1QI4A

Mutant (e219g) maltotetraose-forming exo-amylase in complex with maltotetraose
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
418
structure length
418
Chain Sequence
DQAGKSPNAVRYHGGDEIILQGFHWNVVREAPNDWYNILRQQAATIAADGFSAIWMPVPWRDFSSWSDGSKSGGGEGYFWHDFNKNGRYGSDAQLRQAASALGGAGVKVLYDVVPNHMNRGYPDKEINLPAGQGFWRNDCADPGNYPNDCDDGDRFIGGDADLNTGHPQVYGMFRDEFTNLRSQYGAGGFRFDFVRGYAPERVNSWMTDSADNSFCVGGLWKGPSEYPNWDWRNTASWQQIIKDWSDRAKCPVFDFALKERMQNGSIADWKHGLNGNPDPRWREVAVTFVDNHDTGYSPGQNGGQHHWALQDGLIRQAYAYILTSPGTPVVYWDHMYDWGYGDFIRQLIQVRRAAGVRADSAISFHSGYSGLVATVSGSQQTLVVALNSDLGNPGQVASGSFSEAVNASNGQVRVWRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (EXO-MALTOTETRAOHYDROLASE)
publication title Roles of catalytic residues in alpha-amylases as evidenced by the structures of the product-complexed mutants of a maltotetraose-forming amylase.
pubmed doi rcsb
source organism Pseudomonas stutzeri
molecule tags Hydrolase
total genus 148
structure length 418
sequence length 418
ec nomenclature ec 3.2.1.60: Glucan 1,4-alpha-maltotetraohydrolase.
pdb deposition date 1999-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09081 DUF1921 Domain of unknown function (DUF1921)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1qi4A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1qi4A01
3BUDA 1UASA 3SCOA 1HL9A 1BVNP 4CKQA 1SMDA 4NRRA 4DO6A 2E40A 2XFFA 2B31A 5A95A 4QAWA 2YKKA 1V0KA 1C93A 1W32A 5E6YA 3GXTA 1KCKA 1C3FA 3M7SA 1R87A 1CGWA 1DHKA 1WDSA 4W7WA 2ZXQA 3N17A 3BCDA 2RGMA 4M82A 3BLPX 4XX6A 2D3LA 3A5VA 4QCEA 1HVXA 1KTBA 2PWGA 1B3VA 4U5KA 3VGDA 3SCPA 5FIPA 1OM0A 3QOMA 3LPPA 4ZE5A 1DWIM 3AFBA 1R47A 1UKSA 5D9OA 4MADA 4PCTA 4JFUA 2BV9A 2G4FA 4UQBA 1ODUA 5AC4A 1FP8A 4F79A 1JZ8A 1ZBKA 2DH3A 3KE0A 1MW1A 2DSKA 2WHLA 4AYSA 1QNRA 5EBAA 5EFFA 3BLKA 1WDPA 2YDQA 1HKMA 1H11A 1Q6CA 4CD6A 4H41A 2QF8A 3BH4A 4PRWA 1VEPA 1CDGA 1DEDA 1NARA 3GXMA 4E4PA 4JCLA 4M29A 4MJ2A 1V0MA 3WF1A 3DYOA 4LX4A 4CU6A 2J62A 3PTKA 2CBVA 3PBGA 4S3KA 1W2VA 3K8KA 3ZR6A 2VRKA 5AY7A 2VZSA 2WMIB 2BFGA 5A8QA 2X2HA 5CPSA 1CXFA 5AC5A 2YL8A 2Y8VA 3W24A 2CKRA 3I3BA 3MUZ1 4MPKA 2CBIA 3BVUA 2YL6A 1L8NA 2PF0A 4J3XA 4MDOA 1K9TA 1QHOA 1UR8A 4UCFA 5M03A 1B9ZA 3BMWA 1BTCA 1LWJA 4PSPA 2F1AA 2EPLX 1E0XA 3VSTA 2NW0A 2PC8A 4TUFA 1E1FA 2J4GA 5FL0A 2DSUA 3ZJ7A 2F7RA 3T0AA 1HT6A 4PMNA 1ISXA 2FDMA 5D8WA 1NP2A 2XVNA 2XVPA 2WSKA 1WZMA 4PMYA 3DDGA 3ARVA 1ISYA 5EFDA 2J74A 3FN9A 1FHLA 3CZEA 5ABGA 3W0KA 3WMSA 3CO4A 3K4AA 4AXNA 1KFWA 4XUYA 4XV0A 2W91A 5A8MA 3N1AA 5JUVA 1NM9A 2WSPA 2CBJA 2JIWA 3CUGA 3VM5A 1E15A 2W66A 1CPUA 2BNJA 1UZ4A 4AD5A 4QP0A 1VAHA 1F4AA 3WDPP 3WQVA 3SUVA 1VBUA 4MDPA 1E6ZA 2JF6A 1PJ9A 2GDUA 2FYVA 2YOCA 3LPOA 3VSVA 1J10A 4QCFA 1H41A 2D0FA 3QHNA 3AIQA 2CNCA 5JIWA 3W82A 3GXDA 5IDIA 2AOSA 3SCWA 3WL1A 1JGIA 4F8XA 3RO8A 1VIWA 3BVWA 3B9EA 3HJEA 2JE8A 1OWQA 3CUFA 3SCSA 4B9ZA 4WKAA 1HN1A 1ZBCA 5I23A 3I3DA 1TQTA 2W4XA 1B90A 1H3GA 3ZJ8A 3OGRA 5M17A 4Z2GA 4TX6A 5LA1A 1O7AA 3TTQA 3EDDA 2J75A 1LLOA 2XGBA 1CLXA 5BRQA 4CCDA 3GXPA 1H1NA 1P6WA 1TQVA 3A22A 3ZIZA 3AMKA 2QV4A 1UWRA 4MB1A 3POCA 3BC9A 1J9YA 4P8VA 4HU8A 1NOWA 1EDGA 3EDKA 1PEZA 5AYBA 5I2UA 3MSGA 1NWSA 3AYRA 3VDHA 1H5VA 3DX0A 2CEQA 2VO5A 2E9LA 1JF5A 1JG9A 4UQEA 1J01A 4GIAA 3WQWA 3NDZA 1HIZA 4KRTA 3UEQA 1UH3A 5C71A 1UKQA 3A21A 1EH9A 2D73A 4LQ1A 1ZJBA 2O9TA 3K8MA 3EJSA 4CD7A 1J0KA 3SCRA 1XRVA 1R7OA 1PBGA 1CXEA 4ZFMA 2G3NA 5I79A 1GOMA 2EJ1A 4R27A 3SCQA 2VX6A 2XWEA 1NWRA 1UKOA 4OUEA 3VKKA 2OWWA 1CGVA 2F2HA 3LXAA 2WCGA 1G9HA 2WVUA 3AZRA 1SR0A 1OIMA 3F5KA 4P8XA 3PHAA 2JEQA 4FLOA 3WY4A 3WENA 1VFOA 4AIEA 3GTNA 3A4WA 2XVKA 1V03A 3ZT5A 2BVYA 3L4WA 1ITCA 1EGZA 2XFRA 2WB5A 1E4LA 2A3BA 4QLLA 3MKKA 3DHPA 4CD5A 4OZOA 3CHCA 2ZIDA 3SCNA 3BVVA 6A3HA 5DF0A 4FLRA 4HMEA 2WVVA 2Z1SA 3ZT7A 1DWFM 3GH7A 3VIPA 3O6AA 3ZT6A 5DEZA 2J7EA 3AISA 5IHSA 1CEOA 3UG4A 4AYGA 1JI1A 5D9MA 2D0HA 4CN6A 3WN6A 4FLQA 2WKLA 3ZMRA 2VX7A 3WKZA 1E56A 3AIUA 1I75A 1JXKA 2OYMA 3TTOA 3RCNA 1E55A 4AY1A 3WEMA 5JBFA 1PS3A 3POHA 3DX4A 4Z2JA 3AXIA 1LL4A 4PMXA 1B3XA 5ABFA 4UQDA 2J7CA 1XD1A 1S46A 2EXOA 4OOZA 4LYRA 3VILA 2XWDA 2ZICA 1SYTA 6CGTA 3S5ZA 4HA1A 3U7VA 2EACA 1NP0A 5E0FA 3IJ8A 4TOQA 3WH5A 2WM0A 4JKKA 4BQ2A 1V3LA 4AD3A 4PTVA 1LWHA 3W28A 1WKYA 3QOKA 4D6JA 1BSIA 1JD9A 2CHNA 2FE0A 2PWFA 2XHYA 1CGYA 1QI0A 4D6FA 3THDA 4AC1X 4HOWA 3H54A 5IFTA 1CXLA 3L4ZA 3EJQA 3BLBA 3EDEA 2A3AA 4WSKA 5ECUA 3VIJA 3WSUA 4GZIA 3VTRA 3VIFA 5HBFA 2E9BA 3ZOAA 3WBEA 1HX0A 3QHOA 1W9DM 4X0NA 1OGGA 3N12A 1AMYA 2ZUUA 4BCEA 2PWHA 2GK1A 4LGXA 2VT0A 2VR5A 1ZB5A 5D4YA 1M7XA 2OSYA 5A8OA 1E1EA 5I78A 1WO2A 5CLWA 1XCWA 1G1YA 2VVNA 5A69A 1BG9A 2WVVB 2ZWYA 1X6LA 2YL5A 3L4YA 4DWSD 2V38A 3DX1A 1GOWA 3O2LA 3LX9A 3AMGA 4U5IA 3WNLA 2Y24A 2OSWA 3ARRA 4M80A 3A24A 1GQLA 5A6KA 3NSMA 3PZ9A 3U57A 3BXWA 4GI9A 1C7SA 1LJYA 1VEMA 3NYDA 4MTVA 3WDJA 2QPSA 3D52A 3PN8A 2EQDA 1W3KA 2JF7A 3PZMA 1M01A 3L4VA 1EHNA 3MO4A 3B9DA 4HA3A 4UQCA 4IUGA 4OIFA 1LG1A 3BUBA 2GDVA 4ACZB 1MWOA 1HKIA 4WJXA 3BVTA 3TTYA 2DGAA 4GQQA 2OWCA 2J78A 2QMJA 3AYSA 2WHMA 1QNOA 1TR1A 3BCFA 2WC3A 3KLLA 3WH9A 3WF0A 1EQCA 3VU2A 4U33A 3JUGA 1G5AA 1QHPA 1HJQA 4TVCA 2MANA 5A6BA 2X1IA 1W9UA 4AD2A 2Z1KA 3UCQA 2J7FA 3T0BA 1MVYA 3RJXA 1KTCA 2F1BA 1K6AA 2VURA 4UR9A 2VL4A 2IXVA 2EO7A 5M5DA 1GOIA 3N15A 3GBEA 4U2ZA 1ZBWA 1H0GA 5D8ZA 1XYZA 4HP5A 2EBNA 1C8QA 4NZJA 1R85A 5DT5A 2YA2A 1OBAA 4PYSA 1E6XM 1LG2A 5TD4A 2GK1B 5FKYA 3DYPA 2BVDA 4NSBA 4PUEA 1B3ZA 4W7UA 5LYRA 1B1YA 3F4VA 3AIRA 4M81A 3WQ4A 4HMDA 4JZ5A 5KEZA 4HTYA 1R86A 4AIOA 4FNTA 2G3MA 4AZHA 5A2AA 4W85A 4D6HA 1EO5A 1W3LA 2JEPA 5E09A 3K46A 1CXKA 2FGLA 5C8BB 1UH2A 4AD0A 2J47A 3DECA 1E4NA 1BYAA 2WAGA 1CZ1A 3MI6A 3W37A 1L0PA 2CETA 3WDRA 2CIPA 3CZLA 2GJRA 3VPLA 4MNJA 2VCAA 3WUFA 1O6IA 1TFVA 1KR1A 3ARPA 2D2OA 3WQ8A 1UWSA 2Y4SA 3S6TA 1JZ6A 3WELA 3MUIA 5D9NA 2VQTA 1BG4A 1R46A 3WH7A 1UR1A 2YDSA 3VIKA 4CD4A 4U2YA 4KRUA 4D1IA 2YFOA 3VX1A 1DWHM 4JKLA 3AIWA 3T2QA 1GOOA 2GVYA 7TAAA 2EEXA 3AMLA 1AVAA 1K9EA 3CHDA 5A6MA 3MMDA 5HXMA 1IV8A 3ARYA 5BXSA 4JHZA 1DP0A 3AHYA 2UWFA 3BUIA 4AEEA 4PBGA 4YHGA 2WCAA 3D4ZA 1E0WA 4Q22A 1E6SM 4XZWA 4W84A 2ZXBA 1KXTA 2VRQA 4UFJA 4J28A 2VNCA 4UOQA 1C8YA 3DHUA 2PI6A 3ARUA 1IZKA 1HKKA 5JBDA 4UOZA 4U3AA 4CU8A 1GJWA 2EABA 2XN2A 3FHAA 5A8PA 3WDQA 1M53A 3KEHA 2ZX6A 1ZS2A 1C7TA 1NOUA 2WMFA 2PBGA 3SUTA 2X0YA 1ISWA 4DM1A 3NIYA 3VM7A 4UTFA 3BSHA 2XN1A 5GQBA 4BA0A 1E6QM 3W53A 4FNPA 3RIKA 2UY5A 4E8CA 1OCQA 3A3HA 2OWXA 1UR0A 3IAQA 1NWUA 3VGBA 3BVXA 4AZBA 4V2XA 4PMUA 1TCMA 3L2LA 1BYCA 4Z2KA 4M8UA 5BRPA 1LL6A 2UY3A 3AZSA 4WK9A 5JIPA 3WY2A 3VDBA 3EMZA 1PZ3A 4MB5A 3D3AA 4JFTA 1OIFA 1W9BM 4FNSA 1M04A 1G94A 1IZJA 4P8UA 1JYVA 4Q7NA 3IGUA 4FLSA 1F4HA 2DT0A 2F7PA 9CGTA 3CHEA 1UKTA 1QI4A 3MUAA 4F9JA 3RJYA 2GJPA 4BF7A 1UUQA 1WAWA 2BY3A 3GNRA 2ZUSA 2Q8XA 4J3WA 5E1QA 3BUQA 3ZM8A 4CU7A 3BAYA 3WNPA 4WF7A 4DUXA 4GQRA 4TVUA 1E40A 1EQPA 1JZ3A 4GO8A 3WDHA 5F7UA 2J8FA 4BZYA 4UFIA 3CMGA 1VBRA 4MAZA 2ZUTA 3WD0A 1W9XA 1WZKA 1VFFA 1RPKA 4HMCA 3K8LA 1V02E 1VB9A 1UD3A 1FFRA 1PX4A 1V0LA 2O9OA 4PSRA 1E72M 1BHGA 3CUIA 2CPUA 2WW5A 2WNWA 2VX5A 3TOPA 2V5CA 2YJQA 1EXPA 3UETA 1QI5A 4M56A 3OG2A 4P7QA 3KWXA 1JDAA 4LPCA 5E0CA 4D72A 1MQRA 4IM4A 1V6YA 4QLKA 1HVQA 3CUJA 3ALGA 2YL9A 4LXFA 3L4XA 3WF3A 5CLTA 1DTUA 1UR9A 4C7GA 2V3DA 2E8YA 3OGSA 4A4AA 3PTQA 4WLCA 1W91A 2W63A 2CYGA 4P7OA 1HL8A 1CGUA 3EDJA 3ZO9A 1PX3A 2HISA 4HZ6A 1VFMA 3EDFA 5I5RA 3GH4A 5BXTA 3MV01 2ZX7A 3L2MA 4GZJA 5CPQA 2E9MA 2VC9A 1MFVA 1JZ2A 3A4XA 3QGVA 1UD4A 3K1DA 4FMVA 2CESA 4JIEA 1J0ZA 3PTMA 3O9NA 5BCAA 1BGGA 1W9PA 4OBSA 1ESWA 4DUWA 5IHRA 3WL0A 1GOKA 2AAAA 2BXYA 2D22A 1SZNA 4YHEA 3SUWA 4M1RA 3VNZA 3MUY1 3TA9A 4XB3A 4J3VA 2DIJA 2OLHA 1UD5A 1OINA 1UWQA 5CQ1A 3L4TA 1CENA 3A47A 2WPGA 1QNQA 4KGLA 3PZUA 2D0GA 2EPNA 5GNYA 2JALA 4JFVA 2X2YA 1WB0A 1XYFA 2XGIA 1XGZA 3PZTA 1PZ2A 4JHOA 1LL7A 4J27A 3AZTA 3F5JA 1QNSA 4WKHA 1AQ0A 3DX2A 4IISA 3UR7A 3VGFA 3U5YA 2VJXA 4OGZA 3BAJA 3LXBA 4ATLA 4UZUA 4FNRA 2FGZA 3CHFA 3VIOA 1U2YA 1GNXA 8A3HA 3GXIA 4NF7A 1G01A 2RGLA 2XJ7A 4PUDA 2EPOA 1GPFA 1FFQA 1VJZA 4CN4A 1CNVA 1ZL1A 2C7FA 3ECQA 3D51A 3CTTA 4D6DA 3FHQA 3BAXA 1UR2A 4W7VA 2ZUNA 2C8NA 3SUSA 4AZCA 3W27A 1ZU8A 1QOXA 1OD8A 1LF1A 1FOBA 3CUHA 4D6CA 5GPRA 2F18A 2TAAA 2D3NA 2J7GA 4FF5A 3VX0A 1Q6DA 1WE5A 1XCXA 3G6LA 4NZCA 1K9DA 2AMGA 3WNOA 2Y8KA 4MNMA 2XG9A 4TVDA 4EE9A 2WXDM 2O9RA 1KGXA 2WVSA 3RDKA 2NSXA 1KWKA 4RE2A 3KZSA 2BHUA 1V3HA 1W1VA 2O9PA 2X8RA 4AD1A 5A6JA 3GBDA 5AYIA 2W61A 5A94A 1H49A 4BQ3A 1U30A 1FH9A 3WQ6A 2DPEA 3VOCA 2DT1A 4MJ4A 3WD2A 3BMVA 3AS2A 1GVYA 1UWIA 3EJRA 3A23A 1W3HA 3A4AA 1WCGA 1GCYA 3VMNA 1E73M 1MW3A 3B8SA 4OJYA 3N04A 5ABEA 4CD8A 2IGTA 1TUXA 1GJUA 2O92A 1DWGM 4DUVA 1XSKA 2A3CA 5I3DA 3S2CA 1RH9A 1VF8A 3D5HA 1UD6A 2WVTA 1ECEA 4P8WA 4Z2HA 1E5NA 4ACYA 1JL8A 2DSVA 1R8LA 4W8AA 3SCTA 1HXJA 4PMRA 3TONA 1CYGA 1UH4A 3IANA 1FP9A 4W88A 1X6NA 5M3WA 3MU7A 7CGTA 1WZLA 1G0CA 4PMOA 2VQUA 3CGTA 2XVLA 2VCCA 2ZUMA 4J3UA 1R7AA 1TQUA 1VJSA 1TA3A 2XTKA 1B30A 5E70A 2G3IA 1XD0A 5LA0A 5A6LA 3IK2A 1VRXA 4AEFA 1E6RA 1YHTA 3DC0A 3DDFA 1ISVA 2GSJA 2ZX9A 5DO8A 1NQ6A 4EAMA 1VENA 2V3GA 3MS8A 2W92A 2VR4A 3WD4A 1VEOA 1RP8A 5HOSA 1Z32X 3CZNA 1X1NA 3VD9A 1GOQA 3EJUA 2EPKX 3N9KA 3VDAA 1QW8A 3ARXA 3HG5A 4H2CA 1E4MM 2Y2WA 1HP4A 1HJWA 3IJ9A 4W8BA 1O7DC 4DO4A 4BQ4A 4DWSA 5ABFB 3FXYA 2QHAA 4J7RA 3HU7A 1V3IA 3J7HA 1OSEA 4ML4A 3W29A 1TG7A 1Q6FA 1VFUA 1JZ5A 1J12A 3WY1A 3RM9A 3WUGA 1U33A 2WANA 2YLAA 4M24A 2JIEA 4A3YA 5FL1A 1SFSA 3VD5A 4PN2A 1TQWA 2WCSA 4ATWA 4K68A 3OLIA 2X2IA 2F7QA 2OW7A 3KL0A 1QVBA 3AOFA 1UG6A 1KQZA 4X0VA 1ITXA 4LYQA 3LPFA 3T08A 4AZ5A 1OT1A 2CITA 4JAWA 2DT3A 3GNPA 2FHCA 3WUBA 4F66A 3AICA 4NZFA 1EOKA 3WF2A 1HP5A 4W8LA 4AMWA 1B2YA 4LYPA 1KGUA 5E9AA 1KB3A 5HPCA 1JNEA 3PZVA 4NXKA 5IFPA 4E8DA 1NH6A 3CPUA 1EHAA 2DSWA 3IJ7A 1XH0A 1D7FA 2D24A 1CIUA 2FH8A 2OW6A 2VZVA 4AZGA 1CBGA 3D4YA 2XVGA 2CCRA 3HZ3A 2E0PA 1XH1A 4H04A 3VIHA 4C7FA 1W1PA 1KQYA 3LPGA 2E3ZA 4H8HA 1XHGA 4D6IA 1UD2A 3UESA 5I24A 3W25A 2GJXA 1B0IA 3CZJA 1UA7A 3K4DA 2XSBA 3ARZA 4V27A 2ZX5A 1KWGA 3T2OA 4WIWA 4B15A 3H55A 5CXPA 3D50A 2VVSA 2BY0A 4DWSB 2ZUVA 3VNYA 4D71A 1E3XA 4GKLA 3VO0A 1HJUA 1HJXA 4DWSC 2YLLA 1TE1A 3WY3A 1V6WA 3OBAA 3T09A 4AZ6A 3SEPA 3CZGA 2FHFA 3LRMA 5CZKA 4AZIA 3VINA 2EPMX 2BHZA 1JF6A 5EMYA 1UYQA 4CCCA 2W62A 4TXEA 4J3TA 1UKPA 3AI0A 4ZXLA 1QWUA 3VGHA 3E1F1 3NJ3A 5GNZA 1V3JA 2XIIA 4ATDA 1JFHA 3WMBA 3BAKA 4QLJA 4X9YA 4B9YA 2ZOXA 4MB4A 1OD0A 1BLIA 2F61A 2IXUA 3OZOA 4W5UA 4HOXA 2BVTA 4S3JA 1GQKA 3WEOA 3L4UA 1V6VA 2WLYA 4D1JA 4AWEA 2J7BA 4TX8A 2E8ZA 4GI6A 4B16A 3MANA 4OBRA 1QHZA 3CZSA 3VUPA 1C8XA 4PEEA 1UA3A 2ZXAA 1H0IA 3WBAA 4PTXA 3OZPA 3DYMA 2WBKA 5A2BA 4U31A 1E4IA 2E4TA 4UFHA 1EOMA 1N82A 3ALFA 3LMYA 2CHOA 2IUZA 1W1YA 1W9VA 3SURA 1EA9C 3CV5A 3WD3A 4GPNA 2DQXA 1DWAM 1DWJM 3TP4A 4P7NA 1XV8A 2J7DA 1ISZA 3W38A 2A3HA 3PZGA 4PTWA 2UY4A 1A47A 1WZAA 4B3KA 3LRKA 2WWDA 2WMGA 4U3CA 4H8VA 2DT2A 3II1A 2W5FA 3VVGA 1Y7VA 4P7RA 1M03A 4JCMA 3GM8A 4HA4A 2GJXB 1YQ2A 1US3A 4CUCA 1NOFA 1C92A 1PIGA 3GYCA 4ZEPA 3SIMA 2DH2A 1JAEA 1PX8A 2YIHA 3U7BA 2V3FA 2XPKA 4ZENA 1BPLB 3GDBA 2X0HA 4MAVA 5BROA 4ZE4A 1W1TA 3QR3A 1IT0A 3H53A 2EADA 3AMCA 1UQZA 2OYKA 1J18A 1D2KA 3WMCA 2G41A 4HZ7A 3W6LA 3EYPA 1WDQA 2VI0A 3VD7A 4TTGA 1GUVA 1FHDA 3KL3A 2ZX8A 2XYLA 4RE3A 4XZBA 4NRSA 3RM8A 2QPUA 3N11A 5BYWA 2HVMA 4BS0A 1GONA 1QBAA 2PWEA 3FW6A 1W3JA 1CECA 1RP9A 2DSZA 3WIJA 5FCZA 1MQQA 1B3YA 4NX0A 1GVIA 1A3HA 4W89A 3VIMA 3ARTA 1QX1A 2ALWA 4E2OA 1V6XA 4TTUA 2WMKA 1MW0A 1HTYA 3NSNA 1KR0A 4RE4A 2PB1A 1JYWA 5A1AA 2ESCA 2XFYA 3QHMA 2BY2A 2XN0A 1XH2A 1AQMA 1OT2A 2PWDA 2A3EA 2VX4A 2G3JA 1C90A 3ZSTA 4UFLA 4JL2A 3WUEA 6TAAA 2J79A 3AIEA 3BGAA 2OYLA 1B31A 5LA2A 5BXPA 3AHZA 5FOOA 2W67A 4EANA 1PPIA 3RM4A 4FNQA 4JFSA 4W5ZA 4IPLA 1JYXA 1EDQA 2VMFA 1JD7A 2WBGA 1RD6A 1UWTA 4MNLA 1BF2A 4RL3A 3FY1A 1J0IA 2YDRA 3ARWA 4PMZA 3PZQA 3MV11 3EJPA 2CERA 1J0HA 2VZOA 1UD8A 2QMKA 1CXIA 2V3EA 1V3KA 4YN5A 4MNKA 2VUYA 1K9FA 3TV8A 3ZR5A 3THCA 3AJ7A 1D3CA 3CLWA 3HG2A 2D20A 1JIBA 5CSYA 1OB0A 3FAXA 3CH9A 2WMHA 4V28A 3HN3A 3AQUA 3LXCA 4L4OA 1KXVA 4N42A 3KLKA 3OLDA 1UHVA 3B9AA 4CGTA 4WSJA 3AS0A 3SCVA 2YBTA 1Q4NX 4NXSA 1JDDA 4KH2A 4CVUA 3M6DA 5HNNA 4AZ7A 1KCLA 3AXXA 2Y5EA 3HG3A 4Z2IA 3AIBA 4CN1A 1GQIA 4IPNB 5A8NA 4F9DA 1ZBVA 1V0NA 3WNNA 4ZXOA 1JZ4A 2FH6A 3BAIA 1QNPA 1T0OA 3ZQ9A 3HG4A 3SCUA 3A6OA 3VDCA 1FA2A 1UOKA 1GORA 1JXJA 5BWFA 1SMAA 1WNOA 2G8ZA 1E6NA 1ODZA 4UOJA 1BFNA 1Q6EA 4AMXA 4BQ5A 5C70A 5KZ6A 1V3MA 2F8QA 2CKSA 4EKJA 2YA0A 3FAWA 4OOUA 1PIFA 2WHKA 3FNDA 1QWNA 1WPCA 1PAMA 5A6AA 4DO5A 2QLYA 1EDTA 5ABHA 3AIVA 5I0DA 5CG0A 1MW2A 2JFEX 2YA1A 1V02A 2J8GA 1R33A 3RILA 4C7DA 1JNDA 2X05A 3MMWA 4HU0A 3NDYA 1MXGA 3CBWA 3G6MA 8CGTA 1QBBA 5DT7A 2ZXDA 1MXDA 2CXGA 2BS9A 2ZWZA 5DFAA 1BYDA 1R34A 5BXRA 4UQAA 3GH5A 3WQ5A 3NSXA 2YBUA 1CTNA 3CZ8A 1I1WA 4WKFA 5HPOA 4HPHA 3AMDA 3WH6A 2XUCA 4PMQA 3M07A 1UR4A 2X2JA 1H2JA 3F5LA 3WD1A 1FH7A 4UFKA 2NT1A 2WKGA 3VIIA 4P7LA 4KWUA 1J11A 1V6UA 1HJSA 1TVPA 3EJTA 4QFUA 3HMCA 2VCBA 1E71M 1BQCA 1HXKA 3ZJ6A 3AS1A 4PTMA 3OIHA 4ACZA 3VGGA 2WC4A 2VRJA 2DDXA 5CGMA 1GQJA 4H7VA 5EB8A 1JZ7A 3NUKA 1WP6A 4W86A 1H4PA 4AIUA 1GW1A 3CMJA 4H8UA 3BSGA 3VD4A 1E0VA 4CCEA 1I1XA 2X09A 2VZUA 4R5EA 5CJ5A 1CWYA 2WLZA 1EO7A 4QDMA 1XSJA 2YFNA 2VTFA 3BAWA 4GO9A 3AHXA 2WZHA 5CPTA 3WF4A 2WZEA 3TTSA 3UERA 3VD3A 3ARSA 2WZIA 3M46A 3AHVA 4KMQA 2BHYA 3EBVA 3KL5A 3VSUA 4AD4A 4PMVA 5A3HA 1CGXA 3OGVA 4J3SA 1OGBA 2EAEA 1JFXA 1BGAA 1J0YA 3MMUA 3PZIA 3SUUA 1KBBA 1MYRA 1Q6GA 3AROA 4AISA 1KXQA 1JI2A 5FD0A 4D6GA 2WMJA 3PZNA 1FH8A 2XSAA 2BY1A 2ZE0A 3T2PA 3RMEA 4AMCA 3UR8A 1GHRA 1C91A 2VOTA 3WNKA 4AZCB 3N13A 1R75A 1E6PA 1WDRA 1KXHA 4HPGA 4MB3A 5GNXA 1CLVA 3WDIA 3W26A 2XM1A 1TQSA 1J0JA 1LQ0A 5CGTA 3IAPA 1BAGA 1NWTA 4W87A 3EMQA 1US2A 3OA5A 3LRLA 3VGEA 1TMQA 3CZKA 2C0HA 2GUYA 4Z2LA 1HF6A 2D1ZA 1V08A 3GXNA 3UG5A 5DMYA 1QW9A 2J7HA 3GZAA 1E43A 4UZSA 3ZJKA 5A6BD 3GXFA 2BXZA 1UWUA 3ARQA 3W6MA 3S5YA 4D6EA 3WFZA 3MSDA 2XM2A 4PCSA 1HNYA 3W4RA 3OLEA 4OKDA 4HZ8A 2J77A 1E9LA 5IXEA 1XSIA 4JL1A 4NI3A 1ZJAA 4GI8A 2D23A 2XIBA 1E70M 3OB8A 4KGJA 2PBOA 3RPMA 4A3HA 4B3LA 1HWWA 5I6SA 3EMCA 1E5JA 3GNOA 4UFMA 4W93A 3N18A 5D9PA 1GHSA 3CC1A 4L4PA 1CXHA 3WFLA 3AS3A 3UG3A 1JAKA 2CBUA 3T0DA 1E3ZA 1MFUA 3U5UA 2WK2A 2DIEA 1TVNA 3OLGA 7A3HA 3DX3A 3ZSSA 4FK9A 4GXPA 1TA3B 2UY2A 1MQPA 4AW7A 2DEPA 2WWCA 1BVZA 4HOZA 1CGTA 4CVWA 1W2PA 1AQHA 2V5DA 2NT0A 2WC7A 2FHBA 4YPJA 1JDCA 2ZUWA 1TZ7A 1XC6A 3WH8A 3PZOA 3BUPA 2J25A 1UZ1A 4FNUA 2WHJA 4GZEA 5HDRA 3AXHA 1KBKA 1KGWA 1EIBA 1OGSA 5A2CA 4JKMA 3WEZA 3VMPA 1HJVA 3NCOA 4JFWA 4UQ9A 3CIVA 1BYBA 2WMIA 3APGA 2F7OA 3AHTA 5JBEA 1JYNA 3VIGA 4EK7A 1QI2A 3WNMA 5E6ZA 2OSXA 4N0RA 5A6SA 4URIA 5CSUA 4GINA 1UQYA 4PMDA 4DM2A 4UNIA 3VMOA 1GZJA 1HKJA 1QI3A 4Y7EA 1H09A 5I77A 2WYSA 2VZTA 3W81A 1QPKA 2GFTA 1B3WA 3I3EA
chains in the Genus database with same CATH superfamily
1UOVA 1UC6A 3OSVA 4NRRA 4HZMA 4FQCL 2H3KA 1W32A 3CX5K 2QGDA 3WJSA 3GI9L 2B0SH 2YBRA 1OB1A 2NNCA 4GAJH 4Q6IB 1HK6A 1KTBA 4W1TA 1ZT4A 1YYLL 1SLXA 4OCMC 5D9OA 3WJXA 4ZO7A 5J1AB 2FD6L 4MKVA 1FNEB 4UQBA 5G1YA 3QC6X 1ODUA 3MUXA 2HQAA 3BQVA 3STEA 4G3YL 2J5LB 2A6KB 4HUMB 1SJMA 2WHLA 1MJJB 4JPQA 4DY1A 3M64A 4H41A 4YDKH 4UNVA 4JW3A 2HKHL 2ZQKA 3CV2A 1P1XA 3P81A 3TPUB 1LO3L 4G1KA 1AQDA 2GT9A 1XL9A 1JNHB 5E5LA 5AALA 3E5BA 2PGRA 4H9XA 4NJAL 1ZAHA 4S10A 1K9TA 1F7BA 1B9ZA 1ILUA 4WWKD 1JV5A 2Z6IA 2QCLA 1NFDF 1FRBA 3S37L 3VG9C 4V1DA 2XVNA 3B0UX 2HT2D 2MOQA 4P2AA 3V6ZB 3N25A 1E9IA 3GLEA 3KM1A 2CHZA 5K4ZA 4Q9BA 1JRHH 4X7DC 2YQGA 3SGEI 3TCXA 1JERA 4CSSA 3MVTA 2BWIA 3PWJA 3HZMB 3P8JA 4GP4B 2GDUA 3MHFA 4GLEA 1SHSA 3S2NA 3GXDA 1XX1A 1OAYL 5CBIA 3C5ZB 3PFMA 4FQ1L 4PRPD 4G9DA 5HHOB 5LHDA 2FMNA 5GS0C 3V7AE 5J13C 3CVHH 3FTVA 4DX3A 4RQQA 4DEFA 5EBLA 3BT2L 3H7LA 2Y89A 4LSRH 1KYOJ 4XBGB 4CCDA 2DZEA 2ZUXA 4K5NA 1SF5A 2DQ6A 5CMAB 1WD9A 3V0JA 5F7DB 5LNEA 1NL0L 3MN8A 3S6CA 3PBYA 2E9LA 1O5RA 2ENJA 5FHBH 5SWSA 1UH3A 1XIWB 3A21A 3UGEA 1IWBA 1YSOA 3QY7A 2IAMD 1F6FB 1T2XA 2Q9OA 1QSFA 4GT0A 2R2CA 1GOMA 2ZWSA 5IT2H 3B7SA 3OKLA 1FY6A 2IH8A 2PCEA 4XPBH 4H44C 3HZKB 4HPYH 4QI3A 1I8KB 1D8CA 5E8DH 3GEWB 3RPDA 2NQDA 1J87A 1R1CA 3EX4A 1MUCA 3IJDA 3K1GA 2HX7A 3E2SA 5T1LD 3DX5A 4I89A 4HMEA 4TQHA 2ZAIA 3MLYL 4FOKA 2X7LB 4UV4L 5D1ZI 2D0HA 4ZRGA 3QEUB 4Y4FD 3T0EE 5C5YA 1IBYA 1RQEA 5HQLA 4R26H 3A6BL 1W54A 3GE7A 3NM3A 1B3XA 4UQDA 1E2VA 1OM3H 4DP7X 2HA1A 3C5QA 3GSNA 2WB1A 4X6DE 2HLAB 2Z7ZA 1XWYA 5DVOA 4IP5A 3NFSL 2XRAH 5KETA 1V3LA 1RUPL 4EXQA 3DVIA 2CHNA 1JGMA 1RIUH 1A64A 2P8CA 4EE2A 2DQMA 5E8NB 4M6MH 6REQB 4MZRA 3P2BA 4YO0B 3X1NA 2HRPL 2CBOA 2ZZUT 1L9QA 3GRBA 4RGNC 4ERAA 4CJ1A 3J27A 1PZAA 1AMYA 4A2EA 4UDUA 2Y1YA 5IB4A 4QROA 5C0CA 2GCYB 3C2YA 3CVDA 3R0MA 2EKSB 5CLWA 2X0VA 4I3GA 3VRJB 1HHGB 1H5BB 5IVOA 4BYHA 3RWHB 1U1HA 1OV8A 3WIHH 1YAZA 1YN6B 4A67A 2GDVA 2Q6WB 3MOBL 3HB3D 3WQGA 4PBEA 3TN5A 4YDJB 4WO4B 1ORSB 5CHNA 4F4RA 1NICA 3ZDXF 2F1BA 4F7TA 1L6YA 2IXVA 5M5DA 2WZ0A 4TRPH 5C08A 4ONHB 5FDWA 3LN4B 4QNEA 3MMTA 2EO9A 3RPTA 5LVEA 3F01A 4ZFGH 1EJWC 4ROPA 3RN6A 3JQOB 5CEZH 3TN3A 1ZSHA 3PHOA 4NQCE 1RU9L 1IVTA 2YKLL 3VFWB 1Q9OB 1SEQH 1TZIB 1IEIA 2TRYA 4ZMYA 3QULA 2B2XL 4JZOB 2NWRA 4AD0A 1G4EA 4PB3A 1O7VA 1QFOA 1XICA 4KJWD 3QRFM 3MI6A 2E27H 5C0IB 4QGCA 1Z5LB 1PZUB 4RMRA 1ZRUA 1P53A 1NC4A 2IPUK 3H2OA 2I69A 4PI0A 1YPFA 4G1MA 2AK1L 5HGBA 1INEL 2BNUA 1UUMA 2CK0H 4OGYL 3AIWA 1R6WA 5GSRA 3AMLA 5JVLA 3ONBA 2XICA 3V52H 4KO6A 4JHZA 4K23H 4XVJL 1M2VA 3MNWA 3D4ZA 2ADGB 1UCTA 4YGAB 2J6XA 4PJEB 1AFVL 2ZXBA 1IZKA 5JBDA 5A8PA 5E1AA 3BP6B 2XZQH 1MHPL 3N2XA 2OJEA 1N68A 3BSHA 2PGEA 5DO2D 5J89A 4H26A 1UMYA 1I2PA 4FFYA 4B9CA 3ARGA 1DVFD 4FIRA 4Q6XA 2UWEF 4HCRA 5FKPB 3IFPB 1BYCA 3Q65A 4WTQA 2NCMA 3GIZL 5HMFA 1MDLA 1PUDA 2GSMB 5HBBA 5ADOL 1G94A 1BJ1J 4R90H 1SGJA 4Q4SA 3HOGA 1E6OL 1FO0L 2CLFA 2FIKA 4F9JA 3KXFE 5D5MF 1CD8A 2P5EA 4AHPA 3T9PA 5J56B 4BF7A 5JO5B 1EUAA 1WAWA 4S2SA 2G75B 2QGEA 3RPKA 3I4EA 3UJRA 2C3ZA 1SFJA 2FDSA 4FFTA 3ECWA 1JZ3A 3CO8A 4M7KL 5HANA 1THFD 2A9MH 3C8DA 2CZFA 1V02E 4DTGH 2ICEB 4DEWA 1J8KA 1LLAA 1KV7A 3RUGF 1BZOA 4FIQA 4BFFA 3UAFA 1JDAA 4PJ5B 4TUOB 5E0CA 4ZB5A 4PTUA 2VEMA 3XISA 4I7ZC 2IFFH 5E1HB 3L4XA 3BV4A 3MGOB 2F5BH 4K5MA 1GGTA 2V3DA 3ARGC 1M7DB 4M1CD 3PTQA 4WLCA 4X98A 1HL8A 1F45A 1XMEB 4JM2D 1PX3A 2WSDA 4L8CA 3HS8A 3JV6B 5AVZB 1JGDB 3PULA 3HUJF 4GG8A 2CM6A 5IMKA 1E0TA 2BOBB 4KKBC 4FTVE 3KOZA 3VFRA 1XCFA 3UTSD 4F37K 4JFFD 4LSPH 5FYKE 3IDNB 4OZ4B 2XNAB 4LT9A 1HXMB 4IJRA 1KZQA 2R6OA 2PXYD 2JALA 5AOUA 3INUH 4HHMA 1QNSA 2HVNA 3UBHA 5F1NA 4XO8A 4ZD3H 1K02A 3CFBB 3GSUA 4RCAA 4FOUA 2VE6A 3VRIB 3SGZA 5LLIC 4AC7C 1DUZB 2EPOA 1J5OL 2PSNA 2VDQB 1FYTD 4N5UA 4XP6H 1OE2A 3WSQH 5D32A 2C8NA 1Q7ZA 1AKJA 1MUWA 3WJZA 1RZIB 1JUKA 4N0YH 1CYWA 3PWPA 2TYSA 3URAA 3QFJE 3FA5A 2X1OA 2BCMA 4QKTA 2PDCA 1E7VA 5C07B 2BHUA 4BHYA 4JGMA 1XYMA 2CLPA 1ZP3A 4QE5A 2E7CA 2DZPA 4A6YL 4HEME 5ABEA 4OSUL 5DMIH 2A3CA 2F53B 3BURA 1HH6A 4CSTA 3D5HA 2WVTA 2OL3L 3G9VA 2AEQH 1ZY9A 4PMRA 3F12A 2NMSA 1VH7A 3QDMB 1ORQB 1A6WH 4GJIA 2A6NA 3FMGH 2G0KA 4DOHB 1R7AA 2ERJB 5B80A 2FO4A 1IL1A 2JKRM 5CEWA 2OMYB 3M17A 2G50A 4XNZC 2G3ZA 4OCRL 4WV1B 4L1XA 3C60A 2ZQ0A 3U48A 2VC2H 1YHTA 2ZX9A 2VXQA 3T3MF 4UNKA 2VR4A 3IETA 4UAOC 1RA5A 4X8GA 2ATSA 4G7FA 3EJUA 1FHGA 4ABVA 1S1PA 2YCJA 1NEZB 4HOMA 3RCYA 4XQ6A 4HFUH 1NC2A 1U92A 4DWSA 2NQHA 4AGNA 3RU8X 1ZWIA 1DBKL 1BD2B 3LCLA 3L66A 3S9YA 2OPCA 3WUGA 5BQDA 4BIKA 1CL7H 5K1VA 5AL0A 3MP4A 4L5FL 3OLIA 4Z3EA 4G9PA 1COBA 1AMXA 3UYPA 4FI4A 4DCQB 4UINH 3PR2A 3T08A 3CQQA 2NV9A 4IL0A 4NFDA 4FZ8H 4I88A 1IFRA 2D69A 4K94H 2A7BA 2XKSA 2JK5B 2YQ3A 3OM3B 1J96A 2LV4A 3DHDA 4E9QA 3RX7A 4NQED 1U3YA 3H23A 2BFVH 1Z3GH 4PIBA 5DBTA 2AGKA 4AZGA 3S2JA 4MNQD 2CCRA 4Y7MA 3WN5B 4NNPL 4JB9H 3MCG1 3C60C 2HCVA 2JCWA 5I24A 3DENA 4MD0A 3CZJA 2XSBA 5I1HL 5C54A 4NKMB 4L3FA 2J8UE 3D18B 1QU4A 2WINA 5BMXA 1P7QB 3MV9B 4G7SB 3UBXG 4DWSC 1UW9A 3FPYA 3MA9L 1SEBB 2XN9B 3EO1A 3U0WL 2EPMX 4ZXLA 3CWOX 4JN2B 1V3JA 4UTBL 4W9FC 3FQRB 2XWZA 3TN0A 5DZJA 7ENLA 4W5UA 5ID1A 1EJVC 2ALDA 3G1HA 3WEOA 3VNIA 5CSRA 4F1SA 4BEQA 2GB2A 2V17H 3N43B 3JUZA 5H91A 3CN2A 4PTXA 3UJIH 3AGVA 4M3JA 4LMQE 5GS0D 2HZHA 4GJTB 3LQAL 1ZTMA 1VFLA 1DQLH 5C2XA 3KVJA 4YYFA 5DQDL 2EP6A 5L9DH 3APFA 3MRHB 5IVZA 2DT2A 5CEZE 2OJPA 3AU6A 4DWHA 3GBML 3KP0A 1YQ2A 4PWKA 2ZRVA 1HJCA 4TLTA 1MNUH 1DQWA 3ZGHA 2E6YA 5FB8A 3H53A 4PGDB 2VN6A 4V1DD 1GTFA 3NDZE 1TWWA 1PJWA 3LZLA 5FOBB 4U3SB 4IGBB 4N68A 5E00B 2HVMA 3BG5A 2JJVA 2VLME 1CTOA 2QZQA 2G3XA 1AHMA 3C52A 4HPJA 3TN0C 3A67H 4MNHA 3D0VB 1DVYA 2G2RB 3RGVB 1DVXA 1YYCA 3QHMA 3B2PA 3M45A 5D1QC 4XX5A 4NZUH 1OAJA 3ULUC 3HRZA 1EJUC 4HZLB 2OYLA 3GO1H 3FYOA 2W67A 4MMXB 2AKRA 1SUXA 1RJZB 5KJRH 4IIBA 1YEIL 3K72B 1UWEL 3H26A 1QYGL 3H9YA 4LOVA 4Z7VE 4KPHH 1MCBA 5KUMA 1KCVL 2NNFA 5EOCL 5DWUH 1UXSB 4QISA 1AZZC 1JIBA 5SWSD 5EMKA 4AVKA 1T22B 3QUXA 2E3VA 4LAOA 4FMFA 1ES0B 4AI7A 3SCVA 4KHTH 3IE4A 3BSMA 1UIPA 1KLGB 3BKML 3QWNA 4QNWA 3AXXA 4LLYA 3C0JA 2ZZ3A 3SQOL 4BSVA 3FOMB 3OKMA 2FJHA 3WTUA 5AUMB 4OZFB 1R5WA 4BQ5A 3F03K 3DIFA 3WCYA 5EBWB 4XIAA 4IBYA 5IJVB 5DK2A 3FK3A 3HRZC 2AITA 2JFEX 2XV0A 3W87A 3Q2CA 3NA8A 1WG3A 1S7QB 3EPNA 4JO4H 1JCTA 4HU0A 4GS7B 5G4EA 2PPGA 3TNOA 1XF2A 8CGTA 1QBBA 2PYFB 4HIIB 1REQB 5C0EA 2OOFA 1LP9B 3IJIA 3UW6A 1ONEA 2OFQA 1W16A 2RUSA 3DFQA 1TO5A 1FC1A 5B7MA 1CTNA 4ISVA 2KS0A 4NZ1A 4UILL 2X2JA 1W0YT 4W4OA 1I9RH 3QUXC 2V7HB 4PJDE 1PDZA 1UB6A 1JVLA 2JH2A 4E5XB 1YPZF 5AHMA 3F64A 3NQ8A 2EDRA 1DQJB 1OK6A 1F5WA 1S9VB 1FL5B 1L7TL 1MJUL 5IBXA 2YXMA 5I1CH 4QDMA 1MCWM 4EZLA 3GSXA 1NCWH 1V93A 1BEYH 5C0CD 3DUHA 4WWOA 3CSBA 4F8NA 3NJKA 3CFIC 4JR9L 4AD4A 4KIRA 4J3SA 3MRGA 3SUUA 1LLWA 4OTKA 5I15L 2Y85A 1EGVA 5DVPA 2DQUL 1BWLA 1O5XA 1IEBB 2QVHA 4K73A 2XBDA 4MB3A 4M5YH 4JRFA 1ZA6B 1CLVA 1GGOA 1OFOA 4MZ3A 2WNXA 2C1IA 2RDWA 2WO2B 1RK1A 3UA3A 2NR6A 1HHJA 1XF4A 3RYSA 4IQDA 4OZIA 2J7HA 1GPWA 1W3NA 3WFZA 3SGDH 3HN5A 1S78C 4ZW5A 3C6SB 1X5AA 4ODWB 2NQJA 4HUXB 5C08D 1CT8A 4KMTH 2OI9B 4UOW0 1E8XA 3CC1A 5IBXC 5SWZB 3AS3A 4AG0A 2YYTA 3OJDB 5CJOL 5HYSG 3GRWH 3CLFL 2EC9U 2FTWA 7A3HA 32C2A 3U0HA 3PNUA 2P5PA 3I9PA 1I1YA 1SYSB 5TE4L 2WWCA 3GZKA 3I2CL 4WDIA 4AV5A 1B54A 3QDAA 3QNZA 5DGQA 2ZAHA 1BQHB 1GT8A 1JNLL 4KOCA 2J25A 1FLRH 4AHOA 1QNZH 3E8VA 3W01A 1ZT1A 1H1ZA 1TITA 3PGDB 4UDTA 5A2CA 1XGPB 1NC4D 4NAMA 2C7UB 2E6AA 5D71H 3CIVA 3NDOA 4TSCH 5JW4M 3GMOA 2W9LA 3SKMA 4AXWB 4NY2A 3WNMA 4Q32A 4URIA 5CSUA 2NR6C 1VR6A 4LU0A 1QRQA 5JUEH 4M4RB 1D6EA 4O2FB 2Y7MA 3UTPD 4LCYA 4ZPTB 2H0EA 4Q4EA 3SCOA 6TIMA 3WJJA 1ZEAL 4FYRA 5IWLA 2HT4C 4ZCWA 4DQOH 4RSYA 4LKCA 4PJFB 4NN5B 4FOMA 3L6FA 2G0LA 2O4MA 4BD4A 1VSCA 2VM8A 4YL4A 3JXAA 1AS6A 4KRPB 5KS9B 1JWSB 4GXMA 4QHNB 1FNHA 3Q1SH 3SBFA 2KKQA 4UTWA 5I16B 2ATKA 1EPFA 3ARGD 4JHWL 5GGUB 3GVGA 5EBAA 2SFPA 3WG7B 2POTA 2IPTL 2Y1VA 4M6UA 3U6WA 1DDTA 2PGFA 5DUJA 4YR6B 2F0CA 5DDHB 3U4BL 1QUNB 2J62A 1VP5A 1KBGH 2X70B 4I0KA 4YE4L 1T2QH 4QF1B 4XP9H 5TBOA 4TNFA 5AC5A 2H0JA 3WUWG 3T0WA 3BVUA 4LCVA 4HS3B 1IGJB 5EZOL 4OU1A 2P5ED 3SKNA 1L8NA 2LLGA 5HHME 4DPRA 3QGKC 2CO7A 2ROXA 1BTCA 3H22A 2Z8VC 3U9IA 4XGZB 2K9UA 1DQXA 3ZWSA 3RA7H 3EGXB 3II3A 3CHOA 3VXME 1KFAL 1LVEA 1O6SA 3WJJC 1NP2A 3LH2L 4QR6A 4J35A 1IM3B 5E4EB 5DRCA 3NABH 3QT2A 5IWLC 4PMYA 3CZEA 4XP1H 4WWKA 2J6VA 4LAZA 1JWMB 3HI1A 5A8MA 2Z7KA 5KTEL 2WSPA 2AXFA 1KCRL 3QCTH 1CPUA 5CINL 4JYDA 2JKEA 1W5PA 3HC0A 3SBWA 1A5SA 4DZ5A 2PDNA 5MENB 5CIPA 4UTWC 5F7HA 2HBXA 1RZQA 3MRDB 2AOSA 4BSJA 1JGIA 5LIYX 3P77A 3RNDA 4LT7A 3REWB 3SCSA 2Z1VA 4AVNA 5FGSA 5E08L 4QSFA 4BK8A 5IMMA 2PDMA 5CNHA 3QBUA 3UU0A 3ZE2F 4PUJA 5BRQA 5GISL 3QY8A 4PRPA 4MB1A 2AJZB 4X50A 3QJFB 1JPST 5J9PA 1W3IA 4JFEA 3NG5A 4LRNL 3H9HB 3EFDL 3COTA 3WQWA 5L7XL 2VN3A 1U3HC 2QVMA 3EJSA 4IRZL 5GJSH 4PJAE 4ZFMA 4X6CF 4GYKA 5I79A 2PDUA 2QDHA 1S3TC 3WFEL 2ACSA 1U8HA 2WCGA 4WVXA 2DBJA 4NJ9L 4LVNC 4ELME 1ASQA 4P8XA 2LFGA 1U21A 3WY4A 1Q7QA 2QFRA 3SBWC 1M7IB 4PRAB 1ZVSB 3R18A 3V0GA 1C16A 2UV3A 3AWFA 1TV2A 3OKDB 4L8BB 5TE7L 2WB5A 2VXTL 4QLLA 2BDNL 3J2PA 3CT2A 3VXSB 1TUPA 3WFDL 4XD3A 2XTJC 3SRDA 2CW6A 1G6RH 3O0RL 3QJOA 4PG2A 2BNQD 4IX2A 4EUPG 1XIEA 3NEOA 5D1XB 2YD6A 5DR5L 3M0VA 1UM5H 1FZJA 3POHA 2RFXB 3O11B 2H26B 1FWGC 2CIIA 3LZ5A 2J7CA 4OOZA 1QA9A 4Y1TA 3BOLA 3U7VA 4ONVA 3TWAA 3CAQA 4WKZA 4Y4FA 3IJ8A 1EXBA 4LGSB 2QF7A 4AD3A 1T21A 4OZHA 1HU8A 3TH6A 2FE0A 5F89B 3O6FB 4PW9A 1AHWA 4RW5A 1XCTB 2WXPA 3PY2A 4D6FA 2YPLE 1T20A 4I0PA 4F2MB 1FSKB 4LCSA 5TDOB 4MA7H 5AZEH 5HYJD 3MRPA 5F3BA 3PNZA 3P82A 5CO1A 4K7PY 3DLQR 4HH8A 4UUJB 3KHDA 4LEBA 3ZYIA 4J23A 3LNMA 5A6IA 3KJ4B 2WMPB 4LS2A 3TWCL 2YN5A 5A43C 2F84A 1G1YA 4Z7QE 1X6LA 4KBXA 2C9VA 3LU2A 4LC6A 3AM8A 1GPOH 4DWSD 1FCVA 5C0QA 1G0XA 4EOWL 1ZGLA 1J05B 1RZ8B 5HPMB 4EIVA 1CIDA 3VFCA 1NFIB 2JCCA 4PG2C 3K0WA 5AHNA 4PFEA 3CLEH 2CU0A 2I9LB 2PETA 2ENPA 1FJ1A 3QC0A 3P3SA 1I9IH 4L1TA 3LV5A 1U1UA 3TTYA 3VCLA 4NNXB 4PLOB 2FLRT 4MMZA 2FGWL 5I71B 3S96A 2OULB 4HWBA 1ADQH 3SQBA 1AHWC 5T3ZH 5KTLA 1WBZB 5FUZH 4GC3A 1X44A 1QMLA 2J88H 4I0PC 2Y61A 3EOLA 1H0GA 5D8ZA 2CIKB 4HP5A 4JRXB 2NZ1A 5HNTA 2V8MA 2V9RA 5TH2A 5TD4A 3LQGA 1B1YA 3B2UC 2UYLA 3AT9A 2DQEH 2Y5SA 5H35A 4FNTA 4Z3TA 3RWEA 2R1NA 1F90L 1OGAB 3AM8C 2FGLA 1B3IA 5ITBH 5CF3A 2IGLA 4RVBA 1CZ1A 3ZLGA 3G04A 4WW1B 3TN0D 1MMFA 2GVJA 4RFOH 1S7UA 4GE8A 2NUTA 4IRSB 2NYKA 4F9LA 5D1QD 3B5GA 1LEKB 2YPVA 4WI8A 4MMZC 1IV8A 1SY6L 2W0FA 3BQUB 2PLCA 3D25A 4PBGA 1TRDA 5K33A 3LZPA 1UGNA 4J28A 2QVNA 2EYRB 2NOYA 5EORH 1U2HA 1FVCB 1UPPA 2DWSA 2P26A 1RJLA 4K71C 2V2HA 2X0WA 2AC0A 4UTFA 1ONQB 4MCZA 4NRZA 1FG2A 4XD5A 3QJZA 5IMOB 1U5VA 1Q66A 3A3HA 1AGBB 1KIQA 3UWQA 4C90A 2NX5E 5EIIG 4K2UL 4X7SH 2EDTA 5HMSA 5IESH 5FUCE 4IRJA 5GRJH 4ZUSB 4JFTA 2WZAA 3EOAA 3VRLE 1UP3A 1PG7H 5F1IB 1F41A 4P3WA 3U6XS 1W5MA 4WUIA 3VXNB 3PS6A 4F9LC 3GNRA 5ICYB 1P2CA 2PURA 4KJWC 3U4AA 5C2UB 1U41A 5I3GA 4YVXA 5AYUH 4CU7A 4JX0A 1Y5XA 4OD3L 3QUZD 4GO8A 5GSVB 3WD0A 3LBMA 3MFFA 1ZA3B 2QUVA 4H4NA 5HP5A 2NY5L 4MJZA 4FQXB 3L81A 4RZ5A 1BHGA 6PTDA 5C86A 2VX5A 2NUWA 2FVKA 3RNQA 1J88A 5LGJB 3MHGA 4P5TB 1QI5A 3UEZA 2ITDB 2GJJA 2ZZ6A 4QLKA 1MWAL 2IWGA 4HFWA 4AK1A 4Z7UF 5CLTA 1BRLA 3UIZA 3TSDA 3OB0K 2DQGH 1E27A 3QUXD 2E8YA 2OMZA 3TAOA 1N19A 2CHXA 2NY2C 1J7VR 4IRJC 2NLYA 1A6PA 4M6NH 3K6SB 4PCKA 2BSSA 4OBSA 2X16A 4JQ1A 1NGZA 4JM2A 4UIOA 4N4YB 3VW3L 4B41A 2HVBA 5L88H 3M7FB 4X42A 1JHLL 1M1XA 2OLHA 3LPWA 4LFHG 3Q58A 4M7ZB 1WB0A 4H8NA 3NN8A 3IJSB 5CEYB 1CGSL 3IGFA 1NAMA 1AXTH 3B2VH 4JRLA 3R79A 3LKNB 3ZFHA 1S9YA 2QELA 4NP4H 3APMA 4M62L 3QSTA 1XTMA 4P2OA 4R83A 3VFTB 1OO2A 4AQAB 3EXJA 3V0UA 1NBVL 4N9GB 3MROA 5I18H 4GQ9H 1V55B 3DHMA 4PJGA 5M94B 1RSFA 4WFGE 1S78D 1DE4A 4U1MB 3U9UB 3ULVL 3NQFA 3GJFH 3ZL1A 1WE5A 1T0NA 3QXAA 3N6YA 1HAWA 4WFED 5BJTB 4Q7DA 3PWIA 4XR8C 1GQNA 4CSPA 4CC1A 5ABAA 2Z7YA 2DPEA 2DJ4A 2Y88A 3KM2A 4JM2C 2Z93A 3T4AB 3GS6A 4PR4A 3S98A 4DUVA 3W2JA 3I68A 3S2CA 1RH9A 3QJHA 4JFOB 4FG0A 4UF7C 2MNUA 4YDIH 3PWNA 3IVTA 4W8AA 2HCZX 2L04A 5C9RA 2NZIA 3OMAB 4G56A 2H5UA 2HWZH 4LVGA 3NSJA 2YC1B 2AFNA 3C08L 4DN4L 1NWOA 3EXRA 1G0DA 4P2OC 1TJ2A 5TTRA 5DJ0A 1OP4A 3Q6GH 2NR6D 2Q8BL 3MRFA 4R7WA 5EZLB 2R82A 4P9HL 3VD9A 3N0PB 3V7MA 3BEWA 4PJ7E 3TQPA 2PCFA 1RD5A 1KEGH 2QCHA 5EF3A 1X7IA 1P4CA 2HT4D 8XIMA 3GSOB 3FKKA 5CCKL 1PB0A 1Q6FA 1P7KA 1OAXL 2YLAA 5TDNA 1ICQA 1S2UA 2PO6B 4LLQB 3O3EB 1ULVA 1OGTA 2BVQB 3QCVL 4L48A 1NMCB 5CZRA 1I0DA 2GL5A 5IMLB 4D9LH 5ACZB 1KQZA 2X5PA 1ITXA 2PTDA 3US1A 1W6TA 4XXCA 1F6AA 1XLEA 1NKRA 1R24A 2Z35A 5L4FA 1RLCL 4F66A 2EDQA 4E3TA 1P6AB 1V27A 2EINB 1KZYA 4ODVH 5IJCC 4GAAA 1IXQA 1TEFA 3N5AA 3U0TB 1JVKA 2CA4A 1KB5A 1BQ5A 3HZ3A 12E8H 1OEZW 3W2NA 3FEQA 5LGYA 2QZRA 4H8HA 4IBTA 4NHUB 4HPXA 2IOMA 5D70H 3VFVA 2J5WA 1UG9A 4XAWH 3BX7C 3MCMA 3PAYA 1TVHB 1UOZA 1V8HA 5D33A 1ZV2A 1N64L 1RURH 5GGVH 1XDTT 3OJ2C 4EQ2A 1HQTA 3P0YH 1I1RA 2XIJA 3ZDYE 3OD3A 4AE1A 4YHOL 2X9WA 5E0KA 2V2WA 5IM7A 4RESB 4S3JA 4LY4A 3TBYB 4IKLA 3IXAA 4TX8A 3MZ2A 4XXCC 4I77H 2VCOA 3PE9A 4AOFA 5T3ZE 2HUEA 4UQ2A 3P2TA 5GGTH 2FBJH 2YEZB 4ZFOA 3GSMA 4A66A 3NFNB 3V6OA 4NP9A 3U30C 4I3RH 1UFUA 3AQDA 2PPEA 2WXGA 2FB2A 3GK8L 1I8MB 4KJPC 4B3KA 3HTLX 3A4DA 4H8VA 5AG8A 5K9OB 2C3WA 4HG4J 1FFNB 5DEFA 4ZJ9A 4TS6A 3SIMA 5I17B 2OBGA 2XPKA 3KPMB 1ZT7B 4CMHB 1U3HD 4MAVA 3U7AA 1ID2A 1SBSL 1AE6H 4PN6A 3N3TA 4OCXH 1GUVA 2ZYFA 1FORL 3MRRA 2XYLA 2QPUA 1YYML 4U0QB 2VW4A 2DSZA 1T6WA 5HYQB 1A3HA 1XGDA 1V6XA 5FYKH 2PP0A 2B5IB 4YMZA 1YAIA 1FWBC 3RWIA 1MRQA 4QWWC 3A3XA 2BY2A 4C59B 4DQAA 5IK3B 2FB4H 1IBHA 3MUGA 3QLLA 3MRKB 5EULV 3K2UH 2QHRL 2Z6FA 3MRCB 3L95B 1HCZA 2XTJD 3TMLA 1U8JA 5HJ3A 1EP2A 4A7QA 3HAEH 1VFBA 4FNQA 3OXSA 4KEZA 3V6OC 4PJBE 1TOXA 3FY1A 2QEZA 2I9UA 5ECGA 4ANKA 5I7GA 4RISH 2V81A 1J0HA 2Y7QB 1PYWA 3S35L 3QEHA 2Q5BA 1ODAA 2AV7A 2OLAA 3U6XA 4JFED 5KSBA 4XUGA 1AR2A 3ABRA 3HG2A 2D20A 4GNKB 1S3RA 1MAMH 1UP2A 3FQXA 1NGWB 5J3HC 1YRRA 4DXXA 1A7RH 3AS0A 4GXVH 4WSJA 4TNGA 3QUKB 4GNJA 4DVRH 5SX5H 1TCRA 4FQJL 5A8NA 1OFPA 3DSNA 5IFJB 1H61A 4MM1A 1OF8A 3LVTA 4MPQA 5FLUA 4K9EC 1F4YH 4MS6A 4ZW3A 3D6NA 2HWGA 5KZ6A 4X6BB 3FAWA 3GVVA 2CC0A 3ONCA 4NKDB 3U3HA 1QSVA 3S3SA 3LOWA 4ANUA 2P5WB 4K36A 3MV8E 3H2MA 3KDOA 4L3CB 3IXTA 4JQIL 5JOEA 1EEXA 5FYJE 4BSWA 1AJ7H 5FGBA 2H8PB 3RX8A 1MXDA 1O68A 2ZWZA 4QXWA 4S11A 5J5RA 3E9AA 1RY7B 3WQ5A 4U1LB 1OTTC 2YBUA 1MAKA 4WKFA 1I1WA 5HPOA 1VZGA 1JGUH 4NUQA 4NO0B 5G1MA 3PM6A 2XUCA 3H8AA 1OP3K 1P5VB 2ZXCA 1X96A 3MJYA 3CC5B 1F8IA 3VNLA 5HGAA 2R1YA 4Y19B 2P47B 5F7WC 4I0PD 3S3DB 4AYID 4G8EA 2AI0H 4HN4A 1FI8C 4W86A 4IBSA 2R69A 2BIQA 2X10A 1ZD6A 1XSJA 2IANA 4Q8WA 3G6AB 5IB5A 3B2UD 4XO7A 3V18A 2O6PA 4LU5H 3EH3B 4JAMB 1V7ML 1DUYA 2GPTA 4LH8A 1R5VB 5DQ9A 3AXMA 3PNRB 4WFHE 4ZS7L 2VLLB 2YSSA 3PWUA 1JFXA 4QCIA 2FSEB 4PJ9B 3AROA 1TV5A 1E3FA 3CAWA 4HT1L 5FGBC 2GBUA 1RZFH 4GQ0A 2HE5A 3D1MC 4LPUA 1TQSA 1J0JA 4NAFB 1EIXA 4RDBA 2O6FA 4Z2LA 3O9WB 1V08A 5I66A 4W81A 5AZ0A 3HNTL 4K7PL 4XNUH 3WO4B 1IKFL 1AP2A 1ZLDA 3PJXA 3NJNA 3N44B 4GH3A 2FYYA 4HIXL 4UMGA 2D23A 2XQBH 1K8ZA 1XAUA 2VGLM 3RPMA 3HG1B 4JX6A 3HRPA 3MJWA 2VQ1B 3MJ7A 1GHSA 3N3MA 2P0IA 3R8RA 3P0VH 4AYFB 1G4RA 2KHAA 1FWTA 5IVXE 3LNPA 1PLCA 1RERA 2DIEA 4JG1H 1TVNA 3TUUA 1TA3B 3NGBB 5T3XD 3SJ3A 3LSOB 1JDCA 1TZ7A 1HNGA 4WI7A 5F21B 4PJXE 4JFZH 2YR1A 2YAEA 3OAYK 2GUUA 3AXHA 3MV7E 1THAA 5DJZB 2ZAGA 1R3JB 2OOGA 4J8QA 4D94A 1EO8H 3U6RA 3GT6A 4PJIB 2ZTBA 3AHTA 4MAUL 3D3VE 4Z0BH 3HE7B 5FJJA 4PODA 1YEFH 2VDNB 3HI5L 2QUNA 4IBVA 1GZJA 1M6UA 4OZGB 4XNAA 2JVUA 1A5NC 2BVPB 1C93A 2XVBA 1ZHBA 4R33A 3UZQA 5EC2B 3IDGB 2I9TB 3BLPX 1TJPA 3S3CB 1IAOB 4Z0JA 3KWSA 3S4TA 3VGDA 1MFEH 4QS5A 2EZ0C 1IEQA 4ZE5A 2XV6B 4GY7A 5DCDA 1DJGA 4NRXA 4YHPA 4GKOA 2NQ5A 3TYZA 4IQEA 4H88H 4Q8TA 2AEPH 5FFLA 3P4OA 5FLVA 5AFDA 2NY2D 4CD6A 3RDTA 4BUQA 3BQ5A 1MJ7L 4IRJD 2JQXA 2AQRA 1BOYA 3KLAA 2EAWA 2C1PB 4GW5A 3RL2B 2FK9A 4J3OF 2R51A 1KJ3H 1FL3A 2FCBA 3S5SA 2ISWA 1AGCB 1YNKH 1DQMH 4WI9A 3BOVA 4R7NB 3W24A 2CKRA 4ZUVA 4UAHA 4BKSC 5CD3B 4GRSA 4HYRA 3ITXA 1KLUB 4PY8J 3BMWA 1KF9B 3FKUS 4W68A 1HE8A 2C3VA 4XXDA 1OHQA 2DB8A 3I6GB 3LY0A 3MJ9A 4P2QA 1Q6RA 1TVBA 3GW3A 2BP8B 2NW3A 1NMAL 5C0AA 3V36A 4YXKH 5G4MA 5HA7A 3QDJB 4DW2L 1W5NA 1EYWA 4RMWA 4RX4A 4OV5A 2WJ5A 1F4AA 3SUVA 4OF8A 2VDLL 2Y36L 3ZDZB 4PV9B 1NLDL 3Q2VA 4KFMA 2QAPA 2H3BA 4NYLA 2ZSVA 4Y2LA 3RO8A 1A3WA 3ULUF 3HNVL 5C9JA 3RDTC 3UO8B 3HC4H 4FXSA 4DZIA 2ADJB 4BZ2L 4JRYA 3BXNA 3QUML 2DQFA 1P6WA 4JPWH 5KYXA 3VFSA 3O8XB 1D5BB 2V2TB 1NU5A 4K8RL 4CL7A 3DO3A 4AKQA 3AYRA 4D0CB 3VDHA 2GITB 5CZ0A 1L9PA 1DCEA 1UKQA 2HFFA 1KRBC 1R7OA 2WBJD 4PTDA 3T8XA 2DZTA 4NPJA 3SPVA 3QYMA 4O02B 3BN3B 1Z9LA 3LXAA 3C09B 2C14A 5TF1L 2Z7UA 3D2UB 4P2OD 1GA2A 4ELDA 1ENUA 4BKLA 2X3CA 3A4WA 1TJXA 4O2CB 5T1DL 1CB2A 2VZ3A 4JFPA 4DNLA 2XFRA 3C86A 1BXAA 1W17A 5DF0A 3LD8C 2WVVA 1R3HB 5JW4R 3ANUA 1A6TA 1TQBB 4LUJA 3VXOB 5I5JA 1RVFH 1T7YA 2R1MA 1MLBA 2JI1A 2FEDD 2WKLA 1TRIA 1JPTH 4PRIE 1E56A 5CWSA 4JFQB 2ZOKA 1KBVA 2OYMA 2GTWB 1YLVA 1VBGA 1FH5L 2ARWA 1HDMA 5HVWA 3ZE1B 1BQLL 3CBJB 4EPDC 1S46A 2NXGA 2XWDA 1RK6A 4OLXH 2BNQA 5DEJA 5LN8A 5FFOA 1RMFH 1KM1A 1TJHL 3M0LA 3GRIA 1LWHA 4X0KA 3W28A 4D6JA 4J6IA 2XU9A 3AU1A 2Y6TE 1EJ6A 3BLOA 3UJSA 4KVCL 1CI3M 3WE6A 4RR4A 5EU5A 3VB8A 5CLZA 3CFUA 1ED3A 1IO4C 4D3CL 4LARL 4L9DA 1A14H 2CKBH 2QTVA 2GK1A 4FB7A 4LGXA 3NIGE 4LCIL 1TPXB 1E1EA 1OQOA 4B5NA 5HYJA 2NXYC 2KPWA 1OJXA 4JNXA 5IEHB 4PRHE 5JW3H 4K5OA 1RY0A 2Y5JA 3MLWH 3PBUA 3RB5A 2P43B 2F15A 1MREL 5EA0L 2BP5M 1AANA 4QD2E 1Y6NR 3FLUA 3QORB 1W3KA 4NQDA 5FEWA 2QR0A 4GW1B 3BRGC 1HKIA 4O15A 3VFMB 1BXVA 1JCKA 3EX6A 3SI9A 2MPAL 3VC6A 3JUGA 1SQ7A 5KYUA 2VDRH 2C5DC 1B3JA 3RJXA 2BZDA 1K6AA 2LR4A 4V1XA 3KEDA 1XC4A 1URLA 2BSRA 2G3FA 3SO5A 2QCEA 3O0KA 1REIA 1VGEL 1NIUA 2Y6ZA 4KJPD 2F19L 1C8QA 1R85A 3V0SA 4WGVB 3UBPC 3CBKB 4OIAA 3KJ6H 4PUEA 3L54A 1UUOA 5HD8C 5LG1A 5DHVA 3SBPA 2NY6C 4M5ZL 1TZ8A 5T8GA 1XTLA 5DS1A 4XO3A 1BEXA 1CXKA 2ZOOA 3N4AA 3SQMA 4C4KT 4F0HA 2D7MA 5BQ7B 4F80A 3DOIA 3ECUA 5ICZB 1LO2L 2CIPA 2PLTA 2O5YH 3BP5B 3AADB 4XCYA 3EGDB 1S3KH 5DCCA 4C55A 2H3NA 3WELA 2JKAA 4QWWD 4DVBA 3VIKA 4CD4A 2TSAA 4XAGA 3KBJA 1BBDH 1AD9B 1W2KT 1C1EL 3CHDA 3AAZB 4OZIF 2Q09A 2EEDA 4WX2A 1H8SA 4HU4A 1DJIA 1JPSL 1FV1A 1E6SM 3AWNA 1IBBA 5JH1A 1HQ4A 3MRMA 3ITOA 5D1QA 4GIPD 1QW7A 4JY9A 2YK1H 1PG7X 1M53A 1E4HA 3QS3A 4ZW8A 1PTAA 3UZVA 5I75B 2OMNA 4HKBA 4DM1A 3H3PH 1A6VL 2WV8A 4MY9A 3LCGA 5HHVL 1J4EA 5ESQA 3QSKB 4HPOH 4KI5E 1UR0A 4NC1E 4W9CC 3RWDB 4L61A 5J3HD 4NHVA 4CQDA 4PBDA 3ICJA 4PV8B 3QUYD 4WY0B 4GXFA 3PGCB 5LGZA 4MF4A 5T1KB 3M5ZA 1D3HA 2WUBL 7FABL 1XR8A 3UYIA 4PRDA 2K7QA 3B9OA 3VE9A 3US0A 2RACA 3IMBA 2PR9A 4U1HB 1QI4A 4RNHA 2CDFB 3MUAA 3TN6A 3D85D 3ATBA 3W1ZA 3SFKA 2WQDA 1YJDC 5GS1A 4UR8A 4HGWA 2BGNE 4EIZC 1SJCA 1G69A 2Z1PA 1TTQA 4XE5B 1S1RA 5F7UA 2FPVA 3S88L 3KGUA 5JDSA 4LUTB 4L29A 4I1NB 3UX9B 2EXWC 3AC0A 2FAUA 2BRQA 2A3TA 2C1GA 1DBBH 3RB7A 3BDYL 1OARL 4DPPA 3H4WA 3TOPA 3RG1C 3N50A 3QUZA 4OLVH 1OTTD 2YJQA 5IUSA 2FB3A 3TW9A 3L0NA 1HVQA 1UB5B 3NCCB 4N26A 1AW1A 4JO1L 4PY7A 1DTUA 4ZK8A 3OG6B 2W63A 1IAIM 1CGUA 4M5TA 3BD5A 3HI6L 4FQ2H 1UM4L 1TZGH 4OQVA 4MNGA 1PLGH 4QG6A 1HZHL 2VXUH 4DYKA 5LGXA 4L0PB 4WHBA 2E7FA 3ZHNA 4PBXA 4V33A 1U8LB 1PKOA 4ZTPH 1IGCL 3N2TA 5C0JB 5GS1C 2BRRH 1F3RB 3L4TA 1CENA 1VA9A 1XGRA 4TPRL 3KVMA 3QQ0A 2CXKA 1SOSA 4OV4A 2TSBA 3AZTA 3F5JA 3U5YA 3PUCA 4RWYL 4AQEB 4OGZA 2G4JA 4DEPB 3OQEA 3X11A 1MRCL 3VFUB 3ESVF 3FV9A 3BH8B 5HDBE 2Z8SA 3QUZC 3IVUA 3EXLA 1FNSH 1P0BA 1JV2B 5IW6B 1YDPA 3TJ4A 1J48A 3NOYA 4RBPH 3TIEA 2V5JA 2XY1A 4FQQA 3W27A 3W7JA 1OD8A 1LF1A 1KJ2L 4D6CA 4Y4KB 5IW3A 1QT1A 2H1PH 5L2JB 4NYUA 5DMNA 2UZXA 3R1GH 4ZTOL 4MWFB 4M6OH 4S1RL 3VAEA 4UIKH 1W1VA 4DYEA 2CO2A 2IAND 1DFBH 4AYDC 1NQKA 4O52A 1QPXA 4J3OG 1GVYA 3SDYL 1LO0H 4OGXL 4JFXA 1MW3A 3B8SA 3L3IB 3W7OA 4O1AA 4CD8A 3U1QA 2AABL 1NDVA 3P84A 4NWUL 4R7LA 3CCHB 1NJJA 4PWIA 1X5JA 3L08A 3SCTA 3O81A 3VOGA 4YK4B 3DK2A 2Q71A 4FR6A 4XC3H 3JVFC 1OSPH 3CPRA 2EVGA 4LCCA 2CM5A 2WLLB 3QDGD 1J2BA 4JIHA 1RULH 3DC0A 2O7QA 2WM1A 3QISA 4WW2B 1BLNA 1S7TA 5CN2A 3Q2WA 4J2MA 1Z0MA 3QXTA 4JKPL 1A5FL 4WO0A 2DDQH 4BQ4A 3TYDA 2M1KA 1FWHC 3BVNB 1VFUA 1D7CA 3NBNA 2EH7L 3C6EA 3G5ZB 2XH2A 1FDJA 4YS1A 5C09B 1NGXB 4ZUTA 2OJ1A 1CFVH 1T66C 2BOCA 2EZ0D 4AMKL 4XWGL 4JTAA 2X2IA 5CC5A 5FV2A 4QRRD 5HNRA 5D7IB 4G7YH 3ZE0B 2DWXA 5I0ZA 2C3GA 4JAWA 3NP3A 1O9VA 1Y6MR 4IBQA 4PMJA 1UWGL 4OZHF 3CQJA 5DMLA 1B2YA 4XVTH 1SNRA 4J2PA 3RP1A 1OY3B 4NAQA 3IDIA 1Q9WB 3W2KA 3KCPA 1R3IL 4AZ8B 5C1MB 3C75A 3O41A 1TKWA 1P0DA 3ARFA 1YQVL 4WY7H 5FHAH 4LCCC 3EOTL 3SW6A 3G6JB 2WXRA 1UD2A 1I8JA 4JZNB 5HTSA 4ZAKB 1GH7A 1KPRB 2EKCA 5DRZA 2ADIA 4W9IC 2EICA 1JXDA 2CR3A 4N6EA 3EBIA 2IWFA 2GI0A 3SDXB 2CNYA 4JNZA 2JCCF 1XXDC 3AI0A 4E41E 4RCXA 3ZKXC 2EDXA 3NJ3A 4I1PA 5GJTL 1QBML 4Y2NA 1BOGB 2R94A 3TFKC 1JPFA 1VIZA 4JVPA 4OD2A 4AWEA 2J7BA 4UT6L 1BZ7B 2J6EA 4NN7B 4B16A 4FA3A 1B4JH 5CJQL 1F97A 1TZHA 3DHJA 1BAFL 3RDTD 3WFHB 1GC1C 3OU8A 2APTA 1T96A 1HOCB 4OF3A 3RLUA 3KPSB 4CDHA 3LMYA 1DANU 2CHOA 1OW0A 4U1KA 3GTIA 3SURA 4OVUA 1M3JA 2DQXA 1LCOA 4PHXA 4WKXA 1RBLA 3ARFC 2XWBB 4OVXA 5AD0B 4HK6A 3LRKA 3CASA 4PCYA 4F58H 4U7SA 3ZL2A 1FF5A 5ETUA 4RJEA 1QKZH 3JWOL 4IGHA 2Z7WA 4QDPA 2PZ0A 4S3DA 5EEWA 4FXLA 4YLCA 5JQ9A 2JI2A 4X8CA 3ABOA 1MZYA 3L9CA 1Z7AA 3TNNB 4P2QD 3GKWL 3AMCA 2GABA 1J18A 4U7KA 2Q8AL 3P61A 5I8EB 4JPKH 1E50A 5C0AD 5DRIA 1YUKB 3VD7A 4AX7A 1EEPA 4NNYB 3ZKMC 4K3EL 4OJFL 1PSCA 4BS0A 3JU2A 1RP9A 1U3HA 3KDNA 4WGHA 4H7ZA 3MLZL 4RX4D 2ALWA 1PSKL 2WMKA 4ZS6D 1LDCA 3F5WB 2PYEB 4ZX5A 3BW3A 3HV9A 4RFEB 4TQEL 4C4BA 2JKLA 1RZJH 1EEZA 2A74B 4HBCL 2FDBP 1XIGA 1F73A 4JL2A 1ZCOA 4GMTL 3IB4A 1MH5A 2COVD 2ZOLA 2YD9A 2X42A 2VMFA 4O58H 5IFAH 5EOCJ 1OW0C 4F92B 4RL3A 5MERA 3O4OC 4JRYD 5C0BA 2ICWJ 5DJYA 4MZ1A 4NC2B 3INOA 3VH8A 2G5RA 2DVTA 5CZVH 3I84A 5K9KA 1XFPA 1F18A 1NANH 3IVKB 1UJ3A 3LQLA 3PGFL 3DOSA 2QDVA 3X3GL 2LTQB 3VXUB 4H13C 4P5KB 3GVQA 4FEIA 4X5PA 4IQHA 1DLHB 3MRQB 4YS4A 5ERWB 4RKAA 2VLJE 4EDXB 2ISSA 4IMKA 5FO7A 3ZLQC 2JKXA 2EECA 1LDPL 4GRWH 1LUCB 5GIRA 1TPUA 3UAAA 2OKMA 4JOMA 5DUML 1R2RA 2PWUA 4MSWB 3CWGA 1Q6EA 4PGZA 2CKSA 2A6DA 3IMTA 2NXYD 1NELA 3FNDA 1RZ7L 4O1BA 4RGMB 3GMNA 4DO5A 4NDMA 3HA1A 4QT5A 1N8FA 3ZUCA 4GSXA 4Y5XB 3MX0A 4ETQA 5EUKA 1HYSD 2P50A 1WV2A 1X39A 1I7TA 2EDJA 2EC8A 4IK7A 2A4EA 1JN6B 1QNVA 1GYMA 4TUKH 1IBFA 3CHPA 3S3GA 3BRDA 4JPSA 1JZEA 1BYDA 3TROA 5KN5B 4M7LT 3RLVA 3M0JA 1UJ3C 1WFUA 1LWRA 4JTSA 4Y5YC 2W07A 5T5FH 1THCA 3TVMA 1QTYT 5JIKA 5JIDA 5FECA 3WKML 4ACZA 5MEOB 4IMKC 1JZ7A 3MZNA 1S2VA 3GI8L 5DC4B 1VS1A 1ASOA 3USZA 3QR1A 5DZNA 1F8MA 5EU6E 4R5EA 2I9EA 2OMUA 2YFNA 2VTFA 5HD8D 2F58H 4JM2F 3NQIA 3WF4A 1RH8A 1T6MA 2NY6D 4FXGB 1T5WB 3RX4A 4AT6A 4GKTA 4B5EA 2BHYA 3EBVA 5FR3A 3ULSB 3WIFA 2HKAA 5D7LB 3QEQE 5EU3A 1EX1A 3DUSB 4WUUE 1J5CA 2R8WA 3N13A 4NQDD 5GRVK 2XM1A 2K6ZA 5CGTA 1OTUC 3VGAB 3V5KA 4W87A 2VSDA 4H4IA 4LF1A 1N4XH 3HMXH 4YSUA 2ITCA 5DMYA 4PJGF 3ZJKA 1U2CA 5G5DA 3MSDA 5AVNA 3TVMC 1MZHA 2J77A 1TREA 3IU4L 4Q8NA 4G43A 4NI3A 4DP8X 4D7PA 1E70M 4LHUB 1LEGA 4X4YB 4A3HA 1F4WH 2NQ9A 3MNZB 2YZ5A 4PRBA 1RFDH 4W93A 3SPIA 1T80A 3A12A 4K3JL 4NO5B 4UTAA 5KZCD 5BS0B 2EYSA 1KFEA 4X61A 3PL6B 4TL5A 2CLZA 2E68A 2YHGA 3LCWA 2IWEA 4AGMA 4RFNB 5E5UB 3QVQA 1VESA 2Y69B 3GNDA 1V10A 5FYLE 4IMFA 3O63A 1LE5A 5J0BA 4JKMA 1DJXA 3SOBL 4G72B 4OM1H 3VMPA 4LLDB 2VFHA 1PZ5B 2WMIA 5INDA 3APGA 1C08B 4QGYA 5A6SA 3VFNA 1OY0A 3TCEA 4DM2A 2BB0A 1ACYH 1L6WA 3ILPB 4IDJL 5EHFA 1EAPB 4BHUI 3FUKA 3I3EA 2R23A 1PYFA 3HPZA 5E2TL 3LCYA 5EEZA 1SM3H 2XFFA 2B31A 3WU1A 4H0IA 4J8RB 5FXCH 2EXWD 4L1HA 4PY8I 4ZQOA 2OSLB 3UTQB 1WDSA 1U8IA 3N17A 2FLIA 4XBEL 2R9HC 4XX6A 4NM8L 4QTIL 2OR7A 3V8OA 5FIPA 3FRPA 4G8GB 2OCFD 3ETBJ 3E0WA 3I6TA 2FX7H 1MFAH 4R8WH 5FF2A 4U6XA 3U7YH 2NDFA 1MUJB 1FZOB 4JVWA 5CPMA 1IGMH 2CRIA 1U4EA 2X4RB 2R1LA 1E0OB 1TNMA 1T1ZB 1IFHH 1NARA 4QR7A 1OAQH 4M29A 4AEHH 3DYOA 4LX4A 3ZL4H 4NLHA 4CU6A 5D2LA 3PTKA 1KCXA 1JCNA 3PBGA 3MGTB 3I9IA 4LCRA 2VRKA 1R3LB 5CJNA 1Y07A 2P8MA 1GTHA 6XIMA 4AWTA 2PP8A 1QHOA 2WYHA 4Z6AT 3L3OB 2C91A 4TUFA 4Y1AB 3TZFA 4JCWA 2FVMA 3C2VA 4JTRA 5JHAA 3V0VA 1AH4A 4IYKA 3T40A 2DQTL 1H9VA 4IHCA 1N5AB 3HPJB 3DX6B 2Q7YB 5JW4N 5GRVL 2EVHA 1N12A 3GDCA 4MY1A 1Q9KB 4AD5A 3OO2A 1SXAA 1SMOA 1E6ZA 3UWZA 4XCCL 3VSVA 3MKCA 4Z7OF 1HHIB 1JHTA 3V5FA 3TF4A 4BWWA 3SCWA 1BWWA 4IMLA 3O3DA 5FYJH 4ABQA 4WKAA 1WBYA 1M9SA 1ZBCA 2GQ3A 5DJ2A 3WLBA 3IWPA 3UMNA 2PW1B 3PQYB 3T0TA 1AR1B 1IAKA 3LKQA 4OWGA 1ZSXA 3SYQA 2VITB 1CD1B 2XGBA 2W65A 1NLBH 1GVFA 3GXPA 1H1NA 4IFKA 1EX5A 4HH9A 3NM1A 5CP7B 4EO5A 3ABKB 4IIQA 2VO5A 3TBTA 1AI1H 1AUSL 3FCSB 4OGAD 1HAUA 3RZCB 1C9DA 1HIZA 4KRTA 4LCWE 4CVXB 3TZVA 4V2CB 2VMDA 4O0QA 4Q4QA 3VKAA 1PBGA 4U0RC 3C5JA 3WTSA 2XX1A 1OCWH 1PZBA 4JHAL 3HJZA 4YJZL 4KXZI 5CSZB 2Z0UA 1NSJA 4M48L 1QLEL 1OAUL 3F5KA 2Z92B 2WBJA 3TEVA 3GTNA 5DJCB 2BVEA 4RLIA 1TPB1 4EI5A 2UBPC 4J12A 4KVNH 2P7TA 4HC1H 3W1NA 3FJTA 1IAIL 3CHCA 4KTDL 1XCQB 5H94A 3RNKA 4LLVB 3VG0H 3T3PE 3N2CA 3H56A 1YTKA 4OI8A 5JOPD 5G55A 5FS5A 1T66D 1ZK5A 5C8JA 3DFOA 3SKJL 1BXCA 1VFAA 1LL4A 3N85H 3BSZA 1ITUA 1HSAA 5F9WC 4IIQC 5KSBF 4M8QA 1NJ9B 3IACA 4JKKA 3S83A 2E1DA 1Z1WA 3SDDB 1BSIA 3TZVC 4GRWE 3MA7A 3ZIYA 1A0QH 2CR0A 2ALAA 3EJQA 1ZTVA 4OM0H 1KFJA 3WBEA 3A6CH 1D5RA 3W6YA 2DV0A 1ZCRA 3VE0A 1LBLA 2AF2A 2GBAA 3MWAA 2WBJC 2RKXA 1UZ6F 2X4PA 1E6JL 4JIQA 4ZOCA 1ZB5A 1M7XA 4EI5C 3HGOA 1KYFA 3BHBB 4JLRB 4KJYB 3EAUA 1OYBA 2V38A 3BDBA 1KBJA 4BKTC 1MFDH 4EF9A 5JORA 4PWEA 5A6KA 4F3FB 4BUGA 3CVHA 4MTVA 4GA8A 4JPVH 3TFKD 4KQ3H 2DQHH 1UJPA 3C0LA 4V2BA 3BE1L 4PLJC 1EJXC 3NXLA 2ZYIA 3H9SB 4GQQA 1XGYH 3WAJA 2CZDA 1QNOA 1TR1A 2FEDC 2X4NB 3UYCA 4U33A 5TQ2L 4JDTL 1RK7A 3DMMD 3ECVA 2VSKB 1SDDA 4MVBC 3V4BA 3DTUB 3ARFD 4RXFA 3QG7L 1X1OA 4R0LB 4F8LA 2KDYA 3EYVB 1SW0A 3P60A 1HG3A 1GK8A 1P84K 4J4KA 3VI3E 2G4GA 1ZHKA 5KEZA 3T77A 2G3MA 5L2KA 5AVWB 1EO5A 3CFCH 4J5NA 1TUFA 2FWUA 3ZKMD 3DECA 4IX0A 1MHEA 3W37A 3BKCH 5DQPA 2CETA 3CZLA 2O93L 5I3JA 4QTHA 2VCAA 2VMEA 3MMEB 1JULA 4DN3L 1JZ6A 1ACXA 2QQ6A 3EJYC 3OKEA 3EO0B 3E0VA 2F6KA 2PABA 3H9ZA 3UBGA 4LLMA 5C3TA 1GY1A 2JB5L 5AW9B 3NZRA 4IBLT 1DR9A 4YHZH 1HSBB 3KOYA 1T1YB 3BWAB 3UR2A 4JQAA 3JS3A 1JZFA 3GJEB 3ISIX 4UTCA 4CU8A 4DNHA 2EABA 2XN2A 2UY7A 4PJHA 3P6LA 3D39E 4WXYA 4NU7A 3DXAE 1BBJB 2FEEL 4FRWA 2BSLA 1D5MB 3B6SA 1UCBL 2Q3OA 1LHZA 4KDTA 3D69A 3IAQA 4TSAL 2WJEA 2E1WA 3NESA 2GUOA 2UY3A 4K7VA 3QNFA 3FU7A 1MCDA 1HEZA 4MFEA 3D3AA 3LENA 3BIAX 2YXXA 4H3DA 4RMSA 2OQJB 3WIHA 3AXLA 3EBGA 4DXVA 1NDTA 3CHEA 1TMHA 3QUYA 2WTRB 4HSNA 4KZDL 1KFCA 3B37A 1Y0LB 4IGNA 3OVQA 1SFDA 1WA1X 2VXSH 4E42A 4UM9A 1D2PA 5B1BB 1LYXA 3VUSA 2G30A 3UZJA 3HFTA 2F9RA 1P48A 5ICXB 3D85A 1SRDA 5DYFA 4RSVA 2QQKL 3D05A 4NZTH 5C0BD 3V10A 2ED8A 2CPUA 3IMWA 2GG1A 1AA1B 1NA8A 3BANA 1R3KB 1WK0A 2V5CA 3ZKNC 4ZPVB 2YLKA 4XRCB 1CLOH 1KIPB 3NRPA 3SJVB 1BWVA 4ENED 2YL9A 1AGEB 1MSSA