1QI4A

Mutant (e219g) maltotetraose-forming exo-amylase in complex with maltotetraose
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
418
structure length
418
Chain Sequence
b'DQAGKSPNAVRYHGGDEIILQGFHWNVVREAPNDWYNILRQQAATIAADGFSAIWMPVPWRDFSSWSDGSKSGGGEGYFWHDFNKNGRYGSDAQLRQAASALGGAGVKVLYDVVPNHMNRGYPDKEINLPAGQGFWRNDCADPGNYPNDCDDGDRFIGGDADLNTGHPQVYGMFRDEFTNLRSQYGAGGFRFDFVRGYAPERVNSWMTDSADNSFCVGGLWKGPSEYPNWDWRNTASWQQIIKDWSDRAKCPVFDFALKERMQNGSIADWKHGLNGNPDPRWREVAVTFVDNHDTGYSPGQNGGQHHWALQDGLIRQAYAYILTSPGTPVVYWDHMYDWGYGDFIRQLIQVRRAAGVRADSAISFHSGYSGLVATVSGSQQTLVVALNSDLGNPGQVASGSFSEAVNASNGQVRVWRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (EXO-MALTOTETRAOHYDROLASE)
publication title Roles of catalytic residues in alpha-amylases as evidenced by the structures of the product-complexed mutants of a maltotetraose-forming amylase.
pubmed doi rcsb
source organism Pseudomonas stutzeri
molecule tags Hydrolase
total genus 148
structure length 418
sequence length 418
ec nomenclature ec 3.2.1.60: Glucan 1,4-alpha-maltotetraohydrolase.
pdb deposition date 1999-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09081 DUF1921 Domain of unknown function (DUF1921)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1qi4A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1qi4A01
1WO2A 3WDIA 4HU8A 2WK2A 3IGUA 4Z2HA 4J3WA 4AZ5A 4D1JA 4UZUA 4AZBA 3AS2A 3LXCA 4GQRA 5GQBA 1GOOA 4P7NA 1V08A 4AXNA 3U7BA 1E5JA 3VIMA 4E4PA 1AQ0A 3BCFA 1V3KA 1V03A 4ATDA 4FF5A 1HXJA 3WY3A 4ZE4A 1QNPA 1UR8A 1LL4A 1NP2A 4XZBA 3CO4A 3AZRA 4OIFA 5JBFA 1W9BM 4KRTA 5CPQA 2WLZA 4D1IA 3CLWA 3N13A 4AD2A 2FDMA 2W66A 1QHPA 1FA2A 3W0KA 1MW1A 3GXPA 1M03A 1Y7VA 2DH2A 2UY4A 2DSUA 4HOXA 3L4ZA 3WH8A 3WH5A 2WBKA 3I3EA 5E0CA 4MNKA 1GONA 5A95A 2BVDA 3AZTA 1HJQA 2XJ7A 1KXHA 1J0HA 1CPUA 1BGGA 1G0CA 4XZWA 3T0BA 3VKKA 2ZWZA 3WUGA 1JFHA 1GZJA 2G4FA 1DP0A 5EFFA 3SURA 1A47A 2YDQA 1W9VA 4DWSB 4TVCA 1EHAA 1XSJA 3A6OA 3CUJA 1XCWA 1E6ZA 3CBWA 3SCUA 3QHNA 4LX4A 1VRXA 1CXKA 1VEPA 4R5EA 4B3LA 1LG1A 3S2CA 3PBGA 3MV11 5I77A 2VX6A 2JEPA 1TVPA 3K46A 5KZ6A 3CUHA 1PX8A 2VNCA 1ISVA 2IUZA 2Y8VA 3O9NA 2TAAA 5BYWA 3VX0A 2YL8A 3K1DA 2JF7A 3BH4A 3WQWA 3KL5A 2VX5A 3O2LA 2YFOA 4UQCA 2ZUMA 4ZEPA 2UWFA 3WQ6A 2PWFA 1TA3A 4MB4A 4EK7A 3HG4A 1OT2A 4OOZA 4RE4A 5I23A 1CGWA 1JIBA 1MYRA 1QI2A 2VO5A 2CKSA 2OW6A 3WUEA 2E4TA 3TV8A 2X0HA 2FGZA 1JXKA 5C70A 1WB0A 1HT6A 3A5VA 1HJUA 3CUFA 2BXYA 1UHVA 1GOMA 4QAWA 3WDRA 2C7FA 3VINA 2VR5A 1EOMA 1C3FA 3A47A 2DIEA 3VILA 2WBGA 5D9PA 2WZEA 3NDZA 1BGAA 1QHOA 4AMXA 2VCBA 3U7VA 2XN0A 3DX4A 1LL7A 8A3HA 5DT5A 2W92A 3OLEA 2OSXA 1W9PA 4MJ2A 3LXAA 1OM0A 4U31A 2WPGA 2D2OA 5I6SA 2FHCA 2XVLA 3J7HA 2F8QA 4ZE5A 3B8SA 4PCSA 2W4XA 4QLLA 4E2OA 4JKMA 3WF1A 3A24A 1CBGA 4E8DA 5ECUA 4AD3A 5E09A 3WNNA 3NDYA 4GINA 1MFVA 1DWIM 1ZS2A 1OGSA 1B3YA 2BV9A 3UERA 1E6PA 3VUPA 1CXFA 4FNRA 4D6EA 4CD6A 2EADA 4H7VA 4D6HA 4EE9A 2BY0A 3D4ZA 2X0YA 1HJWA 1VEMA 5IFPA 3CZGA 2XM1A 4P7RA 4MB1A 3PTKA 1UD4A 4ZXLA 1U2YA 1WDPA 4P8UA 4HOZA 4GZEA 1EA9C 3FAXA 4B3KA 1TG7A 1B31A 3MV01 3DC0A 5BRQA 1C92A 2YBTA 5A8PA 3CMJA 1V6UA 1FP8A 2BY1A 2XFRA 2CBJA 5HPOA 3ALFA 1GHSA 1CTNA 2EPNA 2E9MA 1R75A 3HZ3A 1ITXA 5A8OA 3MU7A 3LMYA 1JI1A 4NX0A 1VEOA 4F9JA 1CGTA 3AHTA 4CKQA 3BGAA 1LG2A 1WZLA 4KWUA 4OOUA 3VIFA 3SCOA 1VAHA 3BLKA 1E6NA 2J7EA 1IT0A 2PWEA 3BLPX 4D6JA 1SMAA 1TQUA 3NSMA 4F8XA 4QCEA 1KGUA 4GKLA 1WE5A 3A4WA 4QFUA 1SZNA 1LWHA 1E4MM 1W1VA 4MDOA 1NWRA 3S5ZA 2DPEA 2OLHA 4HTYA 2Y8KA 2DSZA 1HWWA 1V3LA 4A4AA 3VIGA 3DHUA 3EDDA 3HG3A 2XVGA 3ZSSA 4B9YA 3UG5A 1QWNA 1MQPA 1VJSA 4IM4A 3VDCA 2ZWYA 3GXTA 1V02A 2YA2A 4OJYA 2GUYA 3MKKA 1M01A 1E15A 1IV8A 5I0DA 3W27A 2DT3A 2PC8A 2OSYA 1UD5A 1VFUA 4UTFA 1QNOA 3WL0A 2CNCA 1E6QM 1TA3B 4V28A 3AXIA 1E6XM 4U2ZA 4P8VA 1HVQA 1UD8A 1E9LA 2DEPA 1UYQA 1GORA 1NWUA 3D51A 3WY1A 3GNPA 2Y2WA 5CGTA 3AIWA 1H1NA 2E3ZA 3VD4A 3BVTA 1JI2A 5CSYA 1O7AA 3CHDA 2WZIA 3UCQA 4V27A 3BSGA 4C7GA 3THCA 3ARSA 1XCXA 2G3MA 3TTQA 5A2AA 4X9YA 2VJXA 2O9PA 2D3NA 4PEEA 3SIMA 2VUYA 3ZM8A 1QI3A 1V02E 2ZE0A 2XSBA 3A4AA 2UY5A 2XG9A 1NWSA 2JIWA 1OIMA 3VMPA 4UQDA 2V5CA 5A6JA 3ARPA 1BF2A 3QR3A 2WZHA 2J78A 2Z1SA 1W1TA 2XWDA 2AMGA 2V3DA 2WAGA 1B90A 5GNXA 1CXIA 1RPKA 2X2JA 2YOCA 5CZKA 4U3AA 4LGXA 1UR1A 4PUEA 1F4HA 4H8VA 4PBGA 3BVUA 4CVUA 3AZSA 4CU7A 4UQ9A 2PB1A 5A6LA 1ZBVA 2E9LA 4KH2A 1OCQA 4D6DA 1PIGA 1OGGA 1BSIA 1DWGM 3KLKA 4BCEA 1E55A 2OW7A 2VVSA 2D20A 4U5KA 3SCVA 3W26A 3VSTA 4BZYA 3PZIA 3S6TA 4HPHA 3WMBA 1OD0A 3ZT6A 1XD1A 1DEDA 4WF7A 2A3BA 3H55A 3OBAA 1BQCA 4CD8A 4IPNB 1PAMA 4AYGA 1CXLA 3ZJ8A 4M8UA 3KLLA 2EPOA 1XRVA 3BUIA 3FXYA 3H53A 1AVAA 2VC9A 2WMFA 3BSHA 1XHGA 1J10A 3SCQA 1JDCA 1B3VA 1HF6A 4JFVA 3WQ4A 1ZBWA 3NYDA 3ZR5A 4PTWA 4UQEA 3SCTA 3GZAA 4MNLA 4JL2A 2WMKA 2D23A 2W67A 3EJPA 4J3SA 3ARVA 2ZOXA 4NXKA 2CHOA 1EDGA 1KGWA 3VMNA 4DO6A 2CKRA 4AZGA 2WYSA 3CZJA 4QLKA 1K9DA 1HIZA 2DDXA 2VTFA 4MTVA 1R46A 1TQSA 2XWEA 4FLOA 3WENA 2D22A 3W25A 2J7GA 1JXJA 1PBGA 1ISXA 1CLVA 1UD2A 2ZUWA 3NIYA 1QI4A 4W88A 5BXRA 1BAGA 5A6BD 3CZNA 4XB3A 1E0WA 3UR8A 4XUYA 2OWXA 3ZQ9A 5CXPA 5HPCA 1QPKA 3PHAA 4M82A 2J8FA 4JFUA 1KQYA 2WB5A 1GQIA 3EDFA 4AD4A 1JZ6A 2XFFA 3BAXA 5AC5A 3WD2A 1KGXA 4JHZA 4U3CA 3PZGA 3DYOA 1ZJAA 4PYSA 3WDQA 2UY2A 3HG5A 4CCDA 3DX0A 4S3JA 4BF7A 1ZL1A 3S5YA 4NRSA 3ZIZA 1UH2A 1CWYA 3SUUA 4FNQA 2VL4A 2OYKA 2XHYA 1RP9A 3U57A 1LF1A 3AOFA 1JZ2A 3VIPA 3CMGA 4HOWA 2FH6A 1ZBCA 1OBAA 3ZMRA 4H2CA 1HJSA 2ZX8A 4UR9A 3QGVA 2ESCA 1GHRA 1V3HA 5D9OA 1QBBA 1LWJA 1PPIA 1UG6A 2VZUA 1O6IA 1VB9A 1B0IA 3M6DA 3TTSA 3W4RA 2ZX9A 3EJUA 1I1XA 4HMCA 1CIUA 1NQ6A 5M5DA 4CN6A 2EJ1A 4WLCA 1FH8A 1JFXA 4LPCA 2G3NA 2GJXA 1N82A 2WM0A 1HL8A 3K8KA 3BLBA 1KXVA 4PMVA 4AW7A 5D8ZA 2WHMA 3SUSA 1J12A 4AZCA 1UD6A 3KL3A 2XGIA 5GNZA 4J27A 3POCA 1CGVA 5A3HA 2W91A 1C8QA 1QNSA 3AMDA 4DUXA 3UESA 3WNOA 3QHOA 3GH5A 2QPUA 4PMOA 1VFFA 1YQ2A 2JALA 2UY3A 1TZ7A 4W8LA 2WVVA 4D71A 1EDTA 3VOCA 2FE0A 1XYFA 2EABA 3ARXA 3AISA 3ZSTA 3VGGA 1UUQA 5FOOA 5BRPA 1MVYA 5LA0A 1G5AA 3A23A 1EO7A 2DSWA 2EO7A 1V0NA 3SCPA 1W32A 1LJYA 4WIWA 5ABHA 5TD4A 4EANA 2J79A 1E40A 4MDPA 1W3KA 3AQUA 3OIHA 3BAJA 4JCMA 1HJVA 3ARUA 3WD3A 1AMYA 1RD6A 2WMJA 3MUAA 2CIPA 2GFTA 1ODZA 3EJSA 1VJZA 3CHCA 2CITA 2CXGA 1CXEA 3DHPA 1C7TA 1K9TA 2ZUTA 1UWUA 1JZ7A 1W9XA 1QI0A 2NT0A 2QMKA 1GW1A 4JKLA 1WZMA 2WMHA 2PWHA 6TAAA 2BXZA 3G6MA 3DDGA 5A94A 1SMDA 4Z2JA 4H41A 5E1QA 1E6SM 3L2LA 3HJEA 2WKGA 1PX4A 3M7SA 1Q6DA 1V6YA 3AYRA 2WNWA 1GQJA 4Z2GA 2E8ZA 2J47A 2PWGA 1SYTA 5C71A 2DH3A 2ZUSA 2J62A 3FAWA 1BYCA 1NH6A 3FHAA 4FLSA 3VGHA 1DWJM 3HU7A 1WKYA 4ZENA 1O7DC 3W81A 8CGTA 3AI0A 1QNRA 3WF3A 3WNLA 3IAPA 1D7FA 2W62A 2ZXQA 3EJRA 3WELA 3ARTA 3APGA 2G41A 3VD3A 3SCNA 2CPUA 4NSBA 1QVBA 2W5FA 4HMEA 3WIJA 3DX2A 3L4TA 1E43A 4AZHA 3T2QA 3BAYA 4UFJA 2OWCA 2RGMA 2VURA 2ZIDA 1WDRA 1V6VA 4URIA 1Q6GA 4AIUA 1VBUA 4WKAA 2OSWA 3EBVA 2EPLX 4OGZA 2VQUA 2EACA 3BAWA 3AICA 3LRMA 3AFBA 5IFTA 5LA2A 4IPLA 5D9NA 1E3ZA 1WCGA 4RL3A 3TTYA 3THDA 1OWQA 3VM7A 4BA0A 4HA4A 3MSGA 4FNUA 1L8NA 3RM9A 2XSAA 2X2YA 1UD3A 4PTXA 1FFQA 1HXKA 4PMDA 1W3LA 3NJ3A 2BHUA 1NARA 4BQ5A 2D3LA 5I24A 3AS3A 4JFSA 4P8WA 1B2YA 3M46A 3SUWA 5CG0A 4PMQA 1Q4NX 4W84A 1W3HA 1TUXA 3AJ7A 2D24A 2YFNA 3DDFA 3BMWA 4PTMA 4LQ1A 4ATWA 2F1BA 4BQ4A 2VX7A 3BVXA 1H0IA 2CETA 1HL9A 1RH9A 1B1YA 3ARRA 1JNEA 3KE0A 4W8AA 2V3GA 4UQAA 5BXPA 3U5YA 2FYVA 3WEZA 1KQZA 4AIEA 2XVPA 4UFMA 3U5UA 5A6SA 2GK1B 1WDQA 3VGDA 3AIBA 3ALGA 3RIKA 1VFOA 4JZ5A 5A6AA 1UKQA 1BG9A 1V6XA 1V3IA 2J4GA 3GNRA 2CBIA 1J11A 1R87A 3UR7A 3UEQA 3RM4A 3IANA 3D50A 5CLWA 3OZOA 1CGUA 3WD4A 1ITCA 3BUQA 1H41A 4X0VA 4PN2A 2X09A 5CGMA 4AD1A 2J7CA 3QOKA 2JF6A 3PZOA 4J3XA 2F61A 3VNZA 5M3WA 1JZ5A 1XSKA 3MSDA 3AIEA 4KMQA 1UZ1A 3EMQA 2YLLA 3ARWA 3SCWA 1UR0A 1KWGA 4HZ6A 1MQRA 3T0DA 1H5VA 3WDHA 4AY1A 4P7LA 5HXMA 3WD1A 2ZXDA 3ARZA 3G6LA 3OZPA 5I79A 4UCFA 1B9ZA 1OT1A 5IXEA 4DO5A 2BHYA 4K68A 1G94A 4M56A 3F5JA 2GJRA 2F7RA 4PMRA 1G9HA 1AQHA 2ZUNA 3CZ8A 2ZX7A 1H11A 5DEZA 3D4YA 1UH3A 3BVVA 5EFDA 1EQCA 1NWTA 2J75A 3PZUA 5BCAA 2YA1A 4OBRA 2YL9A 3AXXA 2O92A 2BHZA 4LYRA 3T2OA 1KR1A 1K6AA 1ZJBA 1R34A 1PJ9A 3GDBA 1E0VA 2D0FA 3VIJA 1B3WA 5CQ1A 1H0GA 3EDKA 5BXTA 3RJYA 5ABFA 2WKLA 5AYIA 4CD4A 2WLYA 3W6MA 1J01A 3CZLA 2FHBA 1B3XA 3VGFA 4YHEA 2IGTA 1E4IA 1UWQA 4YN5A 4AD0A 2VZSA 1XH0A 1R86A 5IHSA 2WANA 2WCAA 4W87A 1FOBA 3WD0A 4GI8A 4GI9A 1UWSA 2D73A 4A3YA 4JFTA 2Z1KA 4TTUA 1JD7A 3WY2A 3GH4A 4TXEA 2WHKA 4W7UA 1VENA 4XX6A 1R85A 1SFSA 1V6WA 4GZIA 4OBSA 1GOIA 2O9OA 4EAMA 2WC3A 3CUIA 5AY7A 3RDKA 2PWDA 3EDEA 7CGTA 2XVKA 2W61A 4IUGA 3AMKA 2DIJA 1J0IA 3A21A 4UFLA 1E5NA 1K9EA 3B9DA 2MANA 3W29A 1JG9A 1QHZA 3KZSA 3K8MA 1BLIA 3ZJ6A 3L4XA 1KWKA 2VT0A 3PZTA 4GZJA 3N11A 2Y4SA 2WVUA 1PZ3A 3WN6A 4M1RA 1E4LA 3RCNA 2VRKA 3MS8A 1XV8A 3MMUA 4W86A 3VD7A 4R27A 2YKKA 1BYBA 1WZAA 3N1AA 4D6IA 3GBDA 1HNYA 3L4VA 1ISZA 2DSVA 3WNPA 4TUFA 3AIQA 4J3UA 2WVTA 1G01A 3GM8A 2RGLA 1GQKA 3GXDA 1PEZA 3CHEA 4HMDA 2VZOA 1GVYA 5HOSA 3A22A 6CGTA 1NOUA 3L4YA 3AMCA 2X2HA 3TOPA 4GIAA 4CGTA 4RE2A 1VBRA 3K4AA 3WQ8A 1JGIA 4F66A 1UWIA 1FH7A 4L4PA 4HPGA 3HG2A 2V3FA 3AYSA 4RE3A 2E9BA 4AISA 1W91A 1R33A 1LQ0A 2J7DA 3AMLA 1NOWA 1J0KA 3DX3A 3L4UA 1C7SA 4CU6A 2YBUA 4AYSA 4M29A 4QLJA 1EIBA 4P8XA 3AIUA 3OA5A 5CSUA 2F18A 2YL6A 4HZ8A 3MO4A 3F5LA 5FD0A 1JNDA 3N18A 4BQ3A 3VGBA 3GXNA 2PBOA 7TAAA 3I3DA 2XM2A 4YPJA 1X1NA 1HX0A 3W82A 4DM2A 3VM5A 1EQPA 3OGRA 4AMCA 3WH9A 2XGBA 3FW6A 4FLRA 1CEOA 2F1AA 1H49A 3MMDA 1TQVA 1HKMA 3VIKA 3LPOA 1TR1A 4J3VA 4UFKA 1UR9A 2Q8XA 5D4YA 2CERA 1HTYA 1US3A 3PZQA 3DX1A 3CV5A 1JAKA 1HKIA 2WHJA 3CZSA 3OG2A 2PF0A 5CLTA 3WF2A 5JIPA 1EOKA 2PBGA 4DWSA 1E6RA 4JCLA 4FNTA 2VZTA 3ZT5A 4MNMA 3LRLA 2X1IA 1B30A 4W5ZA 1KFWA 1G1YA 2BVTA 3SUVA 1CGXA 1UQYA 1UQZA 1FHLA 1HKKA 4HP5A 3AIRA 3OLGA 1GOKA 1TQTA 4MB5A 5I3DA 4ZFMA 3H54A 3AHXA 2J7FA 4TOQA 1C91A 1XH2A 2VRJA 2ZXAA 3VSUA 4WKFA 3W37A 1BVNP 4PMXA 5FL1A 3CC1A 2G8ZA 1QW8A 3WEOA 1V3JA 2J7BA 4HU0A 4M81A 1JAEA 5DMYA 3KWXA 1GVIA 3WNKA 1J0JA 1ZB5A 2E8YA 1GUVA 3WQVA 3WMCA 4PCTA 1JL8A 1H3GA 1E4NA 1BYDA 3W28A 5CPTA 1M53A 4AZIA 2IXUA 4MB3A 1R47A 1E1EA 1J0YA 4CN4A 1MW3A 2XN2A 3PZNA 2YJQA 1T0OA 2C8NA 1ESWA 3D5HA 3WF0A 4ACZA 3MUZ1 1CXHA 3MANA 1XH1A 5A6MA 2WW5A 1W9UA 4Q22A 4A3HA 2O9TA 3N04A 1XSIA 1LL6A 4CCCA 1D2KA 2A3HA 1E0XA 3BUPA 1UR4A 1X6LA 5A8NA 3VD5A 2QMJA 3ZOAA 3WKZA 1JYXA 4WJXA 1J0ZA 1OD8A 3VX1A 2BNJA 4BQ2A 1VIWA 4HA3A 5E9AA 1JZ4A 1WP6A 2XFYA 3VD9A 1V0LA 5DT7A 4NZFA 1C8YA 3BCDA 1JF5A 5LYRA 1W9DM 4NXSA 1KXTA 4DUWA 1UZ4A 2XUCA 3PZMA 5A6KA 2Y24A 4W7WA 2WSKA 3OGVA 3HN3A 1KCLA 3QOMA 3VSVA 2FGLA 2WWDA 4CCEA 2YL5A 1UKSA 3W24A 2EEXA 3NSXA 3WBAA 4UZSA 1UA7A 1FFRA 1E3XA 4MADA 2AAAA 4DWSC 2EBNA 2OYLA 1VFMA 4DUVA 5JUVA 3SCRA 4V2XA 3K4DA 4CU8A 3F5KA 4QDMA 1XGZA 1CENA 3AMGA 2F7QA 2VR4A 1L0PA 4JKKA 1NM9A 2HISA 5CPSA 3TTOA 5ABEA 4EKJA 1US2A 3AHZA 4TVDA 1E1FA 2ZXBA 1E71M 1QOXA 1XD0A 4GO8A 2E0PA 4HZ7A 4S3KA 4E8CA 4JL1A 3WBEA 5BWFA 1X6NA 1EHNA 4W89A 1ZU8A 3AS0A 2WMIA 3NUKA 4D6FA 1I75A 2ZX5A 1GJUA 4KGJA 1WPCA 5AYBA 4WK9A 3HMCA 4DM1A 1KCKA 2WC7A 1ZBKA 3CUGA 1TVNA 1HKJA 2CBVA 1U33A 2X05A 4CUCA 4B9ZA 4GO9A 2GJXB 2QHAA 2BVYA 1CNVA 1GOWA 2E40A 5HBFA 3A4XA 1GPFA 1GQLA 4C7DA 3ZJKA 4FNPA 5BROA 4KRUA 1I1WA 3WUBA 1AQMA 4AZCB 2VVNA 3T08A 1IZJA 1EXPA 1JDAA 4FLQA 4L4OA 4D6CA 4W7VA 4F79A 4FMVA 5DFAA 3T09A 4MAZA 2DT2A 2C0HA 3B9AA 1H4PA 2DQXA 4PUDA 4PSRA 5E70A 2VCCA 2WVVB 2QV4A 2FH8A 2J77A 4QCFA 1DHKA 1KXQA 4W93A 4UOQA 2D0HA 1R7AA 3RPMA 1UWRA 3LXBA 1KTCA 2YDSA 3WQ5A 2JE8A 1WNOA 4GQQA 3A3HA 3RILA 4AZ7A 3WDJA 1D3CA 4ACZB 4N42A 2CYGA 1V0MA 4AMWA 2BY3A 5FIPA 4X0NA 2F7PA 1U30A 1JD9A 3LRKA 1ISYA 2WHLA 1TCMA 5BXSA 4D6GA 5D8WA 4N0RA 4AEEA 2X8RA 4ML4A 4PMUA 4NI3A 1ISWA 3BVWA 2D1ZA 3VIOA 1PS3A 3OB8A 4ACYA 2WSPA 4MNJA 3WMSA 1P6WA 3OLIA 2YDRA 3MUY1 4U33A 2A3CA 3D52A 3WUFA 2XIBA 2WCGA 4U5IA 4B16A 2EXOA 3GXMA 4WSJA 4ATLA 2J7HA 2ZICA 3K8LA 1EO5A 4LXFA 5A2CA 3AIVA 3I3BA 3VDHA 3EYPA 1HJXA 4J28A 4AZ6A 3CZKA 4DO4A 4AC1X 4P7QA 5I78A 2CCRA 2VOTA 1UOKA 2G3IA 3N9KA 1C8XA 2OWWA 4Q7NA 1PX3A 3ZR6A 2JFEX 3PN8A 1C93A 4TTGA 3VO0A 5I5RA 3RMEA 1V3MA 1DWHM 4AD5A 4J3TA 3LPGA 3PTMA 3WFLA 1FH9A 5JBDA 4MJ4A 3D3AA 3CZEA 5GPRA 1E72M 3T2PA 4F9DA 1TE1A 3AROA 2PI6A 3UG3A 5FL0A 3AXHA 5A2BA 1KTBA 1HN1A 3GYCA 2WMGA 1QNQA 4TVUA 2W63A 2EPKX 1RP8A 3POHA 1Z32X 4LYQA 3VGEA 2Y5EA 5LA1A 1XC6A 3FHQA 1W2PA 5E0FA 6A3HA 1UASA 1NP0A 4NRRA 2WMIB 1Q6CA 1GOQA 3IAQA 3L2MA 1K9FA 3CPUA 3ECQA 2F7OA 3WNMA 1W1YA 4NF7A 3RM8A 5A8QA 4GPNA 4AEFA 5HDRA 1BHGA 3CHFA 3F4VA 1QX1A 1HP4A 4UFHA 3KL0A 4TX6A 1WAWA 3VNYA 3W53A 4NZCA 1HVXA 1TQWA 1BFNA 5D9MA 1MWOA 4Z2LA 4U2YA 2CHNA 2EAEA 3NCOA 5E6YA 3FNDA 4Z2IA 4OZOA 3EMCA 3GXFA 3RJXA 4UOZA 4P7OA 2BS9A 1YHTA 3JUGA 5M03A 2FHFA 5I2UA 2F2HA 3WFZA 1EGZA 2CESA 3B9EA 2EQDA 2ZX6A 2NW0A 4PTVA 1IZKA 1MFUA 3ZO9A 1V0KA 1BPLB 2AOSA 2DGAA 1CLXA 2B31A 3OLDA 3ZT7A 2ZUUA 2V5DA 1JZ3A 1NOFA 1SR0A 3DYPA 2GVYA 3BUDA 1CGYA 2DSKA 1BVZA 2NSXA 1QBAA 2DT1A 3FY1A 1CDGA 4DWSD 2YA0A 3LPPA 2QPSA 2J25A 3N12A 1BG4A 1KR0A 1DWAM 2WVSA 2GSJA 2QF8A 1J9YA 3EDJA 1W3JA 3IK2A 3T0AA 1FHDA 2D0GA 4M80A 2WXDM 1J18A 5DF0A 1QI5A 1QW9A 4HA1A 4UNIA 3ARQA 4MAVA 4H8HA 4JFWA 5F7UA 2BFGA 3CGTA 4UQBA 3UG4A 1LLOA 2CEQA 1WDSA 1ODUA 3WF4A 1QWUA 1TMQA 1H2JA 3CH9A 1R7OA 2V3EA 2WWCA 3VPLA 5JBEA 1JYNA 4W5UA 1CECA 1E73M 3EMZA 3DYMA 3N17A 5IHRA 3GTNA 4CN1A 2GDUA 1XYZA 3EJQA 2JIEA 3WSUA 2YLAA 4OUEA 3N15A 2VMFA 7A3HA 3MI6A 5FCZA 3ZJ7A 1PIFA 3VMOA 1UR2A 1UKTA 2EPMX 3II1A 5A69A 5A1AA 4PMZA 3ARYA 3CTTA 1UWTA 4CD5A 2VI0A 5HNNA 1TFVA 2XPKA 3W6LA 2NT1A 3EJTA 1JF6A 1Q6FA 1KBKA 2V38A 1MW0A 3SCSA 3BMVA 4FNSA 2HVMA 2J8GA 3TP4A 1OB0A 3VVGA 1Q6EA 3VIHA 3GNOA 2BY2A 3E1F1 4UFIA 2XVNA 3DECA 5A8MA 5AC4A 2GJPA 3MUIA 4GXPA 5ABFB 1F4AA 5GNYA 5IDIA 5E6ZA 1MXGA 4Z2KA 4WKHA 3BC9A 4PSPA 1C90A 4LYPA 2ALWA 4PRWA 4Y7EA 2X2IA 1FP9A 4PMYA 4UOJA 3SUTA 3VU2A 1UKPA 3LX9A 2A3EA 1W1PA 5EBAA 4D72A 1E56A 4GI6A 1R8LA 1BYAA 4H04A 2VCAA 5ABGA 1BTCA 3TONA 5JIWA 3GXIA 4NZJA 3RO8A 3VTRA 4JIEA 1JZ8A 3PTQA 9CGTA 1UH4A 3W38A 1A3HA 2VRQA 3IJ8A 3NSNA 1MXDA 2IXVA 3VDBA 1EDQA 3PZVA 3M07A 3AHYA 3PZ9A 3UETA 1JYWA 1M7XA 4JAWA 2A3AA 1OGBA 1S46A 2JEQA 2WC4A 3SEPA 4C7FA 2VX4A 1GCYA 4W8BA 5KEZA 5M17A 4ZXOA 2XN1A 3AS1A 2XYLA 5FKYA 2QLYA 3WH7A 3WL1A 3LPFA 1M04A 4OKDA 4WSKA 1OINA 1UKOA 5C8BB 4TX8A 2DT0A 1GJWA 5DO8A 3MMWA 3BAIA 3WEMA 3O6AA 5EB8A 2ZUVA 2VQTA 4KGLA 3QHMA 1E70M 3OGSA 3CIVA 5EMYA 4J7RA 2GDVA 3L4WA 4M24A 1OIFA 3FN9A 5CJ5A 4YHGA 2G3JA 3GH7A 1JDDA 1KB3A 2YIHA 4W85A 1KBBA 4IISA 1W2VA 4H8UA 1OSEA 2VZVA 4MPKA 1GNXA 4CVWA 3VDAA 3WH6A 4QP0A 4XV0A 2O9RA 2OYMA 1H09A 3VIIA 1WZKA 1DWFM 2XTKA 3AHVA 1EH9A 3IJ7A 4BS0A 2CBUA 3BUBA 4AWEA 1CZ1A 3WDPP 2J74A 4PMNA 3BXWA 3IJ9A 4AIOA 4CD7A 1UA3A 1VF8A 3GBEA 3BAKA 1MQQA 3KEHA 2XIIA 1HP5A 5A6BA 3TA9A 3WY4A 4B15A 1DTUA 1B3ZA 1PZ2A 1MW2A 4JHOA 4FK9A 1ECEA 1CYGA 2GK1A 1JYVA 2WCSA
chains in the Genus database with same CATH superfamily
4RJEA 4G3YH 1CFNB 1UB5B 1G9EA 1F11B 3TT1L 3VIMA 2QT6A 4G1EB 3O3BB 1O5PA 3TA3C 1V03A 1FCCA 1HXJA 5F2FA 1CYXA 4Z7VE 1DCLA 4WEVX 3FUDA 4P2OD 4XVOA 1EFZA 3TCTA 4OTXL 4DQOH 2CNZA 2I60L 4XP6L 3STEA 3SGGA 3EYUL 3FT1A 2GQ8A 4UOW1 1KC7A 5KW9L 4OCRL 5F1SA 2WBKA 1GONA 2Z0IA 3US1A 3HG0A 5IM7B 4XPGL 4JFEA 1U9KA 5JPNA 4DX3A 1SMOA 1BBDH 5AB1A 1JRHL 1DO6A 1OGTA 5T91A 2ATKB 4J3OD 5FF0A 1WD8A 4KY2A 2TAAA 2Y5TB 4OQTA 3VXQA 4AEHL 5REQA 2YB4A 4Z3FA 3MOAL 5I3HA 1VFHA 4H20L 2JBMA 5DQPA 1BVLB 4KRNA 2ZPKH 1MYRA 1FL6B 2UY7A 1XYLA 4NG3A 1KV5A 1AGFA 3FT3A 3V5DB 3NOIA 4XO5A 3QDMD 1IIGA 3IEAA 2VCBA 1N0XL 3ALPA 3E96A 3LZNA 2QUMA 5ID0A 5F4SA 1HIMH 1HI6A 43CAA 3PUUA 1MRCL 1KEML 5C0JB 4XMLH 4CSZA 4AY0A 1OGSA 1K6WA 5F7YC 5AZ1A 3VUPA 1UZHA 5CILH 4OV6F 1TTCA 4DBDA 4N0YH 2X0YA 3AG3B 1FRGH 4Y4HA 4QRPB 4P7RA 3HM7A 3K1KC 2PW1B 1CLCA 4KVNH 5ISZD 1FGVH 1A8JH 5IB2A 1A3LH 2H41A 5DLML 1KY6A 5A8OA 2L7QA 4NX0A 4JE4B 2OZ0A 3SJVA 1ETB1 3LMJH 1MWAL 1K5NB 2A85A 4BFKA 2BRRH 5C9JB 3TYAA 3T4YB 4UNKA 2PUQT 4EP8C 2YLHA 1LK2B 3IPBA 2ON3A 2POTA 4IIBA 5IW6B 4HSOA 1AJ7H 1XUUA 2VDOH 2XQBL 4D2NA 4HG4K 4LCIL 2QELA 3O7UA 2DQCH 4OZHA 1H6UA 3S4SB 2HVKA 1NJ9A 1KB9J 4HK0A 2V8MA 1UPMB 5CJ8A 2P76A 2JKTM 3IRDA 1WEJH 2PTXA 1UPPA 1WSST 2Q86A 2L7UA 3KPSB 3MLRH 5U7SA 2BP0A 3TJLA 1QI3A 2YOAA 3BP6B 1TEFA 2ZE0A 2X10A 3Q9PA 2Y7GA 1Q1JL 4K5MA 2VH5H 1ADQH 3JUYA 5JDSB 4G8GB 3SKJL 2J21A 2IPJA 4O1DA 2AMGA 5EU6E 4RR4A 3EZ8A 4Y4HC 4BFJA 1XL6A 2P49B 1SYSB 2ZAHA 2CBTA 1BSIA 5AALA 1E55A 3V36A 2GFBA 1KTDB 1WCQA 5AW0B 3W26A 4ICCX 4PJ7A 3RMJA 2YCKX 4UT6H 5CAKA 3SYQA 1MO0A 2RBLA 3B8VA 4LIQH 3B6SA 1FN4A 4AYGA 4O1BA 5EG6C 4FULA 4DNMA 5LCVL 3RKDD 1J96A 2FZBA 1ZDQA 1MCHA 3HHRB 3WQ4A 3P0WA 3ZR5A 2YQBA 2ZQ0A 4LMQE 4R53A 2CE6A 4JL2A 4XCEB 3S88L 3NCWA 2PDCA 1SVBA 4K7VA 1EDGA 1P6CA 4AIXA 3LK6A 2HFFB 1IEBB 4JYDA 2XWEA 4FIQA 1UD2A 2WJ5A 4ECLA 2CDGA 3NH7H 4GW4A 1GZHA 1XF2A 4XAFA 2BOBB 4ZUVA 2PDWA 1OARH 2MQ3A 1LO3H 2C7UB 2R1KA 5C0BE 4GAYA 5JW5A 1R5WA 4AD4A 1J93A 5I6NA 3Q2NA 4K55A 4PYSA 4YBQD 1KTKE 3KPTA 5I1EL 5AOKA 4HB7A 1FGNH 5DURB 3HPAA 3NCJL 1EHXA 1Q1PA 5D32A 3PJSB 4H2CA 1YN6A 4PULA 2XJKA 1C08A 5D9OA 2Z64C 1YYML 1O6IA 5JA8B 2X28A 5F71A 3W4RA 1I1XA 1MAML 5C0FB 4OLZH 4Q8WA 5K9JL 1JFXA 5EOQH 1GHFH 3I6KB 4YZFF 1QQDA 5IREA 4P48A 3PBMA 2YPLE 4N25A 1EGJA 1IBYA 1YIXA 3NL2A 3FYEB 4JIRA 4GYKA 4HDIA 3GPSA 3POCA 2NY1C 4P5RA 2BC4A 2ESVA 4MAYD 3UYRL 5LUMA 5EF2A 1QLEB 3GH5A 2C9SA 4EOWH 5F8QC 3G6JE 4I2XB 4M4RB 3O4LA 4FI6A 2DQDL 2DQTH 1EWDA 4ELMF 4JTLA 5F6IB 3GHSA 1NCCH 3LYRA 5B7EA 5F70A 4U0RB 1R3SA 3WFEH 3HGSA 3NR0A 1E1CA 4YBHA 4JCMA 4LY8A 3ARUA 5C0CE 3NGBC 4YCPA 2DFAA 4KO7A 1GZHC 1U8PB 4M7TA 5GJTL 4BH7A 4HT1H 8TIMA 2FBRA 4I4WB 1ZTXH 4OB5L 5EULV 3L2LA 3B4UA 2WQ8A 4JFDA 1SYTA 2DH3A 1A0CA 3EO9L 2ZYFA 4ZPVB 3FAWA 3VFWA 3FHAA 1RZIA 2EE6A 4CC0A 1IJ9A 3HU7A 1DCEA 4KIEA 1MREL 4XAZA 4XMPL 3C6CA 1NTDA 4L4TB 1EIXA 1QVBA 3EPOA 2MH4A 2GL5A 1FBIL 1AQDA 3BAYA 4FXRA 4Y1SA 2NVCA 1SLVA 1RZ7L 4KI5C 1VBUA 4FR6A 5TJWK 1CFVH 3QFDA 2LGNA 2QQ6A 4DKEH 4YDJB 3BQUD 2EPLX 4KJYA 4JRYB 1LCOA 4AVJA 3LRMA 2NY2C 3IRCA 2WAHA 1EHLL 2HRWA 1OTSD 4UMCA 1FWRA 3RA7H 1B9KA 1RZ8A 1PTDA 3I4EA 3CH1B 1G7MA 4Q4PA 4WTZA 3DGGB 3VB9A 5EZLA 2CLHA 4AY8A 4DJDA 2OK0H 4TNVF 2DYPD 4LNRA 4YPGB 1U3HB 2NY3C 1TTFA 2YD9A 3U2JA 3JWNC 5AOIA 3EYFB 1LK3H 2IANE 3KVQA 1NL0L 2X12A 5CHNB 2RDTA 3DBXB 4KHTL 1UKQA 4FS0A 1GOHA 4OZ4A 3BE1H 3UJTH 1QFWM 2CUIA 3UR7A 2YMTA 3IANA 5AC8A 2FFCA 3QH3A 5DC2A 2Q09A 2EDFA 3K6IA 2DJ4A 5CGMA 3SBRA 3QIBD 3T3PB 1DYSA 1AK5A 2XZZA 4BFBD 3LV5A 4JDZA 2GSIA 3E2VA 3REQA 2X0UA 4N24A 3LGEA 4W1TA 1MFAL 4MYXA 4NHCH 1X5GA 4EVNB 1F0LA 4KI1A 4ORMA 1OHLA 5EC2A 1H11A 1T1YA 5TDPA 4TNGA 4Y19D 3F2BA 3BW9B 2YSSA 4WDXA 5CGYD 5AB9A 3S3GA 3NJKA 5IF0B 1H0DA 2I9TB 5ESQB 1LYXA 4D0BB 1OOWA 5IBTL 4MD0A 1E0VA 5CQ1A 3SRHA 3TYGL 5A2IH 2BDQA 2CMRL 4OFPA 5G5IA 4FJYA 2FB2A 1XEUA 4HSNA 4PG9B 3KRSA 4HIEA 1UWQA 4YN5A 1T1WB 5JHDE 5SX5K 4L6OA 4ERSH 4DJDC 2IDTA 5LWYL 1CDYA 4B5XA 2BTMA 2FRGP 4NQ1A 2G9HA 3SGUA 1BEYL 1OO2A 4F3FB 3OGOE 4RWYL 3NZGA 4HXAH 1IGTA 3W29A 5CC5A 4K2UL 4Z7AA 1QBML 4XAGA 1SJEB 1ZVSB 4Y4KD 2NNRA 3GM0A 2FCBA 4REQA 2DI7A 3IDIB 3WN6A 2BGQA 3MRHB 3QF0A 3E8UL 1U8CB 3RIAF 4L23A 2RJGA 2YGVA 3IDGB 4D6IA 2VYRE 5KYYA 3Q3GB 2DSVA 4J3UA 2BSLA 1RL1A 3GM8A 1P1XA 1PEZA 2DLFL 3FU0A 3AMCA 3VWKD 2IDQA 1G0DA 3UXDA 4RE2A 1G87A 1ETA1 3TZVB 4F66A 3CJPA 1UWIA 1E6JH 3SY1A 1WISA 2G3XA 1ZV9A 4P9MH 3NRFA 1NOWA 5D71H 3ZE2B 2VISB 1NIEA 3S8HA 5J9PB 1U5VA 3T8XB 1MIML 3L5XL 3L95B 3MO4A 1XT5A 3T0WA 1J05A 4FZEH 5C9RA 2OLAA 3NQCA 4Z7QE 4QTIH 3U6WA 1NBZA 1SJVA 1I2NA 1OFOA 2QUTA 3QDGD 1HTYA 3IMUA 4PUNA 1ET5A 3MCKB 4M5ZH 4JHUA 3QEHA 3S1XA 2WZTA 1S5NA 1KPRB 2R2EB 5D2NE 3VA6A 4ILSA 5CLTA 2A6DB 3BLIA 3N41F 1WFTA 3FFCD 3AUJA 1A50A 1FFOA 1DE5A 4YOKA 2V9UA 1BMZA 43C9B 2GEQA 1YQVL 1VFLA 3ANUA 4HZMA 2VRJA 2HROA 4C54A 1ZGLM 3MRRB 3H9SD 4F7TA 1FNSH 2ZYSA 2V81A 2VLJE 3ZKMD 4J3BA 3QUZA 4HWBL 2CR3A 3KPLB 5LBVA 5DZVA 3TYDA 3SCMB 3LQZB 5DTFA 1I1YB 3P61A 3WMCA 4EMZA 5D2LF 3GVVA 4NN7B 4B5EA 1U8JB 2R29L 4OT1L 1E1EA 2E1DA 4NQEB 1N26A 4BWLC 4GH1A 1JHKL 4K23L 1U8LA 3ISWA 1NUFA 1W9UA 3P77A 1N55A 1P2CB 1O60A 4L8SB 3CVIH 1OC6A 4WCYH 3DJRA 3WHE1 3C4UA 1IQDB 1AD1A 1SVZA 1MEHA 1XRTA 2XFYA 2XTLA 2V9TA 4OZFH 5ALCL 1GVFA 1L7IH 4HUMB 1OY3B 3FUKA 4D0DA 2IEPA 1YX1A 4DVRL 1EDYA 2CO1A 3TSDA 2QR0B 5HGDA 5HHVL 3A4DA 2WWDA 5F4WA 2NXZC 3NSXA 1VYSX 4JFOA 5IV2B 2VAJA 4BEIA 4IQLA 1AXTL 3LB6D 4PJCE 1VFMA 1ZHKB 4CU8A 4XNUH 4H0IA 1XZWA 3LERA 3KW7A 1B0RA 1OPGL 5INCA 3PWPE 3PABB 4S3KA 1CI3M 5BWFA 3ULVF 3UIZA 3V6FA 3NQIA 5H2BA 4NKOA 3AS0A 1MNZA 1WPCA 2R69L 3QUZC 3VTAA 5I3KA 4AK2A 3D5OF 1XIDA 1BVKA 1G1CA 1BXBA 1KBPA 3W7RA 4GRMB 3GSXB 4JBRA 5AZEL 3WL9B 4BHUA 5FLUA 3REWA 1PLGH 3R19A 4AZCB 2R39A 3MQTA 3C5ZA 3H2PA 3QIWD 4D6CA 2HKAA 3VC5A 1EJVC 3EX6A 2WVVB 4L9XA 2FH8A 1D3HA 3ZDXB 1R24A 5T3ZE 1KTCA 4NFDA 3TBSB 1EO8L 2KS0A 2BSRA 2DQUL 1DANU 1IBGH 1H1YA 4ALAL 1OP5H 1XLEA 2X89D 4DEPB 5HUPA 3VKJA 4WU7B 2DEYX 1QABA 2X8RA 1TO5A 8FABA 4L05A 2NX1A 3HPLB 1FLRH 4F33A 2A9NH 3HOGA 4YGAB 4UILH 3D52A 3WUFA 3E6FA 4E0RA 2DVTA 3I75B 3CFEA 4J28A 1P0NA 3U4FA 1D9KB 3CZKA 1XCTB 3X3FL 1SLXA 1XLIA 4DF0A 2WXJA 4TTGA 4PPTA 3L1EA 3QUMB 5AB2A 3PTMA 3WFLA 2FJUB 2VABA 2GB2A 2Z8VC 4GCAA 1L7TL 1A6VL 1UUSA 2WGNB 5I1CH 3BN9D 4NKMA 2W63A 1PCWA 4IOSA 3FLUA 4LYQA 4AF0B 4KF1A 4MZ2A 3QDJB 1KYOJ 1UVQA 3SZ8A 1EAOA 2OKMA 3A6CH 1S5MA 1OAQH 3SN4A 2ENQA 5JXAL 15C8L 2F7OA 4IU3B 3ZRFC 3C5ZC 1HXMA 3B9KD 2EUWA 4JR9L 4LAMA 5FYJU 1CG9A 5DA0B 2ACQA 1LQAA 4WO4A 2CHNA 4LAUA 4XBPA 4NYLA 4OZOA 1W6LA 4LEQA 1BKHA 5E8NB 4CEUC 5M03A 4Y1AD 3E0FA 2NW0A 1X97A 4L4VD 3T78A 3MV8A 2AOSA 3IDNB 3VG0L 5LZLA 4F9PC 3A4FA 4APXB 5FA5A 3D39D 2GVYA 1IC0A 2DSKA 1LO4H 1QPRA 1TVDA 3LPPA 2D2JA 1Y5XA 4DFIA 3NVQA 4RGOH 4LAQL 2D0GA 4PJDF 2YW4A 1J18A 3RGBA 5KSBA 4I9MA 3W11C 4IS6B 3K7UA 1LJMA 2YPVH 3AG1B 2APSA 2YQ3A 3L3OB 3UG4A 1JUEA 1RJRA 2Z7KA 2ZZ6A 4UB9A 4NAEA 3QI9A 4ZCWA 3HVNA 3MCNA 3RUGB 5AKSA 1XYZA 4I1RA 1KKRA 3JSSA 2P5WD 1ZXKA 3CL7A 4JHWL 5FCZA 2X16A 4S38A 3EOTL 4NPKA 5T9BG 4PV9B 4JDVB 4N90E 1F3DJ 2NT1A 3EJTA 4DP4X 4WUKL 4Z8FL 4HHAB 1Q6FA 3EKZA 2ZXWB 2NRDA 2GQAA 5K93A 4PTTB 2G96A 3O3DA 2BY2A 1K77A 5C0QA 5EF0A 4M43H 1AFVH 3CX2A 3I6TA 4FMFA 4ZNEA 2FPYA 1PCKA 4ZTOH 2V7NA 4ZUSA 4FGMA 2VLME 4WO4C 1ZAIA 1EEXA 3D3VA 2NX5B 3A3WA 4FYSA 2VCAA 1OFQA 3TONA 5FHBH 4U1JB 5AVXB 4GAGH 3NSNA 3OZ9L 4MMYA 3LNFA 3GLEA 3ESNA 2CDEA 2A3AA 1MPAL 1T6WA 1H62A 4C6KA 5FYLE 3IDJA 3AS1A 2OXGB 4G11A 2KX9A 4J3ZA 3QP3A 2Z9TA 5D9SB 2FVMA 3O6AA 1DLHB 3QJFB 1B6UA 2R0ZH 4M48H 4HU4A 4HUCA 5FKPA 3B0YA 3OGSA 2P5EE 2I16A 1LE9A 3NCEB 1T7XA 1A1NB 3QCVL 4KK9D 3VXRB 1NDVA 5EPMB 3TW7A 1ITUA 1W0MA 3WH6A 2OYMA 4LBEB 3QI9C 3VYLA 1BZDA 1DWFM 4L1DA 2E7BA 5F1NA 5JW4Q 4M3KB 2DW6A 3BARA 3QXBA 3GBEA 5F89A 3KPMB 4DJFD 1L6SA 3WY4A 5EU7E 5HINA 3AU1B 1Q72H 4G7QB 4ZTPH 3RNDA 1CYGA 1F3EA 3CUXA 4X6CF 1F8MA 1NFAA 1FJ1A 4NQVB 4JNZA 3LKSA 3QA3A 3Q8CA 1J9QA 4I0PD 5IVXF 4GSQA 2G4EA 1AACA 1E5JA 5JUEH 1MCPH 2J1ZA 2F38A 3W70A 4KWOA 4XBEL 3BCFA 1Q0XH 3NCYP 3D47A 4KFZC 3BPWA 1NP2A 5DJ8A 1FG2A 5JBFA 4KRTA 3MZNA 3MBFA 4CQ8A 4R26H 3QXWA 2A7RA 4PLOB 4Y4FB 2IBGA 2JJTC 5TPWL 1R3KA 3W0KA 2XTSA 1QPXA 1R9XA 2OO6A 3MBDA 3HLAA 1VGKA 4J3OH 2ZWZA 2Q7YB 3VXPB 4H1ZA 4TN9A 4IJCA 1FNEA 4B3LA 2QULA 1DQLH 3IJHA 5E8OA 4JRXA 4MD4B 5IQ9A 2GYIA 2MKLC 1ND0B 4UTBL 1PZUB 5CP3A 3P9LB 2HWZL 4YHYB 4JRLA 3TQ0A 5I66B 5B38G 4KZEH 3QK0A 3V4PH 4Q58C 5DJCA 2TYSA 3A5VA 3CUFA 4XK2A 4XI5C 4LLYA 4QAWA 3PWVA 4LE8A 1Z9OA 1HHGB 2Z92B 5J6SA 1JZJA 4MJJA 4PJGE 4H88H 3O6FC 2EXWD 3DI2B 1BQGA 4H8WH 3FUEA 1D2OA 3LQAC 1N4XH 3LXAA 3MRLB 3HN5A 4PCSA 2P5PA 1I31A 3PWNB 3K2GA 4NQCD 4IICA 5EZIH 4BM7A 1S3TC 2HLFC 1SGKA 4AD3A 2YUVA 1TJ2A 1I9EA 1MFVA 1W0WB 4XVTL 3TCXA 2VC2L 2ZKWA 3CN0A 3P0VH 4D6HA 3GHBL 3MCLH 3KUMA 4US5D 1XYMA 4QXUL 2V7HA 3PFUA 4GIOA 4UTAH 1L2QA 4WRHA 1LM8V 3CMJA 3O4OC 1HKLH 2BY1A 3Q65A 2J88L 5IQLA 4I88A 1YZZA 3WEXB 4S0HA 4Y9AA 4MMXA 1N2RA 3LN3A 1NGQL 4NSKB 3LMYA 5MENE 5GJMA 1WZLA 2WBJD 2XTJB 1H19A 3PULA 1QO2A 1MLCA 4P46B 5C6PB 3EOSA 1NMAH 4KKBD 1NGPH 2ZCHL 5KVGL 2ZKHH 3EDDA 3QQXA 3GC2A 2CCLA 3MRGB 1OM9A 4QGCA 2QADC 1P6FA 1V7NL 3QJHB 2YMXL 5I17A 3NXLA 1ADWA 2BWGA 5I8EA 2V4LA 4IUOA 4O0QA 3KGRA 4UTFA 1TJ1A 3A64A 4QD2E 3EYOA 4TLUA 3IJ6A 3KZPA 2CNCA 1ZY9A 5HQMA 1E6XM 4OCLC 2DZWA 4IGSA 5GRVL 3HZMB 3K2KA 1H1NA 3CFJA 1OLZA 3BVTA 1YNLH 4DN4L 3CHDA 3FH8A 1GVEA 3TS8A 2HFGL 5A2AA 1C9WA 4XP4H 3FRPB 3VRLE 5CEYB 3BQ6A 4XRCA 2VDRL 1ZLWH 2BOCB 1LQ2A 1LE5A 1FWJC 2ICWA 5DMJB 1XF3A 3DXAA 4JZNA 8RUCA 3FOLA 1W1TA 4FOJA 3ES8A 4WJ8A 4U3AA 4EPDC 1WJ3A 1L9PA 1XG3A 5IB3A 1UWFA 4C6IA 1FXPA 5BO1L 4JTTA 1ZAGA 3MFGB 2TSBA 1UZGA 1KJVA 2Z93B 2SEBB 2B3RA 1YAIA 5BQ7B 1QP1A 3ZJ8A 3BWAB 3BIKA 3ITCA 3N4EA 1T66C 1OAZH 5DGRA 5C1MB 2R15A 2D3JA 1N9PA 4A6YB 2EDWA 2ILLA 1ZENA 2WIMA 3G1RA 4Q6XA 4A7QA 4RNJA 2QKIB 3UGEA 4DK6A 1T21B 2WHVA 1Y18B 3GSMA 3RX8A 4NO0B 1T04B 1EJ8A 3FUHA 2J7GA 4ZS6D 1DEEA 1SXBA 2WOYA 2L7EA 5LCVA 4Y8EA 3RFZB 1YEEL 4OCSL 3BKMH 3DYOA 4NGHH 4YL9A 3ES7A 4F0MA 5EOTB 4N0CD 1EZVY 1CWYA 3D0VA 2WXRA 3STPA 2ETWA 5BO0D 2FH6A 4Z3TA 4OJDH 3MGOB 2V68A 4L37B 5HVGB 5D93C 5CD5D 3IS1X 5D7LD 1FFNB 5C08B 3MVIA 1UWEH 1ZA6B 2TRYA 3T0EE 1KD0A 5I71B 3IS0X 3GTIA 4LPCA 4YFDB 3GHTA 2G3NA 5DK2A 3E5PA 4OE7A 2BNQE 3H9HB 3EOEA 1LILA 1A7RL 2BZDA 3KL3A 5EWIH 4R4BA 1SO4A 3M8OH 4DPQA 4HIQA 1JPKA 3UESA 2VXTH 3K6FA 3KHDA 5T9CE 4N3UA 4DAGL 1K8CA 5DWUH 4LAZA 5DUML 2AV1B 2FWLB 2K3TA 3OAYH 1EJWC 1SY6L 4AYFA 5HGGS 4H25A 3W23A 3FN3A 1UUQA 4L6DA 3IMWA 2VR7A 1B9BA 4O8RA 3W9DA 4QG6A 4DKDC 1TNNA 1W32A 1ES0B 1V79A 7FABH 4RDQG 4OZIA 2GIMA 3MRKA 3OBKA 4NZ5A 4S3EA 2UX7A 2BWDA 1AMYA 2WMJA 3FQNB 5HY9A 4HIIB 3PHSA 1CI1A 2ADIB 2Q02A 3FB5A 3LRGA 3F5WB 3L7RA 4Q6IB 3EH5B 1HQRB 4C5YA 1U8OA 2Z1XA 4WGHA 1AMXA 4NDMB 5E1QA 4L1WA 2Z7GA 5C6MA 3R2GA 5C09A 2INEA 1A8ZA 1P5BA 2ZUYA 1LWIA 2J62A 5TIMA 4XODA 4MDRA 2ZSVB 1M6OB 1D7FA 2UYLB 4IDLA 4NSBA 4KV5E 1KCSH 3NTYA 8XIAA 3T2QA 4MUZA 5BS0B 4URIA 3WS6A 1OALA 1XR8A 1PZBA 1J1XH 4KETA 1A4JA 3NJFA 4JQIA 3W1PA 3CMOL 4Z08A 2HZGA 3ERXA 3KPNA 3W39A 3PGCA 2XY2A 5EBWB 4LCUA 4LSBA 1J9SA 4IGBC 4WI2A 2PTTB 4ZFFA 1IE7C 4KQ3H 4O0KA 1L9OA 3N55A 3Q6GL 4Y2NA 1OX5A 5LHEA 2N7BA 4U6YB 1HINH 3NESA 2K70A 2VLRB 5HGAA 1SJAA 3VFGH 3G3DA 2DQEH 3K6OA 1Q4NX 3VGAC 4PC8A 3OKOA 4BQ4A 1D2PA 4XAKD 4PRRA 1MZRA 5JNYB 1A9VA 4POCA 4BZ1H 5DD6A 1SXSA 1K6QH 1TQCB 1CB7B 1S7VA 3X14B 3N4AA 1IC5L 4L1HA 2D31A 2XVPA 2WMPA 5EPDA 4AXKA 1DFBH 3GMQB 3W7JA 2A4CA 1OEPA 2P1FA 2R27A 3LVTA 2GSEA 1V6XA 1V3IA 1YNTB 2G30A 1PKQE 5FM8A 3WD4A 5I1KH 1ITCA 1X1ZA 1HJBC 3QEGH 4HF5L 3ZE0B 4Y8AA 4Q9QL 4HHPA 2ZOKB 2BBFA 2JF6A 2CLPA 3CFDA 3KR3L 4WFHD 3AIEA 4PRHD 1MHPH 5LXVA 2ROXA 1TQBC 2NDGA 4LOVA 1RIUH 2F2KA 4WHDA 1VKFA 1K8YA 2NXIA 3CDZA 5BZXA 2AK4D 4BXSV 3G6LA 3EGSB 4K68A 4HHWA 5DJ0A 3PR2A 1LP9E 3PBWA 3WS6C 3FDGA 2HA1A 3UWWA 1UBSA 1BXUA 3VA2C 3GB7A 4FQHA 4F3HA 2AEWA 4JPKH 3AG4B 3VGFA 5DD3H 1E4IA 5FV1L 3ZW3A 2OEJA 1PNCA 3O11B 2X6BA 1ZLUK 2Y06H 5AG9A 1IM3D 3JWNG 3OHXA 1WCBA 2QGDA 3UEZA 1EZSA 1VFSA 5I0ZA 2NY7H 1JD7A 5TQ0L 4GOSA 4BWUA 3WMLA 2PUZA 5EU3B 1SFSA 3CZUB 4Y2OA 2XPYA 4YGVA 3PB0A 1CO1A 3VCLA 3EOLA 3VWJD 1O6VA 1J0IA 4V11A 1N0LB 1AZBA 4E6MA 2ZNWA 4WI8A 4AKQA 5CJOL 3NIDF 5GRUH 4PB9H 2VT0A 5IMOA 3B2UC 4EN2A 1H3UA 4U1GB 1C5BH 3HNTL 3NQ2A 8PAZA 3K0WA 3ROOB 1W72B 1BQUA 3GTVA 1SYVB 4U4IA 3ULUE 1MHEA 4Z76B 3W1LA 1KM5A 1TOXA 3ULVD 4JTUA 1ISZA 1E2WA 3FO2A 3FO0L 3KYKL 3KYMA 4IRZH 5FOBB 4O1AA 1OAYH 4HJFA 3A22A 3MV7D 2I7GA 5HANA 2YHGA 2VEFA 3BEWB 5EL1A 4LC8A 4PJXB 3TASA 2WWNA 2Q8AH 3IXAB 4OVXA 4S1FA 3QIUA 4C1LA 1TEGA 4GKZA 4FQIH 5B38A 5BPPA 1A6ZB 1WHOA 3QXAA 2LT9A 3S34L 4NZRL 2OL3L 4PRDB 1AGBB 3NQKA 4WTZG 2JB5L 1E5ZA 5CSUA 1JPGA 3PHQA 3PAVA 4BQ3A 1J8HE 2IXQA 4JQXA 1DQVA 1VACA 1LNUB 2YRPA 4KAQL 4AMCA 1ZP4A 1LOQA 2Q8XA 3OHXC 4DGIL 1MHCA 5DVNA 2NW3B 3S6OA 1HKIA 2WHJA 4Y5XB 3R8HA 3PF2A 2LVEA 1TU2B 4HUWA 4KHXL 2R94A 1S7XB 3MI3A 1BX2B 2IGFH 3AAMA 4RFEB 4HETA 4Q9BA 3BPNB 4JIQA 1BWWA 1UJQA 1YXCA 2Z3FA 4LEFA 1CFQB 4Y5YB 4ZFMA 3FTWA 3CN4A 3O16A 2ZZUT 4LU5L 2PCQA 2ICSA 1LEIB 4ZRGA 3WTVA 5EIQA 5FL1A 1GGBH 3WXVL 1X98A 4OUUB 5DZOA 4HIBA 1IXPA 3NQFA 4PGBB 3G5YA 4YHOL 1T5AA 1K2DB 4M6VA 4PCTA 2FIRT 5KVEL 4KNQA 4J6RH 1IEIA 2XRAH 4L4JA 3KLHD 3D1MC 1A2YA 2R4RH 3MN8A 4B9CA 3UPMA 1WX0A 3QIUC 3QEQE 1OK8A 3GI9L 1I3RA 3G1FA 2BJMH 2PO6D 3SB3A 3FBQA 3W7KA 3IV3A 5E08L 1VLIA 2V9QA 3LKNB 1OTUD 1U36A 2FGWH 3N5AA 3WLOA 4MNGA 5T1LA 4O02A 1H6FA 5CPLA 4JQXC 2YKLL 3QNYB 3TPUB 1RA0A 4DJMA 3RQ3A 3V6ZB 1EUAA 4IIDA 3W7DA 4AHPA 1KBGL 3RVUC 3UGRA 5IQ7H 3N40F 4FX6M 5K7JA 1Q7MA 4PJ8B 2PDBA 1MSPA 1JS4A 4B2DA 2XBTA 4X7TA 5FWQA 3Q43A 4ZBCA 2AAAA 4B7IA 4JO4L 4P2QD 4DUVA 3IIZA 3FSZA 4H00A 4R7VA 2E9WA 3BLLA 2J7LA 1BMGA 5CC3A 3AHZA 1SHSA 2V2WA 4JL1A 2A38A 1EHNA 1NMCB 2OMWA 4JM2A 2ZX5A 4M7ZC 5AYBA 1GTEA 2MQGA 4TRPH 5TF0A 3KOZA 2WC7A 4UDUB 2F15A 1BW8A 2GJXB 2BVYA 1WBYB 1WT5C 4YNYB 2IBBA 3O9WC 4CVXB 5E1IA 4UNVA 1RUAL 4QBXA 3Q2WA 1S5VA 1NEUA 2JJWA 4FTVE 4LUSA 3VZXA 3O6LH 3ZQWA 3BPCB 3WJYA 4PUDA 4PSRA 4ZYKA 4G9FD 3H4FA 2BSTA 2VDKL 3HMWH 3PGDB 3PLYA 3GKWH 5C0DA 3GK8H 4HUNB 3UROR 1EX0A 4AZ7A 3RVXC 3TFXA 3QPZA 3OJGA 4GKTA 2Y5JA 4XPBL 4XPHL 5I0WA 1NDTA 4XTDA 4NP4H 4PCPA 5AVZB 3DOPA 4C1NB 5FUZL 2XVBA 1QZ1A 3IFLH 4NI3A 3AWEA 1FVCA 1E9PA 1U21A 3UXAA 3W1ZA 1FZMA 3L2IA 4PVLA 2A3CA 5ALBL 3WTWA 1HJXA 4YL2A 3RG6A 2AGKA 2JKSA 3IT8D 1EF2A 4R3UA 1UOKA 5DK0A 4V1YA 3E2HC 1JVOA 1C8XA 2JFEX 1T0NB 4JVPA 2MCPH 3IUIA 3W1XA 4K8HA 3JWOH 4QNEA 4YX2L 4JM2C 5C9KA 4IHOB 4WUUE 4K3JL 1KENL 3WLWC 3LUTA 2WMGA 3SIKA 4TVUA 3W5MA 2PLTA 4OI8A 3IUDA 2YZ8A 3VFUB 3KXFD 5E0FA 5SV3A 5J13B 4JANA 3U1PA 3N9GH 3L2MA 2R9HD 1QFUH 2XJLA 3F4DA 1RUMH 4R7DB 3RHGA 1X3DA 1WVZA 5ENWA 4Z3IA 5E51A 3CHFA 3F7RA 3ZHNA 3W22A 2NTFA 3GSWB 1XLCA 4TX6A 1TTIA 1WWAX 3W53A 4XO6A 3BDXA 1JVLA 4QTHB 3LY6A 3NYZA 1MJUL 1RFDL 1G6RA 3TC6A 4N9CA 3KWVA 3JUGA 5DJAB 5SX4I 2IPTL 2LTQB 3D0AA 4G59C 4O50A 3MODH 1A5NC 1XBXA 4WZHA 3FYIB 2EQDA 4O4VA 4B0MM 4JJ5B 1TMHA 1TWDA 5KBPA 2P80A 3QJZA 4L1BA 5IMLB 4NJGA 4L9YA 1CVRA 5B22A 3Q05A 3QAQA 2DT1A 3GJFK 4NQSB 1BWVA 5F3HA 4AZ8B 1KR0A 1GA2A 2QEJA 1Q63A 1FHDA 2Z27A 4HMNA 3HIZA 3HN8A 1GZPB 2YEVB 2AV7B 1QW9A 2QZ5A 3ARQA 1EBAA 4UNIA 5E56A 2IDUA 5EO9B 3GKFA 1K3ZA 3CGTA 5DD0L 3WF4A 4F57L 1PUDA 3C60D 4HSCX 4LRIA 3P2BA 2W07A 1E0UA 2YLAA 3BI9X 3ZE2F 1ECYA 3VMOA 4G1KA 4HSQA 3CC5A 4KRMB 2ZKYA 4CBZA 1AR1C 2Q3AA 2HCZX 4PJFE 1JXFA 3ZZQA 4QJ1A 3GDCA 4FNSA 1TFPA 4W9KC 3TP4A 3VVGA 2H8PB 4XB8A 3VIHA 2EGZA 4XKYA 2Q8BH 1BQLL 4QDPA 5JLZB 2G4JA 2I9LA 2XXMB 4EO5A 4UOJA 1XFPA 1AZRA 3LY0A 3T8QA 3BCJA 1UGNA 4PJ9D 3B2XA 4R85A 1FO0H 2QCDA 2ITCB 1O7VA 2IPKA 5IRPA 4DGVL 5AW3B 3I02B 3BDYH 3SI9A 1S2UA 4FQXD 3AWOA 3C6LA 2VELA 3QXDB 1BXVA 5AW6B 2VEIA 5D5MA 3KCPA 4IJTA 4H9TA 5GS2D 4IBWA 3DUSA 1MVUA 2FNBA 1OINA 2HT4C 4IP5A 2XN9E 2IJ0C 4R2GB 5DO2D 4RX4A 4NO2B 3QHMA 1E70M 3CIVA 5EMYA 3L4WA 3AT9A 2HNHA 2YIHA 1JUFA 2OOGA 4IISA 1QSFE 2H26B 4A3RA 1GMEA 4LRIC 5LBSH 4BS0A 1Q9LA 3QHTC 5CD3B 4X2RA 4NNPH 1LTXA 1REIA 2ZCZA 4N8CL 3V9EA 4HGXA 2RIKA 3CIQA 4QTGA 3TWCL 4LSQL 1F41A 4HU8A 5LNVA 4JJOA 4UZUA 1UM6H 3DU0A 1P7QA 3FTGB 5AW9B 2XWJB 1Z5LB 1AQ0A 1PB0A 3LHYA 1YDNA 3H2NA 2YGPA 2WLZA 3ITLA 1D8WA 5BRZE 4X6BB 4O4YH 2CZDA 2OMZB 4NT0A 2OJZL 1KXHA 1NDGA 3TCLA 1PDKA 5E2VH 1XBRA 3RWJA 3C6LC 1YEDA 3O2DH 3O06A 1B54A 5JW4R 1S7TB 3RUBL 4PBXA 2NX3A 4RAVB 2UV3A 5CN2A 4JN1L 4AJWA 2VNCA 3VX0A 2NXHA 3B8DA 3O6MH 3WQWA 5IUCA 2J8UB 3RITA 3TF7C 2Q2EB 1F58L 4DPCX 2OVLA 2AJZA 3ZY7A 1FHGA 2VLKA 4N2GA 2H2PD 4LCWA 3MLPA 4ODSH 3QUYA 2OW6A 3EO0A 3ES6A 3Q48A 2FEEI 1QLRA 5FO7B 4RDVA 1EOMA 3NACL 4AL8C 4IH3A 4RGMB 5HK4A 4UBPC 3HAEG 1NFDB 3VI3A 4U31A 4PGCB 3HB3C 5G4NA 5L8KB 3H8NA 1TQXA 4LKXB 4GP5B 4HPOH 2A7PA 5K3VA 4PG2A 5I1IL 2BV9A 3VFRB 2EADA 2CUAA 4EE9A 2V67A 2NNAA 4S1SL 1NFPA 4N8VB 4A8LA 4MJIE 2O6CA 2B4CH 4IX2A 5FFLA 4JHBA 3DFOA 1N8IA 3QYSA 4V33A 2KHAA 1DUZA 2J4WL 5GJPA 2WNXA 2B7QA 2FYYB 4JGMA 1R75A 1T7LA 1WDDA 2B08A 2HMCA 3D0CA 4EZMA 3SCOA 4G6KL 5D7KE 1JZFA 2IBZY 3BSZH 5BMFL 4AGNA 3H2MA 5F7HA 3ZWTA 1OAKH 5KS9F 4RDZA 2AVGA 1IGIH 3VI4A 4BD4A 2OX1A 3TJHD 5C0RH 4PY8I 3RHWF 5ERWB 4JUTA 4HFWB 1JPSL 3GXTA 4JG5A 1D7DA 2Z4QA 5DWPA 5TE6L 3QUYC 2XX1A 2Y23A 4XN4A 3V0FA 3OKMB 2B7DT 4KT2A 1TA3B 4QAIA 4QITA 3ATBA 3VH8A 1A5KC 1PSKH 2DF3A 3WY1A 5CGTA 5ILTL 3TAKA 4CJ0A 2FK9A 2PYFB 2LHAA 1BEUA 1CFTB 2QQKL 5KBDA 5G4WA 2B59A 3CFKA 5E9DB 1FVPA 4PCFA 3CHOA 4IQJA 3RPKA 1XZ0A 3BESR 4H44C 4S23A 1Z9PA 2XG9A 2R14A 3DEQA 2XDFA 1KB5A 4PG2C 5C2BL 2P28B 4TVSa 4P5KB 3QR3A 3V4LA 3QSKB 3O0LA 4PA8A 1RPKA 4APQD 2OX5A 3RBSA 4XWGL 4IYKA 4KY1L 3TCEA 1QNVA 3MR9A 4Q4SA 2E3VA 4URKA 3KW8A 3IJDA 1Z5YD 5FSEC 5C3LD 1OD0A 3VUAA 3RUGF 4IPNB 4QRRD 2DQHL 1K4CB 4QDWA 2WQDA 2DLTA 2RDXA 3IFNL 2C1IA 4LCQA 3OVRA 2VN6A 1WZ1L 2R6OA 3IUHA 4BWLA 3MUJA 2I69A 2OMUA 4BRJA 5JZ7D 1A4KA 4GP4B 1G7JB 3YPIA 1L0XA 4JB9L 4GMSH 4J3SA 1OB1A 4RBPK 3GC5A 1OSZA 1MI5B 2PA6A 3MREB 3MUCA 3C8DA 3W25A 3ESPA 1OAXL 3UAJA 5I2IA 1AP2A 5E94A 4AC4A 3RAJL 5DHVA 4MWAE 1T5WB 4NBYB 5M7QA 4GNVA 4B91A 3DIFA 4IPJA 1P53A 3ZGHA 3E2RA 4U6VL 2UY2A 3H26A 4TUUA 3EOAB 2ZYIA 1YBQA 3ABMB 4M6OH 5TDNB 3VXMB 4GC4A 1ZBCA 1ACYL 3TROA 1IEAB 3ZMRA 1X8FA 4KKCD 4RVBA 1XCQB 1MIEL 1P7TA 3M6DA 4N2BA 3DN5A 4RISL 3TBYA 1ZIAA 2A9MH 1NQ6A 3HZKB 3VK5A 2A1WH 4FHKA 2WM0A 4J1UA 1TZ9A 4Z5RA 3K8KA 4F37F 3K1GA 4R6UA 3JR2A 2OODA 2DQFB 3OYZA 1JHTA 3UTTA 3C2AL 1KPVB 2WSDA 5FHAL 2R9RA 2XPGA 2VERA 3WNOA 4IF2A 2BSSB 2WXOA 2JALA 3VFOB 4XWOC 1YMMB 2GJ6E 4K1WA 2JKWA 4M8VA 3UYOD 1JNNH 4OCYH 2J13A 5B39B 4EOUA 3S4TA 5I8KL 1MI3A 4NYUA 4GT7A 1DBAL 4DYEA 3BAJA 5E5UB 2KLSA 1E7VA 3BP4B 2H6PA 2O6FA 3DFSA 1MCOH 1RY0A 1ODZA 3QZAA 3UAJC 4L3EE 2CITA 2JGQA 5JORB 1XLKA 1JZ7A 3SOBH 4DQWA 2QMKA 3ZDYB 3ABSA 4PJEB 2AJUL 4G8GD 5DHYA 3F7JA 4ZNCD 3NA9L 3D2UD 3Q8EA 3TH3T 5G5DB 1HXYB 2E8ZA 2PWGA 3TA3B 4PY7A 3UBFA 4R90H 1KT2A 1GQNA 3SGZA 1WKYA 4F27A 2AGJL 5DELA 4N2EA 3APGA 4WDWA 2OTDA 4L3FA 1RQHA 1RJZA 3HTWA 2G3FA 5I0VA 4FHBD 5I1LA 5F2IA 1A14H 2YD0A 1YCSA 4NN5C 2AGTA 5FGCB 2AITA 5J7CC 4D9RE 4YEEA 3DX9A 1MRDL 3EX3A 2FVKA 5DHXB 4B4FA 3WIIH 3GMRA 4JGUA 3WUZA 2G5BB 3RM9A 3TT3H 4XZ9A 2J55A 3RDTD 4V2CB 1W3LA 3NP3A 1YPIA 3N6YA 3IWUA 1XISA 5HHMB 5F2MA 2HX7A 2N59A 3F12A 4HT3A 3FU3A 3UWVA 2F53B 1DQUA 2F1BA 1M68A 3DNKA 5EIIB 3O3AA 3NBNA 3RZWA 2R91A 3W7PA 3C09B 3S3BB 5DURD 1B1YA 2AXGB 5LGHH 3U5YA 5E8PB 3GNMH 1A6UL 4QX4A 4LL9A 1UM4L 3ALGA 4YLBA 4N26A 1P1ZA 1Y07A 4FYTA 4F9PA 2QCLA 4RNFA 4HLZH 4K3HA 1PTZA 4HNCA 4PRNA 3OZOA 2F58L 3US9A 2ORBH 4LQFL 4PUUA 1AXIB 1TKKA 2HB0A 3OG4B 1I7UA 4F7KA 3QOKA 4ZD3H 3G77A 1ZSDB 3U9WA 3GVQA 4GAAA 4R7LA 3AQDA 4AY1A 3IDYC 1AI1H 2CO4A 5C5YA 2VLLA 1B9ZA 3LIZL 5IXEA 4HBKA 1U58A 1XTMA 5FJIA 4EBQH 2EC9T 5CZXC 2MCG1 5JPNB 2VE6A 1KEGL 5L2JA 2BLFA 2BHZA 4V1DE 1OGTB 1WOBA 3N0AA 4ZQKA 3L9RB 3L5AA 3VXQB 5IP4A 5REQB 3EFOA 2C1OA 5BJTA 3L66A 3QPXH 3RTQA 1UWAA 3PSVA 1AZCA 4GO6B 3SO3B 4FQ1H 2D7QA 4ZOBA 4XE0A 4UI2A 2UY7B 5T1MA 5GHWL 1DQKA 1IC1A 2OM5A 1MFBL 2UWEB 3P54A 1XRFA 5SX4H 1AGFB 2AJVL 3FT3B 3D09A 4TNWK 4LL4A 1R3QA 2PWDA 3DRQB 7CGTA 1D6EA 2BS8A 2W61A 4Z7UF 2DIJA 4XP5L 1E5NA 3B9DA 1QKZH 5ID0B 1QHZA 2GC4C 1KRMA 5JPMC 4DZBA 3ZJ6A 1HI6B 4MASA 3MJ9A 1W15A 2E6YA 3DJSA 1TVBA 43CAB 1A7PH 1O75A 4GZJA 3ULVH 2ZYRA 3THMH 2G60L 2YKKA 1QR1A 3L3JA 4N2OA 5F96H 1ZS8A 4JRYD 1TR7A 3HE7A 4Q8OA 5DMMA 4NOFA 4CA4A 2WVTA 2DDQH 2I7OA 4HPXA 1W0YT 2C9PA 5IB2B 4NUJA 1GVYA 5JR1H 3U4AA 3MUXA 5C07A 3DX6A 2QVIA 5LXXA 4YVPA 3SJVB 4OM0H 3OV6A 4HPGA 4KRLB 3CEUA 1UOWA 3AYSA 3W7QA 4AISA 2VL5A 3L4UA 3H4GA 4AYSA 2FAUA 3GRWA 3G5ZB 1ZD6A 3HAEA 3CUZA 1I4FA 1VBGA 3RTQC 4QQ3A 2QQQA 7TAAA 4BFEA 1QASA 4AV5A 4S3AA 4FLRA 3V5HA 1PL9A 3FQ1A 1PYFA 4OZHB 1SQ7A 2HVKB 4L1SA 1NJ9B 1QUNA 4HK0B 3HMXH 2A7BA 4GKSA 2JJTA 3RU8L 4CRPA 3ZT5A 1G1YA 2BVTA 3SUVA 1G4RA 4FADA 4ZXBC 4NPYA 4M5PA 2BP0B 4OZGA 2YPIA 3ET9F 1F4WH 2D9CA 4PRPA 1KY7A 4FF7A 1H6EA 2PR9A 3HE7C 1AZVA 1EC8A 1ZLWK 5LKNA 5IB5A 4YSQA 4KKNA 1VGEL 4HJ1A 2GFBB 5CJQH 1SPQA 3ZYZA 4FHAA 5K59E 4A67A 4ZW6A 2WKJA 4NZ1A 1IQ8A 3MUZ1 3UT0A 5LB1A 3B6SB 1FN4B 3MNWA 3OXRA 5T1JA 1G9NC 3N04A 3J07A 2A99A 4C6CA 3O6FA 1X6LA 4LO9A 2Y7FA 2K4WA 1YKWA 4XNZC 3WKZA 3GWJA 5AAWC 3V5OA 2BNJA 5DS8A 4YSDA 3AADB 4NBXB 3DTXB 4LKCB 2NZ1A 4XUGA 3TEZA 1LP6A 1QO3A 3NMEA 5XINA 4NXSA 3E8VA 4S2BA 1LO0L 3MX0A 3NGBB 3OC5A 2CDGB 4BQ8A 3OGVA 3KBPA 4F91B 3BKYL 1VKXA 3W24A 1XF2B 2PPAA 4P59L 1JHLH 4ZUVB 2JCWA 1NIAA 2QDDA 3KM8A 1R3IL 2F6KA 2M83A 5JW5B 1R5WB 2D7TH 5JUVA 3ROLA 4LFHG 4V2XA 4BQCA 1NM9A 4X8CA 4MQXC 3OIXA 4TVDA 2K1MA 2ZXBA 1INEL 4ERAA 2E0PA 4Y90A 1I0DA 1TG8A 3TZVD 1YN6B 3IPEA 1C08B 5BOJA 1C8PA 1ZQ5A 1YEKH 1HKJA 3RX4A 1QQDB 4FP8H 1M3UA 1EJ7L 2IF7A 5L8LB 4P5MA 3BWSA 4OF6A 4WENB 2EDDA 1J88A 4KRUA 3T9PA 1OQFA 2NY2B 4MZIA 1EXPA 3IDMA 1JP5A 4HDIB 2BC4B 2H8ZA 1CQKA 1D7BA 1SLUA 4XZNX 3ARBD 3P3SA 1TO3A 1HOEA 5KJ4A 4NAJA 1H3PL 3FT0A 2VCCA 4LBUA 2ZD0A 3O4LB 4LVNC 1EB3A 1KFCA 4XC3H 2VD8A 3WQ5A 3K5SA 1HTIA 2GLKA 4ACZB 3SW6A 4WKZB 3QUXD 3O8XC 4PFEA 1FAIH 1J79A 2FECL 3LRKA 4Q74A 1ISYA 4DIAA 1DL7L 1E1CB 5EOCJ 3MLSH 4HQQL 4WDTA 5MEQA 4FX7A 3QDHA 1HWGB 3SDYL 3SE9L 3MBXL 4BH7B 4Z17A 3HFYA 3CL8A 5E6IA 2A77L 3A5FA 3L3DA 4WSJA 2K8MA 3ZDZB 2ENPA 3SCMD 1YMHA 4AZ6A 5ECGA 4JFDB 3DFPA 4HG4J 3HC4L 1NSJA 1O6TA 5IUSA 4UV4L 1NY1A 3VFWB 1RZIB 3F2LA 3VXUE 2XY1A 2BRQA 4QEGA 3URBA 3OR7A 1BOYA 4F9DA 1JOIA 2PLJA 2PI6A 1RAMA 1YECL 3H7RA 1U1JA 4AVNA 1AQDB 2Y5EA 4F0RA 3QFDB 2WXFA 3VKBA 3CVDA 1GGCH 5CINH 4KJYB 1S78D 3VD1A 4OLVH 4ZTYA 1W1YA 3W73A 3EF4A 5HDRA 4ZQTA 4XNXL 1MWAA 2J5LB 1J5TA 3KL0A 3VNYA 4AG0A 2PAJA 1KACB 2YCJA 4D8OA 1P0DA 1PSCA 4NZCA 1BFNA 3STLB 4YSUA 5J56B 4KXZH 5FGRA 1G7MB 3RBGA 4BELD 4G7YL 2QZQA 3JV4A 4Z3HA 1S9WA 4FFYL 4FXKB 3IWVA 3US0A 5HMSA 1YYLL 4TVPD 3TOYA 3DO7A 1JZ3A 1NOFA 3DYPA 3SE8H 2INZA 3RU6A 1KN4L 3DFYA 2XIDA 2QPSA 2I57A 3MY9A 2WVSA 2B7PA 2LU4A 1DPMA 3EDJA 2DMBA 4RLIA 5E6IC 4OZ4B 3RKPA 1TMCB 4OGXH 3QH3B 4JFZL 4P23A 3GIZH 3SQMA 4PJXF 5E8EB 5FJUA 3RL2A 3H7BA 2C9UA 1VP5A 1QEXA 3P93A 3GMNA 4W5UA 4JDZB 2GSIB 3REQB 1FWEC 1FH5H 4Z1PA 4FI7A 2KI6A 3BPOC 5CLXA 5K9OA 3TLLA 2LLLA 1U3YA 3FB6A 5EC2B 1ORSA 1T1YB 5TDPB 2V38A 2YSSB 5ESAA 3OF6D 2X88A 3IEBA 2JLPA 2W94A 1VYPX 3IV8A 4MD0B 1FZOA 5A8MA 3IXTA 3WYZA 3PV6A 2XZQL 4DPRA 2VMEA 1I7RA 4HIEB 2NLYA 4W6WB 3M1BA 4GIPD 1E56A 4GI6A 1QTSA 2AKZA 3QFJD 4QM1A 3QFGA 2XUWA 1N59A 1JZ8A 3MC0A 3PWJA 2NSQA 3BG3A 2HMIC 2IXVA 2KZ1B 5HMEA 3VDBA 5GS2H 1BD2A 3PZVA 1D9KD 2G9HB 5CMAB 5KYXA 1OZMA 2Z4GA 5SWSE 3W0WA 4FNLL 2O5YH 1OGBA 2WC4A 4WJKB 1IGTB 1I6NA 3F1QA 5DLLA 4UAOC 3WL1A 3MDUA 2CA3A 1UKOA 2GIXA 4REQB 2VQTA 2MQCA 3XISA 4DKTA 4NRXB 2NOYA 4P23C 3QDJD 1GGIL 4ZX4A 4IGBA 4PJ5E 1FHUA 3G5WA 3ESOA 2VZVA 4Z0XB 3NIFE 2F19L 4QKXB 5KYYB 1TETL 2XTKA 1EH9A 1QZNA 2VUOA 4MXWH 3BXWA 3BAKA 2PYEB 3MNVB 5A6BA 5EUOE 1RCOB 4MOZA 1NKRA 1DTUA 1PZ2A 3EYQD 4TL4A 5IW3A 1UJ3B 5I18H 1G6CA 4EQ3A 5JMOC 4L29A 5KSUA 2NXGA 4IOTA 5MHSD 1OANA 4JR5A 3AS2A 4GWEA 4GAFB 4QT5A 3AABA 4LSPH 5JOPD 5LHDA 3NJGA 1UT2A 5I0XA 1CCWB 3NRPA 4E4PA 4QTFA 4ZE4A 1L5GA 2H9GA 1N64L 5HHOA 2J3SA 2R8SL 5CEZE 5J89A 4FTDA 1J05B 4HNOA 4J2QA 3WIHL 3LSOA 5T3ZL 5D1QE 2XV6B 3Q5OA 1FIGL 3ECBA 3ZR4A 2ODHA 5IW1A 1QHPA 2BCKA 2UY4A 4GEJA 5T3XD 2EIBA 2JI2A 1KGCD 3WH5A 2NXZB 4H2HA 3QEHB 1TDQA 4WWID 5J8OA 4B5UA 1L2UA 4BKLA 3T0BA 1BGXH 4LPWA 4HIPA 1FL5A 4FQCH 1XSJA 4C56E 2FJGB 1QSZA 1XCWA 4MJ5A 1E6ZA 1FFOB 3QZWA 1CXKA 3OKEA 5GGQL 2YN3A 4V15A 3U9PH 4LLDA 4P9HH 1SFDA 5C0GA 1PX8A 3RGVB 4HS3A 2YL8A 2PPDA 1XDTT 3KL5A 3OVUB 2JFCA 1TZZA 3RU8X 4NERA 3QLDA 3ZLQC 5GGRA 5BZAA 4KOBA 4MS8C 5AYXA 3CVHB 5D6CA 3UABA 1J6OA 2I32A 1XUZA 2DD8H 2X2UA 4R7OA 1I1FA 4X60A 3FKKA 3P5YA 2X7LA 2CFFA 2B15A 4FKHA 4JW3A 2PDIA 1D3GA 4F1SA 5CPOA 1IIHA 2XN0A 3V52H 1X5FA 3FS2A 5H37A 2NX5D 1U8LB 4K5PA 2H3KA 1XGYH 4X4YB 2W4XA 2NQDA 4H9ZA 3QTPA 3P77B 4NCC2 3ARFD 3TDFA 1DWIM 4F0LA 1DBMH 3TQKA 3DPDA 1NELA 4K3EL 2O6EA 5EZJA 5IFHH 3G1YA 4P8UA 5H91A 4GY1A 4JQ2A 5HYJD 1EA9C 1AJZA 4R96B 3P9MA 1A80A 3ZYJA 2B77A 5HGDB 3RXZA 4JFOB 3BZEA 3Q94A 1V27A 1H63A 4CKQA 4G8EB 4B9JA 3NDYE 5FM5O 3VXRD 4G6AC 1ZGDA 3BLPX 1DQMH 2YZRA 3KDNA 2UXFA 2Q8LA 4ZK8A 3M86A 1B0RB 3MBED 2PLKA 1DKWA 5INCB 1FXQA 1LRNA 4FQJL 1DIKA 4HK6A 3ZSSA 1BZQK 2IOMA 3UG5A 3V6FB 4NKOB 4Y96A 4IOFC 3UCRA 5HJXA 2R0LH 4DBEA 1N2VA 3PJUA 1OCBA 4OIBA 1IC7L 2W80C 4MLIA 5F44A 1TV5A 4Y2DA 1BVKB 5MHBA 1UA6H 1A7BA 4L9LA 1YPZB 4X6DE 4GAJH 3X12A 3REWB 2FMNA 4HFUH 2J6WA 4XIMA 1OADA 3C5ZB 3C75A 5AC7A 4KKAD 5F3BA 4YYCA 3UCQA 1F3JA 2ALAA 2GITA 4Y4FD 5KG9A 4FQPA 2ARWA 3DX8A 5IDZA 1FCGA 3ARDC 3LCHA 1VADA 1R24B 1NWSA 4B27A 2BSRB 4BFIB 2CU9A 2SFPA 3HVDA 2I07A 3RDJA 4M93C 5KZEA 2YOCA 3LS9A 4X9GA 3CSYA 4U1LB 8XIMA 3P60A 4KRPC 5A6LA 2F5AL 5DD5H 1IAOB 2NUPA 1PIGA 1IFHL 3QFEA 2OW7A 8FABB 4JTEA 3VSTA 1KFEA 4AQ8A 5FJPA 4N0FA 1QRND 4LZKA 3MXVH 3ZT6A 1DEDA 1U92A 1EJOH 3GBLA 5AWNL 2IAMB 1QNZL 1IAMA 3E6FB 4E0RB 3T44A 5FYLL 2F6XA 4MA8H 3CFEB 3QJTB 3FU7B 3V35A 2H9AA 2DQGL 1K4GA 3KPRD 3MSYA 5K9XA 1YN7A 5DVLA 3SCQA 4W81A 5ICZB 5K9KA 1ZBWA 3BGMA 5IHHA 4EN3D 4DTGL 1H5YA 2YD7A 2C3GA 3CL6A 2P44B 3UPWA 2AFNA 2VFHA 5GS0D 2VABB 4LNYA 2CKRA 3CZJA 1H3XA 4A2SA 4JG1L 3HHSB 4Y2DC 2AS5M 2C91A 4L9LC 1S9VA 3HFTA 3B05A 4OLUL 1YTKA 2E47A 1EC7A 2B0MA 4RGNE 3TWYA 4I5UA 1HXMB 3BD5A 4BF7A 4NRSA 3GC3A 3ZIZA 2OCZA 4Y2WA 1CG9B 4WO4B 3T40A 1PTAA 2R8WA 4NYLB 4GG6E 4ZFQA 2ZX8A 1QBBA 3TTSA 5C9WA 4TNFA 2XTJD 1Q8JA 4PLJC 3PFQA 2EDYA 3EJUA 5JO5A 4J4KA 3MV8B 2CJUL 1YY9D 1MEWA 3HUJE 2W5PA 3FSWA 2PRLA 4EIGB 1CD0A 2AF2A 2KZBA 5D8ZA 3N85H 4DGYH 3QJVB 2ZOOA 1QA9A 4AQ8C 3G5XA 1WT5A 4BGDA 2WNQA 3QHOA 3GAYA 5KSBB 1F07A 3O9WA 1X8CA 3E0IA 4Q4RA 2FE0A 1OGAB 5D04C 4NAEB 3ZSTA 1E3FA 4MTMA 3QI9B 1DN0A 5JQ6L 4B50A 2XNAB 1G4PA 4HWBA 5HQLA 3L3HA 1ETJA 4W6YB 3VH8G 4H2AA 3K5XA 2K45A 4JN2A 5GXBB 2W0UA 3