5GNZA 5M17A 3GM8A 4ZE5A 1XH1A 1K9EA 1CGXA 1KXHA 1VJSA 2BY3A 2CERA 1E5JA 1E70M 1CBGA 1X6NA 2ZWZA 4HZ6A 1UKTA 4IPLA 4PTXA 1W1TA 1E6PA 1OGBA 5BROA 4D6EA 2DT2A 5A8OA 2WB5A 3I3DA 4CCEA 1JGIA 1UUQA 4Z2LA 2CBUA 1Y7VA 1XHGA 3OG2A 2XM1A 3BH4A 3ZOAA 3S2CA 4AYSA 2YBUA 1VBUA 1UR8A 3PZUA 1C3FA 3AMKA 5FL0A 4UQBA 1JNEA 1DWGM 4PMVA 1V6UA 4H8HA 3UERA 3B9AA 2WVTA 2XGBA 4QFUA 1MW3A 1V3JA 2CXGA 3SCOA 1V02E 1UWRA 1WDQA 2D20A 3TOPA 3AMGA 3RIKA 1MFVA 4M29A 2WAGA 2NT1A 1SYTA 1GONA 4B9YA 3GXMA 3FW6A 4HTYA 5D4YA 3KEHA 3WELA 1HF6A 1R87A 2PWFA 3LPPA 4YHEA 2JEQA 5FOOA 1UD5A 1E6ZA 2YLLA 1UWTA 1W3LA 1W9PA 5A8QA 3UG4A 1NWTA 3EDEA 1JZ6A 4HMCA 1L8NA 1GVIA 3CZGA 3BMWA 2VX7A 1DWHM 3JUGA 1TA3A 2DT1A 1J10A 3GTNA 1VEOA 2ZX9A 5FCZA 5AC5A 3DC0A 1EDTA 1XD0A 4BQ3A 3WD3A 2DIJA 1EQCA 1B3ZA 4LPCA 3VIOA 2CKSA 4XX6A 1EDQA 3PZTA 2WHLA 1JYVA 1XSIA 1NQ6A 3B9EA 3ZT7A 1J0IA 1QI3A 2WZIA 4PMRA 2ZXAA 2CYGA 3N11A 1LWJA 1ZL1A 1KB3A 1TVNA 2WWDA 1JZ2A 1M03A 5ABHA 5HBFA 2VCAA 4QLLA 2Q8XA 1J01A 2G3IA 4B3LA 3GNRA 1KQZA 5JIPA 1UD6A 2VX5A 3ALGA 2WNWA 4PMXA 3NCOA 2XFYA 3UEQA 2VX4A 1E0XA 2VVNA 2VZVA 1CDGA 1EA9C 2W62A 2WXDM 3SCQA 2VO5A 1BTCA 2DGAA 2WMIA 2VQTA 2FHCA 5DO8A 2XTKA 4UQEA 3WDPP 1GVYA 3FAWA 1TA3B 2WC7A 1GZJA 5DT7A 2G3JA 2XVNA 4URIA 3WQ4A 1GOIA 3KE0A 1MW1A 2OWXA 3WBAA 2G3MA 1E0WA 1EH9A 1U30A 4J28A 1QNOA 1CWYA 1PX3A 4UTFA 4BQ2A 3F5KA 5M03A 1MFUA 2O9OA 3KL5A 5HDRA 3PZVA 1QHOA 4DWSB 1OWQA 1CGVA 3TTSA 4F79A 5HNNA 2J4GA 4WLCA 5AY7A 2PF0A 5IHSA 3ZMRA 5E9AA 3VIIA 1VJZA 4LGXA 1UA3A 4AEFA 1PZ3A 1BYDA 4Q7NA 1VEPA 3VD5A 2J7CA 1IT0A 3VGDA 3VIJA 1W3JA 5CSUA 1UOKA 1NP0A 1UD8A 1HN1A 1C7TA 1UYQA 3AHXA 5LA1A 1V3KA 3KZSA 3ZJKA 3EMCA 3FY1A 1BG4A 3TTYA 4UQAA 3WQ6A 2RGMA 3AS0A 5E6YA 1Z32X 4CD8A 1BGAA 3AMLA 2D24A 5E0CA 1LL7A 1D7FA 2BY0A 4X9YA 1S46A 5BRQA 4JIEA 2G4FA 5EBAA 2YBTA 2X05A 4X0NA 3OGRA 2OWWA 1JXJA 4PUDA 3ARYA 4Z2IA 1VENA 2QLYA 1JI1A 1V0NA 2VZOA 1BSIA 3WF3A 4AMCA
chains in the Genus database with same CATH superfamily
5HK4A 1F2JA 3RJYA 3UVIA 1F61A 4IL0A 2AGKA 1T8XA 7CGTA 4N4PA 2WCAA 5IHRA 5J04A 3OPSA 2YXXA 3EPMA 4C91A 5B7YA 3L4VA 3ANVA 3VIKA 4OHQA 4HK7A 3W7QA 2AQVA 1W6TA 4YN5A 4DYEA 3E0FA 4C7DA 3QLLA 2BHZA 2W92A 2VKZG 1YTEA 1HT6A 3DC8A 3UXDA 4PTWA 3HFTA 3VA8A 1XG4A 1XX1A 3LDVA 4CLMA 1WZMA 3MO4A 4CCDA 4C6FA 4INFA 4LS1A 3AHZA 2X8RA 3DG6A 3N2XA 3QFWA 4UB9A 2ZDRA 3VKJA 4F2TA 3VK5A 3W1TA 3GIYA 2PDPA 3LMYA 2W66A 2YL8A 4DF1A 4KEMA 3VGFA 4HZ7A 2VFGA 4YPJA 3NM1A 4JFSA 3PTQA 3BW2A 1JZ5A 4QG6A 4WJXA 1NEYA 3HURA 1L8PA 2JK2A 4GWEA 4TX8A 1BRLA 2RDXA 3CAVA 2VCCA 3G22A 3PBYA 3KBJA 4BHYA 3ITVA 3QR0A 2ZKMX 1DJQA 1KM5A 1R47A 2D0FA 4QJ1A 4K2SA 4KWSA 5TD4A 3VKKA 4FX8A 3PJTA 3WNPA 5LNSA 4J7RA 2F6KA 2WJFA 1PL9A 1OX5A 4MZYA 5J5DA 3PR2A 1TB3A 3VDAA 2ICSA 1SJCA 3KBSA 3RFAA 1DQWA 2C18A 2G97A 3REQB 2XIMA 5D9PA 2A7RA 2O9TA 4CU8A 2C19A 5EFDA 2GSHA 2E7FA 1BYAA 4GQQA 1MZRA 3IACA 5H1WA 2I5GA 3AYRA 4MWAE 5KZ6A 1YW1A 1EGZA 4QEEA 1OM0A 3GXFA 3SCSA 1I2RA 4CU7A 1S38A 4JOMA 2PRHA 1BRLB 4WY0F 3DFOA 3E2SA 3LLXA 4LAMA 4LF1A 3Q4DA 2EKCA 2QV4A 3N14A 3QHMA 4W93A 1WZKA 2A3HA 4K6AA 3R4IA 5JUVA 4DZAA 2DSWA 1AODA 3UA3A 3RN6A 1Q6QA 5HMFA 1B3WA 3RAOA 3OYZA 1HKKA 2VRQA 1KFJA 4ICMA 3G1XA 1QNRA 3U9IA 4RDWA 2UV8G 1QAPA 4UFHA 3RX4A 4DJEC 3A9IA 4YIWA 3D46A 1O6IA 3OBEA 3PK7A 3HG5A 3BLKA 2FPVA 2ISSA 1OSEA 2ZXDA 4ZFMA 2CCRA 4H9UA 1FRBA 3VOCA 1CCWB 4N02A 4LUTB 5C9ZA 3CIWA 3TC3A 3HQ1A 3LBCA 4IGNA 3SCRA 1ZB5A 2YYUA 2WMJA 2QGHA 3RMJA 4JYDA 4XKMA 3W72A 4YNGA 4FXSA 4IFKB 3GW0A 2VGGA 4U3AA 3NDOA 4EE9A 3HMCA 4DI8A 1TV2A 1NARA 3HG3A 3AHYA 4UNIA 2J9ZA 6A3HA 1QMLA 4LVAA 3ABZA 1VGAA 4JN7A 2X09A 3QV6A 2UZ9A 3AFBA 4J5NA 5CC3A 1GJWA 1Z3NA 5FF0A 1MYRA 3WX7A 4OE7A 5AFDA 3TN5A 5A8GA 1PYFA 3UU0A 4ILSA 2FHBA 4AF0A 1NAL1 2CFFA 3WUEA 4WCJA 4FF7A 1GZGA 3UR8A 4NZCA 3UZYA 1QPQA 1W1A1 2ACUA 4NU7A 3O63A 2WZMA 1WKYA 1UKSA 3UJ2A 2OELA 1LLWA 3LGDA 3GNOA 4GZIA 3RRXA 4NRSA 3BCDA 4QLKA 3OHIA 2DQXA 3MDWA 2X41A 3LSCA 1TX2A 5DMLA 3E0IA 1KXTA 4GVIA 4F2BA 2Y5EA 4GUFA 1KRBC 3QF0A 4E8CA 3OBKA 4B91A 3QMSA 3VPLA 3LENA 3K1GA 1B57A 4DBUA 3TZNA 2WSPA 4IPPA 3RHGA 1V03A 1UCWA 2VR5A 2Z26A 1MEWA 3H55A 3KX6A 4JBRA 3RCYA 2XG9A 1R6WA 1HKWA 5EB8A 3NIYA 1KBLA 2PD9A 1EJXC 3KDOA 1ZUAX 2F61A 2Z7KA 2E40A 5CZTA 3IIZA 2FGLA 3B0UX 1JFHA 1KBJA 4NUWA 1EKOA 3ID7A 2PLKA 3W7JA 2DSVA 1E51A 3EB2A 3NL3A 2YCJA 2DEPA 5I5RA 1KO0A 4HNUA 1K70A 4A29A 2W9MA 3N17A 2VCBA 4QTGA 5BXPA 4B2DD 4EWND 3W23A 1XYLA 3QGKC 4OZOA 3P0WA 2QF8A 3EMZA 3GG7A 3MSDA 4W88A 4AF0B 2XISA 3A4WA 4GH1A 4DWSA 1XIEA 5H8PA 4MADA 4YTRA 2VZSA 2ZZ3A 3ITCA 2DPEA 4IP5A 2WCGA 3GTIA 3PUGA 5D2XA 3WLLA 3SCNA 1KNWA 3CMJA 3NPWA 5ENLA 4HB7A 3DGRA 4IIDA 3N9SA 3AZRA 2QV5A 3CHFA 3OO2A 2REQA 4JQAA 1RPXA 4GY1A 4GY0A 3DHPA 3L5LA 3TIMA 4A05A 1Q6EA 2P88A 4PFMA 1FWEC 3G8EA 2D0GA 3SRDA 3POCA 4J4KA 4FALA 1NWUA 5GJMA 1TV3A 4PMZA 5HJXA 4JYFA 3BGJA 1JCNA 3GKAA 3GDLA 1GK8A 4ATLA 4PC8A 3FK4A 1GOWA 3WNOA 2P10A 2W67A 4B5WA 2YPIA 1FP8A 4B15A 1AH3A 2JKAA 1UASA 2JBMA 1WDSA 3T09A 1US3A 1G4PA 7REQA 1OG6A 1U33A 4ICCX 4UOQA 1DKWA 4ADUA 5JBEA 2HVOA 3GXDA 4LAZA 2PZ0A 3WD2A 1TPEA 4NX5A 1NOFA 4FNQA 3L4WA 3DU0A 1WXYA 5CH9A 1XGDA 2I14A 4N42A 1LUCB 3E0LA 3GTHA 3RM8A 4O4WA 2D0HA 3AIVA 2POZA 2DDXA 5LGZA 1J96A 2R94A 1MUMA 4AYGA 3CZEA 3P5ZA 4FNTA 4ZTXA 4LUYA 4S3JA 1DORA 4ADTA 2CLHA 3LQLA 1VLIA 3B0XA 4TR9A 4REQB 5AHFA 3V3WA 3R0KA 4EPBC 4Q8QA 3WH9A 4YTTA 1F6KA 4N6EA 3QPZA 2VD8A 5H2ZA 1TWIA 2Z1XA 1X7IA 3EOEA 4ZXOA 1UHVA 3V1PA 1UD3A 3LS9A 1YXDA 1YNYA 5C9UA 1EX1A 2Q3OA 2RJHA 1W9XA 4CNNA 5A6JA 4OFCA 3S4TA 4A8NA 1H62A 2XVPA 4Z2HA 1XW8A 2ZA1A 3LHYA 2QW5A 4DO5A 3E0WA 2ABBA 3W84A 4O17A 3G6LA 5D8ZA 2WJZA 4K38A 4RJEA 4YS1A 2YFNA 3U4FA 2X1UA 3TTQA 5HXMA 2RHGA 1CNVA 1XDMA 3GFXA 1I2NA 4PEKA 5DCBA 2QUTA 2NX3A 4OWGA 1E56A 2HWGA 4PMYA 3WBYA 1IZJA 3KVJA 3PZ9A 1DYSA 1KM6A 4PFHA 1I9CB 5I00A 5AC4A 4F3HA 2XINA 4EXAA 4AVOA 2FZ8A 2YXGA 4JPGA 3W24A 1GJPA 4TX6A 4P2VA 2GUBA 1ZJHA 4JTGA 4C6CA 4PSRA 4Z08A 3WIJA 1MNSA 3O6YX 3IS4A 3G77A 4JFWA 4GUIA 4OVXA 3VILA 3H4GA 4E5TA 4FEZA 2R1LA 4TVUA 5E0KA 3OLDA 4TVDA 3EZ4A 2OPJA 5AB3A 4RZ5A 2WBGA 4H01A 3O0KA 4AW7A 2WVVA 3PS7A 3PFMA 3H6OA 3RYSA 2VWTA 3H21A 1XINA 1HVXA 3WNKA 2OR2A 4QLJA 1XIHA 4DJFD 2CPUA 1E6SM 3TJLA 1I1XA 4GUHA 3SUSA 1G94A 4XKYB 3SCPA 5AYIA 4PBFA 4BF7A 1DHKA 3ITOA 1B9ZA 4W84A 5A2AA 3DERA 3T8QA 2C3ZA 5JBFA 3T44A 3BUVA 4ZE4A 3RXZA 4KCVA 1FFQA 1YDOA 3LCIA 2I1OA 2Z0IA 4GKTA 1X38A 3MKCA 2H9AB 6TAAA 2TRSA 1ZNNA 2VNCA 1W9UA 3N2OA 1V3IA 3HOJA 3WJSA 1OYCA 3D3FA 1M7OA 3MHUA 4O0KA 1C9DA 1TJ2A 3MKVA 4EAYA 3VUSA 3JU2A 2F84A 4JHZA 5D2WA 4HU0A 1TPDA 1W8GA 3STEA 3GAKA 4PODA 2WZHA 3D0CA 1B5TA 1YPXA 3N12A 4WZHA 3PNUA 3LHTA 4EVZA 3VUPA 4NJGA 1TPWA 1PXGA 4C1NB 4F8XA 1KV8A 2W5FA 1UZDA 3IJLA 1FP9A 4ZL1A 3CUIA 3WH7A 2WVUA 3R25A 4NAFA 4E4UA 2FZ9A 3VOJA 4DJEA 2WLYA 2PDWA 2WANA 3LHWA 3WBWA 1QI0A 1OEPA 3I4EA 4C7FA 5CJ5A 2BOEX 4G7EA 4Z1DA 2FPTA 1PO9A 2FH8A 4EACA 2ALDA 2I9UA 4JNMA 5K2ZA 5CPTA 3PAJA 2EXOA 4IMEA 2CC0A 1XV8A 3SZ8A 1FHLA 4QE1A 3CM4A 3W7MA 1PTAA 3H70A 2PTYA 2DZPA 5K3VA 2OT0A 1JDCA 4AC7C 1OX4A 2OSYA 1HO1A 2VRKA 2X0SA 2F6XA 2CBJA 3KS5A 3APTA 1GYLA 2C13A 2EJAA 3OLIA 3CH9A 1XUUA 3VM7A 4J2MA 2GJRA 3L67A 3M9YA 2ZUSA 1MDRA 4MYAA 4AZGA 4U33A 3L65A 1E43A 3GAYA 3VAVA 3WBEA 3M5VA 2BGSA 1UWUA 1AJ0A 4PMOA 4LS0A 1IWPA 3RLVA 2YCLA 1Y65A 4PGLA 3QMRA 1GVSA 3WMBA 4GE8A 3ITLA 4GJIA 4ZENA 3I3EA 4Q32A 2POTA 3AIRA 2NWRA 1S5VA 3DYPA 2V30A 1CTNA 4DM2A 3MWAA 1W91A 3H23A 3BC9A 1GW9A 4ZB2A 3N19B 2P3ZA 3AOFA 5EFFA 2ZRYA 3WJWA 1X97A 2YJQA 2PZNA 1O12A 4GZJA 2ZZ7A 5AHIA 4DEFA 2IPGA 3V16A 5KTLA 2J8GA 3IJIA 2OSWA 4XIMA 2ADAA 1LORA 3IK4A 3U5YA 3C2OA 1QDSA 3YPIA 2VDGA 3G3DA 3MHFA 4CEXC 1O95A 3FSTA 1NFBA 1DP0A 4QHRA 4O18A 4DHGA 1Z69A 4GQGA 4QROA 3ZJ8A 2VFIA 3S2LA 3Q58A 3T08A 2VFFA 3APGA 2ESCA 3TA6A 4FXRA 2A1YA 1GOOA 4G1NA 5DCEA 4PL2A 4Y8FA 1J0KA 3CZLA 4IP4A 1IV8A 3WLJA 4ZOEA 1SJDA 3FAXA 3NQMA 1FOBA 4DZHA 2CITA 1ZAJA 3ZR6A 1IEIA 2GOUA 4QISA 3Q37A 4C6KA 2NWSA 2J79A 1GTEA 1UJPA 5ABTA 2WVSA 4ZQCA 1WDPA 4NNAA 3VX1A 2VVSA 5F4WA 3U7BA 3SCTA 2O0TA 2V3EA 3SGUA 1PKYA 4WF7A 1SR9A 3W7GA 3QHNA 1WA3A 4Y9AA 4H8UA 3SCUA 4MUZA 1YE6A 3O6DA 2QGYA 4B16A 2ZA3A 1R7AA 3SEPA 1X6UA 3V36A 5FD0A 3E1F1 3NZGA 1BF2A 1RA0A 4OTKA 4G5DA 4GQRA 5EGRA 3GD6A 1CT5A 1Q4NX 1Q6FA 4FNSA 2BWGA 2DV0A 1TVLA 2ZCGA 4FIRA 1GPWA 3KAOA 2YA1A 1JDFA 3KCOA 2A3CA 1D3GA 2GVYA 2R9RA 5JVLA 5E0FA 1F3TA 3FSUA 5IBXA 1SZEA 3KVLA 1NOWA 3VKAA 4HSOA 4QAIA 2PA6A 4E3VA 1GOXA 4O1DA 2VJXA 8XIAA 3QZ6A 2IKIA 4PZVA 3B8UA 3TLQA 2WM1A 4HA0A 3LGEA 2A6LA 4K3ZA 3SO7A 1IEXA 2D22A 1MQRA 3HPSA 4ATWA 3H2OA 1OADA 1HKIA 2PTXA 3PWIA 4F40A 1XS2A 1E1FA 1HZYA 3HQOA 1RALA 3QGVA 4A8LA 1XKYA 1FTXA 3QFEA 3LXAA 3OA3A 3U2CA 3ARZA 2QDHA 2DIEA 3CMGA 5AVHA 5ECVA 1H7RA 4CKQA 4RE2A 3W26A 1RBLA 4JCMA 2QZRA 3GH7A 3ABXA 2D23A 3OLGA 1I4NA 3M0LA 3VD4A 5FIPA 1UR3M 4LYRA 4DUXA 1GGOA 4YU1A 3FX4A 1W17A 4V2XA 5M5DA 2NW0A 3U6WA 2F9RA 1YBQB 2TODA 5GJNA 1TMQA 2XN0A 3ZR4A 3E02A 1XDJA 3C52A 3K4DA 1V4YA 4DJDC 1YE4A 4BS0A 5J5RA 2CEQA 1DIDA 5HANA 3RG6A 1TR1A 4H41A 4HNOA 4JIRA 3GKFA 2VI0A 3NL2A 1KTBA 4HSNA 4JX4A 4LBUA 4A3UA 3WNNA 5BU9A 4WIWA 1OCQA 5PTDA 4AD1A 2HEJA 1WZLA 3L0KA 3GY1A 2IMRA 1G67A 9CGTA 2V2HA 3A5FA 4ORMA 5CGQA 3VGGA 3BLLA 3CK5A 1ADSA 3ELFA 4KMQA 5CSRA 3T0DA 2PS2A 3PZIA 3S9ZA 1L6YA 1HKMA 3L4XA 2PCEA 3DFPA 4R27A 4XV0A 4ADSA 4DM1A 3KOXA 1TQJA 5TAOA 4ML9A 1WQ5A 4U31A 4ACZB 1FWBC 2OODA 2WCSA 3KDNA 3WYZA 3MUIA 7XIMA 2C16A 3VMPA 1LQAA 1ITXA 2XWEA 2G8ZA 2DVXA 1WUFA 1EJ7L 4DAIA 1AG1O 3SIZA 1T96A 1DIEA 1ICQA 1H41A 1GPFA 2QVNA 4XZNX 2CBVA 3B8WA 4NVTA 1BEUA 4KIRA 1BG9A 1AH4A 1H7OA 2HNEA 3M6YA 5GPRA 2VXNA 4EXQA 2DY3A 1Y8BA 4RZ4A 1R30A 2J7DA 5CQ1A 1GOQA 3BLOA 5FF7A 1VIZA 3KXQA 3T40A 4AUBA 2VD9A 2PDBA 2QAPA 4QG9A 2VX6A 3M64A 3RPMA 2D2HA 4D6HA 3P93A 5BU6A 4WX2A 4QSHA 1HJXA 3VDHA 1X39A 3TQKA 2EEXA 3IANA 1CX9A 3MUZ1 4V27A 2A6NA 3ARQA 1EUAA 2F6UA 4NT0A 4MWAC 1JCXA 3HMJG 4DJFC 1UD4A 5G1YA 3BGAA 3MBFA 1DHPA 4H6EA 2E9MA 4HP5A 3T7VA 3KZPA 4JGDA 3WDRA 4HPGA 3TYEA 4HYVA 3GU2A 3UA4A 2CWXA 5F2GA 1ZS2A 4J3WA 1GJUA 4HYWA 1MNZA 2PDKA 3IJ8A 1GQNA 2CLLA 2OYMA 3PPCA 2PGRA 1Q7ZA 1RUSA 1F4HA 4G2DA 2W63A 4Q8WA 2IPFA 3NM3A 6PTDA 4Q4OA 3TYDA 3P84A 5DCDA 1UKPA 3SJNA 4F4RA 2V3FA 1W1IE 4H2CA 2HMCA 1D3CA 1W37A 4I9MA 4ZVJA 5IXEA 2E9BA 3FIGA 3OJGA 3FEMA 5DBUA 1EBGA 1HL9A 3UG5A 2DSKA 3BOFA 1HJUA 1MSSA 1KRMA 1P0KA 1JQXA 5E6ZA 1H49A 3QV9A 1MRAA 3ZR5A 3GBEA 5E5CA 3KHDA 3VO0A 3OQ8A 2OEJA 3TV8A 1JFXA 2LLEA 3KOFA 2QJIA 2CWNA 2RFGA 4V33A 3DFSA 1YADA 1DWIM 1R5YA 3QOKA 3NG3A 5HWNA 3U2EA 4L4MA 1VLWA 4BF5A 2V3GA 1QW7A 3NSMA 1M7JA 1IEQA 2J27A 3CUFA 3NVTA 1A49A 4UTHA 3K1DA 2CLPA 1W3HA 1OIFA 1E9IA 4IH3A 4PMNA 1AQMA 2E5DA 4WY0A 6CGTA 1FFRA 1F3EA 5T26A 3WLRA 1BXCA 4IIHA 2A2IA 2Y88A 3RGTA 3T4CA 1W32A 2GWGA 3T07A 4M51A 3VOHA 3SUTA 1FH9A 4LUSA 4IGHA 4W7VA 3KTCA 4MPQA 2YW4A 4BEUA 2I57A 1FKXA 4LV9A 3MWCA 3HQPA 2E1WA 4PR4A 4AISA 1JIBA 5F1UA 2CZDA 2Q71A 2G41A 3QY6A 1H7PA 3WUFA 1XJBA 3LSBA 2BNJA 4FOUA 1SW3A 3JR2A 3R0UA 3UZJA 2VRJA 2YLAA 4QBXA 5G2IA 3AUOA 3ENLA 3CHEA 3VMOA 3WG6A 3WLKX 1TPH1 4XUGA 3LOTA 2UWFA 1LBMA 3G1VA 3LCLA 1Y5VA 1KXHA 1X98A 4S1FA 1ZAIA 2QCDA 1E70M 3TR9A 3UXKA 2ZWZA 4HZ6A 3W1NA 3R58A 1K4GA 1UKTA 3UG8A 1OG0A 3MP5A 2DT2A 4R88A 3P5YA 1N2VA 1P0DA 4QGCA 2CBUA 1M5WA 1E1CA 3T78A 3ZOAA 3S2CA 4KF1A 2YBUA 2BG5A 2ZZ5A 1TRIA 5G2WA 4GVGA 1O68A 2EG7A 1YNPA 3BDKA 4H6RA 1JNEA 3VZZA 3NVDA 1V6UA 1DJIA 2GQ8A 4HBKA 4QFUA 3V7PA 2FJKA 1ME7A 4C65A 4K1GA 1DJWA 1T6MA 2D20A 2NLYA 4GISA 2NT1A 1V93A 3M5YA 3SRHA 4FR6A 1Q65A 4PCFA 3U48A 3W70A 2Z1WA 2C1IA 4UC5A 3LD5A 1W9PA 3UG4A 3RLHA 3BMWA 2JGYA 2VX7A 4AHPA 3GTNA 5FCZA 3ZZ1A 5AC5A 3DC0A 1EDTA 1XD0A 2PSNA 2DIJA 1ONEA 1YXYA 2A85A 1OFDA 3VIOA 3UZ5A 2VC5A 1XC4A 5D05A 1FXPA 1XSIA 1NQ6A 3B9EA 3TSDA 3COTA 1J0IA 4PMRA 1VKFA 2YZRA 4FXJA 1O5RA 1LWJA 3W7OA 1P7TB 1TVNA 3U0HA 2CZ5A 5HBFA 3LZ3A 2Q8XA 1FDYA 3GNRA 4LV4A 2QUNA 3GW3A 5XIAA 2VX4A 4FAMA 3DFTA 3LI0A 4AXKA 4GYKA 1CDGA 2NUWA 4JDYA 4JY8A 4FXFA 2PTWA 2VO5A 4RNIA 1VQTA 3GO2A 2VQTA 1RA5A 1C8VA 2XTKA 4UQEA 1TA3B 3TROA 5DT7A 5CBIA 4BI5A 2G3MA 3EEZA 4J28A 1CWYA 3BO9A 4BQ2A 1UP0A 1WV2A 3VDGA 1OWQA 1UP2A 4F79A 5AY7A 3M41A 3NAVA 3ZMRA 4MYXA 3NQ2A 1EPVA 4YLWA 4LGXA 3GVWA 3GK0A 4PUUA 3SR7A 4AEFA 3CC1A 2OEMA 1IIHA 4ENLA 1ZGDA 1DQUA 4QRNA 1SZRA 1YNQA 3GVQA 4ZR8A 2J7CA 4NZ5A 1EJVC 1HN1A 1UWAA 1UYQA 1C7TA 1KCXA 3P67A 3T0CA 4C6JA 1W5MA 3AHXA 3PB0A 3MHGA 2MNRA 5U4NA 5HJLA 3TTYA 3WQ6A 4CD8A 1BGAA 1FCBA 3TJ4A 2D24A 1A5SA 4MFDA 2DUAA 4JIEA 3GDRA 2YBTA 3C8NA 1NFGA 4IQJA 3DG7A 3RNDA 4K1WA 3OGRA 1SVDA 1EF2A 4CNTA 1PS9A 2E77A 4PUDA 3ARYA 2VZOA 1HW6A 4NIRA 4AMCA 2HE8A 3UD6A 3BZGA 1A0DA 4DYJA 3WSUA 1EPXA 1J6OA 3PBVA 3CZKA 3IIVA 5DEZA 1UQZA 3SN4A 3TYAA 3EOUA 3BANA 2Z27A 3FXYA 1DQXA 1M7PA 1TQXA 3W0KA 5H8UA 4IICA 4HTBA 3KLKA 1FDZA 2IQDA 4IG2B 1ML1A 4AZ5A 3FYOA 3W88A 3AMCA 2CU0A 4A3YA 1K6WA 1P6CA 1LBLA 1SFJA 4CVUA 2J25A 4AC1X 2OLHA 4DY1A 1JUEA 5F4SA 3V35A 1I60A 1YTDA 2WMHA 3NTYA 3EKGA 1K77A 1RJRA 1FWCC 2FQIA 4G56A 1SM9A 4XD4A 1P0NA 2SFPA 3CU2A 4WOZA 1Z89A 3PJWA 1IZKA 4R3UA 3W6LA 2HS8A 2Y7GA 1QTWA 1KBIA 1SPQA 3IARA 2Y8VA 2ZXQA 4CD4A 5FJTA 2NV1A 1ME9A 1EJWC 1GQIA 4HHHA 2XGIA 5BZAA 1K7EA 5DRCA 1L0PA 5A6BA 2FB3A 4GI6A 1J18A 1ECEA 1C90A 3W7EA 1V0MA 1V8EA 4GI8A 3QR3A 4NILA 3LBMA 1XISA 4F0KA 4GGBA 5T9CE 1VFMA 5CBBA 1J5SA 3ARTA 4RNJA 1B0IA 2BVTA 3C0QA 3ZJ6A 1FCVA 1DTNA 1RQBA 1JPDX 2EG8A 4WGHA 4Q6XA 1WXZA 2EQDA 5D9NA 3HTWA 2G4JA 3UESA 6ENLA 3CIXA 1PHWA 3CV6A 3Q2DA 1P4CA 2DZAA 4L5ZA 1E9LA 2BP1A 4JX6A 4WKAA 1LLZA 1QOQA 2V38A 2WYSA 1BWVA 4DUOA 3GBDA 2I7GA 4O1BA 1YDVA 4FPSA 3N6QA 4HKPA 3AS2A 3O07A 2Z25A 1S3HA 3RCNA 5IFTA 1VR6A 5EKYA 3D3AA 4W4QA 1BXNA 3VYLA 3SCWA 3W1XA 3W6YA 1WKDA 1FXQA 3UPBA 4S38A 1K4HA 3AU2A 5HNRA 1DBTA 2DORA 4FF5A 4ICNA 4JICA 3N4AA 4AB4A 3U7VA 5TQLA 1XQLA 2CHRA 3WNLA 3MY9A 3E9AA 3W1AA 3DI1A 4IQEA 1OBAA 2IPWA 3W7HA 3QOMA 4GUJA 1AH0A 1T40A 4AQLA 4K8HA 3DGBA 4R85A 5HINA 1KFWA 4WDTA 1ZENA 3S2JA 4XD6A 3PN8A 2DT3A 1WAWA 4FIQA 3PVFA 3R5EA 4IIBA 1BKSA 3IAPA 2FTYA 1NDYA 2XVGA 3ARUA 1BWLA 2EBNA 3WJZA 3TOYA 4AD3A 1RCQA 1XXXA 3WD1A 4C6EA 2PB1A 2C1HA 2ZVIA 3GNPA 4GA8A 1QO2A 5HPCA 3LZ5A 2C6QA 1AQFA 3L68A 1Q7QA 4AHOA 4IFOA 2PF8A 3MV01 1AW2A 2Y4SA 4MTVA 2NQHA 3BPWA 2RUSA 2V3DA 4EPEC 5EYWA 1C8XA 4R7JA 3VKDA 2P3EA 4J9JA 3S42A 3T0AA 4DI9A 3L4YA 4CN4A 1S3TC 3BJTA 1E4IA 1P48A 1HFBA 1MRQA 4FHAA 7A3HA 3SUWA 1GQLA 4WSHA 2XIJA 1XLDA 3A4JA 3W2LA 4QDMA 1BPLB 3DFYA 3HA1A 3NO5A 5ABGA 1ISVA 3HG4A 3BMVA 1GCYA 4L61A 4O0QA 1UUOA 4PUWA 3HFYA 3W74A 3RO8A 3S2MA 4DJFA 3GDMA 1TV5A 1G4SA 2VYOA 2Q02A 4Y96A 3RUBL 2VQUA 3CZ8A 5H6HA 1WKEA 3WEOA 4ZQOA 5HUPA 1O1ZA 3L12A 1KTNA 3R7MA 2H6RA 5TIMA 4C6LA 1POJA 2C15A 4XAPA 4KESA 2IQTA 4HA3A 1IT7A 4L1GA 1EYEA 3STPA 3K13A 1GHRA 1KGWA 1FA2A 2FGZA 3UCQA 2D2OA 4XO6A 2Z1SA 3NYDA 4Q4PA 5DANA 1UH2A 3G8RA 1E73M 2RJGA 1RD6A 4KQNA 4LXFA 1B90A 3BLFA 1E71M 2OJPA 3B8DA 4LY4A 2PLMA 1B3OA 5RUBA 1PE1A 4I90A 3ZVHA 1XI3A 3LU2A 4MMWA 3UCCA 7TIMA 1PCWA 4ZZ9A 4MPKA 4TTUA 1W1ZA 2PDUA 4ERAA 3CT7A 2BS9A 1TE6A 2OYKA 1QUMA 4NYYA 3PBMA 3OQEA 4K7VA 1XIIA 5LSMA 3IIOA 5G1TA 2YBVA 4DBDA 1GVRA 3FVDA 2GQ3A 1HL8A 1EX5A 2PCQA 1U83A 1TO3A 1O1HA 2KZHA 3M16A 2W79A 4KIEA 3UWWA 3MV11 3N6JA 4PTNA 4I3GA 1Q6LA 4DXVA 2CLEA 1CGTA 3A5VA 4O4VA 5FL1A 3OODA 1V6WA 3B8VA 2ANUA 3DAQA 4PH6A 4KCWA 2QCGA 1JAEA 1A3WA 4Z42C 4Z2KA 4JIPA 2C8NA 4FZIA 3ARVA 3MU7A 5JH2A 3PBGA 3M5ZA 3BSGA 5DXYA 2A21A 1Z48A 3V0TA 1AW1A 1JYNA 1TV4A 4XZMX 2A4AA 3FGCB 1UROA 2O9RA 1JULA 5A6BD 2E0PA 5AYXA 3M0VA 3GXPA 1EXPA 3AWNA 4XD3A 2EPMX 1EJUC 1SFTA 1DJNA 1OFPA 4P8UA 1UD2A 4U5KA 1W2VA 2KX9A 1VFFA 4IMAA 4GX8A 1H50A 5I79A 3QEZA 3QVQA 4PB4A 2GOKA 1NVMA 3LCXA 4HGXA 4ZO7A 3UR7A 1XDLA 4Q4SA 3BAJA 4C6MA 3UGRA 2F8QA 4CQ8A 2OO0A 1T5AA 4UMAA 4PCSA 5JMUA 4S3EA 2KAUC 3EX3A 3S47A 1OINA 8A3HA 1JPKA 1EJTC 5I3FA 1WCGA 5XIMA 1KFLA 4CD6A 3UG3A 1A5BA 1X8CA 3M47A 3A13A 2J7EA 2ZBTA 5CKSA 2WZEA 1W5PA 3QY8A 2PDXA 1NFPA 3EA1A 4GCAA 4MB5A 3RU6A 1NQKA 2AGTA 1DIOA 1YPFA 4OT7A 1OFRA 3WLIA 1IXQA 1RCXB 3N9RA 3CLWA 5CC7A 3DHUA 3GS6A 4DQWA 1PWLA 3KCJA 3GDBA 5D32A 4ZCWA 2DZVA 2EPOA 4CUCA 1M41A 2Z2AA 5HATA 2YOCA 3VIFA 2C79A 4R53A 3SN1A 3SRKA 4M81A 5D8WA 4GVHA 4KEUA 5CPMA 3MMTA 3H24A 1R9ZA 3ZLHA 5I3HA 4IPJA 2OXNA 4MNJA 2CLIA 1SZGA 3W82A 1VS1A 3A23A 1BYBA 4NYUA 3TMLA 3ICJA 4XZIA 3C3NA 3OEXA 1TIWA 3IIPA 1EP2A 1OABA 4MG4A 2Z1VA 3A64A 4YCOA 4HNTA 1XH2A 5A6LA 5DMYA 2PDFA 4B3ZA 4EP8C 1FDJA 1V7YA 4PRWA 5AYZA 1IE7C 1LRQA 3TN3A 5KINA 4ZQMA 2WJEA 2OTDA 4C6BA 1DV7A 1FWJC 1GW1A 1A0CA 5EL1A 4WXZA 5MKGA 1MQQA 1OFAA 5BXTA 1RAKA 2X16A 1Q6RA 4O1AA 2Y7FA 1E4NA 1ITCA 2D69A 2VP8A 1F4AA 5ABFB 3WNMA 1VC4A 2J13A 3RRAA 3L7RA 1GZ1A 3A3HA 1TJ1A 4UWMA 1Z9AA 2Y8UA 1QWGA 4JCLA 3P8IA 3S6DA 5DN1A 1J12A 3VGEA 3S1WA 3L2IA 2CLFA 1DIKA 3O9NA 1SO4A 4Y90A 1Q5MA 1FHUA 1YXCA 3CNYA 3W75A 3T1GA 2UY4A 4BI6A 3C61A 3I68A 1GVQA 4LAUA 3THCA 4JTFA 1AK5A 3A24A 3QXBA 1DEDA 1ZBCA 3TFCA 2E5CA 2FZBA 4ECLA 4ZQRA 2PDCA 1E40A 1QU4A 1VFUA 2R91A 3N15A 2ACQA 2NXGA 4TXEA 3ATZA 3VOGA 5CJMA 3AMDA 4JTAA 4NX0A 3S6TA 4R33A 3N2CA 1PZ0A 2ZQ0A 3B03A 3WLMA 1A5MC 2OQHA 4NY2A 2XPKA 1JXKA 2HPMA 2E6FA 3SFWA 1Q66A 3UNTA 2AKZA 3OIHA 3P61A 3G0XA 2B4GA 3UWVA 5BXRA 1EC7A 3WLOA 4D6DA 1CI1A 1C7SA 3D5HA 1F5ZA 3L5AA 2BXVA 4JN8A 4P7OA 1KR0A 1SZFA 4N9BA 4WSJA 4J35A 3SN0A 4UFMA 4C6PA 1OK6A 3CV2A 2YW3A 3WF0A 4HA4A 3RCMA 3RPTA 2XVKA 1D8WA 1UW9A 1EHAA 3S5YA 1IHIA 1GVOA 1N8WA 2X1TA 3RLUA 1TPVA 3SQMA 3GHUA 4B5UA 3WDQA 1BF6A 5BXSA 4E6MA 3IUIA 2QCHA 3NUKA 4ML4A 3OU8A 2E09A 1ZU8A 4LVBA 1TX0A 1XLCA 1W1VA 4JX5A 3W71A 3W53A 4L1WA 1KC7A 2VEGA 4L6DA 4AWSA 3CWNA 3ARRA 3N3MA 4I6KA 3DESA 5A1AA 2F2KA 4ZB5A 5CAKA 1I2PA 5LZLA 3Q45A 3NDZA 3GQYA 3CGTA 2WNNA 3BLPX 4BZYA 5CCZA 2FZMA 2B31A 5A8MA 1ADDA 4N9DA 1FWAC 3BLDA 1H1YA 1RY8A 3GIPA 3C2RA 5G4WA 3F03K 4UTUA 2FB2A 1NF7A 2WSKA 2EKGA 4QCFA 1K7XA 3QHOA 1UBSA 2FDMA 3LQGA 4DPQA 4ZQPA 4KRZA 1YHTA 3QV8A 1REQA 2W61A 1J93A 1VAHA 1U5JA 5CZ0A 5AZ0A 3AXHA 4Q8OA 5EMMA 1F3XA 1S5MA 4ZXLA 1LDCA 4E3TA 4A8RA 3BICA 2PUZA 4AZBA 3AYTA 3QTPA 3W38A 4GGHA 4NXSA 3EX2A 3G1AA 3O16A 3GRIA 3UZWA 2YB4A 1F6PA 3M0YA 1N82A 3QMTA 3JRKA 4B4FA 4AWUA 2WM0A 1E72M 3AS1A 3OA5A 1JVNA 1C93A 4FNUA 2Y24A 1A4LA 3W73A 1ZPTA 3MVTA 4UFJA 3TE9A 1PUDA 1K8ZA 3R1ZA 2Q01A 4OOZA 1H5YA 1FCQA 1BYCA 2YCEA 2GFTA 3IGUA 1EWEA 3QQ0A 3MJMA 2O4QA 4JHMA 1EIXA 4HPNA 3W27A 4IWWA 1N7KA 1N8IA 1PCKA 1XBZA 3NQ7A 2W27A 1JD9A 3NZPA 1Q4WA 1AD4A 1U5HA 5GNXA 2CZFA 2O7QA 3W86A 4RCXA 1NWRA 4QX4A 4B5SA 4DNMA 2DFAA 2FFIA 4W9TA 4FP1A 1QNPA 1E0VA 2E3ZA 4DELA 4XISA 1LL4A 1P6BA 3M46A 2OG9A 5EA9A 4XAZA 3OZYA 4IXXA 3GNNA 3LPOA 2PDIA 4D9PA 4PB5A 1HGWA 3W4RA 2G0WA 2INEA 4H6KA 5AVNA 5HAOA 3WLSA 1C91A 1AL8A 4JTSA 1FUYA 4AAJA 5I78A 1ONXA 4CNPA 3OGVA 1TZ7A 2BXYA 2VZUA 4BR1A 1XYBA 3WQ5A 2E8ZA 4NJKA 3WY1A 2QMKA 3PZNA 4U2YA 4PB3A 4LAKA 3CZJA 2VZTA 3D6NA 3MYPA 3B0YA 1GVFA 6XIAA 2TYSA 4A21A 3QSRA 1LL6A 1ZSXA 2GJNA 2PU1A 3IGHX 4AIOA 2QYGA 2ZUTA 1JDEA 4UOJA 2DZTA 3GIQA 3W1LA 2HV5A 4ROQA 4E38A 1Q7MA 4EK7A 1Z44A 4HIBA 1ZCOA 5IOBA 4NZ4A 1G6CA 1HQTA 5D33A 3FKKA 3TYZA 1CLKA 5I77A 1RV8A 4K36A 2NUYA 5BW6A 1RZMA 2P8CA 3NSNA 4KFNA 3PFRA 1IIGA 1F7BA 1VRXA 5U7SA 1XYCA 3H2CA 3XIMA 4D2JA 2D1ZA 2JFEX 1AQHA 1IF2A 5JIWA 4ZSUA 1YLVA 1HP5A 4I5UA 1UOZA 4TTGA 5BYWA 4W87A 3L4UA 2BY2A 2QHAA 1UR1A 3PWGA 2QUVA 3SY1A 5HQMA 4XVEA 3GXTA 4O52A 5HMDA 3W6MA 3LMZA 3C0LA 3IV3A 3WL0A 3NEHA 4GXPA 4WDUA 3ZSTA 4IZGA 1SR0A 3W7CA 3VOFA 4AZCA 1IEWA 1JI2A 4F0SA 1K1DA 4IJCA 2PD5A 4C5ZA 3E2RA 4GQ0A 4A3HA 2A3EA 3PC0A 1VIWA 3TCEA 3AXMA 5I02A 4LBRA 3N3TA 2W4XA 1T0OA 4RKAA 1EEXA 1OX6A 4HOWA 3H2MA 4KFOA 1W5NA 4M0XA 1GUVA 5CZJA 2ZICA 3O15A 4FSAA 4X2PA 3CO8A 1A3HA 1KM2A 1R3RA 4PUKA 3TFXA 3I7SA 4CEUC 2QPUA 2NXIA 3VZYA 1JF6A 1IXOA 4DN1A 1E55A 4WDXA 3CL7A 2ZYFA 5K4XA 3EXRA 4NF7A 3WZ0E 3PF3A 2QXWA 2X2GA 3EWZA 2Y1HA 2P53A 4HZ8A 5JBDA 2ZZ1A 1XLIA 1JZ7A 5G2HA 1BTMA 4DBEA 1EOKA 4L6OA 1GYNA 3CLMA 4QXIA 3RM9A 1TJPA 3ZVIA 2FZNA 3O05A 3CTLA 4L4OA 1DPMA 4GQBA 4HMEA 1H63A 4CNSA 2O55A 3UR5A 2EF9A 2HK0A 4NG3A 3ZLFA 1QR7A 3DHDA 2GGJA 2YCIX 3VU2A 1OF6A 2DUZA 4F66A 1UMYA 2IKGA 1VFHA 4O53A 1QASA 2OMAA 4CQBA 3ZWTA 1X1ZA 3MUCA 2DU2A 3WF4A 3W7KA 4HT3A 4NZ1A 3WENA 4Q4QA 1TV8A 2QCEA 3CIVA 4ZOAA 4DX3A 3SGZA 4UFIA 1ZLPA 2Y89A 4V28A 3C86A 3CHDA 4IM4A 3MSRA 3GC5A 4ATDA 1E3ZA 3WQEA 1BSLA 3INPA 1ZJAA 2QJJA 4LCSA 1XIMA 1KCKA 4YWIA 2GVGA 3RU8X 3QY7A 2PWHA 3U3HA 2VC7A 1F3WA 1US2A 3MSGA 1EJSC 4UTKA 4JDBA 4MKVA 4UZSA 1TKKA 3CL6A 1CLVA 4M6QA 4TO8A 4IMCA 3ARSA 2Y8KA 4O16A 1EXBA 3GZ3A 3EA2A 5HQLA 4FLRA 3IEBA 4RE4A 2UY3A 3WLHA 2PDGA 3GR7A 2RAGA 1QFEA 3BJSA 3HV9A 2QNEA 2J47A 3CAKA 2ZC1A 1IWAA 5TNVA 3TH6A 4Z2GA 3K46A 4BQ5A 4E4PA 3M0IA 3TK7A 4G6CA 3PJUA 3WQVA 4WKFA 1R7OA 2ZIDA 5JQ9A 3RPDA 3WF2A 4WDWA 4DJDD 3ABQA 1KQYA 1EGVA 3KRSA 4GIAA 4KWWA 2QUMA 2A7PA 3AXXA 4GINA 4JEJA 3ABRA 1W2PA 4OGZA 4N4QA 1OCNA 1UB3A 1FX6A 2VFHA 1QPOA 4AZ6A 3HJEA 3TYUA 4GI9A 2EJ1A 3CAQA 3VVGA 3N34A 2QPXA 1R2TA 3CUZA 1W8SA 1BVNP 1XF0A 4X9SA 1PYMA 2J7HA 2OZ0A 3AS3A 3O6CA 4FOJA 1ZCCA 1XRTA 1OZQA 3NXFA 1TE1A 3MZNA 3FEQA 2HCVA 4F9JA 4C60A 1WOAA 1JCYA 1FQ0A 6REQB 1UC4A 1XPGA 1R46A 1WOBA 1MUWA 3BCJA 4QR6A 3PWAA 2CLKA 4FK9A 4DO7A 1NWSA 1UR4A 3TWBA 1R8LA 1DTUA 3GSMA 3BW3A 3U4AA 1JPHA 3TW6A 2VELA 3GG0A 3NXLA 3HO8A 3QRHA 3B9DA 4MB3A 4CVWA 1TIMA 4U3CA 4ERIA 1G1YA 3TAOA 3H22A 1EC9A 1A5KC 3MW7A 1FWHC 2QR6A 3BSHA 1H1NA 4JFUA 1Q6CA 5I6SA 2YDRA 5M17A 3UYCA 4KEVA 2BY3A 3LTYA 2CERA 3TXVA 3L5MA 3W83A 2RDTA 1V51A 2ATSA 1E6PA 1OGBA 5BROA 2BZNA 4M5PA 5A8OA 1UUQA 1TV7A 3M0HA 1Y7VA 4IFRA 1M6JA 3V0SA 1VBUA 1UR8A 3PZUA 3W76A 5FL0A 4QEHA 4UQBA 1VCGA 3H2EA 5LIKX 4PMVA 4LVDA 2HSAA 1V6TA 4K8GA 1RCOB 2HZGA 1QRQA 2WVTA 2XGBA 4O14A 2Y6ZA 2CXGA 3BG3A 2GSEA 5FEZA 3SCOA 3E3HA 1TWDA 3LCGA 3AMGA 1MFVA 2WAGA 2QF7A 1OHLA 1XP3A 1GONA 4B9YA 5F2IA 5LNWA 3FW6A 4E8GA 3KEHA 1HF6A 1R87A 1VYPX 3H4XA 4RXGA 2IS7A 1UD5A 3AU6A 3G5EA 3NO1A 3WQPA 2YLLA 1UWTA 1S2AA 4A2RA 3C8FA 5A8QA 4GYJA 1NWTA 1DJZA 3W7LA 1YKWA 3KW3A 1DWHM 1TA3A 3L0GA 3IGXA 1J10A 4DAFA 2ZX9A 3BZJA 3ANYA 4UNKA 3AUJA 3FCPA 1EWDA 4S3FA 3BL3A 3VNJA 4HU4A 4NJJA 3BTNA 3UJRA 1EDQA 1QI3A 5AZ1A 2J88A 1W0MA 3Q65A 4UMBA 1F74A 1ZL1A 3A12A 3C2YA 4J3ZA 3ABOA 2WWDA 1JZ2A 3BGGA 4TU1A 2ODOA 4QLLA 2QCMA 4B3LA 4IJRA 2ABAA 3WFAA 2WNWA 5KITA 3NCOA 3UEQA 5AHLA 4MY8A 4NI8A 3UPMA 1OY0A 1WBHA 2P76A 4S3AA 2PPGA 6REQA 2W62A 2WXDM 2HRWA 3SCQA 2PLCA 1BTCA 2DGAA 5D09A 2FHCA 3EWDA 4MKNA 1GVYA 3BLIA 3FAWA 1GZJA 2G3JA 2XVNA 4LNYA 3WJYA 2NV9A 1UUMA 1MW1A 3UWEA 2OWXA 3E5PA 5FI8A 1E0WA 4JTKA 5HMSA 1PX3A 4UTFA 5AOUA 2E6AA 2O9OA 1XYMA 3KL5A 1N8FA 2ZC8A 3KWSA 4AH7A 3MZ2A 5IHSA 1J79A 5EMLA 2Y5JA 1UA3A 3GC4A 5B7ZA 4KBXA 1NJJA 3KBWA 2GWNA 3ZLGA 2I16A 1BYDA 2AL1A 5AKQA 3VD5A 1NP0A 1POKA 3LI1A 3F4NA 3KZSA 2AMXA 1BG4A 2DW6A 3W1PA 3FA3A 3AWOA 1Z32X 5FJIA 5E0CA 3FJ4A 1A0EA 1LL7A 1S46A 5BRQA 2DUXA 2E25A 5EBAA 1VRDA 2FLIA 3KRBA 4E0CA 4GOAA 4X0NA 1OQFA 1SGJA 3THAA 4KT2A 2OWWA 3WMLA 2Z2UA 3W1UA 4Z2IA 1VENA 1V0NA 4PA8A 3GFZA 4XSMA 3P2VA 3NQCA 2C7FA 3KLLA 3GC2A 3QW4B 5DXXA 5BOEA 3MMUA 1I75A 3EPNA 1KW1A 1W9DM 1LROA 4UOZA 4CNOA 3B9OA 1AW5A 1RVKA 3USZA 5GQBA 2FVLA 2ZUNA 4C90A 3B4YA 1TR9A 2ASHA 1OFQA 3T81A 3N4FA 3TYBA 4ONVA 2ZVRA 3OZPA 2XDFA 4D1IA 3AZSA 1PX8A 5FEXA 4UTWC 3B3DA 4LB4A 4EWJA 2WBKA 1B31A 3DZ1A 2VDIA 4XD5A 1W3TA 3WFLA 1TG7A 3W25A 2XJ7A 3LXCA 2VEMA 3VNKA 2JF6A 4JTDA 1JDDA 4LALA 3DIPA 4Q7IA 4YMZA 4PMDA 3SDOA 4JR5A 2GK1A 2YXOA 3CWHA 4NJHA 5AC6A 2ZE3A 4GYPC 1W54A 2I56A 1JCTA 1UQYA 1REQB 5BMWA 4P7QA 3VD9A 4DLMA 4IT1A 5LGXA 3V0UA 1W5QA 2J24A 4RUBA 1KR1A 1XBVA 4IL2A 2ATMA 3G24A 3W2KA 2YB1A 2V5JA 4MY1A 4G9PA 1TTJA 4CQ9A 2XN2A 1EO7A 4GMEA 1C8QA 3FDGA 4C6NA 2WMGA 4LC6A 1JF5A 5DQPA 1HX0A 2NQJA 1EEPA 1V7AA 1HP4A 3DDMA 3M0JA 2VC6A 3WQWA 4W89A 3IV8A 4Q3MA 1IXPA 2CZVA 1OJXA 2ONEA 4AWEA 1J0HA 4ZODA 4ACYA 2WPBA 3IUHA 4PBGA 1IWBA 2GK1B 1OT1A 5GNYA 3PAOA 3BOLA 4W85A 2QQ6A 3HBLA 4RE0A 5DT5A 5E1QA 4IIGA 5K9XA 4O54A 1OZMA 2PGFA 1S2CA 1PIIA 2QCCA 3FJNA 4ZMGA 3PZMA 3F2CA 5CXPA 1NSJA 3BOXA 4IUGA 3ITGA 1A3XA 3SB0A 1HIZA 3PULA 3N73A 5CGMA 3EKZA 3CYVA 4KCTA 5BOOA 1KGUA 2HPIA 1B3VA 1HG3A 4PYSA 3WQOA 2ZDSA 4J3TA 3MPGA 2WMKA 9XIAA 2O92A 2OSXA 1Z42A 1JCLA 2H3DA 5IM51 1OCBA 3SECA 2BXZA 4MF4A 3BSMA 4JIIX 3NGFA 1H7XA 4W7WA 3P80A 4LQ1A 3LG3A 1ZJIA 3KL0A 2WHMA 2ZADA 5A8PA 3ZO9A 4UBPC 1PV8A 4I8DA 3GDKA 2XSAA 5AC7A 4EOUA 3A22A 3NPVA 4A3QA 3KFTA 4OV9A 3KWXA 2EAWA 4JKKA 4ZQNA 2OKTA 3S5OA 1XRFA 3WK0A 3VNIA 2R1PA 4AEOA 2VEPA 3W85A 1S2UA 3S83A 4S3KA 1UC5A 3BAWA 3WUGA 4Y9OA 2RDWA 4LX4A 2OCZA 3PP7A 1UIPA 3VXGA 5FJRA 3SFKA 3R11A 4TOQA 4DF0A 3B04A 3BAIA 3DYMA 3TNOA 2VUYA 1HVQA 3EWUA 4JFVA 4IPIA 4H7ZA 5I23A 3C2VA 1LP6A 4HMNA 1U1UA 4HPHA 2Y5SA 2DIKA 4JTRA 4A3RA 3NA8A 5A2BA 1XLGA 3PBWA 1FKWA 3MB9A 4LU0A 4D1JA 1YYAA 4L4LA 1D8CA 3DX5A 5I0DA 1ODUA 3FXGA 1YPIA 4XO7A 4PUEA 3DECA 4QAWA 1LWHA 2D3LA 1BKHA 4DUWA 4K39A 1RBOB 4LF2A 4B5VA 5FEPA 4EIVA 2GUYA 4EAMA 3KTSA 3V5FA 4O19A 4DB7A 5ECUA 1XIBA 3EXTA 1CB7B 5FJPA 3O6AA 1WZAA 1H60A 3ARXA 3VNLA 3W7PA 1H0IA 1SZNA 3QPYA 1KA9F 4I9TA 2XH2A 2XIIA 1UWQA 4DJED 1WE5A 3R10A 3OLEA 1FVPA 2HBVA 4JIHA 1XR2A 3UPWA 3G1YA 2X7WA 1UBPC 1VBJA 4LUIA 3K5XA 3S3GA 2ZOXA 4MDOA 2R14A 2ZRVA 3AQUA 1A50A 3N29A 3SSZA 2BY1A 2VTFA 4UTTC 3EDKA 4NP7A 1AD1A 3TAKA 3CASA 4WD0A 3B8TA 1CXIA 2AAAA 1P1XA 1R3QA 2BASA 5D03A 3GNXA 1OVDA 1XFBA 3W28A 3FHQA 3T2OA 3HB9A 2OKOA 4IQDA 4AZCB 3CT2A 3MANA 2PWEA 2ZWYA 3S46A 3KRUA 3NQAA 2Z29A 1W9VA 4LS2A 4MZ8A 3XISA 2GYIA 1HO4A 2DZXA 5A6MA 1QI4A 5AHEA 3FJLA 5A95A 3RK8A 3M4HA 4LH8A 4H8VA 3R43A 3RF9A 3Q94A 1S5NA 3B4UA 2DVTA 3PPFA 1EFZA 4B5TA 4QG8A 1E0TA 3EEGA 1DWAM 2YFOA 1UIOA 1TMHA 4RXFA 3TA9A 2ZFAA 3EXSA 1VHNA 2X7VA 1HJVA 1TCMA 1D2KA 1PAMA 4X61A 1QHPA 1VEMA 4ORIA 2GGGA 4B90A 2B7NA 3WD0A 2QPSA 3KVMA 3W22A 3VZXA 3ZXWA 3WQFA 3M7SA 3KP0A 4H1ZA 2DJXA 1ELSA 3GB6A 1E6XM 4WJEA 2QCNA 1K6AA 3WK3A 3CEUA 1QI2A 3BQ5A 2XWDA 2DVUA 1DWJM 1XIFA 3PANA 4GX9A 2R6OA 3MP4A 4AZ7A 3RX2A 4NQ1A 1QK2A 3IJ6A 3R8GA 3KBMA 3A6OA 3B8IA 4UFKA 4Z1YA 5DBTA 1WKFA 3OIXA 3RO6A 2EPLX 1UG6A 1TYGA 1GG0A 1XC6A 3WD4A 4O11A 2PGWA 4DO6A 4HN8A 3M6DA 1RLCL 1A53A 1JRCA 5A2CA 4I5RA 3MMDA 5E09A 4PRTA 5HR6A 1CXLA 1UH3A 1ICSA 3ZFHA 4M82A 3FHAA 5HA7A 3LM7A 2VEKA 1G9HA 1OD0A 3QGAC 3UCDA 1UP3A 4OJYA 5DELA 1R0MA 2YDQA 1SMAA 1HGYA 3ZM8A 2QJNA 4AY8A 2WPGA 4OBTA 4FS9A 2R1NA 1ZP4A 1WDWA 3QN3A 1HJSA 1H09A 2O4MA 1E4LA 2E9LA 2X1IA 2GPTA 3HGSA 4FB7A 5HUOA 4QIUA 1J0JA 1UH4A 3QH2A 3URQA 5ABEA 1CPUA 1WX0A 4CNUA 1KWKA 2Q3RA 1KCLA 4M24A 1WXJA 3GHRA 1TUFA 3U57A 1JGMA 1BHGA 3NZQA 2OGYA 1FHVA 2PFHA 2PBOA 4PULA 1DE6A 2E6YA 1GWJA 4B5XA 2XFRA 2X1SA 4H04A 1J4EA 2CKRA 4Z2JA 3FJ6A 3RLGA 3QR1A 3OVGA 3CO4A 4QJ3B 4MB4A 3DHFA 1CYGA 4JY9A 1A4MA 4TIMA 5LIWX 4C6DA 3SJ3A 3DOPA 1XLBA 1U22A 4HOXA 3WN6A 1UZ4A 1TWWA 1TZ9A 4C1LA 5T9BG 3SQSA 3HG2A 3PSVA 1V5XA 3THUA 1XCWA 2C71A 4O50A 1QO5A 3MT1A 1O66A 1R86A 3NZ1A 1UR2A 1A47A 3UVAA 1J11A 5A6AA 4AEEA 1CZ1A 3VNZA 2OU4A 4YTUA 4KPLA 4AU0A 4I7WA 2PP0A 1XD1A 1XL9A 2J8TA 5CZKA 2Z1KA 1VYRA 3UXIA 2JKPA 4D6FA 4UTLA 1I1WA 1RPKA 4M19A 1W9BM 1GYMA 4W86A 3ZT5A 2BTMA 2QULA 4O15A 5FESA 4HJFA 3PHAA 1F8IA 4IHCA 3PSWA 1SSGA 1TJRA 3NWRA 4N9EA 1JUBA 1JJKA 1EOMA 1ADOA 4DVOA 2ACSA 2NVCA 4RE3A 4A8IA 3AAMA 2J8FA 3UJSA 1MWOA 3LXBA 4JTHA 4QNWA 3BVJA 2J7BA 1ONWA 4US5D 3O2LA 1EP1A 2IPJA 3OB8A 1ZY9A 4HK5A 3DXIA 1P5BA 3F5LA 1K9DA 2VURA 4Q4KA 4YVVA 3W87A 1B54A 2XFFA 4HN4A 3RX3A 3MUY1 4GD0A 3CL8A 3LPFA 3WQGA 1WO2A 3DN5A 3G0UA 1CXHA 2OX4A 4KW2A 3W7RA 3LRKA 3C5QA 5EMUA 2HK1A 4N6FA 1BAGA 4D71A 4S39A 3DI0A 4DO4A 4K68A 1V0LA 2QCLA 3K8KA 1P1MA 4ZA0A 1R2SA 4JQ3A 1MXDA 4GG9A 4ERGA 4GC4A 1TUXA 4FLSA 4H9MA 3WDIA 5L9FA 2E8YA 2J7GA 1V6YA 3CPRA 1SFLA 1CXKA 1PBGA 2ZE0A 4N0RA 4EF9A 5LA2A 4LUSB 1E15A 2YA2A 1U5VA 2I17A 4HZMA 4JQ1A 3W2MA 3VI2A 1EP3A 1GEHA 1MVYA 2A5HA 2EO7A 2Y70A 2WC4A 2UY5A 3W29A 3H54A 4CQAA 4XZBA 2IXVA 4JTLA 3URNA 1WNOA 5G4EA 1X1NA 4AX7A 1G7VA 3S1VA 3TW9A 3LLFA 1XRSA 3E74A 3F5JA 4RL3A 5AHNA 1EHNA 2V63A 1EC8A 2ZX8A 3VD7A 4NSBA 4L64A 2Z00A 1C9WA 4RW5A 4UQ9A 1WB0A 5DY3A 4UXDA 3WKZA 3LYEA 3T05A 4AY7A 3STFA 2ZUUA 1PZ1A 4AD5A 2Z4GA 3NOYA 4JTEA 1PKLA 3ANUA 2VOTA 1BVZA 1ESWA 1OC6A 3FS2A 3SURA 4K7YA 3MO7A 5A3HA 1AL7A 3II1A 2EGZA 5IDIA 2X30A 3PPHA 5A5WA 1VFLA 4RZ6A 2V8ZA 3CQKA 4KEZA 4QNEA 1KTCA 1EGMA 3ERPA 3QQWA 1TVPA 1Y0EA 3GR4A 5K9DA 3AXKA 3UJEA 3ES8A 3H26A 4U4MA 4XBSA 1LT8A 1TPB1 3MUXA 4CD7A 2PU0A 3P3BA 1FWIC 4H00A 4L7ZA 1FHDA 4IG2A 4R9XA 2WW5A 2WSYA 2XIQA 3FN9A 1EZ2A 3TP4A 1NELA 2QUUA 1KRCC 4MDPA 3DFQA 4MJ2A 2I9EA 5MKGB 2Q8LA 2FH6A 1ISWA 4MJZA 1UMLA 4ZO6A 3VC5A 5IDZA 5LNRA 1UKQA 2BLEA 4XUYA 1HUVA 4GVFA 4L4PA 4OUEA 1E9ZB 3E12A 5CAHA 5CSSA 5AYBA 4YVXA 3LBOA 4W8AA 2OOGA 3WDJA 2A3AA 1OX4B 2CXEA 1M9HA 4HQVA 3TNBA 1NOUA 5F4XA 3CV1A 3VCNA 2VR2A 1OB0A 4PEEA 3AIEA 3VM5A 4QM1A 1US0A 1Z41A 1U1JA 1MDLA 1R3TA 2OFJA 1S5TA 1P6WA 4XB3A 3T0TA 4J1OA 1XLHA 1TPFA 3UETA 4GHRA 3AYVA 4G7EB 2NSXA 4AIEA 4HPXA 4ACZA 1D7KA 3B06A 3MSYA 1UKOA 2VT0A 3GFYA 3OOQA 2DH2A 3BWWA 4RDZA 4JQ2A 3NYZA 3WMCA 4KGJA 1QOXA 3OYXA 1G5AA 1A5LC 1V6XA 5D2TA 1MUCA 1JD7A 1ZJBA 4WVXA 3RMEA 4LCRA 2PLJA 3BQ6A 1ITUA 3LNMA 1TWSA 2J7FA 2NQZA 2FIQA 3VIGA 1JAKA 2HVNA 5I7GA 3UJFA 4ZFCA 4KRUA 1XH0A 1VJIA 4D8ZA 3A9BA 1VCFA 4NNCA 4NHVA 2EPKX 1UPMB 3AJXA 1TFVA 1WBJA 4MOZA 4M56A 4F0LA 2GGIA 2PRMA 4UCGA 2NSOA 1TTIA 3P74A 4PUMA 2VM8A 1XRVA 4W5ZA 2UY2A 2PTDA 2Y0FA 1KBKA 1L6SA 1XYFA 1V0KA 3NQFA 4R7OA 4G1KA 1R2RA 3A47A 3R89A 2V6AA 3M5XA 3T55A 1PIFA 1V08A 4LB3A 2V5CA 1ZHAA 4MJ4A 4IIEA 1TTPA 3L2LA 5FJOA 5A6KA 1IXNA 1CGWA 3GUWA 2D3NA 1UJQA 4UTTA 1JYWA 1HNYA 4WR3A 1LJYA 5C71A 3W02A 3B40A 4XWUA 2PODA 1LG1A 1WYIA 4B9ZA 3UXLA 3VE7A 5C9RA 1E5NA 1ZAHA 1WDRA 3GU9A 4I5XA 3RDKA 4M7TA 1XIJA 4LEQA 2XIBA 4X63A 1HTIA 1AMKA 1LUCA