1QI4A

Mutant (e219g) maltotetraose-forming exo-amylase in complex with maltotetraose
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
418
structure length
418
Chain Sequence
DQAGKSPNAVRYHGGDEIILQGFHWNVVREAPNDWYNILRQQAATIAADGFSAIWMPVPWRDFSSWSDGSKSGGGEGYFWHDFNKNGRYGSDAQLRQAASALGGAGVKVLYDVVPNHMNRGYPDKEINLPAGQGFWRNDCADPGNYPNDCDDGDRFIGGDADLNTGHPQVYGMFRDEFTNLRSQYGAGGFRFDFVRGYAPERVNSWMTDSADNSFCVGGLWKGPSEYPNWDWRNTASWQQIIKDWSDRAKCPVFDFALKERMQNGSIADWKHGLNGNPDPRWREVAVTFVDNHDTGYSPGQNGGQHHWALQDGLIRQAYAYILTSPGTPVVYWDHMYDWGYGDFIRQLIQVRRAAGVRADSAISFHSGYSGLVATVSGSQQTLVVALNSDLGNPGQVASGSFSEAVNASNGQVRVWRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Roles of catalytic residues in alpha-amylases as evidenced by the structures of the product-complexed mutants of a maltotetraose-forming amylase.
pubmed doi rcsb
source organism Pseudomonas stutzeri
molecule tags Hydrolase
molecule keywords PROTEIN (EXO-MALTOTETRAOHYDROLASE)
total genus 148
structure length 418
sequence length 418
ec nomenclature ec 3.2.1.60: Glucan 1,4-alpha-maltotetraohydrolase.
pdb deposition date 1999-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09081 DUF1921 Domain of unknown function (DUF1921)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1qi4A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1qi4A01
3VX1A 2ZXAA 3MKKA 1B2YA 3LPFA 2FDMA 2W5FA 3VSVA 1UZ4A 3HG3A 5A6KA 4D6FA 3VGGA 1QOXA 1UYQA 5I23A 4ZE5A 3MUY1 2VJXA 2X05A 4GIAA 3HN3A 3IK2A 5HBFA 2XN2A 3BGAA 4LGXA 3D4ZA 4IM4A 3OIHA 1HKKA 4P7QA 1EDTA 3EDDA 4B9ZA 2QLYA 1OGGA 1JZ2A 3UR7A 4DO5A 4FK9A 3BVVA 3U7BA 1CENA 1S46A 4AZ7A 1QI4A 1CYGA 2A3HA 3BAWA 3M7SA 2DT0A 1E4LA 5LA1A 4OKDA 4RE4A 4U2YA 2J7CA 1NOUA 4CGTA 5BRPA 1UR9A 3VNYA 3SIMA 2WWCA 5CPSA 4V2XA 3EJPA 2W67A 2ESCA 3QR3A 2ZUUA 3ARRA 2NW0A 2WLYA 4AW7A 1VEOA 4AMWA 1D2KA 3MI6A 2BY1A 1VFOA 4NX0A 4HA3A 3K8MA 5D9MA 3WQ6A 1E9LA 2JIWA 3ZQ9A 2QHAA 1QHZA 1JYWA 1V3IA 4X9YA 1JNEA 3UEQA 3WUFA 2YFOA 2WMGA 3AOFA 1MQPA 4H2CA 3WFLA 1JGIA 4UFMA 3ZR6A 4ZENA 1B9ZA 2ZX5A 3A4AA 3N15A 3AIQA 2WMFA 3BAYA 4EAMA 4Q22A 2FH6A 4W93A 1GHRA 1F4HA 3W53A 2YL5A 2VT0A 1C7TA 1H4PA 5CQ1A 3HG2A 2YKKA 3AJ7A 3H55A 1LQ0A 2JEPA 3DDFA 3W37A 3RCNA 3AS1A 1JG9A 2E9BA 1CEOA 4KGJA 4W8AA 1EOMA 2BXZA 3DHPA 1C7SA 3MMUA 4GPNA 1KBKA 4B3LA 1FH8A 5M17A 4JFWA 4PSPA 1XGZA 5ABFB 1TUXA 2A3BA 1VAHA 1JXKA 3NSNA 3AHXA 4AIOA 2WHLA 4OOZA 2CBJA 5E70A 2WHMA 2F1AA 1F4AA 2XVPA 1UA7A 2XHYA 2DPEA 3CHCA 1UH2A 3O9NA 1UQZA 1W9BM 4P8VA 4BQ2A 4UQCA 2VO5A 2EPKX 2VZOA 2WSPA 1E0XA 1Q6DA 2AMGA 2EABA 2G8ZA 3BMVA 3VSUA 4ATWA 1OINA 2PF0A 3VGEA 1OT2A 3K46A 4PYSA 3W38A 3QHNA 3CZKA 3TTOA 3PZTA 1J01A 2D3NA 3KL3A 4AY1A 4UFKA 2ZIDA 4U31A 1ITXA 3MV11 2BVYA 3OZOA 4GZIA 2J8GA 1WDSA 3LX9A 4JCLA 1JZ3A 1I1XA 4OUEA 3H53A 3N17A 1UASA 1E4MM 1JYVA 2WZHA 3A24A 2XWDA 1ZBWA 4PRWA 3W4RA 2D2OA 3DC0A 3A4WA 1G9HA 4UQ9A 3RM8A 3GH5A 1EGZA 1EQCA 1BYDA 5GPRA 1NQ6A 4E8CA 5E9AA 3SCNA 4FLSA 5A6SA 5A8QA 1U2YA 4W88A 2E8ZA 4HA4A 1HNYA 2QF8A 2O9RA 5D8ZA 1TMQA 3IJ7A 4JL2A 1BYAA 1GOOA 1PBGA 4J28A 1XC6A 2VX6A 1W3LA 3CTTA 1V6UA 2X1IA 1DHKA 1WP6A 3AIRA 1CBGA 4QCEA 4MNLA 4CN6A 2E40A 1FP9A 5C70A 4JFTA 1HWWA 3MS8A 1PJ9A 3EDKA 1EDGA 4MNMA 3T2PA 4MB1A 4PMZA 3VIFA 4BF7A 3O2LA 5E0CA 3OB8A 3ALFA 2XVKA 1CXKA 4U2ZA 4PMQA 2V3FA 3WH6A 4P7NA 4N0RA 2WHJA 3KL0A 2OSWA 4Z2KA 1H0GA 1GJUA 5CLTA 1J9YA 1VBUA 3CUJA 1CXFA 4TUFA 2ZUMA 4E8DA 1KCLA 3ARPA 5E09A 4WSKA 3DYOA 1AVAA 3A21A 3WL1A 1J0KA 3SUUA 2UY4A 3WF4A 1UD8A 1TZ7A 3M46A 1RPKA 1JDAA 2DGAA 3B9DA 4CN1A 5IHSA 3GYCA 4AZHA 4D6EA 1UZ1A 3CUFA 2BV9A 2WZIA 1JAKA 4U3CA 1CGVA 2GK1B 5A8MA 2WYSA 5EMYA 3VNZA 5E0FA 1UR0A 4ZE4A 5ECUA 3N12A 4CU7A 1XH0A 2EJ1A 3WL0A 1TVNA 1PX3A 5GNZA 1NWRA 1K6AA 1WZMA 4KWUA 1E71M 2Y5EA 5FKYA 4ZFMA 1ZJAA 4H41A 1R87A 4DWSD 2FHCA 3W6MA 2DH2A 3DX1A 2XIBA 3G6LA 1W91A 1QHOA 2WPGA 2GUYA 1QNQA 4AD1A 5TD4A 1NP0A 4HPGA 2WC4A 4R27A 2XGIA 1XSIA 2J74A 4M1RA 1UR4A 1QBAA 2YL9A 1CLVA 4UFIA 4CU8A 4GQRA 1NARA 1FOBA 2RGLA 1VIWA 7A3HA 4J27A 1E0VA 2WMHA 2PB1A 2C8NA 4MADA 1ZBVA 1JI1A 3I3BA 4EANA 1OD0A 3GBEA 2V5DA 1C8YA 1UA3A 3L4ZA 2OSYA 4PMXA 2CCRA 3L4VA 1EIBA 3CZJA 4LQ1A 2XUCA 1QWUA 1VEPA 2FGZA 3GZAA 4TX6A 1KQYA 1HJUA 1T0OA 3TTSA 3OA5A 1EH9A 4JL1A 3U5YA 1LL4A 1YQ2A 2YBTA 1XH1A 4JKKA 4FF5A 1NOFA 3CHDA 2IUZA 3TP4A 2EPMX 5HNNA 4JKLA 5I3DA 3FN9A 3CZ8A 2VX7A 3CGTA 4W5ZA 3MO4A 3WUEA 1B90A 1ITCA 3PZIA 2G3JA 4GZJA 1TE1A 4KRTA 5BXRA 2C0HA 4PSRA 4FLRA 4QFUA 3ZMRA 5DMYA 5CSUA 4ACZA 4HP5A 1HJWA 4UQAA 2W4XA 4PMRA 4M29A 2YA1A 5C8BB 3L2MA 3TOPA 2VVSA 3KZSA 2B31A 5JUVA 4B9YA 1R7OA 1B3WA 1WNOA 4GZEA 1GCYA 2OWWA 1CWYA 1GVIA 3UERA 4MAVA 2WLZA 4NXKA 2XSAA 2EBNA 2VZSA 2V5CA 4PTXA 1UD2A 4HOXA 4AIUA 4HOWA 3AFBA 3WMCA 1HKIA 1TG7A 1ISVA 5EFDA 2OSXA 4IPNB 4ZEPA 1UWTA 1JF6A 1E1EA 3GDBA 3D5HA 3WFZA 1ESWA 1GQKA 3VMNA 2E8YA 5CSYA 2BY0A 3RIKA 1E0WA 3AIUA 2BY2A 4H8HA 1KXQA 3UG5A 1MYRA 2J25A 1KBBA 2EEXA 2D1ZA 2QPSA 1QX1A 4EE9A 3VSTA 5A8OA 2F7PA 1NH6A 3BVXA 1HVQA 1G1YA 2J77A 5BRQA 2Y8VA 3FHQA 1EDQA 2WANA 1C8QA 4UQBA 3AIVA 3D4YA 1BG4A 1ISXA 3AISA 1R86A 1W3KA 2PBOA 4P8UA 1DWAM 3A3HA 1IZJA 2D0GA 4W7VA 3ARQA 1L0PA 3AMDA 1EXPA 2WHKA 2FYVA 3BSGA 3TONA 2X2YA 3VIKA 4W7WA 1HP5A 3WMBA 1KQZA 4MJ2A 4C7DA 2WBGA 2EADA 2FE0A 4DWSB 3VMOA 3A4XA 4AZ5A 4WIWA 2EPNA 2CNCA 1BGGA 5BCAA 4GI6A 3WY3A 2XFFA 3AHTA 1MW3A 1BSIA 1HL8A 4FMVA 4M80A 3OZPA 1J0YA 5AY7A 3KLLA 5A8NA 1SYTA 4FNSA 4PN2A 3GM8A 2YDSA 5KZ6A 1U33A 1YHTA 4CCDA 1R34A 3UG4A 3JUGA 5D9OA 3KL5A 2WCSA 3LRLA 3WH5A 4CD6A 3AXHA 2A3AA 2WB5A 5AYIA 1VB9A 4KGLA 3WD1A 4WJXA 3W81A 1WDPA 3CO4A 1KR1A 3KE0A 1MVYA 3EJSA 4IPLA 4B15A 2CHNA 2VUYA 3PZVA 4AC1X 4TX8A 1W3JA 1CGUA 3L4WA 4ZXLA 4AZGA 3VIIA 4UQDA 3FY1A 4JHOA 4XZWA 3VD3A 4AISA 3QOKA 2JE8A 1FH7A 1QHPA 2G41A 5A6LA 3NUKA 4MNKA 1OD8A 1XD0A 1US2A 5I77A 4UFLA 3AIEA 3B9EA 2YOCA 1UD3A 2DT2A 4XUYA 1V02E 3CUGA 4MTVA 3HG5A 5JIWA 1HXJA 1HTYA 3PZGA 1E73M 3WEMA 1UQYA 3VU2A 1OWQA 3VUPA 1QI2A 1OM0A 4CCEA 3GXPA 1R8LA 2VCCA 3VTRA 3W24A 1V08A 3AI0A 3LPOA 3K8KA 1I1WA 1HP4A 3AXIA 4PEEA 3ZT5A 1FP8A 4XZBA 1WE5A 3PBGA 1UKSA 4UTFA 2UY2A 1G94A 1OSEA 4UQEA 2Y8KA 2GJPA 3AMGA 3WD4A 3VM7A 5IDIA 1QNPA 3A22A 3MMDA 2XFRA 1O7DC 3CC1A 4UFHA 3CUHA 3GXDA 4TTGA 2D20A 3A5VA 3M07A 1C8XA 1B3XA 1UWUA 3CZGA 2VX4A 1M53A 1KFWA 3TTYA 1UUQA 1LWHA 5A1AA 5AYBA 4ATLA 3WF2A 1KTBA 1E56A 3VILA 1UKPA 3ZJ8A 2OW7A 3U7VA 2WC7A 2CBUA 5A6JA 3BCDA 4TOQA 3AIWA 4HMDA 4DO6A 1BG9A 1G0CA 1L8NA 3AS0A 2WC3A 4W84A 3AS2A 5FD0A 1GJWA 3BUIA 2J62A 1E43A 1GOQA 5A6BD 3FNDA 3UESA 2YIHA 2XJ7A 3AHZA 2X09A 4E4PA 1TA3A 4V27A 1J0IA 2YA0A 1ZU8A 3VPLA 3KEHA 3EJUA 2A3EA 1P6WA 1ZBKA 5HXMA 4HZ7A 2WXDM 4HU0A 4AD0A 4S3JA 4MDOA 4U5IA 3A6OA 5E1QA 3G6MA 5HOSA 6CGTA 1W3HA 2WSKA 3QHMA 1E5NA 3CV5A 2AAAA 5A6BA 5JBDA 2IXUA 4DM1A 1V0MA 1ISYA 1VFFA 3ZM8A 2EAEA 2V38A 1QI0A 4L4OA 1QVBA 2CPUA 2JF7A 3ARZA 4GXPA 3SCQA 1BYBA 5LYRA 2DSVA 2NSXA 1LL7A 4ACYA 2GJRA 3WUGA 1KXTA 1MXGA 1HXKA 3SCVA 4UOZA 2CEQA 1R85A 5I24A 2Z1SA 5D9NA 2ZUWA 3ARUA 4FLOA 4PTMA 1ZS2A 2YFNA 4KMQA 4UOQA 1UWRA 3AXXA 1X6NA 4P8XA 4YHEA 2DH3A 1CXEA 1FHLA 1WDQA 1HJVA 3E1F1 4FNTA 2XWEA 1M01A 1PPIA 3VDBA 1AMYA 2D0FA 2GK1A 3EJRA 4H7VA 4F66A 1E6NA 4DUXA 1TQVA 4DM2A 3CUIA 3WF1A 5I79A 1IT0A 3BMWA 3VGDA 1H0IA 4NRRA 1NWSA 4E2OA 4XB3A 4CUCA 3D52A 1V0LA 3UR8A 1E4IA 4IUGA 3W82A 3WDJA 3WY4A 2ZX6A 3CLWA 3AYRA 2WVUA 1MQQA 2VNCA 5A94A 3T08A 3EMCA 3WD0A 3GXFA 3WNKA 5F7UA 3CMJA 2YL6A 5EBAA 1CXLA 3BAKA 4HMCA 2E3ZA 3CZLA 1K9DA 3PTMA 1DEDA 2EQDA 1R46A 2XN1A 4F9DA 5M3WA 3DDGA 1CECA 5ABGA 1H11A 1EOKA 1CXHA 1BPLB 5A8PA 2BHYA 4AZBA 4NZJA 2CITA 1I75A 5D4YA 3RPMA 3VD9A 1QPKA 1HJSA 2JF6A 4JCMA 5FCZA 2WMIA 1JZ4A 4Y7EA 4JFVA 1M03A 4QLKA 3THDA 2OLHA 1NP2A 2J7DA 4UFJA 2O9TA 1EO7A 3BLPX 1BAGA 1MFVA 3FXYA 5I2UA 4P7LA 4PCSA 5ABHA 4L4PA 1E72M 4B16A 3N9KA 4OOUA 2X2JA 3PZ9A 4PMUA 4S3KA 4Z2LA 2XM2A 5C71A 3OBAA 1ZL1A 3H54A 1Y7VA 1BLIA 1WB0A 3SCOA 4ACZB 1W2VA 4CU6A 3UETA 4UR9A 3VDAA 3VIJA 4MAZA 1JI2A 2EACA 2G3MA 2X2HA 3N04A 1W9DM 3WDRA 4CVWA 2PI6A 1KB3A 2J7BA 1BVNP 2E9LA 4N42A 3VIHA 4ML4A 1VBRA 4QCFA 3QHOA 3W29A 2BVDA 4Z2GA 8CGTA 2V3GA 3OLGA 3VD5A 1D7FA 4QDMA 1XCXA 1HKJA 4PMNA 4D6IA 1TQTA 1GONA 1V3LA 3BVTA 3WQVA 1JD9A 1UD4A 3LXAA 1E70M 2OYLA 4MNJA 5ABFA 3FAXA 2XFYA 5I78A 5A2AA 1G01A 3MMWA 3GXTA 2J8FA 4LPCA 3PZNA 1C93A 1KGUA 4JZ5A 1OIMA 3EDFA 1JZ7A 4D6GA 1WCGA 1JF5A 1CGXA 3VX0A 1E5JA 4GI9A 3GTNA 4H04A 1AQ0A 4D6CA 4DUWA 3WN6A 3TV8A 1J0JA 1UWSA 1VJZA 3POCA 4RE2A 4BA0A 4YN5A 3WQ5A 5FL0A 3S6TA 4LYQA 3WSUA 4D72A 2XVNA 1JD7A 4X0VA 1JDDA 3VKKA 3KWXA 4MDPA 5GNYA 5A6MA 1O6IA 1NOWA 3UCQA 1UWQA 3BAXA 1WZAA 3PN8A 3OGVA 1W1YA 3VIPA 3VD4A 2XVGA 4CD7A 2J47A 5EB8A 3D51A 4HA1A 5DO8A 1ZJBA 3RM4A 4V28A 5I0DA 4WKAA 1X6LA 2XPKA 1CGYA 3MU7A 4HTYA 3VIMA 3RM9A 8A3HA 2VMFA 1A3HA 2D0HA 1V02A 3WDPP 1OCQA 3BC9A 2CESA 3HG4A 5IXEA 1Q6GA 1EHAA 1W1TA 2YDRA 2VC9A 3LXBA 4DWSA 1XYFA 3WDQA 4MJ4A 2EPLX 2VURA 3D50A 1M04A 1OBAA 2NT0A 3BLBA 1G5AA 1R75A 2D73A 1J0ZA 4M56A 1QW9A 3DYPA 1LWJA 3POHA 4QP0A 1CTNA 5CJ5A 2E9MA 5E6ZA 3CMGA 1E6SM 3FAWA 3WDHA 4J3TA 3IGUA 3RJYA 1B1YA 4FNQA 2VZTA 2VOTA 4MB4A 2OYKA 3K4AA 1J0HA 1UD6A 3AZTA 3NDYA 1LLOA 1GUVA 3WNMA 3B9AA 2BVTA 1EQPA 3ZJ7A 4JKMA 2HVMA 3AHVA 2O9OA 4AIEA 1C90A 3T09A 2J4GA 3AZRA 1PEZA 3GH4A 1XYZA 5M03A 1TFVA 1JXJA 3FHAA 1HVXA 2F2HA 4QLJA 4WKFA 4W85A 3AQUA 1EO5A 5A6AA 5A95A 4WSJA 3BXWA 3ZT7A 1JZ6A 4TTUA 3CHEA 1J18A 3ZR5A 2IXVA 3OGRA 1VFUA 3AYSA 4LYRA 3EYPA 1KWGA 2F1BA 4M8UA 1W9PA 3CHFA 1TCMA 4URIA 2ZUVA 2J7FA 1AQMA 3NSMA 3RMEA 4F8XA 3LRKA 2A3CA 2WNWA 5IHRA 4AZCB 2Q8XA 1XD1A 3WF3A 1RD6A 3BAJA 2X2IA 3OLEA 5D9PA 4Q7NA 1FA2A 2AOSA 4RL3A 4ZXOA 3VVGA 1QI3A 1US3A 2JFEX 2VTFA 3GNOA 4AZCA 3WH8A 4A3YA 1TR1A 3VDHA 1EA9C 1M7XA 3WKZA 3RJXA 2WZEA 1HJXA 5FIPA 5AC5A 1FFRA 5CG0A 1MFUA 4W89A 4AWEA 1DWIM 3GNPA 5FOOA 3U57A 3BCFA 3F5LA 1OGBA 2ZX8A 3SUTA 4HZ6A 2C7FA 2XM1A 3IJ9A 2Y4SA 1HF6A 1RH9A 4J3SA 6A3HA 2IGTA 4FNPA 4NZFA 5HDRA 3N1AA 2F8QA 1UD5A 3AMKA 1ODUA 3MV01 1D3CA 2EO7A 3BUQA 1CGTA 3VM5A 2WCGA 3N18A 2VRQA 1K9TA 5DT7A 4WLCA 5LA0A 2ZXQA 4K68A 3VINA 2DEPA 2W63A 1PX4A 3ZSTA 4IISA 4B3KA 1MQRA 4AMCA 2TAAA 1LL6A 1UG6A 1A47A 3OLDA 2GVYA 1LJYA 3HMCA 2J79A 1GQJA 3VIGA 1TA3B 1JAEA 3S2CA 2DQXA 1B3VA 1X1NA 1QBBA 2ZE0A 2GDUA 1W32A 2CYGA 1GOIA 1JDCA 3BAIA 4OIFA 1NWUA 4AZ6A 1E6QM 1JZ8A 1XV8A 1CGWA 3MUAA 2XVLA 1KR0A 2E0PA 2PC8A 2DSZA 3PZOA 3SEPA 3OGSA 5A69A 3ZJKA 2WK2A 4AEEA 4JAWA 1CXIA 3M6DA 2O92A 4NF7A 4D6DA 5CXPA 1Z32X 4PUEA 4PMOA 1K9FA 4DWSC 4BZYA 1U30A 2DSWA 2F7RA 2WWDA 3PTQA 3HJEA 3ARWA 2ZUTA 9CGTA 1KXHA 1OT1A 2BNJA 1R47A 1W1VA 3GH7A 1UOKA 1E6XM 3SCPA 3WF0A 1IZKA 4YPJA 3W26A 4P8WA 5JBEA 1J11A 5DT5A 2J75A 2WBKA 4D1IA 1NM9A 1WAWA 1H2JA 2FHFA 2BXYA 4NI3A 1TVPA 5CGMA 4TVDA 3BVUA 3ARYA 5I5RA 2ZWYA 1W2PA 4W8LA 3AS3A 2W92A 1BGAA 1PIGA 2V3EA 1TQSA 2O9PA 3WNPA 3SUWA 1H49A 2EPOA 5FL1A 4WF7A 1HX0A 3T2OA 1GOMA 5ABEA 1BHGA 1CLXA 2WMJA 1QNSA 5BXSA 1HL9A 1TQUA 4UCFA 1UR8A 1J12A 1R33A 1E6RA 1GHSA 1LG2A 1SFSA 4UZSA 4OBRA 4PMYA 3BSHA 1MW2A 1OB0A 1ODZA 3K1DA 4XV0A 4CVUA 1W9XA 3HU7A 1VF8A 2F7OA 3PTKA 4CKQA 3OG2A 3VDCA 3LRMA 1GZJA 2WVVB 3NSXA 4PMVA 4CD5A 3ZSSA 5CLWA 3WIJA 4JFUA 2EXOA 2YA2A 5DEZA 3L2LA 3DX3A 3WNNA 3FW6A 1DTUA 3WEZA 3GXNA 1PAMA 1FFQA 1XH2A 1C92A 1OIFA 2PWDA 1HJQA 4NZCA 3ECQA 4BCEA 3WENA 3N11A 3AHYA 4C7GA 5HPCA 4NRSA 4CCCA 3NCOA 5M5DA 1B31A 1MXDA 2VZUA 4TVCA 7TAAA 3F5JA 2J7HA 1B30A 2DDXA 1JYXA 1E55A 4GI8A 1HN1A 2E4TA 1XHGA 3W0KA 5CGTA 1DP0A 1JZ5A 3K8LA 5DF0A 3DX2A 5IFTA 3I3DA 4AD5A 4GO9A 3PZQA 5CZKA 4TXEA 3L4UA 3VGHA 3ARXA 1GQIA 3TA9A 1IV8A 3ZT6A 2GJXB 4LX4A 4U5KA 3WUBA 1XSJA 2VQUA 2WW5A 1W9UA 3L4TA 2GDVA 3A23A 1SZNA 2XG9A 4HU8A 2W91A 1N82A 5KEZA 2MANA 4UZUA 4BQ3A 2JIEA 1KGWA 2D24A 3ARSA 1RP8A 4DO4A 4D6HA 1CZ1A 4M24A 4Z2IA 1J10A 1V0KA 3SURA 1FHDA 4P7OA 3VOCA 1V6WA 4HOZA 1KGXA 5CPTA 1WPCA 3EJQA 1NWTA 1KXVA 3AMCA 4KRUA 1LG1A 4JFSA 3MSDA 3LMYA 4JHZA 3WH7A 6TAAA 1BFNA 3WNOA 2RGMA 4EK7A 5A2CA 1CNVA 1E40A 4J3UA 2WKGA 1GW1A 4PBGA 2UY3A 5I6SA 1Q6EA 4D71A 2D22A 4AD4A 3F5KA 3T0AA 4U33A 3W27A 4OBSA 4CD8A 3QGVA 2F7QA 3THCA 2ZWZA 1UH3A 2V3DA 1EHNA 2CIPA 3AROA 1PIFA 3PZUA 1E6PA 4C7FA 2VRKA 2X8RA 2ZUNA 3OLIA 2BY3A 4W86A 3APGA 4LXFA 1ZB5A 2FGLA 5D8WA 1DWGM 1DWFM 3EBVA 2XN0A 3D3AA 2F61A 2JALA 3T2QA 1CIUA 3N13A 4A4AA 2F18A 3DYMA 3L4XA 1V3HA 3AMLA 4R5EA 1H1NA 3DECA 1WZKA 1BF2A 4FNUA 2WVTA 4F9JA 1GPFA 2DSKA 1PX8A 2FH8A 2YDQA 1GOKA 3VIOA 2ZXDA 4D6JA 4HZ8A 2VI0A 2FHBA 3LPGA 3IJ8A 3WDIA 2W66A 1QNRA 3PZMA 1FH9A 5DFAA 3ARTA 4AD2A 4AMXA 3WD2A 3ZIZA 2VR5A 4EKJA 4AYSA 5GQBA 5A2BA 4W7UA 1WZLA 4Z2HA 1Q6FA 4AYGA 4GQQA 3K4DA 2DT3A 5A3HA 4OGZA 2ZOXA 1B3ZA 3GBDA 2JEQA 2DIEA 3CZSA 4CN4A 1Q6CA 3GNRA 1CPUA 3EMQA 4HMEA 3MANA 3DX4A 3S5YA 1K9EA 5BXPA 1R7AA 1MWOA 3AZSA 3BUPA 1DWJM 1UKOA 3DX0A 5IFPA 2VQTA 2J78A 1MW0A 2HISA 4CD4A 1ECEA 1XCWA 3MUIA 3T0DA 3EJTA 4YHGA 2OWCA 1H3GA 1E3ZA 2GSJA 1WDRA 1VENA 2WAGA 3WEOA 2G3NA 3QOMA 1BVZA 2YBUA 1V03A 1SMDA 3WY1A 2G3IA 4M82A 4M81A 2WMKA 4ATDA 3ZJ6A 4RE3A 4UOJA 3WQWA 3KLKA 2CETA 1PZ3A 3ARVA 2ALWA 3LXCA 4P7RA 1V0NA 4TVUA 3EDEA 1BTCA 2VX5A 4MB5A 4J3VA 4U3AA 4WKHA 2VCAA 4PUDA 3MUZ1 3NIYA 2WMIB 3II1A 3GXIA 1AQHA 4OJYA 3W25A 4F79A 5JBFA 4NXSA 3ZO9A 1UR1A 4J3XA 3UG3A 1DWHM 5CPQA 1PS3A 1UH4A 1VJSA 2VCBA 2CKSA 5GNXA 3NDZA 4GKLA 1PZ2A 3CH9A 3SCWA 2QV4A 1QNOA 4OZOA 1VFMA 4AXNA 2WCAA 2DIJA 4GO8A 3HZ3A 1QWNA 4JIEA 2XGBA 4QLLA 1V6VA 2CKRA 3TTQA 3WBAA 1UWIA 2QPUA 2WVSA 2YLAA 1VRXA 1H09A 1KTCA 3A47A 4J3WA 2PBGA 3AIBA 3SCTA 1JFHA 1E1FA 1KCKA 2OYMA 1WO2A 4UNIA 2ZX9A 1B3YA 2XSBA 4H8VA 3IANA 2YL8A 1H5VA 3NJ3A 2J7GA 3CPUA 3VD7A 2GFTA 1HT6A 3J7HA 4XX6A 5EFFA 1TQWA 2CHOA 2XYLA 1GOWA 1ISZA 1V3JA 1JIBA 3SUVA 3VO0A 3WELA 3BUDA 3ZOAA 4BS0A 4X0NA 3BUBA 4AEFA 1W1PA 5HPOA 4A3HA 2D23A 2ZUSA 2QMJA 4QAWA 2PWHA 4W5UA 2CBVA 3I3EA 1E6ZA 3SCRA 3NYDA 4D1JA 1HKMA 5JIPA 2X0YA 1V6XA 1E3XA 4BQ5A 3WNLA 1QI5A 4LYPA 1O7AA 3IAQA 5BWFA 2G4FA 1BQCA 4AZIA 3DHUA 1JFXA 1UR2A 2J7EA 2OW6A 1GORA 1Q4NX 2GJXA 4W87A 3S5ZA 1E4NA 1V3KA 3WBEA 2WKLA 3B8SA 2YLLA 2ZICA 3SCSA 4AD3A 2CERA 3VGFA 3ALGA 2PWEA 4Z2JA 3MSGA 3CBWA 3PHAA 3RO8A 1RP9A 1UKQA 2Z1KA 1ZBCA 4MB3A 2NT1A 3T0BA 3RDKA 1V6YA 3WMSA 1C3FA 4KH2A 3WY2A 1VEMA 7CGTA 2CBIA 2UWFA 3U5UA 1SR0A 4FLQA 3WH9A 1QW8A 2Y24A 3IAPA 2PWGA 1BYCA 2D3LA 3W28A 2DSUA 2XTKA 3WD3A 3EMZA 5BXTA 3VMPA 2VZVA 1UKTA 3BH4A 1XSKA 2BHUA 1CDGA 2VVNA 1B0IA 3VGBA 3CIVA 5BYWA 1C91A 4PTVA 2DT1A 1UHVA 1V3MA 3CZNA 1HIZA 4PMDA 5LA2A 1OGSA 2OWXA 4BQ4A 2ZX7A 2X0HA 4PCTA 3SCUA 1LF1A 3O6AA 2W62A 1MW1A 2XIIA 2YJQA 1JYNA 1JNDA 3WQ4A 1GVYA 3GXMA 3WQ8A 1GQLA 2WM0A 4W8BA 2VL4A 5BROA 3L4YA 1W9VA 3EDJA 3BVWA 2VRJA 2BFGA 4MPKA 4J7RA 4H8UA 3AICA 2WVVA 2BS9A 5E6YA 3LPPA 2Y2WA 1E15A 1KWKA 1H41A 2CXGA 2BHZA 2QMKA 1SMAA 2PWFA 5AC4A 1GNXA 2VR4A 3F4VA 3W6LA 1JL8A 2ZXBA 2W61A 2UY5A 3SUSA 4PTWA 4WK9A 1XRVA 3RILA 3CZEA 4DUVA 3BLKA 4NSBA 4FNRA 1ISWA 1WKYA 4HPHA 4GINA
chains in the Genus database with same CATH superfamily
1EGJL 3P4MB 3F2BA 1R3VA 4P57A 4UIMB 1F18A 1G1CA 3T3MF 1YEYA 2A1YA 1B2YA 1Q0XL 4QT5B 1V7YA 1XPGA 2W5FA 3VSVA 4L9XA 2NYYD 1OX4B 5D4IA 3MRRB 3QGAC 3TO2B 1I0BA 1HOEA 2DQFB 4ZE5A 2HN7B 1NA8A 1XR8B 4GW1B 2AXGB 2VJXA 2X05A 4CMHB 4GIAA 5A2JH 5IZ7A 1WOAA 3EWYA 4U6VL 3RNDA 2F2KA 2VABB 4L18A 3CH1A 3UNTA 4S1RL 4ECLA 1AMKA 5HBFA 5BUAA 4IM4A 4ONHB 5DSCA 1HKKA 1ONXA 2PPEA 2EDEA 1JTOA 3D9AL 2JLLA 4P7QA 2UZIH 3D7PA 4KKBC 3VXRE 4O5LH 3HE7B 4ZPTA 4WEBH 5JA9A 1XR8A 4YNGA 2TSBA 1PBYA 1Q90A 2FRGP 1JZ2A 3WFEH 4M6MH 3HC3H 4J2XA 3GT6A 2J6WA 1KYFA 4XQ6A 3FT9A 3S5LB 3ZE1F 3MRHB 5FYLL 4X99A 1CENA 1S46A 1UBPC 3HMJG 1I82A 2ZXWB 4JIPA 1QI4A 2AEOA 3BAWA 3LQZA 3M7SA 4L5FL 3P4MA 4QM1A 3H23A 2DT0A 4PVBA 4YDKH 5FUOL 5LA1A 2JV6A 4OKDA 4LSSH 1RUKH 5TDOA 2J7CA 1YTEA 2VGBA 2FEJA 4A2GA 3VQ2C 5FO9A 3VNYA 4E9QA 5BRPA 3MTXA 2WWCA 4JY8A 4TQEL 1VBHA 2LLEA 2NQZA 3QR3A 2GLKA 4OLVH 2A74A 3MA9H 3WMPA 4O13A 4AJWA 2ZUUA 3ARRA 4RA3A 1PKOA 2WLYA 4U6VH 7PAZA 2P8MB 1LE5B 4TNGA 3FQ2A 4B53A 2VDNH 2W65B 2NYYC 1K6WA 3EX6A 6REQA 1DVUA 1BA9A 2HNEA 2NSQA 2VDOB 5DEGB 3QH3A 3DX9A 2QF7A 3F12B 1J8HA 2XUWA 4BKLB 4JM2B 3F2DA 1I4FB 3HE7D 4CQ8A 2WUCL 4EOWH 5HTSA 5I8CB 5F7DA 3K8MA 1QLEB 5F1VA 2A4CA 1J1PH 3KD4A 3I7RA 4NIRA 1RPQA 2E86A 3MODL 4FXKA 3QCUH 4NQVA 5DMKB 4HS3B 1JYWA 1UT1A 4L4TB 3LZPA 1P6CA 1MJ7L 1N0LA 3IEBA 4X9YA 2X1UA 4NAJA 2GPTA 3UEQA 3WUFA 3CPLB 1DVYA 1VCGA 1RZKL 1PZCA 2CMRL 3ML9A 5HDBE 1ID5I 5I1KH 2QVNA 4RXFA 4OU1A 3WFLA 3Q5TA 2J5LB 1JGIA 2V63A 4HCLA 3CQHA 4FG2A 2YPVA 4N0YL 1YEFL 1LWIA 2PU1A 5DLCA 3T81A 4L4TA 3OVRA 4AHQA 1XG4A 5CEZH 2P88A 4GVHA 2CK2A 1B9ZA 4LHUG 1TEYA 4NZRL 3BO8A 4X6CA 1EX0A 3OXSB 5B39A 2V8ZA 5EO9B 1Y1DA 1HW6A 3QEQE 4N86A 5E00A 3F12A 1P1VA 4YE0A 3VXTA 3BAYA 4BKLA 1J05B 1R3HA 4IGHA 4Q22A 4W93A 3PJSA 3MV7B 4EAMA 2ROYA 2P80D 2VT0A 2GWNA 4UYQA 1H4PA 1GVSA 3P74A 3QKZA 3DTUB 5DT1H 3CVHA 2QQKL 3X14A 4B5EA 2YSWA 3HG2A 3IDYC 5HUOA 4BCZA 4DH2A 1NGZA 4OFKA 4RCAA 4Y2NA 5D33A 3CL8A 1LQ0A 2NY1C 2ZCKL 3G5YB 1GWJA 3F4CA 4O28A 5AVHA 2SEBA 4YHLL 2IMNA 3MRCB 2ICWA 2XICA 3RDTA 1FO0A 2ROXA 4UOW0 2ZOOA 3NCWA 4R7OA 3QO0A 2Y5TA 3CFKA 1RAMA 1NMCB 4HJSA 2BXZA 3DHPA 5HHVL 1A5LC 1IWPA 4G56A 4Z0BH 4S3EA 3OMNB 3FLUA 3WJWA 4FOUA 2C9QA 4LAKA 4B3LA 5M17A 2Q9OA 3IGKA 4GXMA 4H88L 1JHLH 3SY0A 5GS1A 4XRCB 3ZKQD 3B8TA 2BIOA 3V0HA 4JFOB 1BVOA 4QYOB 5E03A 1WUEA 2B1AH 1JNJA 3CZFB 5H8MA 3LN5A 2GTZB 3WFEL 2P1FA 4MYXA 1MCEA 2FZ3A 2WWMC 4GEIA 5C2BH 1XI3A 1MNUH 2I9UA 5FF0A 5JIIA 1JR1A 1VBJA 1AJ0A 2BX5A 4X7TB 3K81A 4XMWA 2PRLA 2XHYA 5KYYB 4JXCA 1UQZA 2HRPH 3EOBA 4OZIA 2ZQ0A 1AR1C 4BQ2A 2VO5A 3GVRA 2VZOA 5AYUH 2WSPA 4QOKA 3B4YA 4HN8A 5B80A 4OFYA 1OZUA 4WO4B 3U9PH 2JWYA 2AMGA 2P5EB 4JTLA 4Y4KC 2ZKHL 1U8LB 3L3GA 3H21A 4NJ9L 4XCNA 1VH7A 2ZSVB 2ZTKA 3TMLA 3KX6A 1IVTA 2IADB 2Y5QA 3G6DH 3OHXA 5DCCA 3CPGA 3ITOA 4PJXB 3FB7B 2R9HD 2YUXA 3FT0A 1N3NB 2C3VA 4R4NC 5IG7B 2Q87A 3ZHNA 2X4OB 4ZMLA 3FT1A 4HT1L 2J66A 4PYSA 4B2DA 5B7EA 4CNSA 2PS2A 2PDXA 1J01A 5FJPA 2D3NA 1OGPA 3BVNB 5IFHL 4UUIA 3ULVL 2GBVA 4C6QA 3KPPB 4G5DA 2XQ0A 4UFKA 32C2B 5BOZG 2ETWA 3AXKA 4Y9MA 4DN4L 4QCIB 4HH8A 1XLLA 3ME3A 4RGOL 4U31A 4DERA 3ITYA 3MV11 3GSXA 4DYEA 4MA3A 5I30L 4K7PL 4DP1X 4IMCA 1EZWA 5DVOA 4E5XA 3P8JA 4YEFA 4BSVB 2A6DA 3T0EE 5EA0H 4OUEA 4FQQB 5EZIL 4PJEA 1QK2A 4RIRA 4KO9A 4L3FA 4TV5A 4FHJA 5HHPA 4ELKA 5DJXA 4X2PA 4IIQB 1CIDA 2JCCA 3RHGA 2HVNA 1JERA 3S8HA 3FQNB 4IEFB 3C60C 2O4QA 4NJ9H 3UF9A 4JY5H 1JCMP 4WUUD 3EYUL 3LV3A 1ZBWA 1TJGH 4BY3A 4CNNA 1S6NA 4AGQA 4MLRA 3W70A 1G9HA 2CO3A 3KWWB 3QJRB 4FZEL 4UQ9A 1R2TA 1XH3A 1EGZA 3GH5A 1LLWA 3RM8A 1Z5LB 1TYJA 5CCGE 1M7UA 2C4FT 4LLVA 4ALAL 4C56B 1L9SA 4R2GC 4TQPA 1TE6A 3UJRA 4DKDC 4MJID 4PVMA 2IPKB 1S2CA 1NPUA 5EMJA 3HA0A 4M6NH 1M3IA 2HKFH 3FU7A 4JVUA 4X6CE 3WFDL 1A2YA 1ROWA 2QL1A 4QXVA 4ZNEE 5I1LA 3C2YA 4DY1A 3ISYA 5A8QA 4OSUH 3QEQA 4OI8A 5D5ME 4M5TA 4HA4A 1HNYA 5D8ZA 1XZ0B 3O6FD 5MI0C 4ZXBC 1PG7X 5FOBB 3SDAA 3JVGA 4F40A 2Z1XA 4LUJA 3IGAA 2XDHA 1F4XH 3BP5B 3DCPA 1FYTD 3N2BA 5LNUA 4PH6A 2OCFD 1HHGB 2QZ5A 2OT1A 5LNRA 2JKPA 4P49A 4H88H 1A3LH 5DR5H 3V52L 1T20A 1W3LA 3STFA 4BQ8A 2DJXA 1U83A 2E6YA 4AYID 4UI2A 3NH7H 4MMWA 1DHKA 3ESNA 1YY9D 1WP6A 2WWKO 3AIRA 4P9HL 5DHXB 4QCEA 1KPRA 3CDYA 4CSSA 4RZ6A 4CN6A 3MRBA 2E40A 3SIZA 2XDFA 1DFXA 2GHWB 2MOGA 4WW2F 1FP9A 1JPKA 4JAMB 1EUAA 1D5BA 3CL7A 4FR6A 2Q02A 1AD9B 3URNA 3MTRA 3S37H 3RK8A 5DQJA 1XIGA 5DU7A 4G7SB 1HESA 3HUJB 4JN1L 3B7SA 4F7PB 2DY2A 3EYUH 4RMTA 3R1GL 2IS7A 5DHYB 4JTEA 4XO7A 2ENSA 1CICA 3BH9A 3SDAC 3UJIH 3WD5L 3THMH 6ALDA 5E0CA 3TMQA 4A2FA 1I3VA 2X41A 4HS6A 3SGJA 2AQTA 1CC3A 4U10A 2CDEA 2ZRZA 2Z1BA 3O2VL 1VRSA 1JCNA 4U1MB 4P7NA 1OCRB 2EIDA 1EEYB 1HC1A 2APFA 4N0RA 5TDOB 1BQGA 1I2QA 2W1NA 1CURA 1OANA 5I02A 5IIEA 2O6CA 4Z2KA 1SZEA 3QIUA 4B0MB 3BD5A 3ZE0E 1CXFA 4E8DA 4PRRA 2Z3FA 4LHUB 5FDWA 2VLKD 4ICCX 1CCWB 5E09A 3OZLA 1AVAA 1HEZB 3GD6A 3QH3B 1BFVL 1NQKA 3VJ6B 1UD8A 2ZUYA 5BRZA 3FUKA 5T1DH 3M46A 4F8QA 5I8CA 3L5LA 2KC0A 2X6UA 2YAFA 2DGAA 3EO0B 1U21A 2X9XA 1YHPA 2HSAA 2EXYC 2NY1B 3CU1A 3EGSA 2JK2A 2XGZA 1T89A 3MHGA 3D06A 1N0LB 5LKYA 1RLCL 2A6LA 3PWPD 2DQEL 4J3OH 2R56L 3NJGA 5INCB 1UZ1A 4XMLL 4PLKC 4I6KA 4Q4SA 1KC7A 4PJFB 3QNXA 4IJ3B 1JAKA 1NMCC 2WZIA 1EEXA 4U3CA 5IIEB 2CJ3A 4HIQA 5D7EA 1YEDB 1CGVA 5HYJD 2BNUA 2XTSA 2GK1B 4AUUA 2ASHA 1ACYH 3PPFA 2Q3AA 3UPMA 1UR0A 4KEUA 1IIHA 1A4KA 4HEME 3CDGA 4I3SH 4I3GA 1A5UA 2PCQA 2CIIA 4YDJB 3ATBA 5D1QA 5F0LB 4M5YL 4FHAA 3SDCA 4RRPA 1NFIB 4EXPX 4HPNA 3APCA 3U2SB 2DJLA 3WL0A 5IW1B 4I18B 2E76C 1TVNA 5BVJA 1QNVA 3QG6A 3JXAA 5DJYB 5GNZA 2APSA 3A6CL 2G2RB 4YHZH 1NBQA 3EH2A 2ADGB 4QO1B 1NWRA 4X7EC 3VCCA 4HUKB 4M7TA 3RYMA 3VFOA 3FS9A 2AS5M 4IRZH 3WAKA 2HN7A 2PYEE 4GW1A 4R9XA 4WU5A 2AEQH 5D2LE 5FKYA 2J7LA 4FFZH 4X4ZA 3UTQA 2YGVA 4DKFL 1ICPA 1R87A 1XPYA 3ULAB 1J5HA 3SE9L 1P1MA 4DWSD 4FG6C 4ZNEA 3DHJA 3BW9B 4FEIA 5D1ZC 5ABDE 3I10A 3RXZA 2WBXA 1OP9A 4N28A 4AD1A 1IBZA 5TD4A 4Y4HA 3ZDWA 3QJHA 3EYSL 3TAKA 4LAOA 3R11A 4EWND 4I8DA 4YFEA 3N44F 3PREA 1JF1B 4HXBL 3APGA 4QHKI 2XGIA 2KPNA 2G5RA 1Y5WA 3RCYA 2QUVA 4RRPG 4GC3A 5HI5D 4TU1A 4BQ9A 2BTMA 2BCKB 1E67A 4H25B 4Q6YA 2EXWD 1CLVA 1UA6H 5EU5B 1UZ8A 4GQRA 4CU8A 3KHOA 1IWBA 1X97A 4JY9A 5JOEA 1NARA 3TR9A 4IWWA 1FOBA 4CMHC 1E65A 3WFBH 2JIXA 1GZHC 3G5VB 1GMEA 3MGOA 5C09A 4FMKA 5D96C 5AOZA 3ITVA 1TQJA 4C6MA 5EO1B 5AHEA 1S7RA 1SPDA 1E0VA 1FBAA 5IM7B 2PB1A 3PRZA 4P05A 4R83A 4WJ5B 5GJTL 5GJSH 3MZNA 1ZLDA 4WKZA 6XIMA 1K5NB 4XVJH 1LNUA 1JI1A 4GJIA 4BM7A 3FTSA 4RVBA 4JTUA 3OPZL 3KP1A 4DXXA 1MJUL 4AQAB 5F3HA 2V5DA 3FFDA 4DRSA 3L4ZA 4KNSA 2CCRA 1UURA 3EYSH 1D5IL 3MRDA 3W39A 1VZWA 2GITA 4G5ZH 4JN7A 3I6RA 3QRHA 1F9CA 4O2FB 2RA1A 2WLIA 4K5MA 2NY7H 4ETQB 2E1WA 1JTPA 4R7DA 3SE9H 1GTNA 4HFWB 2NY0D 4Z0SA 1OAUH 3PNWA 1OO2A 1BZ7B 5D2LB 4XT1C 4MDJA 3CLFL 4KI5F 1HJUA 1A6VH 2V9TA 1UVQB 1NGWB 5EBWA 5IB5B 2RHGA 3FSZA 3L3DA 4JX5A 5CPOA 1M6UA 4JDVB 5E6SB 4JL1A 4K23L 1LQAA 3DKLA 3GC2A 1B0GA 3U2JA 2QR0B 4OD3L 1A9EA 2VLME 3G6AA 5LBVA 2OYPA 5A5WA 4JKKA 4EN3C 2DYPA 3QGKC 4LMQI 2O6EA 1PQZA 5HNNA 4JKLA 1QVOB 1FNEA 1IM3B 4NO0B 4FXKC 4E68A 1X5GA 2Y6TE 3MV9D 1HKFA 1UYWL 4NJGA 3CGTA 5M1TA 4HNCA 3MRQB 3U6RA 3U1SL 1KJ2H 2ICWJ 2A99A 2ENJA 3HRZC 1B90A 1ITCA 4BZ2H 4IF2A 4RW5A 1GGCL 2G3JA 3CAQA 1TE1A 3F7JA 2CWXA 4F0HA 2Y63A 5BXRA 2IOMA 3MLXL 1MJJB 4WZ9A 1Q72H 1X5JA 3ZRCC 3ZGIA 3ZMRA 4Q8VA 2J5LC 5IGXH 1P0EA 3DIPA 4IBQA 4UTBH 3DVGA 4BD4A 4YDMA 2O5YL 1EC9A 1L6XA 2W4XA 1H5BA 4M29A 4PGDA 5BMFH 2AL2B 3RHWK 4X63A 4TNWK 4E9YA 3GNDA 2B31A 5I1LB 2P8PA 4GKOA 2QCHA 2NX5E 4J2MA 1C16A 2IANA 2KAUC 3M1BB 4HJ0D 1K2DB 4B9YA 3CJJA 3SY0B 1LZOA 3S83A 4GZEA 3F4WA 4U1LB 1UC6A 2OZ4A 4ELMA 5HHOD 4U1MA 4DVRH 4EAEA 3PLYA 4G42A 4MRBA 4NRYB 4QEEA 3LQAH 4NXKA 3AALA 3GKWL 5H91A 2ADJB 4Z0JA 2VZSA 4LVGA 3DETC 1UD2A 2WOQA 4L8SA 1ZT4A 4B41A 4HOXA 1DR9A 1PSCA 3BZFB 5EDXA 3PB0A 4I2XB 3C2FA 4H26A 3CWOX 3WS6C 4YU1A 1UUNA 2ATKB 3FQWB 4KVCL 3FPXA 4FQCL 1NLBH 2E9JA 2YRLA 4XX1G 3ZZ1A 2JB6A 5JR1H 2PMZA 3QJAA 1HHKA 2YXMA 3MJ8B 2R1WB 1JPTL 1XIFA 5TQ2H 4DJDC 2GZXA 3JV6B 1ISVA 2CDFB 2X38A 3FOLB 4PJ5A 5DYOB 9XIAA 1JZDC 3C5XA 2OSXA 3CX5K 1V7NL 1MFEH 3URAA 1QA9B 3LEYH 3LPWA 3R7RA 1K7XA 1UWTA 1E1EA 4NDMB 5FECA 1BMWA 3LQAC 3WFZA 1DIDA 3VMNA 4BK5A 1ZANH 3MBEA 4IIGA 2HT3C 1XIIA 4GRLC 2PWUA 2VDML 3U4FA 3EX4A 2QQQA 3QNZB 5IMMB 2Z28A 4O17A 3WK1A 4LGPB 2ZJSH 1ZRQA 5C9ZA 1IJNA 1NCWL 1E0WA 2BY2A 1E6JH 3CIQA 1IKOP 2E77A 2PDQA 3N1MC 3S1GA 2P80A 4AY7A 4A2DA 4L37B 1U58A 3D2UA 4JGJA 4TRPL 4HX1B 3VSTA 1KMGA 5A8OA 3S9IA 3C5ZD 2FJHB 2F7PA 2QKIC 1LDCA 1TVBA 3D39A 1KY6A 1QUNA 3AG2B 4CNIA 3VACA 1DXIA 3DFQA 1H60A 4JTQA 3QQDB 5BRQA 2Y8VA 3PQYD 4Q8WA 1EDQA 3CXHJ 1PCSA 3T8MA 1ETA1 2AQ1A 4L6DA 1C8QA 2DLGA 1D2OA 4WTZA 1XIHA 2FWOB 1RU9L 1QRNA 4EVNB 1JTTA 5C7HA 4EP8C 3KBEA 2P5PA 1ZGLA 4S10A 1Q7QA 3VXMD 1YN7A 1B4JL 4FI6A 4PW3A 1BG4A 1ZDQA 1ISXA 1W3KA 2ITDB 5I17A 1I1CA 2A74B 2ZZ3A 4YXHL 3ROLA 5EC1B 1SF3A 4YDLB 2OTPA 4MZRA 4U0QB 5I28A 4OTKA 1XSOA 1ZQ5A 4WI3A 4TULH 1YMMD 1NCWH 4WXYA 3WXWH 1WDWA 3CUZA 4NI8A 2RUSA 3UVAA 5GRJL 5EBGA 3ARQA 2QQKH 1JGLL 1I0DA 3L9EA 2ZWKA 3AAZA 3IVUA 3WCZA 2EKJA 3CM4A 1U8OA 2WHKA 1JWMB 2FYVA 3D39D 4DKEL 2WNKA 2X2YA 2YQGA 3LNHA 5D6DA 5K9QI 3FQTB 4RDYA 5ESVA 1I9RL 2FSEA 1KXVC 3TQ0A 4TTDC 4MHHI 1KQZA 4WW2C 1R3LA 3SDYH 1A7RL 1YEKL 2EADA 5LXVA 3EGXA 2XI9A 2A3LA 4HG4K 4AZ5A 3AREB 4WIWA 3A9IA 3P11H 3MRJA 1BGGA 2GJJA 3N40F 2EPHA 5AC6A 4GI6A 4YTTA 3NCYP 3OX8B 4WHYH 2XFWA 4GHRA 3MOBH 1TZHB 2VE6B 4ZQKB 1OFDA 5GGTA 3W2DH 3MRPA 4BWTA 2F8XC 1HL8A 3AHTA 5BZWB 4M80A 4JPIB 1ZKAA 3CFCL 5MEPB 3OZPA 1F90L 5E8EB 1IILE 3LV5A 4KK6D 2WUCH 5KBKA 4O57A 3GLAA 5IBXA 5HD8D 5JVLA 3KLLA 4YWGL 3FSVA 3NPZB 4YSQA 4MXWH 1P5UC 3BRDA 1NFBA 4PN2A 5CJMA 5A8NA 4X9IA 2YDSA 3R0DA 4W9TA 1UM4L 1E9PA 2XH7A 4MPQA 2EDDA 4FG6D 2EDOA 3ZLGA 2P5WA 1ZAJA 2NX3A 2HQAA 5D9OA 1Y6NR 5CAHA 3BZ5A 3HLAB 1GY2A 3QO0B 4ZMAT 3DXAD 3BSZH 3OKOB 1SMOA 1KBIA 2AJ3A 3TZFA 3QQXA 4M51A 1NBYA 1P7TA 4XBEL 4POZC 4JR9H 1L6PA 4P2RB 5AFAA 3P62A 5LIXX 1NPNA 5CCHE 2E9WA 2X4QB 4G8GD 5JW5B 3GMLB 3W81A 4AB4A 1KLFB 1KR1A 3SPHA 3KE0A 3QT2A 1FRGL 3BZ4A 3ZU8A 4G9FD 2PGRA 4IPLA 1DEEB 3HZVA 2CHNA 2N01B 4AQ1C 5ES4B 4Y4KB 1WA1X 4U1HA 3ELQA 4Q7DA 4OZGE 2Z35A 2HPOA 2L4OA 4S1QH 1L9QA 1OKEA 1YEGH 2VUKA 4PQXA 4JN2B 4XAKE 4FGMA 3BOLA 4JQIL 2EDFA 2B0SL 4NJJA 5E94A 1I3RB 3VD3A 1T41A 2JE8A 5K69A 4K2UL 3NIDF 5FM5O 4FXTA 1TTJA 2QDDA 1XYCA 3N73A 4S1RH 5DEFB 4JZNA 2MKLC 3O6LH 3LN3A 4P2RD 1QHPA 4DZHA 3VQMA 2A9MH 4XVTL 2GY7B 4I5XA 1NBYB 3H8AA 3DV6B 5HHVH 3P9WB 3FA5A 5DHDA 1ET8A 4CMMA 1NSNH 3O3EB 2XH4A 4WY0B 1CBVH 3NJLA 5HGAB 1URIA 3QIBD 4X98B 3KMDA 1QO2A 3JWOH 2IAMD 4PB0L 2EG7A 4F2TA 5C0QA 5I77A 1EEZB 5T8GA 4JPQA 1GYVA 2CJSA 2CHRA 2IGLA 5EC2A 4Y4FC 1Q4WA 2J4WH 4LK4A 3H85A 2YOCA 1FGVH 3J2PA 1U4EA 3PWUA 4U1HB 1JXFA 4WJG3 1EEUA 1MUJB 1ZWIB 3HE7A 1RUAL 4ZPTB 5C7XL 1OOAA 4XUYA 3B0YA 1V02E 3CUGA 3SCMC 1DVFD 2NOYA 3QI9A 3ULVF 1QSEA 1HXJA 1HTYA 2D7NA 3WJYA 1DBJL 3HRZA 1EBGA 4F0RA 1EGJH 4XX5A 1GY1A 2GG1A 5DFVD 2LAGB 3VG9C 3VU2A 1IT8A 4AH2A 1OWQA 3HHSA 2HVJB 2HP4A 5CEXA 1D5RA 4YLQT 3WKQA 1V08A 3W24A 4B3ZA 4JM4L 3FQNA 3QI9B 4IEFA 1I1WA 3SO3B 5FKAB 5DRZA 1S7XB 3KM1A 4PEEA 3D05A 1KC5H 4KKCD 3ZT5A 4EN3A 2HBVA 3R8GA 1ONQA 2BIQA 3DURA 3SGKA 5D7KE 4OIBA 1L2UA 2BSEA 1FP8A 4M62L 3EXLA 4ZR8A 2OTDA 3GRBA 3PBGA 2NNAA 3N25A 3DBXA 5EPDA 2VM9A 4GQZA 4JFFB 4OF3A 1DVSA 5DJ2B 4XVTH 4QNPF 3T42A 5HJYA 32C2A 1NC4D 2IWFA 5JPMA 3A22A 4P3WA 2M2DA 1L2QA 4F0SA 4MS6A 3E6EA 1EVUA 2IALA 2X4TB 4AF0A 3CC1A 3WKML 4UFHA 4HZLA 2MCG1 2ZOWA 3MBXL 1F05A 4HBKA 2AXGA 2Y3AA 3INPA 4GPVA 3T2LA 2Y85A 1S2EA 4DWHA 3ZRSA 3V16A 2JH2A 3QCVH 2HE5A 3NEOA 4GW4A 4OZFA 5DJXB 5JXAL 4JN2A 1KNWA 4MD5A 4K7FB 5T3ZH 2VMJA 4XZUB 5B4MD 4HLZH 4XP9L 3CN0A 3LRHA 4L4LA 1JULA 1LWHA 1A4LA 4WKZB 3QXBA 3M0LA 2WYIA 3G3DA 5AYBA 4F37F 3FZUC 3WF2A 2VFFA 5I3HA 5CHNA 3PAUA 3P61A 5HULA 3F2CA 1CB2A 1EO8L 3PABB 5MEOA 1P4CA 2B4CL 2NZ1A 2W80C 3QCTL 4FXJA 3U7VA 4ZUWA 3SB3A 3BCDA 4TOQA 3KPPA 5IHUL 3PTDA 2BVOB 1F13A 4PMEA 3PWPE 3T6WA 3S9DB 1SRDA 2L7EA 2XFGB 4FD0A 4UMBA 3P3UA 4DO6A 5IEHB 5BMXA 2HT4C 5ELIA 5GGRA 5CBAA 3PPGA 1KDIA 1BG9A 2ACSA 3WFDH 3I6GB 3P4OB 1YEIH 3MUHL 3AS0A 4MAYA 2WC3A 4NKMB 1NWOA 2QCDB 2J73A 4EI5A 4KNQA 3JTTB 4LH8A 3EH4B 3OZKA 2J1ZA 15C8H 2ZG2A 1RUMH 4FE9A 4DCQB 2ZZ7A 4ZB0A 4PTTB 2JIXD 2H0EA 1Z44A 5EB9A 2AGJH 5AVTB 1GOQA 4A04A 3M1ZA 2R14A 2Y5TB 2FR4A 2VLKE 3MRFB 4YFDB 4P2OD 1EF2A 3KDNA 5I6OA 4KUZL 4AC2A 4AGMA 3ETBJ 2XJ7A 2W9DH 3V6ZA 5HYFA 4B6ZA 3BWUC 4LDLB 3ZDXE 3F7LA 3FUMA 1DVJA 2CUAA 4GIPD 1IHIA 2HV5A 2YA0A 2A5UA 1OSZB 1PLGH 3THML 4V27A 4Y9PA 4KI5D 4LHUD 3T1WA 3OAWA 1ZBKA 2A3EA 5C2CA 4YTSA 2G5BA 3ETBF 3FFSA 4FX7A 2WXDM 3VXPA 4QJ5B 1RBAA 4B97A 4O0QA 4S3JA 3FCGA 1JCXA 3NPXA 3QM3A 2VLJB 3ZUCA 5LXXA 4MDOA 4KJWD 4MD0A 2H26A 4AVJA 4U5IA 5TAOA 2ICWI 2CLRA 4RGMB 4BWUA 1OLZA 1TRDA 4EF9A 3NA8A 5I3GA 1T40A 2E28A 5AHNA 3G6MA 2KUTA 4NNCA 3KXFA 4I9XA 3LZ3A 1YSOA 3NK4A 1XBYA 3TW9A 3RWHA 3K0WA 4RMRA 4Y9AA 5F1IB 3GJFB 1D7KA 1UP3A 2GQAA 2NQJA 5IW3A 1F6AB 1XRSA 1XYMA 3KLAA 1U8LA 2ZZ2A 1D5XB 3OU8A 4DM1A 1V0MA 3H12A 1ISYA 5C0IA 2Z00A 3ETSA 3UTTA 3EAUA 4UT9H 4MNQE 4IOSD 5EY5A 3UBXA 1EK3A 4G9DB 3VWJD 3QIUD 2WD0A 4IQHA 2VM8A 1U1JA 4L4OA 2Y7LA 3TPKA 2DVXA 1OGAA 3BQUC 4NSKB 4HUVA 3ARZA 3H9SE 3IMRA 3OF6D 1KTNA 4I3RH 2F54D 1ZLEA 4YDVA 4GSUA 3TLQA 4KKPA 3U4AA 4MCZA 1QTYT 2A83B 5DO2D 1T22A 3JYBA 4HGWA 3QZNA 4M1DH 5T5FH 1EA0A 4D0BB 2OCCB 6REQB 4ACYA 4WI7A 2DQDL 2BSDA 3DSFH 4AV4A 4JFHE 2Y1HA 1A6WH 3ABKB 1HXKA 4JQ2A 3ES7A 4C1NB 2KPWA 4GUGA 2G2NA 3QAZC 2B59B 1QPRA 3PUCA 2A7RA 1E8WA 3P4NA 1M4KA 4W9CC 4FLOA 4XPAL 5JXEA 2X10A 2HFFA 1H1YA 4KMQA 1F00I 1UWRA 2FTPA 1X6NA 3AWGA 3FCTA 5LB1A 4M43L 2HKFL 5IBLC 2D9CA 1HJVA 4FNTA 2WBJB 5JW4Q 2RH9A 3BWUF 1RK5A 1EXGA 4WV1C 4JD4A 1C5DA 2YD4A 2Q6WB 1GC1C 3JV4A 3Q1EA 3NZSA 3WJMA 5LNEA 5L2JB 3J8F7 2Q76A 3WAJA 4N1HB 5D1QD 4IPIA 2F54A 5E8OB 4H7VA 3IBOA 4JMXA 3RKDD 1UZHA 3KBSA 1HOCB 4BUHA 2WGXA 1YNTB 3L13A 4ETYA 1BOYA 1MQ8A 5CMAA 1RJYB 2CPCA 3C8KA 4MQ7B 4A7VA 2YCIX 1S7RB 5CPLA 3FO0L 4B9JA 2QGYA 4LIQL 4JJHA 4HXAL 4NQEA 4FOMA 2Z4GA 1H0IA 2PDUA 2VEMA 5DRWA 2VDQH 4E2OA 1YPIA 3CK0H 2WXOA 1A8JH 3PWPA 4H20H 1Z7AA 1UZ8B 5E8NA 4FNLH 4Q4KA 5AYYA 3NFUA 2WZ0A 2GWGA 3N06B 3SBQA 3HS8A 5I8KL 1JN6A 1FCGA 3RVVC 1EFQA 2A9BA 2WKOF 3B2MA 1SYSA 3K2GA 3CH8A 3MACL 3O7UA 4XBGB 3S97C 4DEPB 3PUGA 3W82A 4IUGA 2NTFA 3WDJA 5LN8A 3D47A 1EV2E 4G8AC 1I9IH 2HX9A 1I7UA 4Z5RB 2ZX6A 2C0AA 4HXBH 2DS4A 3CLWA 3SYPA 4JNZA 4O50A 5C6TH 1VZGA 3Q65A 4GXVH 4XVSL 4ESKA 1SLXA 1NPJA 2AKRA 2B39A 4NRXA 5FM4A 2VNCA 3VRJA 4QRQA 5JPNC 3NK3A 1QTWA 3EMCA 5FEPA 3WD0A 1UVQA 1CVRA 3SKUD 4LEOA 1TU2B 3DK2A 4OLYH 3W9DB 1TVHB 6PTDA 3O6YX 1Q72L 1HJBC 1FLRL 3QQNA 4R8WL 4DBUA 4JMNA 4HMCA 1S9KC 4WO4D 4CSZA 2E3ZA 4NG3A 2CHWA 3IRZA 3O8AA 2EQDA 4NUWA 4WW2A 3SGEI 2HTKC 3EGXB 4KO5A 5F9WB 3TBTA 4BZ2A 3QDMB 4PRPA 1QBMH 2EDMA 3BP4B 3WIFB 4DAFA 5I0ZA 2R0ZL 3ESUF 4NT0A 5AD0B 1CECA 3E2QA 5IB1A 5HHPB 4OOUA 5ABGA 5FWRA 3HC0A 4ORGA 4M6QA 1OCWH 4PUJA 3W73A 3IM1A 3KGUA 2EZ0D 2ZUXA 3GDCA 2BVWA 3TEWA 1DJZA 3S4SG 4GGBA 2CITA 3LM3A 1JPMA 4AVFA 1QP1A 3NIGB 4KKXA 4RNFA 3LZQA 2WLMA 4CNPA 4JCMA 4NYUA 2UXFA 1X6UA 5J12C 5IB1B 2B7NA 5CP7A 3SN4A 3L65A 2X4UA 4R7JA 4YE4H 5PTDA 3FTXA 2H7WA 2NYZA 1JZ4A 1TV4A 4FQXC 1RY0A 2F6KA 4Y7EA 1R3RA 1SEQH 3O4LA 4OLYL 1TPFA 5LGXA 1PD1A 1KCWA 1FV1A 1EXHA 1LOSA 2A2IA 3LHYA 2H90A 4QLKA 5EORL 2WZ6A 3MGTB 3GDRA 4UFJA 5HR7A 1JZGA 1CFQA 1GHFL 2O9TA 2VSDA 1OQFA 1JVOA 1ZLWH 4CADA 3H9SA 4OJCA 1VHNA 5ABHA 1IAKB 3O9WC 4J1UB 3KYKH 5AYZA 2VKWA 2ZDRA 3TEVA 3DJSA 4HYRA 1QD0A 1E72M 3SQMA 1HEZA 5M94B 4X5WB 2EKCA 4M8QB 4MD5B 5T3ZE 2AEWA 4OI9A 2FD6H 5FKPB 1MCSA 1RMFL 1X5IA 2FQDA 2QSTA 5MEND 1EJVC 5KBLA 2DQUH 4O14A 4RXGA 4L1LA 1RL1A 2RACA 5MHSE 1A4MA 4HHHA 1E3FA 4KRLB 1XR2A 4P61A 4HWBL 3C5SA 4OFVA 3APNA 3HE6B 3SKMA 5C71A 5F7HA 2BDNL 1AFVH 5H8UA 2E74C 2V5KA 1Y7VA 1BLIA 1F6PA 3SCOA 4NT6B 3QV6A 5FGCE 2MNWA 2OI9C 1XGRB 1HDMB 4HJ0C 2XA3A 4LRNL 3RTQB 4ZMYA 2YO3A 4UR9A 3UETA 3H1ZA 4K3JL 4A55A 1GCFA 3NDZA 1YYMH 4LVHC 4S1DD 2X2HA 1FDZA 4G1EA 1W72B 1UEYA 2NVAA 1G9NL 5SWQB 2VXTH 2HSIA 1EUNA 2YEQA 1BOGB 1DBAH 1MVUA 1ZEAH 2PI6A 2Y0FA 4WY0A 1KB3A 2J7BA 4I9JA 3QUGA 5I6PA 2F54E 3LKQA 2PF6A 3TO4B 2HTLC 2OJEA 2WXRA 3WIHH 4F58H 2XIQA 1ZT1A 5KSWA 4LDOB 2E9LA 1E51A 4XD6A 5ALCH 4K7VA 3VIHA 4ML4A 3LQLA 1DQQB 1EDYA 1XIWB 1RZ7L 2P42B 4A7TA 6FABH 2Z92A 3LN4A 4I0PD 4E42A 4HJTA 3FJLA 3HURA 2BVDA 3G1HA 4P2OB 1ZT4B 4Z2GA 2VDQB 4PG9B 3TBTB 3F5WA 4J6RL 1OAKL 3TWCH 3VD5A 1B4EA 2V3GA 3OPSA 5DURD 3THUA 1D7FA 3NCCB 1XCXA 3VFOB 5E6IB 4ABUA 2A0NA 5D7SL 2QJGA 3GRIA 5F7EL 2NLIA 2VYOA 4H4IA 1HHGA 1JD9A 3BG3A 2WBJD 4BQCA 2WJDA 2P9RA 1PF3A 5IV2B 1IGJB 1L5GA 3IDXL 1E70M 5BUPA 4JQ4A 4ORMA 5IUCA 4MNJA 5ABFA 1PKQB 1Y18A 2ZWSA 3RY6C 1W8OA 4X6DB 1YIXA 4NN5C 2ZJSL 3DOSA 4KBPA 2AK1L 1K4CB 2A5HA 4LY8A 5I78A 5C07D 1G01A 1J9CT 3MMWA 3GXTA 3S42A 1E2WA 2J88L 4HIIA 2CBPA 5CCJA 4RPPA 5CWSB 5BQ7A 2J8FA 3F83A 1EWEA 4HTBA 2CK0H 4E9TA 1JPDX 1QO5A 2P5WE 1XGEA 2AGKA 4CEXC 1OIMA 3BOVA 4XN1A 3RWDA 1JZ7A 4JFHD 1OAUL 4D6GA 3QNXB 1WCGA 4Z1AA 1JF5A 5TK2A 4PRID 4JFZH 4XXDA 4ZBJA 3LH2H 1E2ZA 3VFUB 1S7SA 3EPNA 1Z9PA 4WWKA 1E6JL 4WHDA 4PJ6A 1K85A 4QHMB 1X1ZA 4X9HA 4IXXA 2ID5A 2VXTL 4XI5D 3TWCL 4CVXB 4H04A 4Y8FA 3I50H 1CE6B 3U0HA 3V5CA 2X4SA 4GRWF 4WHTA 5FA3A 1UM4H 3CX5J 4RE2A 5G2IA 3P9MA 3BEWB 1WV7T 2KL6A 4UIKL 4Z7VA 1RCQA 3FONB 1YMYA 2DTMH 2FLRT 3PBMA 3XIMA 3W6YA 3DA0A 1LP9F 2XLLA 4X60A 2PTZA 2PLCA 3RGVD 4QRUB 1QG3A 2R1LA 3G18A 1XIEA 3EKLA 3HB9A 4H2AA 4ATTA 1JDDA 1H8LA 4QRRB 3WV0A 1A1MB 3ZL1A 4HETA 3WFHB 1TWDA 4PB3A 1TT6A 3CG8A 4OM1H 4QD2E 1G7QB 3S2MA 3V18A 5A6MA 3ARFB 3N40P 4TUKL 3UWEA 3EKCA 3VXMA 2ITCA 3QUKB 3FYIB 4LVEA 1NOWA 1O6IA 2WXNA 3OTRA 3EBHA 1H8OA 3A3XA 1WZAA 5F9AC 3TYCA 5D8JL 5CU9A 4L3CB 2FX8H 1O6SB 3IJHB 1BXCA 3P7YA 4WGVB 2XISA 1NC4A 4CD7A 3EWCA 4A7SA 4YHML 3CIWA 4HA1A 5DO8A 1G9NC 1WKDA 2YSTA 4QSHA 1K6QH 2YB1A 4WKAA 1X6LA 2XPKA 2FO4B 4OGYH 5C1MB 1XCFA 1REIA 3STBA 1K5NA 3VIMA 1DUYB 3S35X 2HJFA 2AABH 3CN4A 4ZPVA 1G1OA 1PIIA 2ZOKA 1JPGB 1BLNA 1Z9NA 2A1WL 1QRNB 2D0HA 2OTUA 2X3CA 2PO6D 1N59A 3RPDA 4D9QD 2ZP9A 2YD8A 4KV5F 2NW2A 5AWNL 3HIJA 1RZFH 5C09B 5JDSA 2CESA 3TR2A 3HAEG 5FGBA 3I85A 2X4NB 1POKA 5JO5A 2YDRA 3LXBA 3TBYB 3PAJA 1DUYA 5IQNA 3RY5A 4Z42C 4JRWA 5KWYC 4NZ3A 1EJXC 4MWFB 3BDYH 4XP6L 4LT7A 3PUUA 4PVLA 2VEGA 4HT3A 2F8OA 3DDMA 2HMCA 3LLFA 3HU7A 3TTEA 1L9MA 2IDTA 4J6RH 2XKSA 5F7BA 3UZJA 1E4HA 1XB3A 3RE0A 5D4JA 1WCBB 4Y4FB 4GXUN 1J5OL 1H3PH 1V8HA 1OW0C 1SDAB 2R4RH 3MV8D 4NQTA 5EOCL 3F6IA 3R13A 1G5AA 2D73A 4XD3A 3EJCA 1J0ZA 4QS5A 3B0UX 4M56A 4CRPA 1EJSC 5BV7H 3DYPA 4QP0A 2AJUH 4IKNA 1CTNA 5BPPA 3JVAA 1DDHB 1SXZA 3ISWA 4FQXB 3WFAA 1UBSA 5C08E 4TSCH 2E9MA 1MFDL 1FKXA 3M7FB 5D8JH 1E6SM 2XRAH 3RWJA 3UBXG 2EXYD 3STGA 3N0PB 3TC7A 5KN5A 5L4FA 5C0DB 5CZ0A 2BNQD 3KW3A 9PCYA 3MRIA 2VZTA 1B1YA 2VOTA 5G5DA 4G6JH 3HAEA 4GRWB 4PWEA 1Q45A 2IPWA 4N9CA 4NKDB 1P7HL 4M62H 4LASH 3M5YA 1G7IA 1YNPA 4AQLA 3ZKMD 3QS3A 3N6JA 3B9AA 3K6FA 4BFEA 2YRBA 4K8GA 5FYKE 1BZ8A 5DFVC 1F2XK 4J2PA 25C8H 2HVMA 4WR3A 1RK7A 4JRYD 3ZO0A 3AHVA 2OMVB 4PP2B 4Q9RH 2QVKA 3IWPA 2DW6A 3I4KA 5M03A 5IJVA 1TFVA 3P54A 3KLQA 1JXJA 3FUFA 3IDJA 1O9VA 3QXWA 4IQEA 4HCIA 4XVOA 1YEFH 3DHDA 3HHSB 1MFAH 3PDOB 4P5RA 3NJVA 3M44A 5ENLA 2EG6A 3Q2LA 5DVNA 4KHXL 2F7FA 4F8TA 2OLAA 4U3XA 2FWOA 4NC1E 3QMSA 1AXTH 1NCCH 3B0VC 3TFCA 1AO7B 5CCZA 3BOXA 4JPKH 1TNNA 5ILTL 5JMRA 2RKXA 3B8UA 3ZT7A 1U2CA 4HKXA 4Z78A 5I71B 5C0RL 3W1NA 3TZVA 1S7TA 3FU3A 3DROA 3ARBB 3KWSA 5L8KB 2OAAA 4GS7C 5EC2B 5DHVA 4LYRA 2DMKA 2F1BA 4M8UA 4OZGB 1ONRA 4NL1A 4MCNA 3NGFA 3OSVA 1WWCA 1LORA 2Y36L 5A7BA 4URIA 5DJZB 5MP6H 2YEZB 4C5YA 1BRLB 1AGCA 5T8IA 4K55A 3CXHK 1G7HA 3LRKA 4X4ME 5JQHC 1NIDA 4WEBL 1MPAL 1J9TA 3WKYA 3VOJA 4ILDA 4JZJA 3C2VA 1KIUA 3GMRA 1XD1A 3F2LA 3GBLA 3MRGB 3EUUA 1IBDA 1SO3A 1W5QA 3NQ7A 12E8H 2X2IA 4MDRA 3P84A 3DOSB 4TRPH 2UWEE 1GC1L 2DIBA 4G1EB 5H4ZA 4Q9QL 3DTXB 1LBFA 4Q7NA 4WGHA 1FA2A 5T26A 2CU9A 4RL3A 3OKNB 1D6VH 1A3RL 4AG4L 2P45B 1RLDA 4POZD 4BHUI 3NM3A 4OT7A 3VOGA 4C65A 3KNBB 2K0RA 2PU0A 3NQ6A 5J1SC 4LVAA 1QUPA 2VTFA 4MXVF 3LYEA 3SDDB 3ZDYF 4ZQCA 5FF4A 1IE4A 4JR9L 1UOLA 1KTDB 3LKPB 4QGTA 4TNFA 2QUTA 4F5CA 4ONHA 5C0JA 1SR9A 2PDIA 2V2CA 3TCEA 5AC8A 4HVXA 2YD5A 3BO9A 3ZVIA 1MHPH 3EOLA 2AQOA 2VXSL 2V5RA 4A3YA 1TR1A 3IB4A 3EW3B 4HIXL 4AVHA 2EDWA 2QGBA 1M2OA 1N4XL 4RETB 4QHMA 2Z29A 3E5PA 5G1YA 2DWSA 3RJXA 3DESA 1HQRA 4UV7L 3ZE2F 3QC3A 5FIPA 5CC5A 1A7OH 4B60A 1RI8A 4GY4A 4H1LA 2CR6A 1CDIA 1OGAE 2M1KA 4Q8BA 5GS0L 1DYSA 4IX2A 4AWEA 1WHOA 3JTTA 3U57A 3Q8FA 3BCFA 5GGVH 2PPAA 5BXFA 1WXJA 5GRYA 1B2WL 1HFUA 4FB7A 1UXWA 2HWZL 4XP4L 3F5LA 4Z1BA 2ZX8A 4LYKA 2OLDA 4NZTL 1U5HA 4KTGA 4N1CA 1TJ1A 3Q1SH 3ECWA 2ATMA 1HF6A 4L1TA 4QEHA 2OXHA 3GZKA 4JRYB 4J3SA 4MVBC 2CMRH 4FNPA 2K6WA 3C8HA 1A7RH 4NZFA 4PCKA 2AGJL 4LU5H 5IFHH 1BXAA 1J88A 2VDKB 4OZIF 1HHIA 5HDRA 2H2PD 3ZDYE 2V5JA 4PJAF 4BH7A 1A5OC 4JDYA 2OZNA 4QTGA 4Q8NA 2YXFA 3IJEA 3VXUE 1YEIL 5CSGA 4S3BA 1UD5A 3CPLA 4Q9RL 1MHPL 3AMKA 1D3CA 1Z0NA 3I74A 3B7RL 4YBQC 4NZRH 1FV1B 3AWEA 5G4NA 3BUQA 2X1WL 1CGSL 1PG7W 1EP2A 4O52A 1CGTA 3GHSA 4OIIL 3VXNA 1U3HA 2QADC 1QFUH 3GI8H 4OCSL 1H7PA 2AVFA 1A4CA 2FBJH 2FO1A 5LA0A 1UPMB 2ZXQA 4P23B 4K68A 2DEPA 1KGJA 3G5EA 2P10A 1NIFA 4WNQA 1E8YA 5E2VH 4GRMB 3LDBB 1AOZA 1J6OA 1F2JA 3OXRB 1F8IA 1FXPA 1BWLA 3DBPA 1MUWA 4Y90A 4PJ8B 3BVJA 4FA3A 4K5PA 4NC0B 3OLDA 1V8EA 3UROR 1N4XH 4F7TA 3JSSA 1TSHA 1E9IA 1SM9A 2W6RA 3HS0C 1P2CB 4LEXH 4QIRA 4UUJA 2O55A 4PUKA 3FTUA 5B8CC 3NVTA 5DXYA 4S1QL 5E4AA 4JVPA 3TKFA 4FIRA 2Z93A 2J79A 4WKXA 1KPUB 1GQJA 1PMYA 1VFBB 3OKEB 1YN6B 2VCOA 3O11A 2Q8AH 1JAEA 1AGBA 1EQWA 4PBDA 3RLSA 3S2CA 2DQXA 5DMJB 3L48A 4N90E 2DWDA 3N4FA 3PF2A 1T0NB 5J6SA 2ODHA 2FK9A 1BFTA 1UUSA 1MKFA 3DXAA 3MYJB 1G67A 1LXMA 1W32A 2CYGA 1EZVX 4C6LA 2J6EL 3MX0A 3VI2A 4XBMA 5K1NA 3KLHD 3MRHA 5C09D 4G3YL 5AC7A 4AUBA 1FYHB 43CAB 3ULUC 3WHE1 3G7TA 2ORBH 3SQBA 1JNHB 3OQRA 5HPMB 4X4XA 1JZ8A 4MJJA 5DJAA 3WUWB 2VFIA 4JHMA 3WBWA 3AQXA 4M00A 2IG2H 3CFTA 1Q94B 2E0PA 4RMVA 3B0PA 5DTFB 3ALPA 2IQ0A 4QRBA 2G60H 3LLDA 3KOFA 2HUHA 1M7DA 3QJVB 5GSVB 4NAEA 2XN9A 4GY1A 5DMGC 4H1LB 4WCJA 3RWCA 2WK2A 4Z7OE 7REQB 4UT9A 3RTQD 5FJJA 2DQTL 4JAWA 3AU0A 2VLRD 2FO8A 3QWNA 4M5SA 5IT2L 4E4UA 2Q86A 4HUWA 4PRPE 4RGOH 2B3RA 3PWGA 5DQ9B 1L8PA 5MKGB 1SVCP 1UXWB 2V5SA 3P93A 4NQEB 1RK0B 4WWNA 3E38A 4O1DA 2R0WH 2WKOA 2PP7A 3IS0X 4R4ND 1MHEA 4XKYB 4H8WL 1I1AB 4PMOA 4FN0A 5CZTA 1RUAH 1FL3B 2DI8A 2FQEA 2YMTA 4N20A 1U30A 4BZYA 5C7XH 4MY9A 4G43A 1AE6L 1OFQA 3P2BA 3AUJA 4CDHA 2OSLA 3AQDA 1F58H 3QC5X 1OTTC 2W38A 3RHWF 1N8IA 3A67H 3H0TB 4R5VA 1Z48A 2OMTB 1H0DA 2ZUTA 3VH8G 4POCA 5LXEA 3CSPA 1W1VA 4C1NA 1GOXA 3SCPA 1YNKL 4BIKA 4A6YA 1IZKA 3BZGA 4GX8A 4IG2A 4LANA 5JBEA 3O8XD 3ZDXF 4PTUB 5KSAA 3PANA 1BF8A 5AFDA 3PWNA 3G24A 2GVJA 3BGJA 3LQGA 4K9EC 5CGQA 2QHRL 5FV1L 4D1IA 1WV2A 4RLDA 2FVNA 2F8IA 1H2JA 1RQBA 1X7QB 3CU7A 3AJXA 3WLPA 1CD1A 2VLMD 3APFA 3L1GA 3QXDA 1N8FA 4QROA 4ZTXA 3ARBC 4NC1C 1CYXA 2JSFA 4YE4L 1ZLUK 3HS0A 1BEUA 2GL5A 5EKYA 2IG2L 1O7VA 4ES9A 4O1CA 2WZPA 2POTA 4TVDA 1MREL 5DHVB 1X98A 3C5ZA 2ZWYA 3IF1B 1XDMA 3GRWL 1QYGH 3UA3A 1HYRC 2GYIA 3EOTL 1W17A 2EAWA 4KCUA 5L2KA 5C7ZA 1BF5A 3NTYA 3LB6C 2R29L 2EPOA 4R85A 43C9A 1SJAA 5I3IA 4WF7A 1HX0A 5ADPH 1X38A 1AZRA 4PMFA 3U0WL 3CHOA 5F1OB 1V5XA 3RAJL 3M4HA 4HJWA 1FORH 4M6NL 3PWPB 1BHGA 4YHIA 3V36A 1BWVA 2VGLM 3PDOA 3WYRA 2X4PB 3S2JA 4ZGYA 1FAIL 5I0WA 2ZKYA 4PJGB 3DO7A 3RGHA 2PCXA 3KLSA 1N19A 2MHAA 2CA4A 3HZKB 3OVQA 2FUTA 1TQUA 3T3PB 3UW6A 2AV1B 1YY8A 1TZOA 1KCZA 1Q9KB 5HAOA 3PJTA 4PGDB 2HK1A 1JPFA 4G7YH 1R33A 1Q1JL 3AU1B 3QPYA 5EMKA 3BFWA 4RDVA 4DAIA 1TPB1 3N91A 5JPNA 3M88A 4ODSH 1OB0A 3MV9E 1TB3A 4BE5A 4MSWA 3KGRA 5DD0H 1F6YA 3GB6A 1BWWA 2FJGB 3BYTA 3JV0A 4WDIB 3OVPA 4LRSA 2FECI 1QTSA 2G75B 3LHPH 1BZOA 2DF3A 2R7EA 4N9GB 4YHNA 3GB7B 2F7OA 5EA0L 5GGUB 4IIQA 3VDCA 2FQIA 3SM0A 1WRFA 3ARFC 4M3HA 3VYPA 3LRMA 4P48A 1GZJA 4OGQC 3EB2A 2WVVB 3OGCA 4FA6A 2NY3C 3NSXA 5C0AD 4PMVA 5G1MA 2ENPA 3DBSA 3WIHL 4EJ1C 4LJ3A 2XFXA 2VC7A 3ZSSA 4U0RC 4YSCA 2DVUA 1NMAL 2YA2A 4Y2DC 3GK8H 3SZKC 1N5YH 2ICES 1ECZA 5IJCC 4HNNA 5EZIH 3FW6A 4W6XB 2NV9A 2OSLB 2VMCA 4MMZB 2VM3A 1FFQA 4AV5A 1C92A 4MJZA 3FTGA 3GSNA 2F38A 3ECQA 4W9DC 3WMQA 3WENA 2F6UA 3JTSB 4QR7A 3H26A 3N11A 4J40A 4FABL 2X4OA 5EMLA 4TVCA 5DD1H 5B1CA 4AE1A 5IF0A 4JO2L 2PF8A 2L04A 5JIDA 1JYXA 4GX9A 4GI8A 2ZYHA 1G4RA 1HN1A 2E4TA 2LGNA 4LLQB 3LHPL 1X7FA 3FJ4A 3GUGA 3WJZA 2QCFA 2CCLA 4DP2X 3GSNL 3K8LA 4ZXBD 3U9IA 5AOIA 5DF0A 5AVXB 2Z92B 3LN4B 4GUCA 5E51A 4E42B 2WNGA 5DR5L 5CZKA 3C12A 3F7RA 3K91A 4X7SL 1XF0A 4AD5A 3ARXA 1ITUA 1SJEA 2I60H 4ASTA 3ZT6A 4LX4A 1IC5H 4LS0A 4U5KA 3WUBA 3U82B 3W1AA 2WW5A 3U79A 4NYYA 4X8XA 3L4TA 3MJGX 3TCXA 3A23A 1SZNA 4Z9KB 1OSYA 4JO1H 4OTXL 4PR5A 5LVEA 1INQB 5J6HA 1L6SA 4UZUA 2X0SA 1AZ2A 3UC2A 3A6CH 1A3LL 3DO3A 1G0YR 2Y1ZA 4XR8C 4QDWA 1FBIH 1NGQL 4DXKA 3TZNA 4A6GA 5AB1A 4PI2A 1CZ1A 4HFUH 5A8GA 1KGCE 1PDKB 2XPGB 2C4FU 3RWFB 4K1GA 4U28A 1K3IA 1MAML 3VD1A 1O0VA 1UXMA 2CJTA 3EFOA 4F9PA 2CWRA 2VJ8A 3U7YH 1FHDA 4P7OA 2ICEB 3R4IA 3R18A 1WIPA 1IAMA 43CAA 3GHBL 4HOZA 4MCMA 4LTSA 2UZ9A 1KGXA 2ISSA 1WPCA 4CVXA 1OPGH 4TVPH 5GRVL 1PKNA 3QTGA 5CPTA 1NWTA 2B0MA 3H56A 4P8QA 5CG7A 2ED6A 3B2DC 1KXVA 1UXSB 2YJLA 4MQXC 2KBGA 2J72A 3ULUE 4ZUVA 2WQWA 4JFSA 3MSDA 3R12A 4Z1PA 3RVWC 4LKXB 3WH7A 2H0FA 4W6WB 4FQIL 4NUGL 4IMAA 3MV7A 2BZCA 2RGMA 5DBUA 5AW0B 4MMXB 2G2RA 5JHBA 2R9HC 2YLHA 1ZCCA 1ONWA 3C61A 2ICSA 2I60L 2WKGA 4J4PC 3TBVA 3W7JA 4MA8H 4RQQB 4UTHA 2EDBA 2CLVA 4YUEH 5ESQB 2V37A 3QEUA 3IE9A 4U33A 2YC1A 3T0AA 2ACRA 4KEZA 4XNUL 3VFSA 4HU3A 3SD2A 1VC4A 5I1JH 4FNLL 1T1YA 4AM0Q 3W22A 4ANXA 5E5CA 4HISA 2FIQA 3VJ6A 3FVDA 3IETB 1UH3A 2V3DA 3QORC 4M7KL 3BW9A 5GGSY 2EDKA 2XZ9A 5T1DL 1WA2X 4H13C 3NQ8A 1BJ1H 2GAZA 4ONGL 5TF1H 1M6OA 2FFIA 3R4RA 2ZUNA 2VFHA 3SRHA 4H0HB 1S9VA 4PLJC 5C08A 3QZLA 4E9RA 2DLIA 2YD0A 5INCA 1CFNA 1RZ8B 1MCNA 4R90H 1BREA 2YQ3A 3DOHA 4NNXA 5BS0A 4QITA 3FX4A 3APDA 2YMXL 4N2YA 3UJFA 2XN0A 1CFVL 2Y7QB 4NUGH 3G22A 3NP3A 4I9TA 4WEVX 3MROA 4JFYA 2XH2A 3DGRA 3IACA 4Y2OA 5I1GH 5TE4H 3LV6A 4GAAA 4MOZA 1VADB 2BERA 4L8BA 1WZKA 2D3JA 4B91A 2JQMA 3WXVH 2BPBA 5EBLA 3ULUD 1MFDH 4FNUA 4R6UA 1M7OA 5DC0A 1WUZA 2PW2B 2WVTA 3KLHC 3CBKB 3AABA 3FQRB 1HQTA 3USBA 5MHBA 3BJLA 1S7QA 2QCNA 3S3CB 3DU0A 3MSRA 4NENA 5GSRB 5BVPL 1U36A 1GOKA 3CWNA 5JXED 1MCFA 2BVUA 2DL9A 2NY1D 2AJXL 4CJ0A 2VI0A 5EBLB 2YD9A 3BANA 2CW6A 1PFCA 4AHOA 4OHQA 1FDYA 3GXUB 2D8KA 3W7GA 1QNRA 2I5QA 1FH9A 2E4FA 4HQQL 5DFAA 1PYMA 5HNUA 4AQAA 1TPH1 3WD2A 3ZIZA 2Y1YA 5D93C 4EKJA 3VH8A 4IU3B 4H5SB 4R2GD 1FBIL 1NGQH 4AYSA 4Z3GA 4K8HA 4W7UA 2X5PA 3SSJA 3RITA 3QRFM 4XPGH 3NEHA 3BZ4B 3D33A 1ZOXA 3VFPA 3IS1X 4GQQA 4HD5A 4ICNA 4XAKD 2N0KA 4KV5E 1DQWA 3M47A 1A66A 2CCVA 3EYFB 1I3UA 3IJSA 3TV3L