1QI2A

Endoglucanase cel5a from bacillus agaradhaerens in the tetragonal crystal form in complex with 2',4'-dinitrophenyl 2-deoxy-2-fluoro-b-d-cellotrioside
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
302
structure length
302
Chain Sequence
SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRESAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into ligand-induced conformational change in Cel5A from Bacillus agaradhaerens revealed by a catalytically active crystal form.
pubmed doi rcsb
source organism Bacillus agaradhaerens
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE B
total genus 122
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 1999-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1qi2A00
1E6RA 1W9XA 2J74A 2VR5A 5LA2A 5I6SA 3FXYA 3GH5A 3NUKA 1NWUA 1B3VA 1QOXA 5BXTA 4UCFA 4AY1A 4OJYA 2J62A 1JI2A 2V5CA 2NW0A 5M5DA 4YPJA 3NSNA 5BXSA 1MFUA 2CKSA 1JFXA 2XFRA 3WNPA 3RO8A 1E0XA 1JYVA 4AISA 3SCTA 3CZKA 1NARA 1KWKA 1UA3A 3AJ7A 4MB4A 1H2JA 1JF6A 4W93A 3CTTA 1PPIA 3ARVA 3OGRA 4CCCA 7A3HA 2YOCA 3TONA 4DWSC 2ZX8A 3GH7A 2WLYA 3WSUA 4CKQA 1MW2A 3ZO9A 2J77A 1WNOA 1CENA 2XVLA 4JFUA 3ZR5A 1V3JA 3AMGA 3NCOA 3VKKA 2BXYA 5LA1A 2J79A 4JCLA 4W84A 2J78A 3VDBA 3VILA 1WZLA 4P7RA 4CN4A 1KFWA 2VVSA 2G4FA 2DIJA 1YHTA 2WZIA 1BYDA 3CMGA 4PMNA 1LJYA 1R7OA 2VNCA 2VT0A 1E0VA 3CPUA 5ECUA 3VGFA 3DHUA 1NP2A 3VX0A 1M53A 1VIWA 4HOXA 3MSDA 3AHYA 1CPUA 4GQRA 2E9MA 1GUVA 5CXPA 3FHQA 2XFYA 2XWEA 5A8OA 2VCCA 3WD0A 3VGDA 3AYSA 1OGSA 5AC5A 2ZX5A 1KR0A 2CPUA 2J7EA 4TVUA 2VRQA 3W53A 2WKGA 5CG0A 1IT0A 3PZOA 2VURA 2BNJA 3HMCA 3BSGA 1UD2A 3S6TA 1GOOA 1BYAA 2BS9A 1UR8A 3WELA 5F7UA 1MQRA 3VGBA 1FH9A 2OYMA 4S3KA 1JYXA 2YIHA 4MJ4A 5D4YA 4IISA 5D9NA 3WD1A 1HP5A 3AXXA 3LPOA 1UKQA 2WKLA 1WDRA 1QVBA 2J7BA 4B3KA 3PZ9A 4UFJA 3GNRA 1CXKA 3CLWA 4IUGA 1TG7A 1TE1A 1WAWA 1WZKA 1E0WA 3AHVA 3EDEA 1BTCA 3VDCA 2E9LA 1JZ5A 4HP5A 3OB8A 4H8HA 1SYTA 3DECA 3WF4A 3I3DA 4W7UA 1JXJA 3GYCA 4WK9A 1W32A 3I3BA 1D7FA 5BXRA 3AIUA 3L2MA 1I1XA 1QNOA 5JIPA 2ZUUA 5A6MA 2J7HA 5IFTA 3WDPP 2HVMA 4FLQA 3WFZA 3QOMA 3W27A 3W38A 1HL9A 1WZMA 2E8ZA 2WW5A 2EPKX 1WP6A 3BMWA 3WUEA 1E71M 3WH5A 4JKLA 4HPGA 1EOMA 1I75A 2D24A 3S2CA 2A3CA 2VMFA 4PMUA 4ATWA 4IPNB 4UZSA 3MMUA 1V3MA 4V28A 4UFKA 5IFPA 3UCQA 4BQ4A 4KGJA 4PMXA 3VIFA 1ODZA 2VUYA 4GZIA 3WUBA 1OT2A 2XM1A 4QCFA 3FW6A 3BAWA 2UY5A 3PN8A 1JZ7A 2EO7A 1UH2A 4AD1A 1J9YA 1CGUA 1UH4A 1W9DM 2ZXQA 4MAZA 1Q6EA 3SCOA 1ZBCA 1OIMA 3WD2A 4Z2HA 1V6XA 3WNOA 1QBBA 5CPTA 5E70A 3KL3A 3RM4A 4NZCA 2J75A 1F4HA 2G41A 4EE9A 2WWCA 5E6ZA 1W9PA 2CETA 1E5JA 1GVIA 3ALFA 2WHMA 2FH6A 4YHGA 5BROA 2EPOA 5KEZA 3AROA 1Q4NX 2OYLA 1CZ1A 1XV8A 1ISVA 1B31A 4GINA 1HKIA 1GNXA 2BY0A 4MDPA 4PRWA 4CVWA 3EBVA 5JIWA 1BSIA 3WMCA 2GSJA 5IHRA 1V0LA 3CZJA 2YKKA 3W37A 2VZUA 3KEHA 1X6LA 4CD6A 4B3LA 2XSBA 1NQ6A 4MNKA 2D3NA 3VIHA 1W1YA 4B9YA 4D1JA 3WQ6A 1M7XA 3FAXA 1Z32X 1H3GA 3W24A 4F8XA 2FH8A 2VX6A 1QNPA 2JEPA 3PTMA 1CBGA 2GJXA 1KCLA 3WFLA 1CDGA 1F4AA 4U33A 2PWDA 3WF1A 4W8LA 3U5UA 5JBEA 4MNJA 2CITA 2VI0A 4MADA 1GQLA 1K9FA 1CXHA 2YLLA 2BHYA 1BQCA 3QOKA 3AHTA 2DEPA 3RMEA 2YL8A 1QBAA 4Z2GA 1VFOA 3A4AA 1E3ZA 4J27A 1OD0A 1JD7A 2X0YA 4DUWA 3SCRA 1KXVA 1JZ6A 3UG4A 1W1TA 4M29A 2E4TA 3RJYA 4W87A 4KRTA 2O9PA 2YBUA 5A2AA 3SCQA 3APGA 5GNXA 3VGHA 1EO7A 1VEOA 4W8AA 1EO5A 2VX5A 3N11A 3WBAA 1E5NA 4QP0A 2WMFA 1QNQA 4UOQA 6A3HA 3L4VA 4PTVA 6CGTA 1U30A 1B3ZA 5A6BA 4DM1A 8CGTA 3BAIA 5HPCA 1NWRA 3FAWA 5D8ZA 5M3WA 4LYRA 2VVNA 3ARRA 4FF5A 4L4OA 1K9DA 3A47A 2FHFA 5A2CA 2V5DA 5BYWA 4M82A 1HIZA 1JF5A 2W61A 2EPMX 4C7FA 3DC0A 2O9TA 1OGGA 5A6SA 3VPLA 1BG4A 3KL5A 3F5KA 4NRRA 1EQPA 3EMZA 3L4ZA 4NI3A 4WKHA 5GQBA 1OIFA 4ZXOA 2D22A 4Z2LA 3CZ8A 3K8LA 3ARYA 1E4MM 3E1F1 1OM0A 3GXDA 4LYPA 1BYBA 1R7AA 1Y7VA 2WMGA 2ZUTA 3WQVA 1KGWA 1WCGA 1NH6A 4OZOA 3UESA 1UD8A 1LG1A 3A4WA 4M80A 3N18A 2VR4A 3ZT6A 1LL4A 1QI4A 4QLKA 4EANA 1BAGA 1H41A 1GCYA 2F61A 4M1RA 3NDYA 3U7VA 4JHZA 2W4XA 1WE5A 4C7GA 3W81A 3VD5A 4CD8A 2QHAA 2OSWA 4J3TA 4P8UA 4B16A 2UY2A 3JUGA 1CXEA 1TCMA 2V3DA 1V02E 3VIMA 3BH4A 4W86A 2X0HA 3OGVA 5DT5A 3T0BA 2CBJA 2YA2A 2J7DA 1W9UA 3ARPA 3MUZ1 4AEEA 3QGVA 5CGTA 3OLGA 1JIBA 2VL4A 2QMKA 4CN1A 1PX4A 2J7GA 1JAKA 1KQYA 1V03A 5I23A 4GO9A 4HTYA 4IPLA 3WDQA 2JE8A 3W0KA 4UQBA 2DSZA 3VU2A 4LXFA 1OT1A 5A8PA 2WBGA 1SMAA 4PUEA 2BFGA 2AOSA 1V3IA 3SEPA 4HA4A 3THCA 5C71A 4KH2A 1KQZA 1UKPA 3PHAA 5IXEA 1R86A 4DWSA 4W5ZA 3VTRA 3VIPA 2VZOA 1M04A 5E0FA 3LMYA 2FGZA 5HNNA 5ABFB 1EA9C 4F9DA 1TA3B 3M7SA 1V6VA 3RIKA 2ZUWA 4HOZA 2DQXA 3BCFA 3DYOA 1XH2A 1VFUA 1H0GA 2VRKA 1NOUA 2DIEA 4JL1A 2VCAA 3RCNA 3IANA 3WQ4A 2BVDA 3VGEA 1QI2A 4HZ6A 2W66A 4MTVA 3ARQA 4PMQA 1IZKA 1ISYA 4RE3A 4QAWA 4E4PA 1FHDA 2QPSA 2CXGA 4CGTA 4GXPA 3CIVA 1ZBWA 3PZQA 3VD4A 3L4YA 4Y7EA 1C8YA 1V6WA 3ZJ6A 4CU7A 4R27A 1HF6A 4KGLA 1V02A 1UHVA 1JDAA 4JL2A 1VJSA 3SURA 3N1AA 4JCMA 5HOSA 1KXTA 3NIYA 1DHKA 5EFDA 4N0RA 4W88A 4M56A 3TTYA 3GTNA 2VJXA 2QV4A 4GI9A 3AQUA 4OBSA 3A4XA 1XYZA 1G01A 2Y24A 3VM5A 4J3VA 4H04A 3T08A 1FA2A 3VD9A 1C93A 4TVDA 2QPUA 4N42A 3KE0A 2DSUA 3B9AA 1CIUA 3M07A 2D0GA 2PWEA 3FY1A 1E3XA 4AZGA 1WDQA 1H09A 2JFEX 3CZLA 4AD5A 2EQDA 1VB9A 2BV9A 4HMCA 3AZSA 1PX8A 4OKDA 3GXIA 2WNWA 4D71A 3GNPA 5GNZA 1XGZA 2D1ZA 1PZ2A 2WZEA 1J0JA 3K8KA 5BXPA 4YN5A 1FH7A 1MXDA 3AIEA 4ACZB 3T09A 4E2OA 2TAAA 2BY2A 3ZIZA 1H49A 3K8MA 3WDJA 1H5VA 1KGUA 2Y5EA 4CUCA 2X1IA 4PN2A 1E40A 5AY7A 2GJPA 2D3LA 1XH0A 4U3AA 1KR1A 3OZOA 1UR9A 2YDQA 1LG2A 3U57A 3I3EA 1C91A 1J18A 1E1EA 1KWGA 1DWGM 1TVNA 4V2XA 4WLCA 3O6AA 4QLLA 2WHLA 4WIWA 1PZ3A 5ABHA 3BLKA 2PWHA 4PBGA 1GQJA 1QHOA 3CUGA 2DSWA 4KMQA 4UQDA 4GQQA 2JF7A 2YL9A 1HKJA 4PMDA 4PMRA 2W62A 1JNDA 3BAXA 3G6LA 1UWIA 4HMEA 4AEFA 2ZUVA 4ATLA 1E43A 4F9JA 3WBEA 3MO4A 3WH6A 4AZ6A 3WIJA 2UY3A 2CBUA 7CGTA 2WM0A 4D72A 1W2PA 1JGIA 3PTQA 1CTNA 2YJQA 5JUVA 1KXQA 2WVVA 1HKKA 3VD3A 1EH9A 5CSYA 3W6MA 1WO2A 5FL1A 5EMYA 1MW1A 3QHOA 4BF7A 4EK7A 3AXIA 1E56A 2Y2WA 3CHFA 3SUVA 1CXLA 3T2QA 2WYSA 3VVGA 2XVGA 2WWDA 1UA7A 1JYNA 2JIWA 4ACZA 4KRUA 3IK2A 3KWXA 4ZE5A 3WH9A 5I0DA 1K9TA 3AIQA 3OBAA 5C70A 4MDOA 3LPPA 1E6XM 4H2CA 3VO0A 3AFBA 3OGSA 4YHEA 5CLWA 1VBUA 4UOZA 3OA5A 2GVYA 2X05A 4AD2A 1FOBA 3ZJKA 4CD4A 1UKTA 2JIEA 4AWEA 4WKAA 4PEEA 1LWHA 1PX3A 2BVTA 2D0FA 5FOOA 5JBDA 2JEQA 3SCVA 1UWSA 2YL5A 1JYWA 4E8DA 1WB0A 9CGTA 5A95A 5AYIA 2Y4SA 1GHSA 2CESA 2PF0A 4H41A 1W2VA 5BRQA 4HMDA 5CQ1A 5D8WA 4OOZA 2CIPA 4FLSA 3CHDA 4M81A 2DSVA 3LPGA 3G6MA 2C0HA 3ZQ9A 4UZUA 4PMOA 3BLPX 4GI6A 1MQPA 4Z2KA 2ZICA 1XSJA 2YDSA 1UR1A 2C7FA 3MUAA 2J4GA 1JG9A 3WDIA 5A8MA 2QMJA 1HJQA 4F79A 4JKMA 4HA3A 4CU6A 3EMQA 3IAPA 2GDVA 3TTOA 1E9LA 4J3WA 1HN1A 2ZXAA 2WVTA 2HISA 1CGTA 1H11A 4H7VA 4MB3A 4WSKA 1JZ2A 1QI3A 4RL3A 3T2OA 2Y8VA 5ABFA 1VAHA 1B3YA 2YA1A 1E70M 3SIMA 1HNYA 3K4DA 3POHA 2E8YA 1E4NA 4F66A 2A3HA 1UWRA 4S3JA 3VIKA 3J7HA 5A6BD 3BXWA 2Q8XA 3RPMA 1NOWA 1GZJA 1M03A 1ZU8A 3UR8A 1W1PA 4TUFA 4TTUA 4JKKA 3WNLA 1CXFA 2VX7A 3OLDA 1JAEA 1UG6A 1UD3A 1WDPA 1SFSA 2WPGA 4D6JA 1FH8A 3VMOA 4D6HA 2FHCA 3GH4A 2E0PA 2WHJA 2WCSA 2RGMA 2G8ZA 3PBGA 2DT0A 1BF2A 3VIGA 2J8FA 3AHXA 3W6LA 3PZVA 1ZJBA 3PZTA 3KZSA 1US3A 4D6DA 4Q7NA 1QHZA 4OIFA 4TX6A 1EQCA 5IHSA 4QFUA 2B31A 3N12A 4AZIA 1R85A 4AIOA 2PC8A 1QI5A 1UOKA 4M8UA 2WB5A 4MNLA 3WL0A 5A6LA 1RD6A 2EPLX 3GM8A 1G94A 1US2A 1QNSA 5HPOA 2DT2A 3NDZA 1UZ1A 2G3IA 3CHCA 7TAAA 3WENA 2X09A 5A6JA 1G1YA 2WANA 4CD5A 4JHOA 4BA0A 2DPEA 3VINA 2VRJA 4U2ZA 3MKKA 3L4XA 3DYMA 1TUXA 3W26A 3K46A 2BY3A 3AS2A 4P8WA 1EDTA 1HKMA 1H1NA 1AQMA 4MAVA 3NYDA 3SUSA 3AYRA 1W3LA 2E40A 3MUIA 2DH3A 3WD4A 1EHNA 2CCRA 1AMYA 4K68A 2CNCA 5ABEA 5M17A 3ZSTA 4UNIA 1W91A 2WXDM 1XSKA 3AZRA 1IV8A 1HJSA 3WY1A 1BYCA 1GQIA 2VTFA 2WC4A 1CGWA 3TA9A 3AHZA 1N82A 3IAQA 5DEZA 1UR2A 3BAYA 4J3SA 2ZUNA 2AAAA 1E55A 1H0IA 2WLZA 3T0AA 1H4PA 4MNMA 2CBVA 3VNZA 3WQ8A 2JF6A 4PMZA 3F4VA 3ARUA 4ML4A 4AZBA 3B8SA 3VDHA 1PIGA 3B9DA 4XB3A 1V0NA 1V3KA 1CLVA 4XZWA 1ISXA 5FCZA 3CUFA 1C92A 4Z2IA 1V3HA 1HX0A 1B90A 2VX4A 1GHRA 1QNRA 2DT1A 3PZGA 4D1IA 1V3LA 1XRVA 2XVKA 5DFAA 2GFTA 1G9HA 4AYSA 1FFRA 3WUFA 1CECA 3NJ3A 2IXUA 3FNDA 3RDKA 4JFSA 2GK1A 2XIBA 1X6NA 2BVYA 3VIIA 1I1WA 3GBEA 2DGAA 5M03A 3L4WA 2NT0A 1GVYA 2EBNA 3AIVA 1PBGA 4X0NA 1GOWA 3UEQA 3VOCA 3WEOA 1GQKA 4ZE4A 5CSUA 4AD4A 3CO4A 2ZUSA 4PSPA 4C7DA 4ACYA 4OUEA 1ZBKA 2O9RA 1UWTA 1J11A 1MW3A 3IJ9A 1UWUA 4AD0A 2UWFA 3B9EA 1VEPA 5A1AA 1AQHA 1W3JA 1ZS2A 1DWHM 2IXVA 3ARWA 1CGXA 1R87A 2J7FA 2EEXA 3ZJ8A 3BGAA 4GZJA 3CGTA 1J01A 2BY1A 4J7RA 1TZ7A 4AZ7A 1MVYA 5IDIA 5HBFA 2A3AA 2VZVA 4PTWA 4A3HA 1GPFA 4WSJA 4M24A 1UD4A 1EXPA 3OLEA 3D5HA 3TOPA 4P7QA 3A3HA 1J0ZA 1EHAA 1ZBVA 1LWJA 4TXEA 4HA1A 4URIA 3CMJA 2Z1SA 1XCWA 4UQAA 1OGBA 5BWFA 1OINA 2CERA 5E09A 3ZMRA 4AIUA 2W91A 3CZGA 4PSRA 3WKZA 5KZ6A 1KXHA 1S46A 1C8QA 1VRXA 1NWSA 2FGLA 4U2YA 2ZE0A 2ZX6A 3AXHA 4OBRA 3K1DA 3BCDA 1KBKA 2D23A 3TP4A 1C7SA 1HVQA 3WQWA 1MWOA 5D9MA 1X1NA 4AZHA 1UZ4A 1KGXA 2WC7A 4JZ5A 1B2YA 1AVAA 3N04A 1GONA 2MANA 3PTKA 4DWSB 5FKYA 3EMCA 2PI6A 1EGZA 4JIEA 2DDXA 2OYKA 1Q6DA 1W3HA 2YDRA 1KBBA 4D6GA 3PZMA 1GJUA 2WMIA 1BLIA 1UQYA 5AC4A 4P7LA 3AS3A 1C7TA 5FIPA 1GOQA 5AYBA 3WF2A 4DUVA 3VIOA 2WMHA 1CNVA 3L2LA 2BXZA 2DT3A 1DTUA 2GJRA 1CXIA 1ECEA 1O7AA 4J3UA 5I24A 4L4PA 1E6QM 1XD1A 5CPQA 2W92A 3FHAA 1J12A 2ZXBA 4LGXA 5EB8A 1JZ4A 2WVVB 1VENA 4HU0A 4JAWA 2VO5A 4NF7A 1VBRA 3UG5A 2OSXA 3UETA 2WZHA 3MS8A 3UG3A 3M46A 1W1VA 2DH2A 4FLRA 1HJVA 3WMBA 1E6ZA 1TVPA 3SUWA 3T2PA 3GNOA 4R5EA 3UR7A 2WAGA 4CVUA 5CZKA 2GK1B 1OB0A 1BG9A 4QDMA 3EYPA 1XD0A 1NP0A 2ZIDA 1QHPA 1D3CA 1J0KA 1TA3A 5A8NA 4UFLA 4DUXA 1J0HA 4KWUA 5A6AA 5LYRA 3U7BA 1E4LA 3A6OA 2VOTA 4FMVA 2NT1A 5HDRA 3CZEA 4AXNA 1E6SM 3VM7A 3SUUA 2OWWA 2EPNA 4A3YA 2VCBA 3VUPA 2XUCA 3T0DA 4ZXLA 3ARSA 4PCSA 3AMCA 3POCA 2E3ZA 4MPKA 1UWQA 4BCEA 3F5JA 4HU8A 1HJWA 2Y8KA 1VFMA 4W5UA 4TX8A 1NOFA 1JZ8A 3MANA 4J28A 2ZOXA 1CYGA 2G3JA 3IJ8A 1DEDA 1J10A 1ISZA 4GI8A 4NSBA 3DHPA 3FN9A 3MUY1 2OSYA 2XIIA 2EJ1A 1WDSA 1UR0A 1HXJA 2XHYA 2ZWZA 3THDA 1ZJAA 1Q6CA 3WL1A 4AZCB 1BFNA 1EOKA 3RILA 2XSAA 3W4RA 2YL6A 2WSPA 4BQ2A 2GUYA 4GPNA 4P8VA 4ZENA 5DO8A 1V0MA 1UD5A 4TVCA 3II1A 2RGLA 4LPCA 3PZIA 4W85A 2W5FA 2V3FA 1Q6GA 1HP4A 4W7WA 3BAJA 4PUDA 1J0YA 1GOKA 2G3MA 2XGBA 5E0CA 2V38A 3L4UA 3AS1A 3N13A 3SCWA 4BQ5A 1M01A 5HXMA 2XM2A 4HZ8A 3VMNA 1PJ9A 3GXFA 3ARXA 4GZEA 2XG9A 2O92A 3GXMA 1G5AA 1UUQA 4PTMA 1AQ0A 4BZYA 4E8CA 1OSEA 2WSKA 5FL0A 3AISA 4XUYA 4UOJA 4ZEPA 4JFTA 5D9OA 5A2BA 3ECQA 3EDFA 2EXOA 4X0VA 2VQUA 4MB5A 2J47A 2JALA 2PB1A 4UFMA 3ZOAA 1JD9A 3AMKA 1FP8A 1JXKA 1E73M 1V6YA 4AMCA 3WEZA 5E9AA 1B9ZA 1ISWA 2J8GA 4ZFMA 1A47A 3O2LA 3CH9A 1E6NA 3MMDA 4PTXA 1GW1A 2WVUA 4DM2A 2CBIA 3NSMA 5D9PA 1ESWA 1SMDA 4FLOA 2XPKA 4U5KA 1EIBA 3TTSA 3ARTA 3WNKA 5CJ5A 2NSXA 4WJXA 1EDGA 1ZB5A 1XHGA 1YQ2A 4JFWA 5CGMA 1OWQA 3AS0A 1NM9A 3D3AA 2F2HA 3TTQA 1UD6A 1C3FA 6TAAA 3SUTA 3WD3A 2DSKA 3PZUA 3EDKA 2BHZA 3OLIA 4P8XA 3EDJA 3W82A 1LQ0A 5JBFA 2PWGA 3AZTA 3W25A 2XVNA 3CBWA 1PEZA 5CPSA 3VMPA 3ALGA 1EDQA 3VIJA 1W3KA 1O6IA 4UFIA 2C8NA 4PMYA 2XWDA 3WF0A 4GKLA 1JNEA 1TFVA 4D6EA 3QHMA 5EBAA 3ZT7A 4AD3A 4HZ7A 4A4AA 3ZR6A 3MSGA 3GBDA 1IZJA 4WF7A 1V08A 1BPLB 2VC9A 1FHLA 3CUIA 4WKFA 1C8XA 1NWTA 4D6IA 3ZT5A 1WPCA 3AIWA 2ZX7A 1OD8A 2A3EA 4BS0A 1U2YA 3SCPA 1SR0A 1BGAA 4UTFA 1R8LA 1E1FA 3MMWA 3VGGA 2ZXDA 3VD7A 4U31A 3GDBA 1BVZA 2G3NA 5CLTA 1UKOA 1KCKA 4W8BA 4FK9A 3RM8A 5GNYA 3AMDA 5I3DA 2ZX9A 2CHNA 3F5LA 2QLYA 3IJ7A 3OZPA 4HPHA 3M6DA 3AICA 1UR4A 4H8UA 1CLXA 4X9YA 3W29A 2W67A 2UY4A 3DYPA 2WCAA 4B15A 4D6FA 4Z2JA 3MV01 2WBKA 4V27A 2IUZA 5I2UA 2A3BA 1L0PA 4P7OA 1KB3A 5I78A 1XH1A 3EDDA 1V6UA 2XFFA 1MXGA 4OOUA 1RP8A 2X8RA 3W28A 1L8NA 2OLHA 2VQTA 1DWAM 2Z1KA 2XYLA 3CUHA 1TMQA 1ZL1A 4LQ1A 4AIEA 1PAMA 3BSHA 2CHOA 5A6KA 1JDDA 1CGYA 4UR9A 1UKSA 2PBOA 1OBAA 4CD7A 3SCSA 3ZJ7A 1HJXA 3SCNA 1BVNP 1BHGA 1B1YA 1W9BM 1VFFA 4B9ZA 1QW8A 1K6AA 4EKJA 2D20A 2FHBA 3N9KA 5A94A 5TD4A 3WH7A 3KL0A 4AZCA 3WDHA 2E9BA 3ARZA 4JFVA 4AC1X 3PZNA 1QI0A 5BRPA 2CEQA 2YLAA 1HL8A 5A8QA 3CUJA 3VDAA 5BCAA 1XSIA 3LPFA 2WK2A 5C8BB 1UYQA 1GJWA 2VZTA 2GJXB 4UFHA 1JFHA 1LF1A 1MYRA 1XCXA 4TTGA 3NSXA 1LL6A 2ZWYA 5DMYA 2GDUA 5EFFA 3WN6A 1E6PA 1HJUA 1RP9A 1RPKA 2D2OA 3N17A 1MFVA 5DF0A 8A3HA 1ITXA 4BQ3A 1XC6A 4PMVA 1B0IA 1A3HA 3K4AA 3WEMA 1B3WA 3WDRA 4EAMA 2X2YA 5ABGA 1QPKA 3U5YA 1K9EA 3HN3A 2PBGA 1UH3A 3OIHA 4W7VA 3N15A 3AOFA 2QF8A 2WMIB 4NRSA 1FP9A 3ZSSA 1B3XA 1JZ3A 1MW0A 3BC9A 1GOIA 3AI0A 3HU7A 2BHUA 4CCEA 3L4TA 2XGIA 5I5RA 4XX6A 1WZAA 5A3HA 5GPRA 2XTKA 4PYSA 4W89A 1C90A 4UQ9A 2J25A 1ODUA 1DWIM 4AZ5A 3WQ5A 1JI1A 1VJZA 4GIAA 5I77A 1LLOA 4DWSD 1QW9A 2OWCA 2W63A 1RH9A 4H8VA 4CN6A 4UQEA 1Q6FA 4MJ2A 1UQZA 3O9NA 3WF3A 3AIBA 1ITCA 1TR1A 2WMJA 1CEOA 1MQQA 3VX1A 2XJ7A 5A69A 4CCDA 3BAKA 4CU8A 2OWXA 2V3GA 1P6WA 2WMKA 2FDMA 1GORA 1HVXA 2J7CA 1PIFA 4ATDA 1DWJM 3QR3A 2O9OA 1J0IA 3QHNA 5FD0A 2D0HA 2XVPA 3UERA 1U33A 1BGGA 1DP0A 3WH8A 3AIRA 4QLJA 1OCQA 1GOMA 2WCGA 4LX4A 1LL7A 2VZSA 1VF8A 2F8QA 4LYQA 3RJXA 3WNMA 1E15A 4QCEA 5LA0A 2V3EA 4PCTA 3AMLA 3MU7A 4J3XA 4P7NA 3RM9A 1XYFA 1B30A 3BMVA 3WMSA 1CWYA 2CKRA 3OG2A 3CHEA 1FFQA 4RE4A 2ZUMA 1WKYA 4TOQA 4MB1A 4AW7A 4HOWA 1HT6A 3WUGA 3SCUA 3VNYA 3HJEA 1D2KA 2WC3A 4XV0A 1DWFM 2YA0A 4UQCA 3WNNA 2WHKA 2AMGA 2ESCA 4Q22A 1JL8A 1G0CA 4XZBA 4RE2A 2WVSA 4GO8A 1V0KA 3GZAA 4U3CA 3ZM8A 1CGVA 3MV11 1W9VA 2YBTA 5I79A 1VEMA 5DT7A 1E4IA 4D6CA 5E6YA 4IM4A 1JDCA 1E72M 2CYGA 2PWFA 4U5IA
chains in the Genus database with same CATH superfamily
4XAFA 2HS6A 3FXYA 3NQFA 2BOFX 2OLSA 4ZOCA 3R79A 2GSEA 3BLIA 2V5CA 3NSNA 3S5SA 4PB5A 2CKSA 4GX9A 2XFRA 2CLKA 3SQLA 1EX5A 3WNPA 1OYCA 3RO8A 3APTA 4JN6A 4K2SA 1NARA 1KWKA 1UA3A 3BG3A 3LHYA 3O07A 1XIGA 3HPAA 2FPYA 1K7FA 2CZVA 4CCCA 3IACA 2NQJA 2YOCA 3QV8A 3H7UA 2ZX8A 1L6SA 5FF2A 1MW2A 4QG8A 1PYMA 2ANUA 1OG0A 3AMGA 3NCOA 3VKKA 2RDWA 3VILA 5A5WA 4BWLA 4CN4A 2A7NA 2REQA 4GXWA 3AJXA 1YHTA 4LVFA 3I68A 4PMNA 1LJYA 2VT0A 3ZWTA 1VIZA 3DHUA 4IIEA 3COTA 3VX0A 3CV6A 5D32A 1IHIA 3SBFA 3PFRA 3RITA 3AHYA 3REQA 5F2LA 4ZO8A 4H7ZA 1TV8A 3N73A 4GCAA 1UWAA 2XFYA 5FSDC 3KUMA 3WD0A 2V8ZA 2C6QA 3W01A 5DY3A 1O95A 1B9BA 4A21A 3CASA 4TVUA 3VAVA 3W53A 3CPRA 2WKGA 3UXAA 3G3MA 1K77A 5CG0A 1IT0A 1OFQA 2E77A 3PZOA 4Z0SA 1QPNA 4O18A 1GOOA 1UR8A 3B0XA 1FWWA 4MJ4A 4S2CA 5JMUA 5D4YA 4IISA 4O1EA 1N8WA 3WQPA 3EX1A 4B3KA 3RLHA 3AUJA 3PF3A 4ADUA 1OX4A 3ZWSA 1DXIA 3UZ5A 4JTKA 5H8MA 4DO4A 3PAJA 5HUOA 1WAWA 3AHVA 1BTCA 1JZ5A 3DECA 4YVVA 3WF4A 3H70A 3URBA 2FZNA 3RPDA 1QASA 4WK9A 2PP3A 3GNNA 1I1XA 1QNOA 5D30A 3BG5A 3FJ4A 3OU8A 4ML9A 5IFTA 1B4KA 1H60A 3QW3A 4QG6A 1WDDA 4RXFA 3W27A 3W38A 1WZMA 2WPBA 1E71M 3WQFA 3LLXA 2YFNA 1SZFA 3T8QA 2A3CA 3NL5A 4UTJA 2VMFA 3BL3A 4IIDA 1P43A 3TCSA 1SUXA 2Z2BA 3FCPA 4UZSA 1IXPA 3TNOA 1V3MA 4V28A 4ZBCA 4UFKA 4RW5A 3TQPA 5IFPA 5FAJA 3UCQA 4KGJA 3PS7A 1ODZA 4PODA 3PJXA 5FEXA 2XM1A 1J9YA 3T1GA 1W9DM 1XIDA 1ZBCA 1ONWA 4JEQA 3UY7A 1SPQA 1YNPA 2J9YA 1DXFA 4WOQA 4RV3A 3AALA 1Y0EA 3CUZA 4H9XA 2QZRA 2J75A 1GTHA 5DLCA 2OU4A 2WWCA 3GSMA 3M0KA 3NO3A 4IICA 1E5JA 1HKVA 1XW8A 4YHGA 2FH6A 1X8FA 2OKOA 2EPOA 3W7MA 3IK4A 1SZNA 3DG3A 1Q4NX 5F1VA 4IXHA 2HVOA 3U2ZA 5HWNA 1B31A 1LLZA 3TUUA 3V18A 1HKIA 3P82A 4MDPA 5J8LA 3KDOA 1FDYA 4R53A 1Q2SA 2E7FA 4LAOA 2GSJA 5IHRA 3W83A 4H19A 1QFEA 3KEHA 4DEFA 4CD6A 2EAWA 4IZGA 1W1YA 4D1JA 3GFXA 1TRDA 3WQ6A 4CLMA 4AMAA 4MHBA 1IXQA 4DNHA 4YVPA 1HQTA 1KCLA 3ITXA 4X9SA 4W8LA 4ICCX 4JN7A 2CITA 3I7SA 4MNJA 4DX3A 1PDYA 4HYVA 3RU8X 1CXHA 1AK5A 3IV8A 4JQ2A 3QOKA 3BV7A 1QBAA 2D69A 3OZMA 3THUA 5FA5A 1SVDA 4Y8EA 2PGFA 2TODA 2X0YA 3IJ6A 4TV6A 3DN5A 4DUWA 3M7WA 3SCRA 2HRWA 1JZ6A 4JPGA 4WSHA 1K8CA 3HZ3A 2YBUA 4KRTA 3NTYA 5GNXA 3GDLA 3ME3A 4B91A 2QUVA 3QVQA 1EO5A 4AIBA 4JD4A 3N11A 1E5NA 1MEWA 3ITLA 5FJUA 4UOQA 1OFPA 6A3HA 4PTVA 2XH4A 6CGTA 1U30A 2OFJA 4L4MA 1B3ZA 1QWKA 2TPSA 4NJKA 3BAIA 2ATMA 5D8ZA 5M3WA 2Z24A 1MZHA 3A24A 1EA0A 5HMDA 4I9AA 5A2CA 2V5DA 1HIZA 4N4PA 1JF5A 2H9AB 2EPMX 2ZRZA 3GLCA 3HV8A 2WQDA 4HCHA 5A6SA 2FZMA 3KL5A 4JY8A 3EMZA 1XLCA 3C3NA 3L4ZA 2DZAA 3EXSA 1XYLA 4DJFA 4NI3A 4WKHA 2D22A 1MI3A 2JGYA 5ECVA 4Z2LA 4Z1CA 2NLIA 1H1YA 3GXDA 3ZYZA 3WQVA 1KGWA 4JNMA 3VYLA 5C7HA 1LG1A 3W1LA 2ISWA 3ZT6A 4WGHA 4S3GA 4EANA 5HMEA 1XR2A 1H7RA 2F61A 1WE5A 1XJBA 4CD8A 2VEPA 4P8UA 2UY2A 3OVPA 1CXEA 1TCMA 3TAOA 5HQMA 5LNSA 2QCDB 3UWYA 1ENUA 4Y9AA 1JCNA 4C6LA 1W9UA 2YX0A 7REQA 4AEEA 3MVTA 3QY6A 3GG1A 3PSWA 2H90A 4NVTA 5CC3A 1JAKA 1OK4A 1KQYA 2CLPA 3WZ0E 3S1VA 4A05A 3W0KA 1KM4A 3QV9A 4UNLA 4WD0A 1HFBA 3TN4A 1AZ2A 5A8PA 4UCGA 2WBGA 1D9EA 1SMAA 3LN3A 2BFGA 4C6KA 2XU2A 3W7PA 4HA4A 1IR1A 3E0IA 5C71A 4KH2A 3EOEA 2X1UA 1KQZA 2W3ZA 2NWRA 4C90A 3NQ2A 2X1TA 3OVQA 3BO9A 4I7UA 1V6TA 2VGGA 1UUOA 2JKEA 3VIPA 3T55A 1HGYA 4N02A 2FGZA 3VC6A 4GVIA 3MQTA 4F9DA 1EP1A 1YBQA 3MA8A 3RIKA 2ZUWA 3E6EA 4HOZA 4LV9A 3DYOA 4PB3A 3CL6A 2VRKA 1NOUA 2DIEA 4ADSA 1AH3A 3R12A 3PP7A 4AWUA 3WQ4A 1JUBA 1Y5XA 4HCLA 2JKAA 1AA1B 3W87A 4X3ZA 4HZ6A 2TSYA 1VCVA 1ISYA 4RE3A 4EVZA 1FHDA 1THFD 3S47A 4LCSA 2ZZ1A 4K1WA 4S3BA 1Y5WA 1O5KA 2XIMA 3PZQA 4JIRA 1PL9A 2NX1A 1SQ7A 3ZXWA 1QMLA 4KGLA 2LLEA 3LNPA 2HZGA 3N1AA 5HMSA 5HOSA 4OVXA 3RYSA 3UP8A 3G2GA 3VCNA 3V5CA 2ZVIA 4IUOA 1L2UA 1QPRA 4W88A 3C0SA 3W22A 1GVRA 1V93A 2VJXA 4A8RA 4GIYA 4OBSA 4PE8A 1TQXA 1G01A 3OA3A 3VM5A 4FOUA 3KBWA 1ECQA 3NL6A 5C9XA 5LSMA 1C93A 4FNPA 2WKJA 5I03A 4QR6A 1V51A 4Y90A 3UT0A 3WLTA 1Z41A 3M07A 2D0GA 5IBXA 3GC5A 3KP0A 1WDQA 2HTMA 1JPKA 3CZLA 4BR1A 4FR6A 1AMKA 5EGRA 3CNYA 2I5GA 3E0FA 4NJJA 3GXIA 4D71A 4OV4A 1IEVA 3LENA 3S46A 3N9RA 5MKGB 2HQAA 2D1ZA 1T40A 3K8KA 5BXPA 2CZDA 3QFEA 3FDKA 2XN2A 3ZIZA 3K8MA 2Y5EA 4GD0A 1MEHA 2OB3A 4GISA 3V3WA 2C19A 4K6AA 4I9TA 2VDGA 4X2RA 3GE7A 1FWJC 4QSHA 3V75A 3O63A 3U3HA 3AWNA 3OZOA 1UR9A 2ICSA 4LAKA 1LG2A 2BODX 3L7RA 3TJLA 5I07A 2IW0A 4V15A 1EC7A 3KBSA 3EZ4A 1EJWC 2XIJA 4Q8MA 4WIWA 1UPMB 1TWSA 3CMFA 5REQA 3CUGA 3KP1A 4ONVA 4GRSA 1T41A 2YL9A 4C65A 4PMDA 3SGZA 3G0UA 4PMRA 2VFDA 4WDTA 1UWIA 3TIMA 2ZUVA 4MY8A 1FWDC 4ATLA 4F9JA 1GVFA 3WH6A 3M47A 2UY3A 2CBUA 2RJHA 3PTQA 2CLEA 4GNVA 3MSRA 1PV8A 4FA3A 3M0YA 5DMLA 5D2YA 4HNTA 3RF9A 3W6MA 2R1PA 3VC5A 1X7IA 1MW1A 1R3TA 3HFTA 4ICNA 3C0LA 3UXDA 1E56A 2O55A 2WYSA 1FXQA 3D6NA 1RBOB 4NKCA 2DP3A 3VKJA 3HGJA 3H4WA 1P7TB 2HE8A 2QCMA 4B5XA 1C8VA 6ALDA 1AQFA 4WVXA 3VNJA 3H22A 1IIHA 1Y5VA 3LPPA 1OF6A 5IRPA 1OFAA 5LIXX 3AFBA 2WSRA 1VLIA 3DXIA 3HPSA 3OA5A 3BZGA 2X05A 5FJRA 1VFSA 1TTIA 2JIEA 1Z44A 2Y1HA 3EB2A 1UR3M 4PEEA 3TC6A 1B3OA 2BVTA 2ZADA 2QULA 3JZUA 2D0FA 4FOKA 2YL5A 1JYWA 5TF0A 9CGTA 5EYWA 4INFA 2OGYA 2CESA 2PF0A 2FZBA 3TX9A 1SZEA 3BLLA 4J9JA 3N14A 5D8WA 3DKJA 3C2YA 4M81A 4IFRA 3TC3A 3NOEA 4QXIA 1DJIA 5HQLA 2X42A 3KCLA 1MQPA 2GGEA 4PEKA 4E8GA 4MWAE 4CQAA 3B8IA 3MUAA 2J4GA 3WDIA 2RH9A 5A8MA 2UZ9A 4E4FA 4UTWC 2AQOA 1HJQA 1I0BA 4LBSA 4DPQA 1R3VA 3P74A 2GDVA 3TTOA 4Q8UA 3TQKA 2ZXAA 1YLVA 5T9CE 1CGTA 1H11A 1JZ2A 2QCHA 5ABFA 2YA1A 5C0QA 1E70M 4RNJA 4J1OA 4JDYA 2VFHA 1W37A 3UZXA 1F8IA 5C5YA 3VIKA 5A6BD 3KWSA 3SJNA 5D2WA 1F07A 2GWNA 4TUFA 4TTUA 4W4QA 1UG6A 3AXMA 3I7RA 3QXBA 1RVGA 4K7VA 3GH4A 2I9EA 1AL7A 2GJLA 4KWVA 3AU6A 3W1XA 2RGMA 2G8ZA 4ICMA 3VIGA 1H5YA 3N2BA 3I10A 1ZP4A 1EQCA 2YXXA 3W1RA 4Y9NA 2B31A 3EPNA 3N12A 4OE7A 1DVJA 1ZP3A 2VDHA 4QE5A 4YVXA 2PC8A 1QI5A 4MNLA 3EOUA 4RR4A 2DVXA 1RD6A 2FB3A 3GM8A 1US2A 4HHMA 4DF2A 3C4UA 1KM3A 5U7SA 3L9CA 2Q71A 2QW5A 2G3IA 7TAAA 3WENA 2X09A 1H62A 1R2RA 3I65A 4CD5A 2VGBA 2NUYA 3VINA 4AEOA 1MNZA 3T42A 3NURA 3PBWA 3L4XA 1RPXA 2NLYA 3K46A 4H9VA 1HKMA 4GK8A 1H1NA 3UWWA 4EPBC 3OQ8A 1G4EA 4AU0A 3NPVA 1Q3NA 2OO0A 4XZLX 3AYRA 3I4EA 2AKMA 1H50A 1W3LA 1ZFJA 2DH3A 1EHNA 2CCRA 4MY9A 5C9RA 5M17A 2B7NA 4UNIA 4CNTA 1A49A 3NGFA 4LVAA 3EB3A 2WC4A 1CGWA 3B05A 4LY8A 1N82A 1KTBA 3BAYA 1NFPA 2ZUNA 1SO4A 1H0IA 2WLZA 3B0YA 4GY0A 3BWWA 4LWWA 3ITVA 3PPCA 3VNZA 1V8EA 4PMZA 4WDXA 1EUNA 2PDGA 4O1FA 4H9MA 3E96A 4ML4A 1AL8A 3R1ZA 1BQGA 1V0NA 1V3KA 1XWYA 1I6NA 3UXIA 4LAUA 4DBUA 5FCZA 3TN5A 1C92A 4NZJA 4UTTA 3TQ0A 1HX0A 1FBAA 3HJZA 1GHRA 1XBXA 1RY8A 3B0UX 2DUZA 1V3LA 2ZBTA 1FFRA 5D33A 1EUAA 4GH1A 1CECA 2Z1WA 3IV3A 2P50A 4EWJA 4JFSA 2FZ9A 2GK1A 3SB0A 3EX4A 4ROQA 1TQJA 1I1WA 3GBEA 1GVYA 3B03A 3T4WA 1PBGA 2I17A 3PUDA 4M7TA 4GC4A 1GQKA 2FMNA 4C7DA 1OQFA 4ACYA 1ZBKA 2O9RA 1MW3A 2FB2A 1SW0A 3W7CA 4UTTC 5H1WA 4C6MA 1UWUA 2UWFA 3B9EA 3NAVA 1VEPA 1AQHA 1W3JA 1ZS2A 3E0WA 1DWHM 2ACRA 5FEPA 3BGAA 4GBUA 2ZDSA 4ALDA 4GZJA 1VKFA 2A3AA 4EAYA 4UR8A 1T7LA 4WSJA 3HQ1A 3KS6A 3GHSA 3A5FA 3CAWA 4NIRA 2ATSA 4EF8A 1X1ZA 4P7QA 1LDCA 5G5IA 1ZBVA 3T40A 2Z25A 3LB0A 1XLGA 4MM1A 1L6WA 2Z1SA 2A7PA 1OINA 1WQ5A 4YWSA 3ZMRA 3FYOA 3UXKA 1EJXC 1XI3A 1S46A 2VGIA 1DE6A 2ZE0A 1B57A 1XLAA 2AGKA 3K1DA 3DBPA 3C3UA 3TP4A 1C7SA 1JCJA 3STCA 5I3KA 2ADAA 3VCRA 2BB0A 4JZ5A 3W72A 2DZPA 1KBBA 5H6HA 4D6GA 1FCUA 4S3AA 2G3FA 1UQYA 5CPNA 2ZFAA 1LOQA 5DXXA 5AC4A 2VC7A 4ZTXA 1I60A 3H4GA 4K3ZA 2E6YA 2BXZA 2DT3A 5PTDA 4RZBA 2NXGA 4AHPA 4J3UA 2TYSA 5I24A 1E6QM 4N4QA 3G1VA 2C1GA 3KOXA 1XFBA 2V81A 3WLSA 2HCVA 3FHAA 3GHRA 3CU2A 1VGAA 2GLKA 1R9YA 5EB8A 4BFAA 2PRHA 4HU0A 3UG5A 3BG9A 1ZLPA 3LHZA 1VLWA 4UB9A 4FXSA 5CJMA 4ZOAA 3W1TA 1W1VA 1POJA 1J2WA 3O3RA 2HXUA 3BDKA 1E6ZA 4IMDA 5RUBA 2WQPA 4R5EA 1D8CA 1XQKA 4OQVA 5CZKA 4JIHA 1QPOA 2GK1B 1OB0A 3MC5A 4QDMA 4ROPA 4Q4PA 2O7SA 2ZIDA 2Z28A 1ZNNA 4H83A 3GIPA 4DUXA 1I2PA 3UVAA 1PVNA 4KWUA 1KW1A 3LA4A 1TJ2A 2VOTA 2NT1A 3SUUA 7XIMA 1XKYA 5TBOA 3POCA 5XIAA 3NO1A 4GABA 4W5UA 3LSCA 1S5VA 1CYGA 1TTPA 1YW1A 2G3JA 1ISZA 2EJAA 3DFQA 4LVGA 1JUEA 4HNLA 1SM9A 3DZ1A 4DJDA 3VFCA 1KFKA 1OCJA 1REQB 4QNWA 3KOWA 4DYKA 3MUCA 3LTSA 3MTWA 1Q45A 4FXJA 1BFNA 1EOKA 2V67A 5I3FA 3H2CA 4Q7BA 2DZBA 3W4RA 4UTWA 3A4JA 2GUYA 4M7SA 4IQDA 3QQ1A 1RXOB 2RGLA 3PZIA 4LPCA 1HGWA 2V3FA 1Q6GA 1OX5A 3BAJA 4PUDA 5DBTA 1XUZA 4UTMA 1J0YA 1GOKA 1VPXA 2IPGA 1EP2A 3AS1A 3SCWA 4BQ5A 3LTYA 2ZZ6A 2XM2A 4Q8PA 4KEUA 1T99A 3TWAA 1Y8BA 1I2QA 4K8GA 4DZIA 2PWUA 3O6CA 2PDKA 2F7FA 4UOJA 3TXZA 2PURA 3W7GA 1KKRA 4XAZA 2EXOA 1S2VA 1RUSA 3C8FA 1W1ZA 4MF4A 4MB5A 2J47A 4F40A 3ZOAA 3QR0A 1ICQA 3KXQA 5M2FX 4RZ6A 1E73M 5HJLA 1YEYA 4F0RA 4ORIA 5E9AA 4WQ6A 3CH9A 3R94A 4PA8A 3PANA 1GW1A 3B06A 3T78A 2ACQA 3JR2A 1YXYA 2CBIA 3NSMA 5D9PA 2DVTA 3BZJA 4KERA 4U5KA 4QITA 4O1BA 5DY2A 2NSXA 5HNUA 1EDGA 3S3GA 1ZZMA 3UYIA 1K4HA 1YQ2A 5CGMA 3ICJA 1OWQA 1NF0A 3PBMA 1NM9A 4FO4A 3LRLA 4GVGA 3OYXA 3TTQA 4HK7A 1GKRA 5EA9A 6TAAA 4WHBA 1HKWA 3A9BA 2PE4A 1MO0A 2C79A 3OHMB 3QV7A 3W25A 1E0TA 2OZ3A 3PG9A 3W7KA 1P0NA 3NM1A 4B5TA 3EPMA 3CQKA 4XKMA 2VWTA 2CLOA 4LEQA 4JBRA 4WEVX 3PG8A 5FEWA 2XWDA 4GKLA 3PBYA 1JNEA 4D6EA 2C15A 3L68A 1P0EA 3GB6A 4TV5A 4AD3A 4HZ7A 3FJ6A 1UUMA 4GHRA 3R8RA 1P0KA 1V08A 1C8XA 3HPFA 4FXFA 1NWTA 4XVEA 4O50A 3EKLA 3ZT5A 4DB7A 4HHLA 1KRBC 4JGDA 3KDNA 1KM2A 2A3EA 1U2YA 3ABRA 3SCPA 3V16A 1SR0A 3WX7A 4FNQA 2P8CA 5HAOA 2EG7A 3DBNA 2OLAA 3CUXA 4H7CA 4Z1DA 2NQ9A 5CLTA 3QEZA 1CCWB 4W8BA 3AMDA 4PH6A 3DFOA 3F5LA 4NZ3A 3OZPA 2IKGA 1BKSA 1UROA 3W85A 1U5HA 3AICA 5HANA 3TA6A 1F2JA 4ERGA 3QLLA 1CLXA 3W29A 5DCEA 2QDDA 3DYPA 6REQA 4Z2JA 4FAMA 2WBKA 3S1GA 4QM1A 1E9YB 4P7OA 4M0XA 1V6UA 3SFWA 4X2PA 1RP8A 3G1DA 3WLRA 3W28A 1SFLA 1L8NA 2F38A 5D02A 3A13A 1TMQA 1ZL1A 1RD5A 3RLGA 1OX6A 4DLMA 4AVFA 3MJMA 3L5MA 1VBJA 3H55A 4JXCA 2PBOA 2Q8LA 2OQHA 1JCLA 3SCSA 2V2DA 3SCNA 1BVNP 1VFFA 1K6AA 2E5BA 4JEJA 3GU9A 1TREA 1QO5A 3WH7A 4PUUA 3CQJA 2YLAA 1JQXA 4HB7A 4L1XA 3UXLA 1KTCA 2BOEX 1FWCC 3TN6A 4F4RA 3EOSA 3BW2A 2VZTA 4K39A 2GJXB 3BJSA 1XCXA 3NZQA 5I09A 1A3WA 4MKSA 2AL2B 3THAA 2FZ8A 2V30A 5DMYA 3A22A 4B4FA 1HJUA 1RP9A 2V5JA 2D2OA 2REQB 2DY3A 2V6AA 4GI4A 1VH7A 4BQ3A 1B0IA 1A3HA 2GQAA 3WDRA 5ABGA 1ME9A 1O68A 1K9EA 1XLEA 1VHNA 2TMDA 4UTLA 3PUEA 1XGDA 3LHTA 3R2GA 3C2VA 3E12A 2WMIB 3ZSSA 3BC9A 3AI0A 1AODA 1Z7AA 3S5YA 3FVMA 4ADTA 1GEHA 3UZJA 3GRIA 1XIHA 2PP1A 3BSMA 4DBSA 4PYSA 4UQ9A 1DWIM 4AZ5A 3LRKA 5I7GA 1JI1A 3AYVA 1VRDA 2FVLA 4ZTYA 5JQ9A 4AFYA 5I77A 5AFDA 3M0ZA 1W1IE 4AH7A 1UP2A 4UQEA 4MJ2A 1X8CA 2ZCGA 2RHGA 2WMJA 3QSTA 1XYCA 3H8AA 1CEOA 1MQQA 2Z27A 3TK7A 3TR2A 1LOSA 4RCXA 2WMKA 2BX7A 2J7CA 3SY8A 4ATDA 1DWJM 5HJYA 4H9YA 4HQVA 2D0HA 4MFDA 4IFKA 4JTSA 2CLHA 2PFHA 3WH8A 4LBUA 3XISA 3EWBX 3B8WA 5D09A 4LX4A 4CQ9A 5DQPA 1VF8A 4AC7C 3RJXA 3WNMA 1E15A 2VEFA 4NNAA 4AVOA 3KLKA 3G8RA 3MU7A 4J3XA 2A79A 4GE8A 3MJYA 3OG2A 3NQ6A 3H54A 2ZUMA 1WKYA 4JQAA 4HOWA 3CYJA 1YPXA 2G37A 3SCUA 4KWSA 1LBFA 2FTWA 3TLQA 3N6JA 3QQ0A 3C0QA 2J66A 4LW7A 3GAYA 3CV2A 1R3YA 2WHKA 2AMGA 3UJEA 2ESCA 3LNMA 3LBOA 4Q22A 4Y6GA 3UJFA 3GZAA 3ZM8A 3GX9A 3CTLA 1W5MA 2YYTA 4I5XA 4JTEA 1Q13A 1DTNA 2Z7KA 3NZGA 5DT7A 5E6YA 3B4UA 3FOKA 1F7BA 4YTRA 1DE5A 2PWFA 1E6RA 2VR5A 5AYXA 1VCGA 1NWUA 2XSXA 2ZA3A 5BXTA 1VHCA 2J62A 3PFMA 3LBCA 1JFXA 3R0DA 3N4EA 3REQB 3WG6A 1E0XA 4D2JA 1JYVA 3WQDA 3R0UA 3SCTA 1XLKA 1TVLA 3AJ7A 4MB4A 4FX8A 1XLMA 4DQWA 3WLHA 3ARVA 1LLWA 3OGRA 4LU0A 3LZ5A 4JTAA 3TONA 2C13A 3GH7A 3A21A 2EKCA 2HEJA 2GVGA 3ZO9A 1P0DA 3GIQA 4GUGA 4JFUA 3ZR5A 4JCLA 4W84A 2OGJA 3TNBA 2AKZA 1U5VA 4XZNX 1SO6A 2GUBA 3UQNA 4S23A 4WXZA 3W2NA 1BYDA 1SO3A 4JTQA 2VNCA 3R0KA 3O0FA 1NP2A 9RUBA 1VIWA 1L6YA 2XIOA 3QN3A 3SRHA 1QK0A 3G1FA 4LRSA 4QE1A 1Z42A 2E9MA 5AZ0A 4KCUA 1TTJA 3URAA 4IJRA 1DL3A 2XWEA 3IJQA 4IP7A 5A8OA 2CLIA 4BF9A 4RJEA 3VGDA 3AYSA 3Q45A 4I8YA 3CO8A 3P6LA 2ZX5A 4RX0A 3NZRA 2G50A 2VURA 4JR5A 4E3VA 3S6TA 1RQBA 3DC8A 1QTWA 1YBQB 2Y5SA 4S3KA 2OYMA 5CBBA 4ILSA 2YIHA 3WJZA 2AQVA 3WD1A 4DIAA 1HP5A 3LPOA 4XBJA 1WDRA 1QVBA 4LF2A 4R7JA 2C3ZA 3PZ9A 3TYDA 4S3CA 2NQZA 3GNRA 4KCTA 5E93A 1TE1A 5CH9A 2E9LA 4ECLA 3WJWA 3OB8A 3GUGA 4MIMA 1J6OA 3GYCA 4E3TA 3UGRA 2CW6A 3I3BA 1D7FA 1G67A 3AIUA 3L2MA 4XAPA 5JIPA 3H2NA 2J7HA 4PZVA 3IRSA 1BRLB 1W8SA 5LIWX 2R82A 3S5ZA 3NQMA 3WDPP 4AUBA 4NNBA 1QJWA 4Y9OA 1KM6A 3LGEA 1HL9A 4JKLA 5CBJA 2R94A 4C6CA 4Q4QA 4N7QA 3GTHA 2YZ5A 2P53A 4HGXA 4ATWA 4IPNB 3VKCA 2PCEA 4RDZA 3L67A 3VIFA 3LRMA 4MKVA 4GZIA 1OT2A 3FW6A 3PN8A 4ASTA 1W1B1 1JZ7A 3S1WA 4AD1A 4YNGA 3G24A 4Q8WA 3DH7A 4BHYA 1UH4A 4H8NA 3SCOA 1F6YA 3P3BA 1AW5A 2D2JA 5CPTA 3DCPA 3KL3A 3W6YA 4B5NA 5F2MA 4HSNA 4M1BA 4ZOEA 5BROA 3P84A 5CC6A 5AZ1A 5FJOA 4YTUA 1KFCA 4IGNA 1CZ1A 2Y70A 4IFKB 4CNSA 4Q8NA 1H7OA 5DX7A 1GNXA 3B04A 3ELFA 1AJ0A 2PDQA 3CS2A 1XBVA 2QNEA 4CVWA 1H7PA 1X96A 2A6LA 5EMJA 1DIOA 4F0MA 2ODOA 1AG1O 1GGOA 1TTQA 3DOPA 3CZJA 1X6LA 3T44A 2J27A 4UWMA 1I9CB 2XSBA 3NO5A 4OU1A 4LH8A 1M7XA 3W24A 5I3HA 4IQEA 4O1CA 3Q94A 3ANUA 4H01A 3BW3A 5DN1A 1F4AA 3U5UA 1TJ0A 2VI0A 3BQ5A 3IEBA 2BHYA 2P76A 5FACA 3AHTA 3RMEA 5EY5A 4FI4A 1P6BA 5AC6A 3A4AA 1E3ZA 4G7EB 4IT1A 2VXNA 5DANA 2Z26A 1PKLA 3BICA 3CQHA 4XK2A 3UG4A 5EL1A 4FX7A 1YNYA 4W87A 2NV1A 3HGRA 3PM6A 1VEOA 3UWZA 4W8AA 1WX0A 1D8WA 3W73A 3WBAA 4S2BA 3UJSA 1QNQA 3GG7A 5EMKA 4QROA 3QY7A 4GNKB 3W07A 2R8WA 1Q4WA 1ZCCA 1KC7A 3QFWA 5HPCA 1FDJA 1NWRA 2PLCA 1A80A 4O52A 3WBXA 4NY2A 1N55A 2YR1A 4FF5A 3YPIA 5I3GA 4QQ3A 3A47A 4US6A 2FHFA 2XZ7A 2PF8A 5GJMA 1T8XA 1BG4A 2NUXA 1CB7B 3FIGA 2PGWA 5GQBA 3ARYA 1E4MM 3TOYA 5TQLA 4LYPA 1BYBA 2X16A 5CSRA 1O94A 4R7WA 3A5VA 1WCGA 4OZOA 1NH6A 1KRCC 1UD8A 3WLNA 3LS9A 3N18A 1QI4A 1H41A 3U7VA 4IIFA 1VPYA 3VK5A 2DZUA 4FR1A 4B16A 4MOZA 1XFCA 1XIJA 5KMYA 3VIMA 4C6QA 4XQ6A 3HPZA 2X0HA 3DI1A 3OGVA 3FVDA 3P5YA 7ODCA 2YA2A 1XYBA 3IUIA 4A8LA 3QGVA 3OLGA 4H6QA 3G1SA 4ZQRA 4B92A 3UPMA 4MSSA 4N2YA 3WQOA 5HWJA 4MZ8A 3VNMA 3WDQA 4L5ZA 2GVLA 3HMJG 3CJPA 1QPQA 5BOEA 4A3UA 3VU2A 3OJGA 4C6DA 4Q6JA 3LLFA 4IMCA 2Z0IA 3W23A 3S2LA 1UKPA 2VKZG 2Q09A 3CIWA 2E6DA 1IE7C 4LALA 2VEMA 3VTRA 2OX1A 1PHQA 5E0FA 1H63A 3N2CA 3M7SA 1VFUA 2OXNA 1TJRA 3CT2A 2VCAA 3RCNA 2WSQA 4DJEA 1TMHA 8XIMA 3ARQA 1EWEA 1IZKA 4QAWA 2QPSA 2ONEA 4CGTA 1H7XA 3KLLA 3P8JA 3RCMA 3VD4A 3L4YA 3V35A 1C8YA 3G18A 2R1KA 4R27A 4UTKA 1HF6A 3V0TA 1DQXA 1UHVA 1V02A 4PR4A 1WOBA 4JL2A 1CW2A 1KXTA 3NIYA 1MRQA 2GVEA 4GJIA 9XIMA 2QUUA 1BKHA 1DQWA 2FFCA 3W76A 2QQ6A 3TTYA 3L65A 3WJSA 3VUSA 2QV4A 2H8ZA 1JRBA 1DXEA 3AQUA 6ENLA 4DJFC 3QTPA 4IG2B 4J3VA 3UBPC 3G8EA 1FA2A 2PGRA 3VD9A 4UMCA 2BVWA 2ACSA 3M5VA 4LEFA 3UG8A 4EPEC 1XBZA 3KE0A 1LT8A 3H21A 3B9AA 3JW7A 1JPMA 2PWEA 3FY1A 1S3HA 4MUZA 4AZGA 3NZPA 3QTGA 1IR2A 3NWRA 1T0OA 4L9XA 2RAGA 3SRFA 1OYAA 4IPPA 2BV9A 4HN4A 4C91A 1PX8A 2AGTA 4OKDA 5LXXA 2E68A 1Q6OA 3F2CA 3LXBA 1A5KC 3VKDA 2A1YA 1E9ZB 3FKRA 3N2XA 3WCZA 2BG5A 3THQA 4LYKA 1F8MA 1WOAA 2Z6JA 2HNEA 2GJPA 2P0IA 3TC7A 1A4MA 3T4CA 2OEMA 3HF3A 5REQB 3EEZA 3U57A 4IOTA 5FI8A 1C91A 1XP3A 4DF1A 1TVNA 1AW2A 4V2XA 3O6AA 5G1MA 3VE7A 3PC0A 3NXLA 4OTKA 4I3GA 4RXGA 3VKAA 4P2VA 4GQQA 2PC4A 4KIRA 2W62A 4EIVA 1YDYA 2I14A 3KBNA 3KRBA 4GKTA 4HU4A 3GFZA 1E43A 3WBEA 1L6FA 3WIJA 5D38A 2WM0A 3G77A 3W86A 1BWKA 1EJVC 1RLCL 3FEMA 3L23A 4JS3A 5JUVA 2WVVA 3LGDA 1OFEA 5DMNA 3N4AA 3QGKC 4ZQPA 4IMEA 4BF7A 1WKFA 1YE4A 3M6YA 4LUTA 4ZO9A 3IGHX 3T2QA 1P48A 4DO5A 4QAIA 3KOFA 1PWMA 2WWDA 1UA7A 3G3DA 1V7AA 1TPEA 4QJ5B 2JIWA 3W1AA 4KRUA 3KCOA 3IK2A 3WH9A 4ZE5A 2OMAA 1K9TA 5HINA 4MDOA 3CK5A 3GQYA 3GTFA 1NDZA 3M1ZA 1E6XM 4H2CA 4YXGA 2POZA 4GGBA 3C6CA 3OGSA 5LIUX 5LNRA 1K3UA 3L66A 1PZ1A 1R47A 3EXRA 5G1TA 4XZMX 2VYOA 3ZJKA 3PUGA 1UKTA 2QEZA 1PTAA 1SZGA 1LWHA 4Z1YA 4O28A 1WUEA 2ZRXA 3LYEA 2CXEA 2QDEA 2IPJA 3SCVA 1WB0A 2Z1XA 5A95A 5F4XA 4XKYA 5AYIA 4DI8A 4H41A 3TWBA 4DRSA 4HMDA 1WAUA 3GXTA 5FF3A 4FLSA 3T8LA 3G6MA 2C0HA 2X1SA 4HIBA 3ZQ9A 4NNCA 1IGWA 1ONXA 3TSBA 3UZWA 3T0TA 3CB3A 2QIIA 5AECA 3QY8A 1UR1A 2C7FA 3A3WA 4EACA 3EOOA 4GNJA 4M6UA 1W5PA 1MUCA 1JG9A 3VDGA 2QMJA 4F79A 4Q8QA 2YCJA 5IBXC 4I5RA 4HNVA 1LYXA 4HA3A 4CU6A 1X38A 2H9AA 3FYYA 2IKIA 3BW4A 2HISA 4MB3A 4Q4SA 3R5EA 4C6IA 1QT1A 1HNYA 1E4NA 4NX0A 1UWRA 1DIDA 1UMYA 1TPUA 3BXWA 8XIAA 3H2MA 3UR8A 2F6UA 3GHTA 1UD3A 1SFSA 4AF0A 3CIXA 4D6HA 3S42A 5CSSA 2PMQA 2FHCA 2VFIA 4EXBA 2WHJA 3C61A 2WCSA 3GVWA 4U28A 2YW4A 5C54A 1BF2A 4E38A 2J8FA 4G6CA 1ZJBA 4C6OA 1OADA 1GVEA 2PU1A 1US3A 4D6DA 1ITUA 4JOMA 5K3VA 2OZ8A 3K13A 1KRMA 4TX6A 4XAYA 4LFYA 1GKPA 1R85A 4H00A 1XRTA 3H53A 3VFLA 4M8UA 4PB4A 3R8GA 1T8QA 3WL0A 1YXCA 3SR7A 4KT2A 4O10A 1KLYA 2NQLA 3NDZA 1UZ1A 3N2MA 1PCWA 4PULA 4Q6XA 2VRJA 5MKGA 3DYMA 1TUXA 4IJBA 2BY3A 3BLOA 1J8VA 4DJDC 2F6XA 4ZCWA 3CWNA 2YB4A 1IF2A 4U4MA 1W5NA 3MUIA 2E40A 1GYLA 3MCNA 4A2SA 5C2GA 3UY8A 1AMYA 5ABEA 2WXDM 3AZRA 1QW7A 4HYWA 2F6KA 2Z00A 4H2HA 4E0CA 2VTFA 2R14A 3SGUA 2R6OA 5DEZA 4LVDA 2AAAA 4DELA 4CEUC 3GXPA 3ITTA 3PNZA 3QZAA 2GQ8A 5LIYX 3WQ8A 1RALA 2VOMA 3WJYA 3F4VA 3HV9A 1RAKA 3ARUA 5DRCA 2PDLA 4XB3A 3G0XA 2DORA 3KTXA 1J96A 2QF7A 1TWIA 2OT1A 1ISXA 3SN1A 2RDTA 4Z2IA 1V3HA 1B90A 2VENA 2PTYA 3TJ4A 4E2DA 2FTYA 2GFTA 1LOLA 1TPC1 1OFBA 2QJNA 1U5JA 4HT3A 4REQA 3QLDA 1HTIA 1UIOA 1X6NA 2QGHA 2BVYA 1XYAA 4H9ZA 1NY1A 2A7RA 1RBAA 3M5ZA 3AIVA 3DHDA 3EAUA 3MPGA 3QH2A 1KFJA 5JVLA 3TROA 3ISIX 1AD1A 3VOCA 3WEOA 4ZE4A 5CSUA 2FDSA 3BOLA 3EX2A 3CO4A 2ZUSA 4PSPA 4OUEA 1UWTA 2J9ZA 4JTLA 4C6BA 4AD0A 5A1AA 3FDGA 6TIMA 1CGXA 4JX5A 1R87A 2J7FA 4F2UA 3V0SA 3A12A 4YTQA 1K03A 4D8AA 1PE1A 3ZVIA 3UCDA 5AHNA 3OVRA 1LTDA 5IDIA 5HBFA 2Q3OA 3Q67A 2B7OA 3G1AA 3H2OA 4I9JA 1GPFA 1G7UA 4HCDA 3NZ1A 3SY5A 1UD4A 1K8YA 5AHEA 3LDVA 2PS2A 3T7VA 1JR1A 4YLWA 1CI1A 1LWJA 2PZNA 4TXEA 2W9MA 4URIA 4UQAA 1B54A 4AHOA 5KSWA 3WKZA 3M0HA 1FDZA 5KZ6A 4O53A 1KXHA 3PPGA 1XG4A 1JDEA 2OR2A 4M51A 1U22A 1C8QA 2MUCA 4U2YA 4NZ5A 2PGEA 2ZX6A 4DY1A 5BNKA 2BXVA 1HVQA 3WQWA 1X1NA 4AZHA 1UZ4A 3RXZA 1KGXA 4HTBA 4CNPA 4HHPA 1AVAA 2Y5JA 3PTKA 5FKYA 2P3ZA 2PI6A 1DQUA 1EGZA 4JIEA 1GW9A 3GIYA 4L6DA 2OYKA 1W3HA 2PDBA 4EX4A 3WLIA 1ME7A 1BLIA 3WQGA 1EKOA 1N8IA 1XXXA 4TIMA 4P7LA 3AS3A 4GGHA 1WBHA 1GOQA 4RDYA 1KCZA 1JGMA 1CNVA 5HQEA 4AAJA 1F61A 1DTUA 3W75A 2GJRA 1CXIA 1ECEA 2HBXA 2PD5A 1XD1A 3UWQA 1J79A 1OYBA 3W1QA 3N4FA 3HGOA 3GR4A 3N29A 2DZWA 2VM8A 4RW3A 2VUNA 4NF7A 2OSXA 4GXMA 4TX9A 2ZRWA 4IP5A 3TSMA 1X39A 2Y7GA 3TW7A 4QRNA 2IQDA 3NQEA 1I45A 4GUIA 4PUWA 3R25A 1JPDX 3TZNA 1RHCA 3WMBA 4NAFA 4HNNA 3AXKA 2QJJA 4IIGA 4EOUA 3GNOA 1V4YA 3UR7A 3WK0A 3U2OA 2D2GA 4LRTA 1NP0A 4I5UA 1D3CA 1JPIA 1J0KA 1TA3A 5A8NA 3QZEA 4UFLA 2WSYA 3NPUA 4GX8A 4O54A 5A6AA 4E5TA 4I7VA 2PTXA 3FA4A 4FMVA 3CZEA 4DI9A 1E6SM 1FCBA 3VM7A 3GW0A 2GWGA 1XPYA 2PDMA 5CZTA 2XUCA 3VUPA 4J4KA 4ZXLA 3ARSA 3GDKA 1ZUAX 2XH2A 2VFEA 4IIHA 1YNQA 1ITQA 3P14A 3N6QA 3R43A 3WK1A 1UZDA 4RV8A 4HU8A 1HJWA 2PTDA 2PDPA 1VFMA 4GFIA 4PCNA 4TX8A 3MANA 1RVKA 1J10A 4UTHA 3MYOA 1PB0A 4GI8A 4C1KA 4A22A 3K1GA 1ICPA 2I5IA 3MB9A 4NU7A 3MUY1 2EJ1A 1WDSA 3NEHA 3L21A 3RK8A 3RR1A 3ZVHA 3OPSA 2ZWZA 4LCRA 2GGHA 1JQVA 3SY1A 1TPVA 2XSAA 2YL6A 4GPNA 4J35A 4P8VA 4ZENA 5BOFA 1L6GA 2PSNA 2QXWA 2W5FA 3UWVA 1FWHC 1X6UA 1HP4A 3IVUA 3R10A 3RLVA 1D3HA 5I3JA 5E0CA 5AHIA 3L4UA 4KWOA 4N6EA 5HXMA 1Q66A 2HROA 4HZ8A 3V1HA 3ARXA 3S2JA 2E1WA 3QV6A 2O92A 1C9WA 1Q6RA 4PTMA 4BZYA 4E8CA 3GW3A 3NQDA 4B3ZA 4JFTA 4GC3A 3ECQA 3EDFA 2R1MA 3MWAA 3QMTA 3T81A 2DFAA 1JD9A 4F0KA 3CL7A 3AMKA 3TFXA 1E9IA 1DBTA 3I6TA 1B9ZA 1GEQA 3O2LA 4ZB2A 3MMDA 5H8UA 1QWGA 1R9ZA 3DIPA 5U4NA 2WVUA 4QX4A 4DM2A 4FX6M 4HJFA 4LAMA 2EGZA 4WY0A 1ESWA 1SMDA 4NI8A 2Q01A 2QAPA 1KO0A 2EG8A 5CJ5A 1P5BA 3QJAA 1QR7A 1ZB5A 1W0MA 3RMJA 1O5RA 3E0LA 2E6FA 2FLIA 3WBYA 3AS0A 1SR9A 1E51A 2F2HA 2HWGA 1UD6A 1C3FA 3PPHA 3LK6A 3PZUA 4JTFA 3DI0A 2BHZA 1Y65A 4P8XA 3WK2A 5AHLA 1JVNA 1W56A 5JBFA 3DFTA 2E1DA 4RE0A 2FPTA 4KRZA 1PEZA 1MRAA 3VMPA 4PBEA 4NZ1A 2W79A 2FYMA 4YTTA 1J93A 4LSBA 4PMYA 6REQB 4B2DA 3WF0A 1TFVA 2HK0A 3W1MA 1JULA 4ZQCA 2DU2A 3ZR6A 3MSGA 2Z2AA 3GBDA 3CUIA 4JQ4A 3KCJA 1ZPTA 4D6IA 3OEXA 3ABZA 4JTCA 1WPCA 2OKTA 4Z42C 1Z6KA 4HBKA 2I5QA 2ZX7A 5F2IA 4BS0A 4GH3A 5K9CA 1H7NA 1EPXA 4UTFA 1E1FA 2BZNA 2J8TA 1J5TA 5FSEC 1YXDA 3H2FA 3VNLA 2E25A 3HG4A 4FK9A 3RM8A 5GNYA 3S6OA 3KM8A 2QLYA 5D2XA 4QDWA 3DFPA 3UYCA 4IMAA 4HNUA 2UY4A 2WCAA 4B15A 2Z4GA 1F3WA 1VCFA 3HFYA 3QM3A 3SECA 2Y7FA 3UZZA 5I78A 1ZGDA 1DPMA 1MXGA 2YSWA 3GTIA 1DWAM 1UASA 3DKLA 1O1ZA 2YYUA 4AIEA 5CC7A 1S5NA 3BSHA 2CHOA 5A6KA 2FPVA 4IX2A 1ZRQA 5K4XA 1CGYA 4UR9A 2HXTA 3TVAA 1B1YA 2OELA 4B9ZA 4LNYA 3W2MA 5KZMA 5CKSA 3EWXA 1R3SA 1A0CA 4B4HA 5TD4A 7PTDA 4AZCA 4FZIA 4RPPA 4JFVA 4LB4A 1QI0A 3QPEA 2EF9A 3SI9A 4LY4A 3PNUA 3HBLA 4R3UA 1HL8A 3CUJA 2HV5A 3SAZA 3BURA 3LPFA 5C8BB 2NX3A 3ONBA 1R2TA 4C6FA 1MYRA 1IT8A 1LCOA 1EPVA 3NSXA 4FPSA 1LL6A 2ZWYA 3R11A 2GDUA 3R7MA 3WN6A 4KEVA 1RPKA 1MFVA 2P10A 8A3HA 1ITXA 1XC6A 4TR9A 4MYXA 2NVAA 2QCDA 4EAMA 2ISVA 2J24A 3MDUA 3QKZA 1DKWA 3ITOA 1FX6A 3HN3A 4P61A 2PBGA 3TE9A 1UH3A 2O56A 3OIHA 1VYRA 3P7YA 2DW7A 3AOFA 3W7RA 1S1PA 4JN8A 3OQEA 1ADOA 3IRDA 1MW0A 1TV5A 1GOIA 3UJRA 2BHUA 4GQGA 1EJRC 4CCEA 5K4ZA 3N2TA 3EWWA 1EYEA 4O8AA 4XX6A 1WZAA 3PBVA 1W8GA 3GD6A 2OQLA 3P80A 1HG3A 9XIAA 1U1HA 4PUMA 1LQ2A 4XBKA 3WQ5A 5GVJA 1Q8AA 4GIAA 2B81A 2XISA 1TX0A 1LLOA 2AMXA 4QSFA 2OWCA 2W63A 1RH9A 4CN6A 1UQZA 4ZMGA 3O9NA 3AIBA 3MP5A 4IXXA 4QDPA 4ZVJA 1CT5A 1TV7A 4FP1A 1F73A 1AH4A 4JQ1A 1G4PA 4XSLA 1SJCA 2GL5A 3C52A 3BAKA 4CU8A 2OWXA 2V3GA 3P8IA 4HD5A 4TO8A 1YDVA 4RKAA 4GYPA 1PIFA 1ZSXA 3QR3A 1WXYA 4GYJA 1IEWA 1BGGA 2X7WA 4BI7A 3AUOA 3CV7A 2HPIA 3CL8A 4Y96A 5HATA 4QLJA 3GDMA 4KFNA 4FNTA 1R5YA 1TCDA 5C2CA 4KWWA 2FIQA 4ERIA 5XINA 2F8QA 3PJUA 1FHVA 1DV7A 3N2OA 5LA0A 1SJAA 2QVHA 2V3EA 3AMLA 4PGLA 1TPDA 1B30A 2I56A 1FFQA 1NF7A 4LV4A 3Q4DA 4AW7A 3LLDA 2J6VA 4RNHA 4ZFCA 3UCCA 4F2TA 3GNXA 3VNYA 1F05A 2HDJA 2WC3A 1ADSA 2A3LA 1M9HA 4PUNA 2O4QA 2ZVRA 4S3DA 4DVOA 1G0CA 2Z7GA 3DFNA 3MWCA 1V0KA 3EWYA 1CGVA 3N34A 3CEPA 4MYAA 1PTGA 2OJPA 1W9VA 3CH0A 2ASHA 2C1IA 3PB0A 4AXKA 1WBJA 3ZFHA 3HG5A 4JICA 2CYGA 4CVUA 2ISSA 4IP4A 1SSGA 5LA2A 3GH5A 2RKXA 3NUKA 1HUVA 1A5SA 2QKFA 5DMMA 1I8JA 4UCFA 4BEUA 4AY1A 3RG6A 4OJYA 3PY2A 5C2XA 4BWLC 5BXSA 1MFUA 4EPKA 2ISFA 5GJPA 3V1PA 3MVIA 3ABXA 4HHHA 1R0MA 1H2JA 1JF6A 3NFUA 1UW9A 3O0KA 2YBVA 4GUJA 2WLYA 3BANA 2WZTA 3QYSA 1BWVA 3WSUA 2VEKA 3GK0A 1TWDA 3NQVA 5M1TA 1V3JA 2BXYA 2J78A 3VDBA 4R9XA 1WZLA 4P7RA 1SZRA 1F9CA 1KFWA 1XLFA 2VVSA 2G4FA 1W31A 4IH3A 2Q8ZA 5E5CA 1XQLA 4H9UA 1VD6A 2PDIA 2QPXA 4ZQOA 5ECUA 4L80A 5AN7A 1M53A 3PWGA 3NEVA 4ZO7A 3BVJA 3O6YX 1DJNA 2Y62A 2JK2A 1GUVA 5CXPA 2E6AA 1LM1A 2VCCA 1XUUA 5AC5A 3A3XA 1KR0A 2CPUA 2J7EA 3T0CA 1EWDA 3MI2A 1XBYA 1K8ZA 4E2VA 2BNJA 3HMCA 1IEIA 2HVNA 4QEHA 2BS9A 4UNKA 3WELA 1FH9A 1TPFA 4MUPA 1EEPA 4DUOA 1JYXA 1HO1A 3N3TA 3NA8A 5FJTA 4XBSA 3HG2A 3MW7A 4DJDD 1UKQA 4Q4KA 3EX3A 2EG6A 1SFJA 2TRSA 4AHQA 1CXKA 1F6KA 3LU2A 3CLWA 2CHRA 1TG7A 2IKHA 1EC8A 2YGYA 1BF6A 1SO5A 3K4WA 1E0WA 3S5NA 4HP5A 3WQEA 4C60A 2VR2A 4ZB0A 4W7UA 3OBKA 1JXJA 1NQKA 4MLRA 1F74A 1W32A 5BXRA 3PULA 1TIWA 4IQJA 4CQBA 2HVMA 4FLQA 3WFZA 3BTNA 1IYXA 1M6JA 1POKA 2E8ZA 1GVQA 4N9CA 1IXOA 3BMWA 3B0VC 1PO9A 3WH5A 4HPGA 1S2AA 1DJHA 1I75A 5LNUA 3SADA 3LCGA 5C9WA 3QR1A 3AO0A 3LGGA 3S8HA 5F2GA 3MMUA 1JCMP 3EKZA 1VR6A 3OG3A 5TIMA 4DO6A 1A50A 1S38A 4QCFA 4KPLA 4DJEC 5EMLA 4XG1A 3P67A 2EO7A 1UH2A 3W7EA 5KITA 1CGUA 2ZXQA 4MAZA 1OZMA 1Q6EA 1OIMA 2ZKMX 1V6XA 1GYNA 3LSBA 4Q8VA 4OUIA 2QCLA 1XLIA 1QBBA 4LUJA 4E2BA 3MKVA 1PZ0A 2HJPA 4UXDA 5E70A 4YTSA 4NZCA 1F4HA 2G41A 5E6ZA 3RGTA 1W9PA 3FS2A 3L0NA 3ALFA 1GVIA 4IJCA 4PCFA 3DGRA 3LUTA 5KEZA 3AROA 4YIWA 4POCA 1LUCA 2CLMA 2QGYA 1Z9AA 4HYRA 1Z89A 2BY0A 4NG3A 3EB4A 1BVWA 1XLHA 3EBVA 2GGJA 5JIWA 1BSIA 3WMCA 1K02A 3PTDA 1V0LA 2CZEA 2Z29A 2VZUA 4Q3MA 2EKGA 2P5NA 2KX9A 1RY0A 1A5MC 3C2OA 3PWAA 2D3NA 1H7WA 3VIHA 3MUXA 3W7QA 3W2LA 1Z32X 1H3GA 3KVJA 3LHWA 4F8XA 2GOKA 2FH8A 2VX6A 1QNPA 1KFLA 1K8XA 1MZRA 1VQTA 3PTMA 1CBGA 3RNDA 1TX2A 3WFLA 1CDGA 3VA8A 4LJ3A 4U33A 3WF1A 5JBEA 1RV8A 1RA0A 5G4HC 1K9FA 2YLLA 1AD4A 1BQCA 3USZA 4OT7A 4F0HA 2DEPA 2YL8A 4MY1A 5C9ZA 4IIBA 3URNA 3P81A 1OD0A 4O13A 1JD7A 2VEIA 4I7WA 1LWIA 3KVKA 3VNDA 5F1UA 1DJYA 1LZOA 3MP4A 4CNUA 4M29A 2E4TA 4O4WA 3RJYA 3AWOA 4MWAA 5A2AA 3AAMA 3SCQA 2CWNA 3APGA 1EO7A 1SW3A 3W88A 4QP0A 1I2OA 3L4VA 1FY6A 4F3HA 2PEVA 3PJTA 1DJQA 3EA1A 8CGTA 4WY0F 3GHUA 3SO7A 3FGCB 4LYRA 3D0CA 5E9XA 4L4OA 4M6QA 5BYWA 4M82A 3T6CA 4C7FA 2EHHA 2GOUA 3QBUA 4NRRA 1EQPA 2NXHA 4NJIA 3G0SA 4ZXOA 3K8LA 2C18A 2WMGA 1Y7VA 3NM3A 2Y0FA 3TAKA 3FXGA 3A4WA 5CBIA 1FVPA 3U2CA 4M80A 3RX2A 3CM4A 3WLJA 3W84A 3NDYA 4M1RA 1P4CA 2W4XA 4PRTA 4C7GA 2QHAA 5J5DA 4CQCA 1OJXA 4J3TA 4LUYA 4MZYA 3MYPA 1IGSA 3GVQA 3GZ3A 4YL2A 2V3DA 4J2MA 3L5LA 3B3DA 3TXVA 5DT5A 3T0BA 4K37A 1GQNA 4GQ0A 2J7DA 4YMZA 3UVIA 2XDFA 3SJ3A 3TSDA 4YCPA 3BOXA 4UMAA 1JIBA 4LUSA 5G2WA 2QMKA 4CN1A 3ANYA 3WLLA 2FJUB 3E49A 2J7GA 3LHUA 3STGA 4HTYA 1TO3A 2VD9A 4UQBA 2DSZA 1GWJA 1ZAJA 4LXFA 1OT1A 3UZYA 3PB2A 4PUEA 1V3IA 3SEPA 3IUHA 4JTDA 3KVMA 4O57A 5AC8A 3LD5A 2XFWA 4O12A 4AX7A 5DCBA 2J6XA 3PHAA 1R86A 1NTHA 1W5OA 2VZOA 1FHUA 1M04A 1A3XA 5ABFB 4QS6A 3GDRA 1EA9C 5H8PA 1V6VA 5AC7A 3P62A 3JRKA 3OBEA 4GYFA 1HO4A 1DYSA 3CWOX 3HPXA 1H0GA 3GAKA 2GQ9A 4JL1A 3IANA 2BVDA 4I90A 3VGEA 2W66A 1BD0A 4V1YA 2V63A 3H4XA 4E4PA 1XIIA 3M64A 3QMSA 1KM0A 3SSZA 1RQHA 1KLZA 3CIVA 1ZBWA 2ACUA 2ZRUA 3W7JA 2CU0A 3ANVA 1R30A 1R46A 1V6WA 3ZJ6A 3TDFA 4CU7A 4ZSUA 3V36A 3WMLA 3AYTA 2VFFA 5FESA 1JDAA 4NASA 4GLEA 1OFRA 1VJSA 4GQBA 4JCMA 4KESA 3GWQA 3M0JA 1DHKA 5D04C 5CZSA 1SU5A 1TPB1 4N0RA 4KETA 2IMRA 4M56A 2V5KA 2QDGA 4HK5A 1D7KA 4RDVA 2NQ5A 1F6PA 1O66A 3HM7A 2Y24A 4LS2A 1DHPA 1TIMA 4DYEA 1MUWA 4TVDA 2QPUA 3KW3A 4N42A 2I7GA 2DSUA 1CIUA 4Q32A 1FKXA 1QATA 4FXRA 1E3XA 3W02A 4WZHA 1H09A 2JFEX 4HNOA 5C9UA 3QC0A 1VB9A 4HMCA 1WDWA 2WNWA 3K2GA 3LEPA 4O16A 3BE7A 3GNPA 2BASA 3F03K 1XGZA 5BW6A 1PZ2A 5E0KA 1FH7A 3GR7A 3SM0A 1MXDA 2QV5A 4ACZB 3T09A 2X41A 4LS0A 3WDJA 1H5VA 3WYZA 4MJZA 4CUCA 1IWAA 1S1RA 5AY7A 1XF0A 3HQNA 4LOCA 4AWTA 1XH0A 4J2PA 1KR1A 2YDQA 3I3EA 3IIVA 1M65A 1FCQA 4WLCA 2QIWA 3RX3A 2GSHA 2RUSA 3HOJA 5ABHA 2PWHA 4PBGA 1GQJA 2XGZA 3NNTA 2DSWA 1MSSA 4UQDA 2JF7A 3SQMA 3SN4A 1EF3A 3ZR4A 3BAXA 3H2AA 4HMEA 4YYFA 4AEFA 4GUFA 3SGGA 4OV9A 2XIQA 3MO4A 1BTMA 1X1OA 2QVNA 7CGTA 1YDOA 3C2FA 3KFTA 3S9ZA 1JGIA 3QMRA 1NIUA 1CTNA 2POTA 5LHEA 2PTWA 1K6WA 1HKKA 5CSYA 4FOJA 1WO2A 5FL1A 5EMYA 5SWUA 3LX9A 5IDZA 1G4TA 3AXIA 2Y2WA 2ZYFA 3BCJA 2Y61A 3SUVA 2BP1A 2WM1A 1UOZA 2ZC8A 3R6IA 1R3WA 3VVGA 4NAEA 1W3IA 1S5MA 2XVGA 3QPZA 3WJXA 1JYNA 3H2EA 3RAOA 2Y8UA 3UW6A 3M5XA 3B8TA 1GG0A 3KWXA 5I0DA 2WZMA 3V7PA 4DPPA 3AIQA 3OBAA 1XPGA 4PBFA 4B90A 4WXYA 5JH2A 3EWUA 1JCYA 3AU2A 4UOZA 2NWSA 5D37A 2A2IA 3OO2A 4AD2A 1FOBA 4L1WA 3IVSA 1PX3A 5AYZA 5FOOA 3B8VA 3A23A 1KBIA 1UWSA 4WDUA 4E8DA 3G1HA 1LBLA 4RNIA 3FGCA 4DXXA 5LGXA 5BRQA 3F2BA 2PLKA 5CQ1A 3OYZA 4F48A 2CIPA 4XTDA 1ZTVA 3DFSA 4MLJA 4PMOA 4UZUA 3BLPX 3DU0A 1OHLA 1I4NA 1M5WA 4GI6A 4GFSA 5HMFA 4Z2KA 2YDAA 4X60A 1XSJA 2YDSA 1PXGA 3R13A 3W2KA 1SW7A 3NPWA 1TV4A 4JKMA 2W0UA 4G5DA 3EMQA 1W54A 3B97A 3E02A 4J3WA 5BWAA 1OC7A 3NYZA 4UUIA 2WVTA 3CQIA 4L1GA 4M6VA 4H7VA 1Z69A 1QI3A 4RL3A 3T2OA 2Y8VA 1VAHA 1S2CA 3IS4A 4Y9MA 3IJDA 2XN1A 3B40A 3SIMA 3N3MA 4XTIA 3QC3A 2OZTA 4IGSA 4G8TA 4KCWA 2E8YA 5BZAA 2A3HA 3CC1A 3M16A 1IT7A 3KX6A 1JEZA 2Q8XA 3G1XA 1XISA 3QRHA 3D47A 5J04A 1GZJA 1M03A 2QCEA 3S1UA 3VZXA 1M7OA 1CXFA 3WLPA 2GYIA 1JAEA 3OLDA 3ERPA 4D6JA 3VMOA 2G96A 1LROA 3GG8A 4GVHA 4RZ4A 4IG2A 4F0SA 4OHQA 5CAHA 3PZVA 3STEA 2NQHA 1WXJA 4Q7NA 1NFBA 4OIFA 3UFYA 4QFUA 4IWWA 4AZIA 2NSOA 1XIEA 1RJPA 3DX5A 1O1HA 4YU1A 4RPQA 1C29A 1HL2A 1ZAIA 3O06A 1EZ2A 1G7VA 1AJZA 2WB5A 1EGVA 2EPLX 3C8NA 1G94A 3LI0A 3ABOA 1QU4A 2ZA2A 3LCXA 1GG1A 2DT2A 1I2NA 3XIMA 3CHCA 4Y8FA 5A6JA 1G1YA 2WANA 2X1RA 4JHOA 2DPEA 3MKKA 3GNDA 1S2TA 3V0UA 4DZHA 3IARA