1QI2A

Endoglucanase cel5a from bacillus agaradhaerens in the tetragonal crystal form in complex with 2',4'-dinitrophenyl 2-deoxy-2-fluoro-b-d-cellotrioside
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
302
structure length
302
Chain Sequence
b'SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRESAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE B
publication title Insights into ligand-induced conformational change in Cel5A from Bacillus agaradhaerens revealed by a catalytically active crystal form.
pubmed doi rcsb
source organism Bacillus agaradhaerens
molecule tags Hydrolase
total genus 122
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 1999-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1qi2A00
5A3HA 4PUEA 1B0IA 5LA1A 1UKTA 3T0AA 5M3WA 5FOOA 1UH2A 2J25A 2WBKA 4BS0A 1ISXA 1MFUA 2QPUA 3AMDA 5TD4A 1R8LA 1JZ4A 3GXMA 3VMNA 4PEEA 1D7FA 1E4NA 3GXFA 3PTKA 1KXQA 1B3XA 4HOWA 4W87A 2X2YA 2CKSA 4DWSB 3N9KA 2QHAA 2XFYA 3ECQA 3CMJA 1CEOA 5A95A 2V3FA 2X0YA 3WF0A 4UFHA 4DUVA 3IK2A 2ZUTA 4Z2LA 3W6MA 3FNDA 2ZX5A 4MB1A 4B3KA 1CXKA 2ZX6A 1GOMA 1E6QM 3VD7A 1DWIM 3WNKA 3O2LA 1ZJAA 1XRVA 4LPCA 4FLQA 1RP9A 4E4PA 3SUUA 4H04A 1UWSA 3AOFA 3WNPA 1Q6GA 2WC4A 3AROA 3EMZA 2W67A 1UD2A 5I0DA 1JZ3A 5EMYA 4WKFA 5FKYA 5LA2A 2W92A 3L4TA 1UD8A 4M82A 1JXJA 1K6AA 5HNNA 1UKQA 3F5LA 2W62A 1JZ2A 2WMJA 1BLIA 1GHSA 2QF8A 3DYOA 4FLSA 5BXPA 1HX0A 3WH6A 1JL8A 1ZJBA 1J18A 4UQDA 1LJYA 3ARYA 3POCA 1EH9A 1HVXA 3BMVA 3CZJA 1BYCA 1CXIA 2CBUA 4W7UA 2J7DA 3EMCA 2WVUA 4JKMA 1KXHA 4AY1A 5KZ6A 1NQ6A 3L4XA 3WQ4A 3AXIA 3AHVA 1NARA 4MB5A 5D4YA 1CGYA 2PBOA 3U7BA 4TVDA 4UQCA 2OSXA 4PRWA 3W27A 2X1IA 2ZX9A 2WVVB 3KL3A 4JZ5A 3DYPA 3S2CA 1UWTA 3ZJ7A 1OINA 3U5UA 3UEQA 2D3NA 1VFOA 3GNPA 1H5VA 3W29A 3VVGA 1GW1A 3AXXA 4JKLA 3WSUA 3TTYA 1V0LA 5E70A 3U57A 2XYLA 4S3KA 4XZBA 3MV01 4UFKA 1J0KA 4M1RA 4EE9A 3BCFA 1JDDA 4HPHA 4CUCA 3D3AA 3WUBA 2MANA 2CBJA 2OLHA 4B15A 1WDQA 2VMFA 4S3JA 2BVYA 1VEOA 2Y2WA 4BF7A 3K8KA 1MW1A 3UG3A 2PI6A 2ZUSA 2E4TA 2YDQA 3CUFA 1XYZA 4NF7A 2V3EA 5BRPA 4PN2A 1DWHM 3AIQA 2WZEA 3MSGA 2G3JA 3K1DA 1GOQA 3VU2A 2YJQA 1IT0A 2VZOA 5CPTA 1UD3A 3GM8A 1FH7A 2VC9A 2PF0A 1OB0A 4LX4A 2XIIA 2XM2A 1NWSA 1CXEA 3ZR5A 2DQXA 3VIFA 2Y8KA 3GBDA 2CPUA 4QFUA 9CGTA 2XPKA 4AZHA 1G01A 1M53A 1H0IA 1QI5A 3CHCA 1XC6A 5E6YA 1F4HA 5CSYA 5DT7A 1VEPA 3WDJA 1VJZA 2EPNA 4UFMA 2IXVA 2ZX7A 3AI0A 4NSBA 4PMNA 4GPNA 4U5IA 3AS0A 2QV4A 4W8AA 4WJXA 4U31A 4CGTA 2E8YA 1VJSA 3W6LA 2VZSA 2UY2A 3SCQA 3OA5A 4H7VA 1JXKA 4F9JA 2ZXAA 4AC1X 1EOMA 4GO9A 4PYSA 3NDZA 3B8SA 1JAEA 4AD4A 3CH9A 3CZLA 3N1AA 4JL1A 1W91A 4J3XA 5LA0A 2GUYA 2CBIA 4CD8A 3BAXA 2XWEA 2NSXA 1WE5A 3AZRA 4P8VA 5GPRA 4D6GA 1JF6A 1TR1A 4CN4A 3FHQA 1C7TA 3TTQA 2DEPA 4C7GA 2PB1A 2GFTA 3WDQA 2WCAA 3WH9A 4NRRA 1W3JA 5A6JA 1UR4A 5DF0A 1GOWA 3ZQ9A 3IJ9A 2YA2A 1HKJA 3AZTA 4D6IA 2A3EA 3VTRA 1XSJA 5A8OA 1E6PA 2J7BA 3T0BA 3ALFA 4RE2A 1ZS2A 2OSWA 4PMRA 3WDIA 1WO2A 3WD2A 1UR8A 4GI9A 3DYMA 2VTFA 3KZSA 3GNOA 2JFEX 4AD1A 4PMXA 3QOKA 4HOXA 3CLWA 1CXFA 1ZB5A 2ZE0A 1V08A 2UWFA 3OLEA 2PBGA 1W1TA 3PTQA 4B3LA 1W3HA 3N04A 1QI2A 1F4AA 1V3HA 1Q6CA 3UG5A 1HP5A 1JD7A 3DHPA 5BWFA 5GNZA 1RD6A 1V0NA 3SCPA 4WK9A 1V0MA 1WPCA 2CIPA 1WP6A 5A2BA 6TAAA 3GDBA 3SEPA 2WANA 2WKGA 4PCSA 3ZSTA 2GJRA 1H49A 1S46A 1YQ2A 2DPEA 1ZBWA 2JIWA 3CUIA 2CHOA 1XD1A 1LG2A 2WSPA 4R27A 2DSUA 1Q6EA 2J75A 1MWOA 2VQTA 3NSXA 3TP4A 2DSWA 3WY1A 1ECEA 2X8RA 1HP4A 4QCFA 1U2YA 3ARSA 4UOJA 3W25A 2Y5EA 3L4UA 3AIWA 4J3VA 4MADA 1L0PA 5CPQA 3BXWA 1I1WA 3O9NA 3OG2A 4CD7A 2BS9A 1EQCA 2RGLA 4AD5A 3CO4A 4LYPA 4TVCA 1J11A 1JAKA 1HXJA 4M24A 3SUSA 3CUHA 1E70M 3OLDA 4R5EA 4AIOA 1LF1A 1ISVA 3CMGA 5E6ZA 5AYIA 4P7OA 4GZIA 3ZJKA 3QOMA 4ZENA 2BVTA 4XZWA 1HVQA 1TMQA 1A47A 4W5ZA 2YL6A 4PTVA 4BCEA 1B31A 3SCSA 2V3DA 1W9UA 3RM8A 1FH8A 2G41A 3PHAA 1FP8A 1UR1A 3UR8A 1DWJM 4JAWA 4D6DA 2AOSA 3ZIZA 3JUGA 1BTCA 1GOOA 3AXHA 2WWDA 1NOFA 1XCXA 2YDRA 3ARZA 3VGGA 1CXLA 3WF2A 2GDUA 1UZ4A 2XHYA 3AYRA 2D1ZA 4HOZA 5A69A 3OLIA 3WF4A 5A6KA 4GQRA 4OUEA 4JFSA 3T08A 1ODZA 4JFWA 2J8FA 5A8NA 1BG9A 3A4AA 1KB3A 4JKKA 2OYLA 1JYVA 1C8YA 5EFFA 3POHA 4MDPA 1OD8A 3FAXA 4HU0A 1CNVA 3W0KA 2E9LA 3QHNA 4X0NA 1G94A 3PZQA 2EJ1A 2VUYA 1BHGA 1UQZA 2D23A 3SCTA 3L4ZA 3G6MA 3BC9A 1E43A 2FH6A 4W7WA 2YL5A 5I78A 2DSVA 1JG9A 1UKOA 2WHKA 1O6IA 4UFLA 1W32A 3F5KA 3UESA 3WH7A 2A3BA 2EO7A 2VR4A 4D1IA 5IFTA 4DM2A 1UYQA 4W7VA 1TE1A 3N12A 3BSGA 1CWYA 8CGTA 4UZSA 1UA7A 5A8QA 1ZBCA 2EEXA 2JE8A 4XX6A 1PBGA 1JI2A 4WF7A 4M56A 1KXVA 2VI0A 3N15A 1CIUA 1HJWA 4PTMA 4Q22A 4OIFA 3FY1A 3SCWA 1HN1A 4ATWA 2Q8XA 3AHZA 2RGMA 4UQAA 4HU8A 4AZIA 3RJXA 3QR3A 4GI6A 3N17A 1ZBKA 3PBGA 1BSIA 5JBFA 1VRXA 5E9AA 1J0HA 3AIVA 1JZ5A 1FA2A 4CD5A 4V27A 3VGDA 1QBAA 4UQ9A 5FD0A 1WNOA 2BXYA 1PX4A 1W9DM 3BAIA 1E4IA 4H41A 2XUCA 3CUGA 3ZMRA 3PZIA 4JFUA 1L8NA 2JF6A 4AZBA 1AVAA 4AMCA 2V3GA 3DHUA 1KR1A 4Z2IA 1PJ9A 1TUXA 1TG7A 3UERA 5BXRA 4IM4A 1EHAA 4ATLA 4IISA 4YPJA 2Y8VA 1GJWA 1VFFA 4IPNB 3PZVA 3FAWA 3VGBA 1CTNA 4W93A 5FL0A 1PEZA 4ML4A 2YDSA 3ZJ6A 3VIKA 4Z2JA 2D2OA 1JNDA 4YHEA 4PSPA 1JYNA 2XGBA 4GZEA 1WZLA 3ZJ8A 1BQCA 4C7DA 1V3MA 3T09A 4HMCA 4W88A 1GQIA 1V02E 4P7NA 3AMGA 4HZ6A 5GNXA 2J7CA 1PIGA 3IAQA 1B3VA 1KCLA 3MO4A 3F4VA 3AJ7A 3EBVA 4HZ7A 4XB3A 2D20A 4QDMA 5E0CA 1GNXA 2EBNA 1W1YA 4PSRA 3N13A 1HJSA 3T2OA 2WW5A 3RDKA 3EDJA 4HP5A 2OWCA 5C8BB 4YHGA 4BZYA 1M7XA 4IPLA 1V6WA 3SUWA 5IHRA 1OBAA 1XH1A 2C0HA 3IAPA 2PWHA 1WAWA 2DDXA 3UG4A 4RE3A 2AAAA 3BAKA 3VDCA 1TA3B 2PWDA 2XVLA 4L4PA 1W9BM 1B2YA 1I1XA 5E09A 4WIWA 2UY5A 1ITXA 3BAYA 4YN5A 3W38A 3U5YA 4H8HA 4F79A 1XV8A 1RH9A 2YKKA 3O6AA 1JF5A 5A6LA 3LMYA 4MDOA 1VB9A 3VNZA 4D1JA 5AYBA 2ZIDA 4UCFA 3RM4A 4KGJA 5JBDA 1W2VA 1QHPA 1UZ1A 1GONA 2JEQA 3M6DA 7A3HA 2XGIA 4ZEPA 4H8VA 4CD4A 4DWSC 1HNYA 3U7VA 4MPKA 1K9EA 3E1F1 4PMDA 1HJQA 3L2LA 3GZAA 4X9YA 1ESWA 3VX1A 3AIRA 3ARVA 5C71A 3MUZ1 5DO8A 2DIEA 5A2AA 1WDPA 1VAHA 1E1EA 4TTUA 1GCYA 1XD0A 2WB5A 2ZX8A 3CBWA 5CG0A 3NJ3A 5EB8A 1GOIA 3MANA 1CGVA 2EQDA 1VFMA 1W3KA 3VIGA 3WELA 4GIAA 3HN3A 3WH8A 3ALGA 5I2UA 2ZUNA 4AZGA 4MNLA 5CPSA 2DIJA 4JFTA 1HKIA 1G5AA 5ABFA 1NWUA 3VIOA 1K9DA 2YBUA 2W4XA 1V6UA 1VEMA 1FP9A 5A1AA 1UD5A 3OB8A 2VX7A 1E15A 1SMDA 1US2A 5JIPA 1E1FA 3MMWA 5I6SA 3VINA 3W26A 3WNMA 1B3WA 4XUYA 2ZUMA 5F7UA 2NT0A 2W91A 4UFIA 1V6YA 3A6OA 1KQZA 4LGXA 2JALA 2J7HA 2WYSA 2XFRA 3VD5A 3WF1A 3AMKA 4P8XA 2CEQA 4U2ZA 4KMQA 1E72M 3PZUA 1QPKA 2YIHA 3BLKA 1KXTA 1UD6A 1MXGA 3WL1A 3K8LA 1FFRA 3AHTA 4WSKA 2XVPA 3T0DA 2ZWZA 3M07A 1NWTA 1V6VA 1H2JA 3MU7A 3WQ6A 4Z2KA 4D6EA 3GNRA 2WMKA 2WSKA 4K68A 5CZKA 5I3DA 1XCWA 2XVGA 3WEZA 1QW9A 4FLRA 3IJ8A 3AICA 3GH4A 4W84A 5KEZA 1JGIA 1NP0A 1WB0A 2O9RA 1JDAA 4TX8A 2VRKA 3LPGA 2WC3A 3BMWA 1KGUA 3THDA 4AEEA 1QW8A 4GO8A 3GXDA 3K46A 1M04A 3F5JA 3RCNA 1WDRA 2X05A 1MXDA 1XH0A 3WQVA 3ARPA 1B9ZA 4LXFA 5HXMA 1BYAA 4P7RA 4ACZA 3PZ9A 1EDGA 1CGWA 3VMPA 4ZE5A 3OBAA 1JNEA 2FHBA 2BHUA 3WKZA 4Q7NA 2VX6A 4AXNA 1Q4NX 3WD4A 1NH6A 4M29A 2BY0A 5CLTA 2YOCA 1HF6A 2TAAA 4PMOA 3WMSA 2VZUA 1E4LA 2J7FA 2XWDA 3WMCA 1R7OA 3SUVA 3WL0A 3NSMA 3TOPA 4PTWA 2DGAA 1X6LA 3MS8A 5A6SA 4MAZA 2BXZA 1C92A 3DECA 4AYSA 2W63A 1LG1A 1GOKA 3FN9A 2WZIA 3AFBA 2J79A 2WLYA 2VJXA 1V0KA 3VGFA 4ZXOA 4AZCA 2BNJA 1UKPA 1QOXA 2WVSA 1J0JA 3OIHA 2BY2A 1BGAA 1NP2A 5BROA 3VO0A 1GVYA 2XJ7A 5AC4A 1JYXA 3WUGA 1QBBA 3BAJA 2E40A 3IJ7A 2G3NA 4AD2A 5ABHA 2BHZA 1WZKA 2YLLA 2VT0A 3W37A 4BQ5A 5BXTA 2QMJA 1WZMA 2VL4A 4W85A 3W82A 4BQ2A 1I75A 5D8ZA 2C8NA 4CCCA 5LYRA 4W86A 1XSIA 5I5RA 2VCCA 1Q6DA 4PMQA 4J3TA 2XM1A 2A3HA 5D9NA 4JL2A 5A6AA 1CGTA 3A4WA 4N0RA 1ZU8A 3OLGA 5IDIA 1AQHA 3WDPP 1JYWA 2DH2A 2PC8A 1E6NA 1GPFA 3AHYA 1E3ZA 2CESA 1CENA 3RILA 1DWAM 1AQ0A 2OYKA 1DWFM 4OOZA 2J4GA 3OGSA 4H2CA 2CKRA 3II1A 2C7FA 3GYCA 4JHZA 1AMYA 4A3HA 1E0WA 1KCKA 2FGLA 1EQPA 4A3YA 2WHMA 2EXOA 1R7AA 4MNMA 3GBEA 2GK1A 1VENA 2BV9A 2A3AA 2UY4A 3J7HA 2IUZA 1FH9A 1W9XA 2DT1A 2V5DA 1QVBA 1DHKA 4WLCA 1PPIA 1MQPA 4UR9A 5A6BA 3MSDA 3AISA 5DFAA 4EANA 1E6ZA 4OOUA 1QHOA 3AIBA 2WWCA 3VX0A 2BVDA 4N42A 2G3IA 1FHLA 4KRUA 1J10A 1ODUA 3SCUA 4GINA 3VIHA 1MW2A 2DSKA 3RIKA 1UWUA 2XFFA 5ABFB 7TAAA 4L4OA 4OBRA 3I3EA 1HJVA 1US3A 5I24A 2UY3A 1VBRA 2NT1A 3AMLA 2FH8A 3N18A 1KWKA 2GJXA 1GZJA 2Y4SA 5AY7A 1D2KA 1WZAA 4DM1A 4EAMA 2VRJA 2VNCA 2VURA 4AZ6A 1V03A 2CCRA 5M03A 2EPMX 3ZO9A 4CU8A 3VOCA 3KWXA 1BAGA 2J62A 4HA3A 2WHLA 3VGHA 3OGRA 2PWFA 5HPCA 2ZXQA 5A94A 4GZJA 3CTTA 1UR2A 2VRQA 3SURA 1V3JA 4A4AA 1DTUA 1OIFA 4RE4A 2E9BA 1EO5A 3ZT6A 3VM7A 1TCMA 5CSUA 4ZE4A 1PZ3A 3VIIA 3MMUA 3SCNA 3ARXA 1XHGA 1DWGM 1V3KA 2Y24A 3CHFA 1UR0A 2WNWA 4KH2A 2E8ZA 2HVMA 2OWWA 1VF8A 4M8UA 1E73M 4AD3A 1HL8A 1GVIA 3SUTA 1BVNP 3W53A 3WNLA 1K9TA 1XH2A 4AIUA 5FCZA 1KR0A 2EPLX 4D6FA 3OZPA 3OGVA 4MB3A 4V28A 5D8WA 2J74A 3EMQA 3HJEA 1QI0A 3VDHA 2E9MA 2YA1A 1LQ0A 1QNSA 4UZUA 1TVPA 6A3HA 5A2CA 2XG9A 4W5UA 2WMHA 5HBFA 1JIBA 2DT3A 2G8ZA 2JIEA 1CBGA 1VFUA 3ARTA 1R87A 2WMIA 1C93A 3QGVA 2DT2A 4DWSD 1W3LA 2ZXDA 5ABEA 2G3MA 4PMUA 2X09A 1FOBA 2BHYA 2O9PA 3IANA 3PZGA 2CNCA 2F8QA 1UWIA 2E0PA 5D9MA 2YBTA 3KL5A 3TTOA 1UHVA 3WFZA 1EGZA 4BQ3A 4E2OA 2VVSA 3K8MA 3PZTA 4MNJA 1MFVA 2O9TA 1J9YA 1XGZA 3AS3A 5I77A 3QHOA 4JIEA 3L4YA 3VD9A 4M81A 1GUVA 1C90A 4DUWA 1PZ2A 1RPKA 1OSEA 1N82A 4UTFA 1HT6A 3M7SA 1J0YA 3K4DA 1CXHA 4MJ2A 4URIA 2O92A 4J3WA 3CUJA 2XSBA 1CPUA 2WC7A 3AIEA 4PTXA 4U33A 3VIPA 4AZ7A 4D6CA 2A3CA 3W28A 5CGMA 2WBGA 3NYDA 3WNNA 1V02A 5A8PA 3ARRA 1M01A 4QLKA 1Z32X 3ARUA 3L4WA 5CGTA 2XVKA 1B3ZA 5E0FA 3AMCA 4PCTA 1Q6FA 2J7EA 3UR7A 1MQRA 1QNRA 4WKAA 1H0GA 4JCLA 2FGZA 1B1YA 4J3SA 5A6BD 4CCDA 3RO8A 1H3GA 1ZL1A 1EXPA 1H1NA 3WEMA 1KBKA 3G6LA 1RP8A 4QP0A 3FXYA 4E8DA 4LYQA 4ZXLA 4H8UA 3WQ8A 3WUEA 1U33A 5BYWA 4W89A 2AMGA 1MW3A 2VOTA 4MNKA 3AZSA 1ISZA 1OM0A 1E40A 1V3IA 4KGLA 4V2XA 1J12A 2CERA 1UG6A 1M03A 2CBVA 2ZUVA 1E71M 3PZOA 1ISYA 5DEZA 1ZBVA 4GKLA 2VCAA 4NRSA 3UCQA 3WUFA 3APGA 5IXEA 4CU6A 3GH5A 1K9FA 2EPKX 8A3HA 1PIFA 2D24A 1UA3A 1WKYA 2ZWYA 1E6RA 3SCOA 4GQQA 7CGTA 2GK1B 3ZOAA 1O7AA 2WZHA 2HISA 1IZKA 1Y7VA 3WFLA 2WM0A 2WK2A 3NUKA 3WBEA 3ZT7A 1OIMA 3A3HA 3VDBA 3CZEA 1UWRA 4UQBA 4OJYA 2DT0A 3TA9A 1E3XA 3CZ8A 2X0HA 3BGAA 1E55A 2V5CA 2VZTA 3VILA 1TFVA 4AEFA 2XVNA 3BCDA 2GDVA 2V38A 3MUIA 3TTSA 3PZNA 1DP0A 4PMYA 1GQKA 3VD4A 1LLOA 2JF7A 2W5FA 1SMAA 4CVUA 4QCEA 3KL0A 1GQJA 3I3BA 3WQ5A 5A6MA 3HU7A 1HKKA 3GXIA 2OWXA 3AQUA 1B3YA 2YL8A 1JFHA 2CXGA 1HJXA 2GJXB 3HMCA 3NDYA 2IXUA 3WF3A 3PTMA 3VM5A 4U3CA 3WENA 3AYSA 3NSNA 3CZGA 1H09A 1NWRA 2FHFA 3MUY1 1B30A 2ZXBA 1JD9A 4F66A 3VD3A 3WD3A 2WMGA 1C7SA 2F61A 1W9PA 1UUQA 2W61A 3AIUA 3N11A 2GVYA 4CD6A 3VGEA 3B9AA 4HZ8A 1X1NA 1J0IA 3S6TA 4DUXA 1UH4A 6CGTA 1ISWA 3THCA 4B9ZA 1JZ6A 1C91A 1A3HA 2WCSA 3AHXA 5ABGA 1H41A 3RPMA 4U2YA 5CXPA 1XYFA 4UOZA 2D0HA 4HPGA 4GI8A 4JCMA 2YA0A 3BSHA 5JUVA 3B9EA 1E56A 2VZVA 2QMKA 1OWQA 4U3AA 2ZUUA 2F2HA 2J78A 4Z2GA 2VQUA 4MTVA 2VVNA 3WMBA 2ZUWA 3ZR6A 4TTGA 4W8BA 4AISA 2WKLA 1JZ8A 1E5JA 3EDKA 3D5HA 3ZM8A 2BY3A 5HOSA 1R85A 2WMIB 4LQ1A 1E0XA 3TONA 1BFNA 3CPUA 1BYDA 3WD1A 2XIBA 5ECUA 1SR0A 2PWEA 5M5DA 5A8MA 3WH5A 4EK7A 1NM9A 3BAWA 3PZMA 1R86A 1W9VA 4P7QA 5D9OA 4FK9A 2OSYA 4FLOA 1KFWA 1V3LA 3MKKA 1LL4A 1G0CA 3WN6A 1BVZA 1J01A 3AS1A 3CGTA 1TZ7A 3CHEA 1EIBA 3A4XA 5M17A 5FL1A 1C3FA 4TX6A 4UNIA 4FMVA 2D0GA 1CYGA 4NI3A 1C8XA 1QI4A 3FHAA 1H11A 1OT2A 1BPLB 5BXSA 1QNQA 2DSZA 1LL7A 1U30A 4CCEA 4E8CA 3M46A 2ESCA 3ARWA 1XSKA 4HA4A 4BQ4A 1OGSA 4WKHA 3VDAA 1OCQA 4U5KA 3WDRA 3VNYA 3DC0A 3EYPA 1UH3A 4CN1A 2OYMA 3BH4A 3VUPA 4D72A 3EDDA 4AIEA 5DMYA 1MYRA 2Z1KA 4AWEA 1G1YA 1SFSA 3WD0A 2XTKA 1UR9A 1OT1A 1PX3A 1BYBA 1E0VA 3VMOA 4DWSA 3CHDA 1UQYA 4TOQA 1UWQA 4IUGA 1FFQA 2BFGA 2E3ZA 1HL9A 3SCVA 1GORA 1KGWA 1NOWA 2DH3A 1JDCA 1WCGA 3WIJA 1CLXA 3L2MA 1H4PA 4J7RA 5GNYA 4HMEA 1IZJA 4PMZA 1JI1A 2ZOXA 3WDHA 1HJUA 2QPSA 3RM9A 1KGXA 4J27A 2ZICA 4PMVA 4F9DA 1CDGA 5HDRA 2QLYA 5DT5A 2CHNA 2WHJA 3EDEA 1HKMA 3LPFA 2WLZA 1UOKA 1PAMA 4WSJA 1MQQA 1E6SM 1EHNA 1KQYA 3RJYA 2FDMA 5CJ5A 3GH7A 3MUAA 3NCOA 1W1VA 4JFVA 3CZKA 1BGGA 5EBAA 4M80A 5CLWA 1GQLA 4HMDA 1GHRA 4D6JA 2J47A 1CGXA 1E4MM 1TA3A 4ACYA 4MAVA 1MW0A 2D22A 1E5NA 1EOKA 2VX5A 3L4VA 4FF5A 4GXPA 2CITA 4UFJA 3GTNA 1DEDA 1LWHA 1D3CA 4AZ5A 3B9DA 1AQMA 3T2QA 1IV8A 1B90A 1CGUA 3VIJA 3ZT5A 2WVVA 1SYTA 2JEPA 2WPGA 2W66A 3RMEA 4HA1A 2BY1A 1C8QA 1YHTA 4AD0A 1E9LA 3FW6A 1GJUA 2VR5A 1KBBA 4Y7EA 3SCRA 2J77A 3VIMA 3W4RA 1JZ7A 3I3DA 3AS2A 5BCAA 1X6NA 4CU7A 2YL9A 5IHSA 4TVUA 5BRQA 4CVWA 2NW0A 4AW7A 1NOUA 3CIVA 4P8UA 1CLVA 2YLAA 2J8GA 1OGGA 2GSJA 3UETA 2VO5A 3WEOA 2FHCA 4CKQA 1V6XA 1CZ1A 4MB4A 4J28A 3QHMA 5JBEA 5CQ1A 5C70A 2VCBA 1BF2A 1MVYA 4JHOA 2D3LA 3VPLA 1QI3A 1QNPA 4OZOA 1J0ZA 4OBSA 3W81A 3LPPA 3PN8A 4P7LA 3WQWA 4W8LA 1UD4A 1W1PA 4J3UA 4CN6A 3NIYA 4QAWA 5I79A 4PUDA 4QLLA 3ARQA 4XV0A 1P6WA 1KWGA 5EFDA 3MV11 4PBGA 2XSAA 4KWUA 2VX4A 2EPOA 4D71A 1EO7A 3WBAA 5AC5A 4TXEA 1CECA 4D6HA 2PWGA 1PX8A 1TVNA 4ACZB 5FIPA 2Z1SA 4ZFMA 2CYGA 1E6XM 3MMDA 4ATDA 1OD0A 5I23A 1OGBA 4B16A 3OZOA 4OKDA 4C7FA 1VIWA 3BLPX 2O9OA 4BA0A 2J7GA 3EDFA 5HPOA 2G4FA 3KEHA 5JIWA 1ITCA 4P8WA 1HIZA 3T2PA 1QNOA 2WCGA 3LPOA 3A47A 4X0VA 4QLJA 1EDTA 3K4AA 4UQEA 4F8XA 1LL6A 1UKSA 1W2PA 4B9YA 4LYRA 1BG4A 2B31A 1VBUA 4UOQA 5GQBA 2GJPA 3KE0A 1LWJA 1EDQA 4RL3A 4AZCB 4HTYA 1JFXA 2WXDM 3W24A 1EA9C 4NZCA 3ZSSA 1WDSA 4KRTA 1QHZA 3WNOA 4TUFA 1G9HA 4Z2HA 4MJ4A 3VKKA 2WVTA 4EKJA 2WAGA 3SIMA 2D0FA 2CETA 5IFPA 5D9PA 2WMFA 1FHDA
chains in the Genus database with same CATH superfamily
5A3HA 4PUEA 4O1CA 2NXIA 3T0AA 2UV8G 1YPFA 1JZ4A 1D7FA 2H8ZA 4ZB0A 1PTDA 1SZNA 3PTKA 1KXQA 4IL0A 4ORIA 3UXIA 2CKSA 5DBTA 3KTXA 4WJ8A 3ITCA 2QHAA 3VOJA 1GVRA 2XFYA 3CMJA 1CEOA 5A95A 5AC8A 1UJQA 3R8HA 4S3FA 4XISA 3FNDA 3LM3A 2ZX5A 4MB1A 3CV2A 1ZTVA 2GL5A 4LNYA 5BU9A 1RQEA 5KTLA 1DWIM 3O6YX 1J93A 3EWCA 4E4PA 3NOYA 3BG5A 5DXXA 3CEPA 3VC5A 1Q6GA 2WC4A 3AROA 3WNPA 4AY8A 2W67A 1JZ3A 2PU0A 1BWKA 1EC8A 2OMAA 1JXJA 1A80A 1K6AA 1UKQA 2IKGA 1T5AA 3IUHA 3QQ0A 2JBMA 1FBAA 2F6UA 1LQ2A 1CB7B 2F6XA 4MZYA 2WMJA 2FZ9A 2V30A 4OHQA 2J9XA 4IIGA 6XIAA 1WXYA 2PEVA 3ARYA 2A7NA 1W8GA 1EH9A 1YNYA 1BYCA 5IOBA 1CXIA 1GTEA 4W7UA 1NF0A 4G7FA 1NQ6A 3L4XA 1TIWA 1RJPA 3AHVA 1CGYA 2PBOA 3HZ3A 2QZRA 3MP4A 5KSWA 3GRIA 2WVVB 2DZTA 3EXSA 1XXXA 1TJRA 4JTUA 3DYPA 5FF0A 2QDGA 1JUKA 5AVHA 1W8SA 1H5VA 5FSDC 1VFLA 3VVGA 4KW2A 3AXXA 3IIPA 3WSUA 3W2KA 4QM1A 1W5PA 3ELFA 5E70A 4CQ8A 1BSLA 2BSLA 4UFKA 4ZMGA 3KBSA 1J0KA 4H6RA 3AYTA 4RNIA 1OYCA 3QFEA 4ILSA 4B5NA 4O1EA 4A6GA 2CBJA 1MZHA 1F6PA 3KCOA 3W7RA 2HE5A 1QO2A 4B15A 1GEHA 2OPJA 1XDMA 1SSDA 2VMFA 4S3JA 2PZ0A 1LBFA 3QMRA 4BF7A 2VFFA 1PZ1A 4FSAA 9XIMA 3W23A 3TKFA 4JN6A 3KTSA 3FFSA 3AALA 2PI6A 3N2CA 3XINA 5BRPA 1WYIA 1PYMA 1P4CA 4GY7A 3LOTA 1GOQA 2QR6A 1J5SA 2VZOA 4Y96A 3FVMA 4IGSA 2IQDA 2PF0A 4DQWA 3VOHA 1V7AA 1RJQA 2XM2A 1CXEA 3ZR5A 2DQXA 3VIFA 3GBDA 9CGTA 2XPKA 3GSMA 3FA3A 4PTDA 1AH4A 4UNLA 5HJXA 3TN4A 3A13A 3NEHA 1WXZA 3KCLA 4IFRA 3WDJA 1QAPA 4MPQA 2EPNA 3PNUA 4W8AA 2JGYA 4O1BA 4U5IA 4F3HA 2CWNA 2QV4A 3A9BA 1OK4A 4GGHA 1H7XA 3E0LA 1A5OC 1VJSA 3W6LA 3IV3A 4BY3A 2IPGA 2XDFA 3DZ1A 4GUJA 3MPGA 4H7VA 4RDVA 1EOMA 1XLFA 1DJWA 3V4BA 2Z00A 3B8SA 2V5BA 2CLIA 2GGGA 1JAEA 3IGXA 3CZLA 3QH2A 4HN4A 4ERAA 2Y5JA 3N1AA 4MYAA 3TZNA 1W91A 3MP3A 4Z1DA 3LK6A 3CQIA 5XINA 4YVVA 4I9JA 4R9OA 6ENLA 2WZTA 1OK6A 2YXGA 3SECA 2PP0A 1QPNA 3LYEA 4EIVA 5FAGA 4GIRA 3VOIA 2W79A 4V33A 4TMCA 1K6WA 3E5PA 4C7GA 3W7JA 1TWIA 3N2XA 4M19A 3A3WA 4NRRA 4PB4A 1UR4A 4HKPA 1A53A 3W74A 3AZTA 4D6IA 4O4VA 1FX6A 2CZ5A 3EXRA 3VTRA 1XSJA 2A0NA 2J7BA 3T0BA 1JUBA 4RE2A 2O56A 1Q5MA 2RDUA 3W2UA 1RJRA 1S2VA 3UVIA 4IQJA 5HAOA 3FJ6A 3APTA 1DIKA 3QOKA 4UNKA 3T0CA 3U2OA 1V08A 3N4EA 2UWFA 1UP3A 3SFWA 5AHLA 4Z17A 3LBOA 1V3HA 1Q6CA 4XAGA 1JD7A 1HP5A 5FACA 5BWFA 4AEOA 1V0NA 1EGVA 1X38A 1WP6A 2FZMA 2PRLA 5DY3A 5A2BA 6TAAA 3GDBA 1XM3A 4C60A 4IMDA 4XD4A 2QF7A 3EEZA 3TC3A 2DPEA 4IMEA 4N9BA 4QRNA 2C19A 4E0CA 1FWJC 2DIKA 2R6OA 2H6RA 3GHSA 3TMQA 4H9ZA 4B4HA 2J75A 3LGDA 1O1HA 1EIXA 3OA3A 5DANA 3BUVA 1U2YA 2TMDA 3ARSA 3DFNA 4IUOA 4IMFA 2R14A 5CPQA 3BXWA 1KFBA 4C1LA 4FF7A 4AD5A 2YSWA 1RCXB 3IGUA 4IIBA 4XBSA 3VI2A 1J11A 5AOUA 3H54A 4I7VA 3CUHA 1R38A 2OEMA 3VE7A 2F38A 3DFYA 4HNLA 3SSJA 4R5EA 3KS5A 1KD0A 1O66A 3KRSA 2POTA 1S1RA 3PM6A 4YCOA 5CJMA 4P7OA 1XRSA 5D37A 4GBDA 3ZJKA 4B3ZA 3P6LA 1E9ZB 3UZZA 3Q58A 1TX0A 1MNZA 3P93A 4IIEA 3Q2DA 4PTVA 2ZA1A 2I9UA 3SGZA 3V35A 1W9UA 3PHAA 3L68A 3ANVA 1UR1A 1BVWA 1F6KA 3UR8A 4D6DA 1AFSA 2ZADA 3AXHA 2ISDA 5EKYA 2CC0A 3VKAA 4E2BA 3LCLA 2RH9A 3NFUA 4N6FA 4HT3A 5FESA 5K7JA 3IEBA 2ZC8A 1Y0EA 3M0YA 3UYIA 2CLFA 4KPLA 4JFWA 3U9IA 1QJWA 2NQ5A 2EG8A 1Q7MA 5HNRA 4DJDA 1RY0A 1TX2A 2OYLA 3POHA 3NQEA 3GFZA 4PUJA 4GYKA 2HE8A 5A6TC 1HGWA 4GE8A 1KFLA 5AB3A 3C86A 4W7WA 2Q09A 5CPNA 3WH7A 1QPRA 1W17A 5FEXA 2V2HA 4DM2A 1K1DA 4AB4A 4WY0A 4W7VA 1UA7A 3UJSA 1Y5XA 2JE8A 2EEXA 3HO8A 1OX4A 4EXBA 4WF7A 3ITYA 2QCFA 1KXVA 1CIUA 1HJWA 1FWIC 4GC4A 4OIFA 5REQA 5HJYA 5HMDA 2VXNA 3P5ZA 3HG3A 4HU8A 4AZIA 1J4EA 3QR3A 1J6OA 3NZPA 3N17A 1ZBKA 1NTHA 1IT8A 3CPGA 2QIIA 1BSIA 3PBGA 1KRAC 4TV6A 4XQ6A 4RW5A 1J0HA 4Y90A 5HMFA 1IYXA 3SGUA 3FA4A 2INEA 5AVNA 3H4WA 1W9DM 2WNNA 3BAIA 5T91A 1QOPA 4Q4OA 2FVKA 4CQBA 3PZIA 1D8WA 2V81A 3HG2A 1AVAA 2PPGA 4ENLA 1ITUA 3NNTA 5TF0A 1EJ7L 4XBJA 2V3GA 4AH7A 3ZZ1A 1W3IA 3N2OA 1GZGA 3M16A 1TUXA 5CC7A 3UERA 1RK5A 4IM4A 5BXRA 5LNRA 3RG6A 1VFFA 1YXDA 3IGHX 1CTNA 4L61A 1PEZA 3W2NA 4O17A 3Q65A 4Z2JA 3S47A 4PSPA 1XYBA 3ZJ8A 4XZLX 1BQCA 3QW4B 3UWUA 3T09A 4B2DA 2RHGA 1GQIA 1V02E 3B0UX 1GJPA 1AH3A 3AMGA 4HZ6A 5HK4A 4DXXA 3IAQA 1KCLA 3MO4A 4IG2A 3F4VA 3AJ7A 3EBVA 2EG6A 3KOWA 4QDMA 1EWDA 1W1YA 2A85A 3W86A 1HJSA 4XBKA 3T2OA 2WW5A 3RDKA 2OWCA 1WBHA 2B7QA 1M7XA 4M5PA 3EOUA 1Z69A 4XKMA 3N2BA 1R3WA 2AL2B 4FOJA 4ZB2A 1EPVA 1P0NA 3CYVA 5EBUA 1TMLA 5AZ1A 2AAAA 3VDCA 1XIGA 1DJGA 4PCPA 1LZOA 3FSTA 1I1XA 4H9TA 1JCMP 1NSJA 1OFEA 3QSTA 2ONEA 3SZ8A 3KBWA 5A6LA 4MDOA 1VB9A 4D1JA 5AYBA 2ZIDA 2E1DA 4UCFA 1DJIA 4DJEA 4KGJA 1W2VA 1QHPA 1UZ1A 1HKVA 2ZZ5A 1HFBA 3CLMA 7A3HA 4ZEPA 1W5QA 1X7IA 4H8VA 3MW7A 4DWSC 1F07A 3E1F1 4OQVA 1HJQA 3QN3A 3W73A 3ITOA 3L2LA 1HL2A 3OOQA 4GQBA 1M5WA 1FCVA 3ARVA 4GNVA 3BV4A 2PDXA 4TTUA 1TJ0A 3LXAA 3NJ3A 3RLGA 5EB8A 2P5NA 4K1WA 1CGVA 3T81A 3EX2A 3WH8A 3ALGA 2HSAA 5AZ0A 5CPSA 1S2UA 1M3UA 3NO5A 1PKYA 1V6UA 1VEMA 1FP9A 3P61A 2OCZA 4IP7A 4MJZA 1E15A 3VKBA 1US2A 4I5XA 1E1FA 3MMWA 3VINA 2P0OA 3W7NA 4RNHA 1T8QA 4XUYA 2ZUMA 2YCIX 4CNNA 3S2NA 2V82A 4UFIA 4GUGA 5D2VA 4I7WA 3VAVA 3GC2A 5I3JA 4XK2A 1XF0A 3ANUA 4K37A 2YIHA 2E5CA 3IGSA 3TOYA 1T0OA 3AHTA 4WSKA 3OO2A 2ZRZA 1TPDA 2ZWZA 5CPLA 1AW1A 3M07A 4LUSB 3PUEA 3WQ6A 1CX9A 2NV2A 5PTDA 3B3DA 1HTIA 4HTBA 1XX1A 2XVGA 1SSGA 4FLRA 4ADSA 2FVLA 1BRLA 4TX8A 1JDAA 1I9CB 2VRKA 2VDIA 1ZRQA 1ELSA 4LTSA 1AMKA 4O0QA 3THDA 4B2DD 5HR7A 3ZLFA 1XI3A 2XFWA 3GXDA 1WDRA 1XH0A 1VPYA 5L6UA 3TC6A 4ADTA 2INZA 2RFGA 4ZE5A 4Q7NA 1ME8A 2VX6A 1JCNA 4IIDA 4JTSA 2BY0A 5CLTA 4EWJA 3UVAA 4S1FA 1SJAA 4LVGA 4LUJA 4TIMA 2XWDA 1UMYA 1H7PA 3WMCA 4UTLA 3NO3A 3P5YA 1R7OA 3GUGA 4O8RA 1LRTA 1TPH1 4JPGA 3V16A 3WL0A 3MHFA 3MS8A 4QNWA 3T9PA 4AWSA 4B5WA 2BGQA 1C92A 4AYSA 4GJJA 1GOKA 1IXOA 3FN9A 3DFHA 2WZIA 1VJIA 1N55A 1FWHC 4NILA 2O7SA 3TDFA 1UKPA 1T41A 1EX1A 4DZIA 5BROA 1GVYA 1XW8A 4F0LA 2ABBA 3WUGA 3VDGA 3JW7A 3IJ7A 1SW3A 5AHEA 3TUUA 5ABHA 1WZKA 2YLLA 4KCVA 5BXTA 4W85A 5D03A 3W82A 4BQ2A 1I75A 5D8ZA 4CCCA 1R46A 2HWGA 4BFAA 4PMQA 4J3TA 2XIJA 2XM1A 4Q8NA 2A3HA 4E3TA 4A8IA 3H7UA 3CL6A 3T1GA 1TYGA 3A4WA 3GVWA 1P7TB 2PGRA 1EJUC 5IDIA 1AQHA 1KRBC 1SJCA 3H22A 2DH2A 1FWGC 1SO6A 3L21A 2YDAA 1R3QA 3RILA 1DWAM 1TSIA 1AQ0A 4IGMA 1W5OA 1DWFM 3LRMA 3OGSA 2CKRA 2C7FA 4BI5A 5FA5A 3EEGA 3GC4A 2EXOA 2GK1A 2BASA 3THQA 3W1RA 1XLBA 3C2RA 3RNDA 4PUKA 1EYWA 3DBNA 2HK0A 2V63A 3NM1A 1DHKA 4X61A 2ZC1A 1PPIA 4AX6A 4IGHA 3CAQA 5DFAA 3MY9A 1E6ZA 1LQAA 4R33A 3UYCA 2PDGA 2BMBA 1QHOA 3AIBA 4F2TA 4QE1A 3VX0A 3WJZA 3TYZA 3PTDA 3KP0A 2G3IA 4JD4A 1FHLA 1POJA 1J10A 2NUXA 2B4GA 4GINA 1HO1A 3VIHA 1AODA 1W3NA 1MW2A 3RIKA 1UWUA 3VZYA 1PS9A 4OBRA 5I24A 1HJVA 1NDYA 4OGZA 3TAOA 2DZSA 3O06A 3STGA 3ZYZA 1LLWA 3LCXA 1O60A 1GZJA 2HBXA 3VE9A 2Y4SA 1BXCA 1PTGA 5M03A 4H00A 4CU8A 3KWXA 4MYXA 1XLIA 2QUMA 4DO7A 4I5UA 1PSCA 3VGHA 1TCDA 3UZ5A 1UOZA 2Y85A 3M0VA 2YW4A 4FX8A 4N6EA 3O15A 1PXGA 3CTTA 4BKNA 1EP1A 4B92A 4V1YA 2A4AA 4H2HA 1Z42A 1XUUA 1DTUA 1FWFC 2E9BA 1R0MA 3MO7A 4HA0A 3ZT6A 1XG4A 5DELA 3LLDA 1XHGA 1W56A 4Q4MA 3CHFA 1UR0A 3IWPA 2OWWA 1V8EA 3AWNA 4M8UA 1E73M 1QDSA 1RBAA 3W53A 2PTWA 3IV8A 3WFAA 1A5SA 1FQ0A 4QGCA 4WOZA 3M0LA 2Q71A 3OZPA 3OGVA 2J74A 3P2VA 3QV7A 5EMKA 4UZUA 2DV0A 3W2JA 4W5UA 2NLYA 2DT3A 3DFSA 1CBGA 4NAFA 4Q8VA 2DT2A 5CZJA 1W3LA 2ZXDA 4JYEA 1YX1A 4M7TA 2X09A 1I2NA 3QTGA 2WJEA 2QCMA 3U48A 1UWIA 4MY8A 2E0PA 3W7KA 2TPSA 2DQWA 3TTOA 1UHVA 4BQ3A 2VVSA 3PZTA 3GWQA 2PD9A 3TJIA 3QGKC 4GYFA 2OQLA 4XIMA 1PB0A 3CJPA 3M7SA 1OYBA 2HVNA 4J3WA 1NELA 2WC7A 3T8QA 4AZ7A 4HB7A 2ZRWA 4FZIA 3S1UA 3W1MA 2A3CA 5CGMA 3KWSA 4OE7A 4UB9A 3RPTA 2VD8A 1XQLA 2IW0A 2I5IA 1JR1A 3DGRA 1B3ZA 2BVWA 1RD5A 1R9ZA 3SM0A 3W1PA 3RHGA 2MNRA 1H0GA 4K3ZA 4J3SA 1B1YA 1ZL1A 1GGOA 3G6LA 1RP8A 3EGJA 4JTAA 2ZRYA 3MC5A 4GUFA 3V5FA 3D47A 4QTGA 4Q7IA 2PF8A 4N9DA 5BYWA 1DVJA 4W89A 2AMGA 1W54A 4MNKA 3BCJA 3V0UA 3D6NA 1E40A 2YYUA 3TJXA 4QBXA 2VFIA 3U4FA 2ZUVA 3PZOA 1ISYA 4GKLA 3WUFA 2HEJA 3ONBA 4E4UA 1RAKA 1IT7A 1PIFA 3JR2A 1SPQA 1WKYA 3VOFA 3WK3A 4GQQA 7CGTA 4ICCX 2HISA 3UBPC 1ZSXA 3ENLA 3GIQA 1TVLA 1IZKA 1LUCA 2ZVRA 1IEQA 3LX9A 1G67A 1YW1A 2QAPA 1UC5A 1DXFA 3ZT7A 1UWRA 4AHOA 4KIEA 3TIMA 2VEKA 3I7QA 2EHHA 1H62A 4PUMA 1G7UA 3BGAA 3P0WA 1ZJHA 2V5CA 1XUZA 1TFVA 4MY1A 2V38A 1DP0A 3EWBX 4FNPA 2ATMA 1AJZA 4XAYA 3O7UA 3GVVA 3EAUA 5A6MA 4X2RA 4OTKA 3DHDA 5KMYA 3GG0A 2X16A 4F0SA 2OFJA 4D9PA 3NDYA 1LORA 4ZVJA 3WF3A 2QEZA 4IT1A 3PTMA 4CNSA 3ES7A 2RAGA 3M5XA 4PL1A 1NWRA 2FHFA 5DQPA 3MUY1 1B30A 2ZKMX 2ZA3A 2OGJA 3CK5A 1C7SA 2F61A 2FLIA 1UUQA 1VYPX 5F2IA 5HWJA 2X7WA 5FJRA 2HS6A 3B9AA 5HA7A 4R88A 3N4FA 2TSYA 4US5A 1X1NA 1QT1A 2P10A 2Z0IA 4LAKA 1L2QA 2QCHA 1A3XA 1OX4B 7ODCA 3DI1A 4UTJA 4PRTA 2WCSA 3AHXA 4UMAA 2NXGA 4H9MA 3C2VA 1XYFA 2FJKA 4B4FA 4X2PA 4JTCA 3RITA 3LENA 1P5BA 2GDQA 3CV1A 3P3BA 3B9EA 1E56A 2QMKA 1RK6A 2X30A 5A5WA 3AXKA 3N3MA 2XN1A 3O0FA 1O12A 4EF8A 2WKLA 4O15A 4LRTA 3D5HA 2BY3A 1FXPA 1SZGA 3O63A 3G1FA 3B8UA 1LOLA 4GX8A 4Z1YA 1FDJA 1BYDA 3N3TA 3U4AA 2ZA2A 1J8VA 3WK2A 1SR9A 3N2MA 4MOZA 2D69A 1LDCA 3UGVA 1LRQA 3S1XA 4K36A 1UIOA 1WDWA 5D9OA 3E2QA 1KFWA 5K9CA 2Z2AA 4PODA 3VXGA 1LL4A 3WN6A 4JQ3A 1J01A 3AS1A 4R7OA 3CGTA 4ZO6A 1EIBA 5FL1A 4HK6A 3S83A 3P82A 3PY2A 1C8XA 3CYJA 3GXTA 1D3GA 4WDWA 1EEXA 3QC3A 3S9YA 4OT7A 1LL7A 4JOMA 5XIAA 3QYSA 1ZQ5A 3RR1A 3TK7A 2ESCA 5JQ9A 2OT0A 2E6AA 1HKWA 4IG2B 2R91A 1FWDC 3BW2A 2P3EA 1FUYA 1MYRA 4K39A 2QXWA 4ZQNA 2DORA 3LHZA 4L56A 3VC6A 2Y7GA 2V5LA 3WD0A 2XTKA 1PX3A 4DWSA 1UQYA 1AL7A 4O1DA 3DHFA 4WGHA 1M1BA 4IUGA 1SJDA 1WXJA 2BFGA 2IPFA 1HL9A 4HNNA 3QV8A 2DH3A 1JDCA 1WCGA 2CLEA 3HFTA 3KZPA 5M2FX 4J7RA 2TODA 1IZJA 1PKMA 2Y7DA 3PPCA 1JI1A 3DN5A 3V75A 1SO4A 2PDYA 2ZICA 4IMCA 4F9DA 1CDGA 3MWAA 5HDRA 5DT5A 1G69A 3RCYA 2IKHA 4D2JA 4WSJA 5LZLA 1MQQA 1E6SM 1EHNA 2PDCA 3MUAA 3NCOA 1H5YA 5CLWA 1GHRA 1E4MM 3DOPA 1TA3A 4ACYA 2F6KA 1IWPA 2QCNA 2R1PA 3T07A 3BJFA 1W1A1 4UFJA 3OVRA 1DEDA 1D3CA 1Q6QA 4BI6A 3VFLA 4DPPA 3DKJA 5GJPA 2XU2A 1CGUA 2XN2A 3ZT5A 3G0XA 1SYTA 4IP4A 2WPGA 4HK5A 4EPEC 2D73A 4GRSA 4HA1A 1C8QA 1KKOA 2PDJA 4C1KA 3CT7A 4Y7EA 3MUCA 1ZAIA 4TVUA 3DGBA 2NW0A 4IP5A 3LG3A 3U2CA 4C6BA 3VOGA 3UPWA 1OGGA 3S8HA 4LC6A 4H83A 2FHCA 2DP3A 3W22A 4CKQA 3EOOA 1CZ1A 4MB4A 4EVZA 1YNPA 1THFD 3RXZA 2D3LA 2HXTA 1I0DA 5I02A 3V1HA 2ZE3A 4OBSA 3TR9A 3BICA 3TW7A 5HJLA 4KCUA 4P7LA 4N2YA 2VEIA 1UD4A 4J3UA 4ICMA 5I00A 1JPKA 4PUDA 4DZ5A 4MZ8A 2QJNA 3GHTA 1BRLB 4HHLA 3BLEA 3WQPA 3TYAA 1WX0A 4FB7A 3LXCA 4D6HA 3W87A 5FIPA 4FALA 4QEEA 3IIOA 2CYGA 1NEYA 4PBFA 4WDUA 1UPMB 1JULA 3TCSA 3OZOA 5K2ZA 1TPVA 4N7QA 4C7FA 3M64A 1PHWA 4F2UA 3QBUA 2G4JA 3PULA 4JTRA 4HHMA 4MFDA 3KEHA 1J2WA 5JIWA 1QXLA 1HIZA 2GLKA 4HSNA 3T2PA 4W9TA 3LPOA 4QLJA 1EDTA 2IKJA 4UQEA 4F8XA 4XG1A 1W2PA 1VBUA 1DXIA 3C8FA 2NXHA 2W9MA 1LWJA 1EB3A 1TQXA 4A2RA 5BW6A 1JFXA 2OJPA 3W24A 3DENA 1RVGA 1EA9C 4NZCA 1WDSA 3W1XA 4KRTA 1QHZA 3WNOA 1I60A 4TUFA 3VZZA 1G9HA 2TYSA 3VKKA 1EUAA 2WVTA 3NA8A 3TJLA 1LP6A 1KKRA 4O1AA 2XZ7A 5D9PA 2NUWA 4L64A 1UH2A 3W1UA 4BS0A 1ISXA 2QPUA 1I2OA 5TD4A 4TO8A 3VMNA 1B3XA 4W87A 4UMBA 1IEWA 2X2YA 4O19A 5EPDA 3NQCA 1UR3M 4EPBC 3N9KA 4IXHA 2P0IA 3BPWA 3WQDA 3H7VA 3P67A 5C9RA 2X0YA 3BOXA 1G4EA 3WF0A 3IK2A 3NL5A 4Z2LA 2J24A 3W6MA 4Q33A 4Q8PA 3ZXWA 1VLWA 4B3KA 4QROA 4REQA 2KZHA 3WNKA 5C9XA 1ZJAA 4XAFA 2HVOA 4FLQA 1S5TA 1YPIA 4MWAD 4GQ0A 2ZQ0A 3AOFA 4KFNA 1UD2A 5I0DA 5EMYA 5FKYA 5LA2A 2W92A 3GC5A 2VDHA 4M82A 1OEPA 4RXGA 1KLZA 2SFPA 3GYEA 2REQA 3F5LA 3NVTA 3BANA 3IVSA 1GHSA 3IACA 3GFXA 4FLSA 3KVKA 2GOUA 5BXPA 4P5UA 5U7SA 7PTDA 1HX0A 2X1TA 1LJYA 2VEPA 4F48A 3BMVA 4QE5A 3C5QA 1TPUA 3IJ6A 1KRMA 2J7DA 2WVUA 4AY1A 3WQ4A 4RR4A 1NARA 5D4YA 2CFFA 3BVJA 4TVDA 2WNQA 3L0NA 2X1IA 2ZX9A 3KL3A 5JXQA 3S2CA 1OINA 3UEQA 1VFOA 2WPBA 4NU7A 3BTNA 3QPYA 4IQLA 2E5DA 3L65A 4RUBA 2XYLA 5GJMA 3PS7A 2FZ8A 4HNVA 4M1RA 2W27A 5CPOA 2QKFA 3BCFA 4CUCA 1K7FA 3WLTA 2E6DA 2P3ZA 1KC7A 4LUYA 4NJKA 1UBPC 2Z2UA 2ZZ3A 5EMJA 3I6EA 3FJNA 5CPMA 4HJWA 1TV8A 3K8KA 1MW1A 3LERA 3UG3A 3BJSA 3REQB 1PHQA 4NF7A 4PN2A 3NZ1A 3QZ6A 2NVCA 3AIQA 3GUWA 3LHTA 3WBYA 3RU8X 3HF3A 4DZAA 3OZMA 3NG3A 2BODX 1IT0A 4ZQCA 3GVGA 1UD3A 3GM8A 4KETA 3CXOA 5CZTA 3M0KA 1FHUA 1OB0A 1Q7QA 2XIIA 2VC7A 3T78A 3A22A 2PCQA 2CPUA 1ZALA 1G01A 1CCWB 1NVMA 1H0IA 1QI5A 1YDVA 1DQXA 4MKVA 1LYXA 5DT7A 1MI3A 3BG3A 3U3HA 3GNNA 1S2TA 4NSBA 4G8TA 4NAFB 1DBTA 4MJMA 5DCEA 5HULA 4EWND 2E8YA 4KEVA 3CTLA 5EMMA 2VZSA 3SCQA 3OA5A 4F9JA 4AC1X 4PYSA 4A05A 3CH9A 1VD6A 3DXIA 5LA0A 5BWAA 1DE5A 2ISVA 3BAXA 3G77A 4FR6A 4RCXA 2VEMA 4J2PA 4F0MA 1TQJA 2XWEA 3QLLA 4AXKA 4OVXA 1WE5A 4D6GA 1JF6A 1TR1A 4CN4A 5A8GA 2J88A 1C7TA 1YPXA 2PB1A 2GFTA 4CQCA 2WCAA 4YS1A 3UWEA 2VFGA 3QM3A 3G1VA 1GOWA 1A0CA 3G1AA 4UBPC 3ZQ9A 3IJ9A 4PR4A 2B0MA 5A8OA 1ECQA 2JK2A 4YXGA 3B9NA 1BXNA 5AKQA 1HW6A 2Q8LA 3QF0A 3OHMB 4H6EA 3DYMA 3KZSA 2JFEX 2Y70A 4KWSA 4PMXA 4G56A 4HOXA 1CXFA 3KX6A 4DB7A 2PBGA 3PTQA 4FO4A 3S5SA 2BWGA 1F5ZA 3N04A 2G96A 1QI2A 1BXBA 3UXLA 1PCKA 3R11A 4Z08A 1GWJA 4HPXA 3UXAA 2X41A 1E1CB 4WK9A 3NQBA 3HIJA 2NVDA 3CL7A 1ME7A 2V6AA 3B0YA 4PCSA 1MEWA 3ZSTA 4X63A 4HK7A 3ABQA 3EX6A 1ZBWA 3UFYA 3B03A 5FF4A 4INFA 1OF8A 3SJNA 2WSPA 3GAKA 2ZYFA 1BKHA 4X22A 1ME9A 3TP4A 3SIZA 4G5DA 2DSWA 3TXZA 1ECEA 1PZ0A 1WOBA 1VPXA 1XLCA 3L4UA 4CQDA 3GDTA 3AIWA 4J3VA 4MADA 4XZIA 4CNTA 1XLJA 3O9NA 3UU0A 4Q4RA 2RGLA 1KW1A 1GVQA 3HV8A 4TVCA 2Q6ZA 3DUGA 1JAKA 2P8BA 3KS6A 1HXJA 4M24A 3SUSA 2IPWA 3PPHA 4FIQA 1UZDA 3KFTA 2C13A 4LBRA 3KBJA 3M4HA 1DQUA 1LF1A 1ISVA 3CMGA 1GKQA 4LVAA 3RK8A 3QOMA 2OLAA 1DE6A 3VK5A 1ZP4A 1CT5A 1PUDA 4XZWA 2NQZA 1HVQA 2ACRA 1POKA 4I9AA 4N9EA 2ZZ4A 2OVLA 1B31A 3SCSA 1TREA 2V3DA 3RM8A 2A5HA 3FOKA 4JAWA 5LNVA 3GB6A 2AOSA 3JUGA 3R8GA 4S2BA 4QG9A 1VPQA 3DU0A 4K8EA 1RLCL 4O50A 1UZ4A 3AYRA 3BWWA 4DJFD 2D1ZA 4GK8A 3WYZA 9RUBA 3FJLA 4KWWA 4GQRA 3LLFA 4LAUA 1BG9A 1XIHA 2CLLA 4QDPA 1Q6LA 4JKKA 5C9ZA 5EFFA 3QSRA 3EKGA 4RPPA 1G94A 4RW3A 2YGYA 3PZQA 2VUYA 3V5CA 3G6MA 4ROQA 1E43A 2FH6A 2YL5A 2QT3A 2R94A 2EAWA 5FJTA 3UESA 1H1YA 1BWVA 3UY7A 2A3BA 2EO7A 5LIKX 4AYGA 4D1IA 1EWEA 1TELA 3CPRA 2C1HA 3N12A 3LBMA 4UZSA 5A8QA 1JRBA 4MSSA 2VI0A 3H55A 2HMCA 1JCXA 5T8GA 1HN1A 4ATWA 3MI6A 1L2UA 4BF5A 3RJXA 3EOSA 1XL9A 2X1UA 3MB9A 5K4ZA 3L2IA 1H50A 3EB3A 5JBFA 4C5YA 4H19A 4Z1AA 5AHFA 1XDJA 4JN7A 1PVNA 3PPGA 4LNCA 5FD0A 1MSSA 1EJTC 3OJGA 3AO0A 2PTZA 4DF1A 1E4IA 2Y62A 2XUCA 3CUGA 5HMEA 4AWTA 3S1WA 3U6WA 4I5RA 3ZMRA 4AWUA 3DDMA 3G2GA 4AZBA 2YCLB 4UTWC 1T96A 1KR1A 1JEZA 3E12A 4Z2IA 2OODA 1VHNA 3G1YA 1PJ9A 4DIAA 4ATLA 4IISA 4YPJA 4IPNB 2RJGA 3PZVA 1EGMA 4LV4A 5RUBA 3VGBA 1Q2SA 5I06A 3GG8A 5FL0A 4ML4A 2C0AA 4AVFA 1OX6A 2NV1A 3LZ3A 3TYEA 4ZO8A 2YX0A 3LU2A 4Z0SA 1WUEA 4HMCA 3QV9A 4H9XA 4B5TA 1D8CA 1C29A 3KOXA 3KBMA 5BZAA 1NAL1 5J5DA 2E7FA 4XB3A 3EPOA 5E0CA 3N13A 4MG4A 4Q3MA 4C6CA 4YHGA 2WSQA 2YFOA 3T05A 6REQA 5HUOA 1K8YA 3CHVA 1GPWA 1OBAA 2C0HA 3BARA 3H26A 1Q8AA 1WAWA 2DDXA 3RX2A 3DFQA 1XLAA 4C6JA 1OHLA 1TA3B 2PWDA 3N9SA 2FMOA 4KRZA 2F7FA 1B2YA 4H4IA 3BDKA 2ZZ1A 5LIUX 3RX4A 2UY5A 3KLLA 3CWOX 1ITXA 2QCLA 3UA4A 1O5KA 1KCZA 4I7UA 3VZXA 3P60A 4H8HA 1F73A 1RH9A 1US0A 5J8LA 1R5YA 4HU3A 5JH1A 3VNZA 3AU6A 5JBDA 1VYRA 3M6DA 3LEPA 3SQLA 4DYKA 1ICPA 4Q8QA 2R1MA 4FNSA 1B57A 2PDNA 2CZVA 4GBUA 4MWAB 3P8IA 1DJHA 1PWLA 3GZAA 4X9YA 3ZR4A 3VX1A 4XWUA 6PTDA 5C71A 5A2AA 3OYXA 1GCYA 2ZX8A 5CG0A 5F4WA 1M9HA 3CWHA 4BWLC 3HBLA 4JTHA 2EQDA 3WLNA 1VFMA 3ID7A 4XVDA 4GVFA 3K1GA 1I2QA 3TN3A 4AZGA 5DN1A 2GJLA 4JFTA 2Z29A 4I9MA 1GVOA 2W4XA 3C0LA 4GXMA 3TX9A 5AYYA 4DAIA 1CW2A 3OB8A 3SW6A 3W7EA 1TWZA 2VX7A 1SMDA 1X96A 3OVQA 4A3UA 3HOJA 3WNMA 5AHNA 3GR8A 1B3WA 3S9IA 4AFYA 3BV7A 4LGXA 5F2GA 1KM2A 1RLDA 1OG6A 4RLIA 4P8XA 3GE7A 4KMQA 3SFKA 3BLKA 3EA1A 2EJAA 4WVXA 3PWGA 2XVPA 3T0DA 1TWDA 3H23A 3LTPA 2G95A 1H1ZA 3MU7A 2PRMA 4EXAA 4AG0A 3GNRA 2WSKA 4K68A 4IPJA 1K4HA 3EPNA 4LF2A 1XCWA 3WEZA 1QW9A 5LGXA 1NF7A 2OG9A 1WB0A 1S5MA 3MYOA 2WC3A 2PODA 2E6YA 4O53A 4AEEA 1QW8A 2JKEA 3W2MA 1M04A 5F4SA 2X05A 3FCPA 3ARPA 3GO2A 4LXFA 3LUTA 1BYAA 3PZ9A 3CV7A 2FHBA 2BHUA 5HANA 1Q4NX 1QO5A 1DXEA 2PGEA 1HF6A 4WOQA 3WLOA 2Z6IA 4JTJA 3A24A 3PWAA 4FX7A 4JIHA 2BLEA 3URBA 3GR4A 3NSMA 2C15A 2DGAA 4PTWA 3B9OA 3EKLA 5A6SA 1OFBA 3DECA 3G1DA 4Q4KA 3QW3A 4QR6A 4FOUA 3STEA 2DJXA 2WLYA 3GU9A 2VJXA 1V0KA 3VGFA 2I17A 4C6LA 4MMWA 4ZXOA 4AZCA 1EBGA 1SO5A 1ALDA 3L5MA 4NT0A 2BY2A 2DUAA 3VO0A 5AC4A 4GJ1A 5J5RA 4GIYA 4RV3A 1QBBA 1Z8AA 2VT0A 3W37A 1EFZA 4C6NA 3KOYA 2C8NA 1RCQA 4W86A 1XSIA 1IHIA 3PB2A 5D9NA 3DX5A 1EJXC 4JL2A 2REQB 4KQNA 5I3HA 1CGTA 3WLKX 4Y8EA 3HQNA 4UR7A 4GGBA 3R2GA 1MUCA 2QW5A 1DV7A 4JY9A 3PANA 1JYWA 2PC8A 1ZLPA 5U4NA 3W1TA 1FY6A 4XO7A 1E3ZA 3KUMA 1CENA 2O7QA 1IEXA 1XIDA 4AVNA 4U4MA 3LCHA 3URQA 2J4GA 2QAFA 2E77A 1X8CA 3UA3A 1KCKA 3U2ZA 1F3EA 1QRQA 1R3VA 2QUTA 4ES4A 1QATA 3TQVA 1I2PA 1HO4A 3J7HA 2F2KA 4KKXA 2GOKA 1W37A 1R2TA 2ZRVA 1XRTA 2BG5A 3O3RA 1ZAJA 1PDZA 4MLRA 1QVBA 3HV9A 4QSFA 3TSBA 3B97A 2Z1BA 3GX9A 5A6BA 3WK1A 3LRLA 4EANA 1OG0A 4FXRA 1ODUA 3W76A 1XLLA 3NURA 2VWTA 4KFPA 2DW6A 2XFFA 5ABFB 4L4OA 3I3EA 4R7WA 3E6EA 3AMLA 3P8JA 4NZ4A 3CQ0A 1XLGA 2ACUA 3NZGA 1MUMA 5AY7A 1W31A 2FTWA 2VRJA 2VNCA 2VURA 1OZMA 4AZ6A 1V03A 3B4UA 2EPMX 2J62A 2WHLA 3OGRA 2PDWA 3K2GA 2O4QA 2ZXQA 4NAEA 5A94A 2G37A 4GZJA 4IF2A 2QCDA 4PGLA 3SURA 3NWRA 1KLYA 2PS2A 4DJEC 1OIFA 3S4TA 4RE4A 1Q66A 3IUDA 3VIIA 3MMUA 3SCNA 3NDOA 4LUTB 1EP3A 4KH2A 1SVDA 1SUXA 4E4FA 4AD3A 1GVIA 3EX1A 3QY7A 2OEJA 5C7VA 1BVNP 1K9TA 1XH2A 2PA6A 3UJRA 2IS7A 4JTDA 3F7JA 1TV7A 5E93A 4ASTA 4AIUA 1U5JA 1N7KA 1OZQA 1SM9A 4V28A 5D8WA 3EMQA 4BF9A 3PUOA 4PTNA 2YA1A 1LQ0A 1KA9F 1ONXA 1JIBA 1U22A 3S2LA 3M5ZA 3Q4DA 3H4GA 1XR2A 4E2DA 3PPFA 3ZLHA 1S5VA 3IANA 3PZGA 1D3HA 2FPYA 2F8QA 1V5XA 1QPQA 3GIYA 2QPXA 2DY3A 3HGRA 1P0EA 3WFZA 1EGZA 4E2OA 2BBFA 3GR7A 1XS2A 3MZNA 4YMZA 1XGZA 5I77A 5HWMA 3PVFA 3QHOA 3KXQA 1XGEA 1VCVA 3ITVA 4M81A 4O18A 3QEZA 4DUWA 1PZ2A 1RPKA 4UTFA 4JTFA 2DZVA 3BW4A 1CB2A 4URIA 1X39A 4U33A 4BR1A 3KAOA 3MBDA 2WSYA 3G18A 1VFSA 1Z6KA 4Q7BA 5A8PA 1M01A 4K7VA 2PDIA 3NEVA 4NJHA 3CAVA 5F1UA 5E0FA 1Q6FA 3ZWSA 2J7EA 3PJWA 3USZA 5MF5A 2HBVA 5A6BD 4CCDA 3ES8A 1WBJA 1U5VA 1XLKA 4LANA 1TPFA 3WEMA 1YADA 3UP8A 2CLOA 3S2MA 3B8IA 4LV9A 3GQYA 4JTGA 3CWNA 4E8DA 4LYQA 1UASA 1ZUAX 3WQ8A 3DESA 4LB4A 2PWVA 2QJIA 2HQAA 4OU1A 1ISZA 1OC6A 1OM0A 4B5SA 3LDVA 4KGLA 3DFTA 1TV4A 6TIMA 4A22A 2CBVA 2OQYA 1ZBVA 3GHUA 2VCAA 3ZS4A 2OZ0A 1NDZA 1EC7A 3APGA 3P74A 3GH5A 4RDWA 3GXNA 1UA3A 2GGHA 1VBGA 2OB3A 2ZWYA 1E6RA 3SCOA 2E6FA 2FYMA 2NX9A 3HPSA 2WZHA 3O0KA 1Y7VA 1MRQA 3E38A 3COTA 2WK2A 3WJSA 4PEKA 4WXYA 1EPXA 4IWWA 4I8DA 3LS9A 2GVJA 2QUVA 1OIMA 3GNDA 3A5VA 2CHRA 3CZEA 3HPZA 1F3XA 3UCCA 3FX4A 2CWXA 4UQBA 2ODOA 1B9BA 4GC3A 3TA9A 4XAZA 4AMAA 3E0IA 3TW6A 4C6EA 4DBEA 1VLIA 4AY7A 1JRCA 2XVNA 3LB0A 2GDVA 5C5YA 3MUIA 4JNZA 3R8RA 3KCJA 3TTSA 4PMYA 3OBKA 1U5HA 1YXYA 3VD4A 3S5OA 4FXJA 1LLOA 2JF7A 1SMAA 1LOSA 3BGGA 2Y89A 4JX5A 3R13A 5CBJA 5MKGA 3C4UA 3OYZA 1B3YA 2YL8A 3AQUA 1JFHA 1REQA 2CXGA 4XD5A 4FA3A 2GJXB 2GGIA 2IXUA 4KWOA 4HIBA 1I4NA 3CB8A 5LIWX 4GH1A 1DJYA 6ALDA 2E09A 4EPDC 2ZXBA 2A6NA 4A8RA 3QLDA 4F66A 3VD3A 4QHRA 4PFMA 1EZ2A 4J4KA 2V5JA 3W1QA 3CAWA 4C6IA 1W9PA 2FGBA 4Y9PA 1PYFA 2GWNA 1BEUA 3CEUA 1J0IA 5C2GA 6CGTA 3THCA 4M6QA 1JZ6A 1C91A 3XIMA 5ABGA 4C6QA 1H41A 3RPMA 4UOZA 2D0HA 4HPGA 1XYMA 4UTWA 5CGQA 2XZ9A 4GI8A 4DZHA 4C6MA 5JUVA 3BSHA 3DC8A 4L6DA 5F2LA 2GSHA 1PV8A 2EKCA 3EWDA 1FHVA 3W00A 3QPEA 4QJ4B 2VQUA 4MTVA 2ZUWA 3W7IA 2RDXA 2GGJA 1KTBA 4TTGA 4YLWA 4AISA 1PKNA 3OIXA 3TTEA 1PWMA 5HOSA 2V68A 4LUIA 2WMIB 2YCKX 2P8CA 4MY9A 3CPUA 4GG9A 1LBLA 3BW3A 4C1NA 5CC6A 2PWEA 5A8MA 3WH5A 4GNKB 3UW6A 1NM9A 3AU2A 2PLKA 2Y6ZA 4MHBA 1R86A 3DFOA 3VYLA 4YWIA 2OSYA 3IK4A 5BOFA 3MKKA 2BP1A 1G0CA 4LAMA 4O14A 4LT9A 1TZ7A 5HQMA 3A4XA 1C3FA 1V4YA 1XLMA 3ZVHB 3PK7A 4FMVA 1CYGA 1QI4A 4J2MA 4U10A 4LJ3A 3BZGA 5HNUA 1BPLB 1QNQA 3UR2A 2P53A 2DSZA 1VFHA 5H8MA 3QXBA 4HA4A 2GWGA 2QGHA 1A5UA 4U5KA 3LI1A 3VNYA 3DC0A 2ASHA 3EYPA 1UH3A 4CN1A 4ALDA 2OYMA 3R0KA 3VUPA 2VFEA 4D72A 3EDDA 2QS8A 1UPPA 3OP2A 4ZA0A 1GTHA 3B8WA 1E0VA 3BMXA 3CHDA 3PAJA 4NNBA 3EKZA 1GKPA 3SN1A 5GJNA 2E3ZA 4DRSA 2ABAA 1CLXA 1CLKA 3L2MA 1H4PA 3B8TA 4KWVA 3MCOA 4GZ7A 2GQ3A 4LVBA 3W1AA 4O52A 3EA3A 2ZOXA 5HWNA 1YKWA 3V7PA 1LRNA 4BWLA 3RM9A 3C2OA 2FFCA 2ZZ7A 2OTDA 2WHJA 3H70A 3W88A 4G9PA 3O16A 3A4JA 3EOLA 4HGXA 5K3VA 3OODA 1KQYA 3PNZA 2FTYA 2VENA 3B40A 4PB5A 3GH7A 2NQ9A 4JFVA 5EBAA 1GQLA 1ZJIA 2J47A 2WJZA 3EB2A 4MAVA 4GNJA 1EOKA 2V67A 5C7HA 4GXPA 4TU1A 3GTNA 2GZXA 3TE9A 4CQAA 1AK5A 1H51A 3KOFA 3B0VC 2UBPC 3G1HA 1B90A 3C2FA 3VIJA 2WVVA 2JEPA 4JICA 2ISWA 3W7CA 7REQB 1E9LA 1ZCOA 4N4PA 3FA5A 1UW9A 1GJUA 2I7GA 2VR5A 1XC4A 1JZ7A 3I3DA 5BCAA 4XD6A 1R3TA 4CU7A 5BRQA 2NQJA 4AW7A 3ME3A 2E67A 2YLAA 2J8GA 4KEZA 4JIQA 4DUOA 2I16A 4BI7A 1HG3A 3WEOA 4GUIA 1AQFA 2FFIA 2VCBA 4NQ1A 1EUNA 3UWYA 2OZ3A 1B4EA 3VPLA 3LPPA 1IIGA 3G5EA 3L5LA 4HYWA 1IEVA 5I3KA 1KFJA 3U2EA 5D2YA 5FJOA 4W8LA 1W1PA 4WRHA 2G50A 4CN6A 3NIYA 4QLLA 3EWUA 4XV0A 2AQWA 3NO1A 3WQEA 4PBGA 3E49A 1KM4A 8XIMA 2C1IA 4PUWA 5CAKA 1RBOB 1YBQB 5FF2A 5DBUA 4WZHA 3N19B 5AC5A 4ZR8A 5KINA 2YB4A 4AHQA 1PX8A 3QMTA 3HPFA 1TVNA 2WM1A 3E2RA 3FKRA 4XSMA 4ZFMA 2ZBTA 1E6XM 4GYPC 3UZWA 5K9DA 3MMDA 4K8GA 3VNLA 1JPMA 1OD0A 1UB3A 4OKDA 3V36A 2PDLA 3GTHA 3BLPX 3RMJA 5E0KA 3T40A 3AUOA 2O9OA 2J7GA 1KM6A 5HPOA 1DYSA 1ITCA 3E9AA 2NUYA 1OFRA 4AVOA 2PDFA 1N2VA 1QNOA 4QE4A 4AHPA 2DZAA 3A47A 4HHPA 3S2JA 3K4AA 4LF1A 3CASA 2NVAA 4LYRA 2HV5A 4QDWA 4M7SA 5GQBA 1NDVA 1Q85A 4H3DA 2J9YA 3KE0A 4MGGA 3MWCA 3T0TA 1EDQA 4RL3A 4AZCB 1KNWA 3CV6A 4PL2A 3ZSSA 2CZDA 1H7RA 4GLEA 4OV4A 1H7NA 4CNUA 1MUWA 2X2GA 4MJ4A 4IQEA 2B81A 4EKJA 1BWLA 3NPXA 4MUPA 4OECA 5BRBA 1FHDA 1XPGA 3SSZA 1B0IA 1O5XA 5LA1A 5M3WA 5HR6A 5FOOA 3E2SA 1MFUA 1OFOA 1R8LA 3GXMA 4PEEA 1AZ2A 1E4NA 4DO6A 4MVAA 4HOWA 3BGJA 2H8XA 1DQWA 3HJZA 1ZP3A 3P84A 3N34A 1FKXA 3ECQA 1UP2A 2OEKA 4PRRA 4AIBA 3IVTA 4UFHA 4V1XA 3TWBA 3RF9A 1VIZA 1UC4A 4HU4A 1E6QM 3GG1A 3VD7A 1RP9A 4MF4A 3SUUA 1VH7A 4JDYA 4H04A 2C79A 2PDKA 3LBCA 4FOKA 4WKFA 3L4TA 2HS8A 1UD8A 5HNNA 3HPXA 3WLMA 2W62A 3IRSA 1JZ2A 2PWUA 3WO8A 3O1NA 4HYRA 2QF8A 4JEQA 4B5VA 4U28A 3WH6A 3LV5A 1J18A 2FB3A 4UQDA 3UNDA 2NQLA 3BQ5A 1HVXA 1OCNA 3R94A 2CBUA 4DJDD 3EMCA 4JKMA 1KV5A 4ZO9A 3OPSA 4L9ZA 4QG6A 3B0PA 4MB5A 3NQFA 2PLJA 4HNOA 3CC1A 4LCRA 1BD0A 1EBHA 4JZ5A 2C14A 5L9FA 2D3NA 3H2NA 4D8AA 2PU1A 3W29A 3H2EA 1GW1A 4JKLA 1D7KA 3TTYA 1V0LA 4S3KA 1F3TA 4B90A 3EPMA 2CU0A 1VS1A 1JDDA 4HPHA 2NZLA 3D3AA 5JVLA 1TPB1 5LXXA 4G1KA 1DL3A 5T26A 4LFYA 3R6IA 5D09A 1WDQA 1VEOA 4EF9A 5EMUA 1P43A 2Y88A 4UCGA 3GTIA 4O8AA 3MQTA 2ZUSA 3CUFA 1XYZA 1DWHM 2DUXA 2WZEA 3IS4A 5LIXX 4OUIA 2G3JA 3K1DA 3UT0A 5FJPA 3L9CA 3TWAA 3VU2A 2YJQA 3S9ZA 4HCHA 2PDQA 2BXVA 1FH7A 3R89A 5EY5A 5B80A 4LX4A 3MCMA 1A49A 1NWSA 3LRKA 2WQDA 2Y8KA 1Q13A 4QFUA 4A3RA 3SY5A 2YB1A 1M53A 3I7SA 1X6UA 1ZHAA 3CHCA 1RVKA 1XC6A 5E6YA 4Q4PA 2X40A 4MKSA 1WV2A 1F4HA 5B7YA 2QDHA 1VEPA 1VJZA 3DIPA 2I57A 4H6KA 3TJ4A 2IXVA 2ZX7A 3AI0A 4GPNA 4WJXA 3AS0A 3M0IA 4XSLA 4IIHA 3S1VA 1JPHA 1R9YA 2D2HA 2ZVIA 3E74A 1JXKA 3Q67A 2ZXAA 4GO9A 5LKYA 3N29A 1RQHA 4HNCA 1YE6A 1WQ5A 4JL1A 3EX4A 2OO6A 4J3XA 2GUYA 3GKAA 4JNYA 3TR2A 4ZODA 3D46A 2NSXA 4OWGA 1IXPA 2EG7A 3AZRA 4P8VA 5GPRA 1F2JA 3FHQA 2GGEA 2XIOA 1T40A 2DEPA 3WDQA 3T44A 1QWKA 3O07A 1W3JA 4IFOA 4O12A 4UC5A 1XGDA 3S1GA 4C6KA 3M5YA 3KDOA 1E6PA 3ALFA 5C54A 1ZS2A 1TKKA 2VOMA 1ZGDA 2DJLA 3PP7A 4PMRA 2OSWA 4IX0A 3WDIA 1WO2A 5I3GA 3WD2A 4GI9A 3KVJA 3W7OA 2PMQA 3B8VA 4S3BA 3ABZA 3CLWA 3QVQA 4KCWA 1DIOA 4B3LA 1W3HA 4DJED 3F4NA 1KM5A 1XIJA 3MT1A 1L6GA 2RKXA 1AD4A 3FSUA 5TBOA 1VYSX 2X7VA 1TB3A 1HQTA 1V0MA 2CIPA 4L9YA 3ITTA 3ITGA 3SEPA 2WANA 2GQ9A 3CUXA 2WKGA 4CQ9A 4Q8WA 1H49A 1YQ2A 4V15A 5CC3A 4MFEA 4NX0A 3TCEA 1GVFA 2WV8A 2JIWA 4Z1CA 4ZQMA 2CHOA 1XD1A 1LG2A 4R27A 1ZZMA 4DHGA 2A2IA 1TJPA 1GEQA 1MWOA 2VQTA 3NSXA 4GY0A 3TYUA 3WY1A 4QCFA 4UOJA 3C3UA 2AL2A 2Y5EA 2OT1A 5HNTA 1PTAA 1PE1A 2DVUA 1I1WA 2DZUA 4CD7A 4DBWA 5FF7A 3CO4A 3E96A 4KCTA 4O11A 4ZTYA 1Z89A 4NZJA 4WY0F 3OLDA 1XWYA 4UTKA 1DIEA 4PUNA 1RR2A 1RCOB 4AIOA 4ROPA 5E6ZA 5AYIA 4AAJA 2XH7A 3TFXA 3W7QA 3EXTA 4R7JA 4C6DA 1PO9A 4ZENA 3QZAA 2C18A 1LM1A 3TLLA 2ATSA 1A47A 2YL6A 4BCEA 1XG3A 2HRWA 5TQLA 2PE4A 1FH8A 4M51A 1FP8A 1QASA 1DWJM 4KEUA 4E8GA 3ZIZA 2IMRA 4A21A 3IIXA 2WWDA 3ARZA 4CLMA 4HCDA 3H24A 1CXLA 4GCXA 4NJJA 3WF2A 2XHYA 2VGFA 3RO6A 5A69A 3WF4A 5A6KA 2GJNA 4M3PA 1L6SA 1F3WA 5HUPA 4JFSA 1ODZA 3MKVA 3ZLGA 1JCLA 2J8FA 5A8NA 3CQJA 1VC4A 1ADDA 2EKGA 4MDPA 4HU0A 4I6VA 1GKRA 3W0KA 2XGZA 2E9LA 2AGKA 3AAMA 1UQZA 2D23A 2YCJA 3L4ZA 3A23A 1OCBA 2DSVA 1JG9A 2HNEA 4YTUA 2WHKA 1O6IA 4UFLA 3ABSA 1OABA 2YXOA 3RAOA 4ERGA 2VR4A 5IFTA 1EJVC 1UYQA 3GXPA 1TE1A 1YRRA 8CGTA 1SW7A 4BJHA 1ZBCA 2B7OA 1PBGA 1JI2A 4M56A 3CU2A 1KCXA 4PTMA 4Q22A 1P48A 4O28A 3TYBA 3GD6A 4C1NB 1KM3A 3BOLA 2Q8XA 2RGMA 3CL8A 1AJ0A 3FXGA 2J9ZA 3N9RA 1Z9AA 2QYGA 3RPDA 4L9XA 3TV8A 3SADA 3BOFA 2ZCGA 1VRXA 4KBXA 1IF2A 3TLQA 1JZ5A 1FA2A 3R58A 1W5MA 1Q6OA 4LAOA 4V27A 3VGDA 1QBAA 3TN6A 4UQ9A 1WNOA 3S6DA 2BXYA 4H41A 5LGZA 1TIMA 4CEUC 5CKSA 4K38A 1KBLA 4PZVA 4JFUA 5IM51 2JF6A 2PGWA 3WK0A 3NQVA 1QPOA 4AMCA 5H1WA 3B8DA 4I8YA 1M65A 3QR1A 5DMLA 2ACSA 1GQNA 1IXNA 1MEHA 4CNPA 1EHAA 3LTSA 3THUA 3UWVA 1TUFA 1Q2RA 1GJWA 1YTDA 3R43A 1XDLA 3O8AA 1YIXA 1RY8A 1N8FA 2YDSA 1V7YA 3W83A 3H21A 3VIKA 1M7PA 3ZJ6A 4DXKA 2D2OA 4YHEA 3L66A 2XGBA 4QSHA 2GUBA 4C7DA 1V3MA 3MZ2A 3IRDA 5D2WA 3GU1A 4DO5A 5GNXA 2J7CA 1PIGA 2C3ZA 2IPJA 4HZ7A 3DBPA 3S5NA 1GNXA 2EBNA 4PSRA 1G4SA 2VDGA 1NY1A 1H60A 2PDMA 2WZMA 5C8BB 2Q02A 4BZYA 4M0XA 3K4WA 3KDNA 2GVGA 1V6WA 3SUWA 4DLMA 1RA0A 5AYXA 1P7TA 2V5KA 4YNGA 4RE3A 3SJ3A 2JGQA 4AU0A 1EA0A 1KM0A 2R9RA 3JS3A 4L4PA 1W9BM 4JTLA 3FVDA 5E09A 1A5CA 1JPIA 1TTQA 4UTTA 3ZFHA 3CQHA 1Q65A 4Y9AA 1PIIA 4GI4A 4YN5A 3U5YA 4F79A 4Y2WA 3O6AA 1YDYA 3C0JA 5JH2A 4XVEA 1V77A 4NZ3A 2Z7GA 3QJAA 3MBFA 2XGIA 1A5MC 3GLCA 3E0VA 5C0QA 3GKFA 4CD4A 4LVFA 1QNVA 3U7VA 4MPKA 4YCPA 4NYUA 4A8LA 2H90A 3TVAA 3XISA 4IPIA 2FPVA 1XISA 2HXUA 3AIRA 2J13A 3N2TA 3F4WA 2D2GA 3RN6A 3BJTA 3MUZ1 2DIEA 4DVOA 3TAKA 1J96A 4ZSTA 4R9XA 1UZHA 1GOIA 2Y63A 2FZBA 1W3KA 3PF3A 3C56A 3HN3A 1HGYA 3V5OA 3W1NA 5I2UA 4GYPA 2DIJA 1HKIA 4ZB5A 3C3NA 1NWUA 3KW3A 5CJNA 3U8GA 1F9CA 5HQEA 5CSRA 5JIPA 5I6SA 2VD9A 4NIRA 5F7UA 2NT0A 2W91A 4HBKA 3UJEA 3KBVA 3SAZA 1V6YA 3A6OA 1KQZA 4RDZA 2JALA 2WYSA 1P6BA 2XFRA 4Y6GA 1XIBA 3DERA 2CEQA 1E72M 3PZUA 4WY0B 5G1TA 5G2WA 4BK9A 1UD6A 5DXYA 1MXGA 3WL1A 3K8LA 4PA8A 4IFKA 3L7RA 1NWTA 1H2JA 4Z2KA 4D6EA 1R30A 2WMKA 5CZKA 1TPWA 1K8XA 4WR3A 5REQB 3AICA 2Q3OA 3GH4A 3RLUA 4W84A 4IMAA 5KEZA 1N8IA 2O9RA 2UZ9A 3CB3A 1IZCA 4JBRA 4HCLA 3PG8A 1PKLA 3BMWA 1KGUA 4JIPA 1JUEA 4D8ZA 3K46A 2B7PA 2WOQA 1UJPA 4FHAA 1MXDA 1F8MA 1W1ZA 1B9ZA 4P7RA 4ACZA 1CGWA 2IKIA 4IZGA 7TIMA 2P88A 3WKZA 3GG7A 4YYCA 1EF3A 4AXNA 3WD4A 1NH6A 4M29A 4JQAA 2XIMA 3UZYA 3WZ0E 3LCWA 3WMSA 2TRSA 3QQ1A 4YTRA 4N02A 1Q3NA 3C52A 2J7FA 4TV5A 4IPPA 3CMFA 4LAZA 4Q6JA 4FX6M 1X6LA 2Z1VA 5CG7A 5C9UA 1VCFA 1KBJA 4EACA 2G3FA 1LG1A 1V93A 4DEFA 2FKPA 2V9DA 1L9WA 1VKFA 3AFBA 1FWNA 3EWWA 1A3WA 1UCWA 4ZOEA 2Y1HA 1UUMA 2BNJA 1T99A 2BGSA 4XZNX 1IXQA 1J0JA 3OIHA 4XTDA 1BGAA 1NP2A 3HQPA 2XJ7A 3NGFA 5D30A 2QJJA 3MUXA 3BAJA 3BLLA 2E40A 1OFQA 4AD2A 4GYJA 4BQ5A 5G4HC 2QMJA 1WZMA 1H7WA 3RLHA 2FVMA 1QW7A 1J6PA 5CH9A 2Z24A 5A6AA 5BNKA 4LB3A 1L6FA 4B5XA 3WCZA 4N0RA 1MO0A 3VNMA 4HJFA 1OX5A 3G8RA 3YPIA 4IH3A 3OW1A 2OZ8A 3NPVA 4NKCA 1GPFA 2CESA 3MKCA 4L5ZA 1F7BA 5K9XA 2OYKA 4OOZA 4H2CA 3JU2A 3N6HA 3GYCA 4DF0A 4JHZA 3LHWA 1AMYA 3PBWA 4A3HA 1XIEA 1E0WA 5DLCA 2FGLA 4A3YA 2WHMA 4XZHA 4MNMA 1VENA 2Y5SA 4X60A 5F1VA 2BV9A 4US5D 3E0WA 1FWSA 2P50A 1EF2A 2JQXA 2YBVA 2Y7FA 3URNA 3VA8A 3VCNA 1OC7A 4M6VA 2AKZA 2IUZA 1FH9A 1JVNA 1W9XA 2V5DA 3SY8A 4WLCA 1PDYA 3MSDA 3AISA 4CEXC 5E9XA 3FGCA 1ONEA 1AD1A 4PULA 2BVDA 4N42A 4J3ZA