1QI4A

Mutant (e219g) maltotetraose-forming exo-amylase in complex with maltotetraose
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
418
structure length
418
Chain Sequence
b'DQAGKSPNAVRYHGGDEIILQGFHWNVVREAPNDWYNILRQQAATIAADGFSAIWMPVPWRDFSSWSDGSKSGGGEGYFWHDFNKNGRYGSDAQLRQAASALGGAGVKVLYDVVPNHMNRGYPDKEINLPAGQGFWRNDCADPGNYPNDCDDGDRFIGGDADLNTGHPQVYGMFRDEFTNLRSQYGAGGFRFDFVRGYAPERVNSWMTDSADNSFCVGGLWKGPSEYPNWDWRNTASWQQIIKDWSDRAKCPVFDFALKERMQNGSIADWKHGLNGNPDPRWREVAVTFVDNHDTGYSPGQNGGQHHWALQDGLIRQAYAYILTSPGTPVVYWDHMYDWGYGDFIRQLIQVRRAAGVRADSAISFHSGYSGLVATVSGSQQTLVVALNSDLGNPGQVASGSFSEAVNASNGQVRVWRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (EXO-MALTOTETRAOHYDROLASE)
molecule tags Hydrolase
source organism Pseudomonas stutzeri
publication title Roles of catalytic residues in alpha-amylases as evidenced by the structures of the product-complexed mutants of a maltotetraose-forming amylase.
pubmed doi rcsb
total genus 148
structure length 418
sequence length 418
ec nomenclature ec 3.2.1.60: Glucan 1,4-alpha-maltotetraohydrolase.
pdb deposition date 1999-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09081 DUF1921 Domain of unknown function (DUF1921)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1qi4A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1qi4A01
3WUBA 1V3MA 1HVQA 5LA2A 4W84A 1HJVA 5ABFA 3VGFA 2XG9A 3UCQA 1KQZA 4ZENA 3WKZA 2YL6A 3LPFA 1E4IA 1H49A 2YL9A 3AHYA 4D6FA 1UZ4A 4V27A 2ZUSA 5A6MA 4NXSA 5I78A 1E0WA 2V38A 4R5EA 1TCMA 5FL1A 3ZQ9A 1W9VA 1KBKA 2ZXQA 1J9YA 4EK7A 1MYRA 1W1VA 1CXFA 4RE3A 3VSUA 3D5HA 3WNLA 5BXTA 5A2BA 2XJ7A 4KRTA 1PS3A 1V08A 1FH7A 2XM1A 3NSMA 4M24A 3CMGA 4MDPA 1J0IA 1HJXA 3IAPA 3OGRA 1M01A 5BXPA 3W29A 3BGAA 3GZAA 4Z2HA 2YLLA 2WBGA 1BYDA 3EJSA 2EXOA 3FN9A 2NW0A 2EO7A 2TAAA 5DF0A 1NWSA 1AVAA 3T2OA 1VB9A 3AS3A 2JFEX 3K8KA 1JF6A 4B3LA 2V3DA 1CXHA 5A8MA 4AWEA 1QI3A 1E15A 3WDIA 5HPCA 1TA3A 1TQWA 1JD7A 3J7HA 3W82A 4E4PA 3CZJA 1YQ2A 3ZR6A 1E4LA 5A95A 4AIOA 3DX1A 3B9EA 2JEQA 3SUSA 2PB1A 4HMDA 2CBUA 5BCAA 2BVYA 3VM5A 1PZ2A 4AYSA 1JXJA 1AQHA 1LF1A 2XIBA 3AI0A 4UR9A 1E0VA 4AD2A 5DMYA 5IHSA 3MUAA 2ZX7A 4GIAA 1WP6A 1H2JA 1A3HA 3A4XA 1MXGA 3MV11 2D2OA 1CLVA 1QNSA 4GKLA 1GQIA 4GQRA 3WMSA 1KTCA 1UWUA 5IFTA 1B3ZA 4W8BA 3JUGA 1C8QA 3GYCA 5A6KA 5CJ5A 1E1EA 4CUCA 1BSIA 1MW0A 4W89A 3K8LA 2WMHA 3WL0A 3AHZA 1GQLA 1R8LA 3A23A 3SURA 3H55A 2DSZA 3MUY1 4E8CA 1BYBA 4J28A 1JNDA 3GXPA 3GXFA 4AZCB 2OSYA 2GJPA 1H5VA 3RJYA 3TONA 3L4WA 2QHAA 2GVYA 3VUPA 3VIJA 1BGAA 2WZIA 3WQ5A 1SMAA 5BRPA 2V3FA 4CU6A 1V6YA 1HN1A 3PZTA 2O9RA 4W86A 3U5UA 4TXEA 4RL3A 2EAEA 1H11A 5E0CA 3BUPA 4HA4A 3EDFA 2DSVA 2WMJA 4ZE5A 2PF0A 4NZJA 2ZXDA 3CHEA 5DEZA 1J0ZA 2G8ZA 1SFSA 1ODUA 2W63A 2WYSA 1IZJA 1ZL1A 3QHNA 5GQBA 4MDOA 5A6LA 1ZJAA 4Y7EA 1HNYA 1VAHA 5EFDA 1NP0A 4U3AA 1WDSA 1UD2A 5HNNA 1BFNA 1QI2A 1ZB5A 1CTNA 3L4YA 1H0IA 1OIMA 3L4UA 1ISYA 1OT2A 3S5ZA 3ZOAA 4HTYA 2J74A 2PBGA 3VD4A 2WVVB 3VIHA 2O92A 3TA9A 1OGSA 3WD2A 5LYRA 2BVTA 3HG2A 2OYKA 1E72M 4F9JA 4FLSA 2A3CA 4GZIA 3AMDA 3SUWA 4PSRA 1Q6FA 4GXPA 3WL1A 4H8UA 2VR4A 4MB1A 2PWEA 3VNYA 2VVSA 3VIIA 4WKAA 1C8XA 3M07A 1EDGA 3ARTA 4CKQA 1V6WA 1JIBA 1EQPA 6TAAA 4PEEA 3DYPA 2VVNA 1UD3A 2RGLA 1MW3A 4A4AA 1UKTA 4IM4A 2AAAA 3FNDA 4KWUA 2J7FA 1W3JA 1XYZA 3W25A 2ALWA 3A4WA 4AW7A 2CHNA 4UQAA 3M7SA 2J7EA 5A6SA 1EH9A 2WMFA 3KWXA 1CBGA 1UD5A 3PZIA 1M7XA 1KGWA 4AZCA 2DT3A 1XRVA 1XC6A 3BUBA 2J7GA 8CGTA 1QWUA 4XZWA 2VNCA 2WBKA 1Q6GA 3HG5A 3B9DA 4BQ3A 5ECUA 5C8BB 1E6QM 2EABA 4LQ1A 1GZJA 3WY3A 5HXMA 5HPOA 4QLLA 2CPUA 2DEPA 1P6WA 4F79A 3MUIA 1UWIA 1KWGA 3VDCA 3AIVA 3HN3A 1E6NA 1W2PA 3NYDA 4UFJA 3N15A 3SUVA 3APGA 2UY4A 2YJQA 3CHDA 1HKIA 1CIUA 1PX4A 3F5LA 3DECA 5CSUA 1UQYA 3OLEA 2ZWZA 3RIKA 8A3HA 5GNXA 3AFBA 4JFSA 2YL5A 4UNIA 2OYMA 3B9AA 4M81A 5AC5A 5JUVA 3VDHA 3WMBA 3WNKA 1HVXA 5IDIA 1EXPA 1CENA 3WD3A 1OCQA 2DIEA 3D52A 2ZUUA 3ARZA 3VX0A 1E6ZA 2YOCA 2AOSA 3SEPA 2DIJA 2CEQA 5CSYA 3DC0A 3CV5A 4AZHA 2CNCA 2VRQA 2WVTA 2WCGA 1UR2A 1H09A 4TOQA 1E5JA 2OWCA 4PMDA 4XZBA 4PMOA 3HMCA 4PMZA 1FFRA 1LG2A 7CGTA 4W85A 3SCUA 4NX0A 3QOKA 2E40A 3WSUA 4AIUA 3W37A 3BUDA 1C92A 3VD7A 1UUQA 3AMKA 1EO7A 3OIHA 3OGVA 3WNNA 4HPGA 5EFFA 2VUYA 1HJQA 1DWIM 2GJXA 1CZ1A 3HU7A 3N11A 1TA3B 4P8WA 4B9ZA 1C8YA 4WIWA 4D6GA 3EDDA 5C71A 1CXIA 1FH9A 4LXFA 3AMCA 1VFUA 1UH3A 3GXDA 3H54A 4DO5A 1W91A 4GI8A 3L2LA 3AZTA 1HP5A 5A8OA 3BSGA 2PC8A 2WW5A 1HF6A 3WY4A 1RD6A 4HU0A 3BAYA 2WVSA 3RILA 4Z2LA 4AXNA 3PZQA 2VZSA 1C93A 1HWWA 1XCXA 4IPLA 4UFKA 1KWKA 3AYRA 3CH9A 1EHAA 4HMEA 1VJSA 1CLXA 1VFMA 3GNRA 3VD3A 1TQUA 1LWJA 3VM7A 2VT0A 2VCCA 1GVIA 1VENA 1TZ7A 3AHTA 1WO2A 1FFQA 5D4YA 2E9BA 4OOZA 1R7AA 3ZJ6A 1V3JA 3VSTA 3RM8A 2G4FA 4D1JA 2OYLA 2BNJA 2HISA 1MFUA 4CCEA 2XGIA 1E1FA 3W4RA 2WKLA 3IANA 4GI9A 1UKSA 6CGTA 5FOOA 3WQVA 4PN2A 3WN6A 1UASA 3WH9A 1UWQA 4PSPA 1PX8A 4MNJA 3RJXA 3CZNA 1X1NA 3AHVA 4D6DA 1KXQA 4AMWA 4F66A 1LL7A 1HKJA 3AZSA 2X2IA 3CUHA 2XN1A 3DDFA 4FNPA 3TOPA 3WF3A 4NRRA 4TTUA 2W66A 3BVUA 1B3YA 5A2AA 3MSDA 2FHFA 4PCTA 5D9PA 4NZCA 3BAWA 4MB3A 3GXIA 2YA0A 1E3XA 1PJ9A 1R75A 2D0FA 3RDKA 3H53A 3F5JA 4OBRA 1U2YA 1KXVA 4CN6A 1FA2A 1B90A 3L4ZA 2J8FA 5D9NA 2NT1A 1CXEA 2OLHA 3PZNA 4M8UA 4H04A 1E3ZA 4PTMA 3MUZ1 3AIRA 2NSXA 2WWCA 4URIA 3WNOA 4CD6A 5A94A 4M1RA 4F8XA 3UERA 3MO4A 1SZNA 3D4ZA 1TVPA 3GNPA 1HXJA 4UQCA 3CHCA 1CWYA 4UFLA 5CPSA 2E0PA 1TMQA 2YDSA 4HOWA 2WANA 1V02E 4ATLA 3SCNA 3T0BA 2VZUA 5JBFA 1W9BM 3D50A 2VL4A 1JZ5A 3VOCA 3S2CA 3CZLA 3EDJA 3BVTA 2ZICA 4QDMA 1KBBA 1OBAA 3CZGA 1GNXA 1J12A 3TTQA 1K9DA 4UOZA 1GOKA 1CPUA 5D8WA 2J62A 3U5YA 3BSHA 5C70A 5E70A 1E6SM 1E5NA 4OGZA 1K9FA 4BQ4A 2JIEA 2F7OA 2X2HA 3O2LA 1QNOA 1BGGA 3TP4A 3BVWA 3GBEA 1JI2A 1QHZA 4XUYA 4MB5A 2F8QA 5CLTA 3KL3A 2EEXA 3SUUA 1B31A 4PMXA 4WF7A 1JAKA 1EIBA 1UYQA 3NJ3A 4UFHA 1B3VA 2UWFA 3W53A 1V6XA 1FOBA 3F4VA 4TTGA 4C7DA 3CC1A 1NARA 1MWOA 3VIKA 1W9DM 4MB4A 4D72A 2VURA 3AS0A 1CGTA 2WZEA 4DWSB 1JFXA 2J77A 3EJUA 4HMCA 1WCGA 4CN1A 2DGAA 4BQ5A 4X0NA 4MJ2A 5JBEA 3WH6A 4AD0A 5ABHA 2ZUVA 4PRWA 1XSJA 1I75A 3VD9A 4IISA 2XVGA 3RMEA 1JZ8A 3CTTA 3ZT6A 2WWDA 4JKKA 3WBAA 4ZFMA 3WEOA 2WC7A 1EOMA 2Y8KA 2WCAA 4OUEA 4U5KA 3UR8A 1VJZA 2XM2A 1WPCA 1PIFA 1HKKA 3SCTA 3PN8A 4WJXA 2BXZA 3EJQA 3BC9A 3W28A 1V3HA 2VZVA 1KXTA 2WCSA 4GI6A 2YL8A 4WKFA 1A47A 4GINA 3OGSA 1US3A 2PI6A 4ZE4A 2XYLA 2CYGA 4JFVA 1HXKA 2VRKA 2CBIA 3LPPA 4TX8A 2J7BA 2YA2A 3L4TA 2QMJA 2ZX9A 4NF7A 1JF5A 4XB3A 4CCDA 5CPQA 3UG5A 1OT1A 1UR8A 1E9LA 1EDTA 3CZEA 1FHLA 1T0OA 3T08A 4AISA 3PZUA 3QHMA 2CESA 2W61A 3AICA 3UG3A 4GPNA 1W32A 1L0PA 1ODZA 1R33A 3RM9A 3ZJ8A 3ARUA 3U7BA 4J3VA 1K9EA 3SCVA 1GPFA 2YDRA 3WUGA 5LA0A 1G01A 1C7SA 2OWXA 4PMUA 3EMQA 5BWFA 1MQPA 5M5DA 2D0HA 1QPKA 3BAJA 1OIFA 2Y2WA 2C8NA 3N13A 5I6SA 3SCPA 3VMOA 3HZ3A 2VOTA 3DYMA 1AQ0A 4P8XA 2VMFA 1ZBVA 2OSWA 1LG1A 3W0KA 2CETA 2D73A 3BVVA 4S3JA 4S3KA 1J11A 2E4TA 1BYAA 1TQVA 2Q8XA 1BYCA 2WC4A 1UWSA 2O9TA 1J18A 4TUFA 2XTKA 3UETA 1YHTA 1Q6CA 1JZ7A 2FH6A 2WKGA 2FGLA 5I79A 2DSKA 3LXCA 5GNYA 4HPHA 3AYSA 1PBGA 3VNZA 3VDBA 4CD4A 2DT1A 4JCLA 4JFWA 3WQ8A 2V5CA 2DH3A 1GCYA 1J0JA 1EA9C 3KLKA 3LRKA 1JZ3A 3ZR5A 2XFFA 2WM0A 2ZUMA 4U2YA 1UKOA 4E8DA 2FDMA 5DT5A 3AIBA 2W62A 3GXMA 1C91A 3GH7A 1MQRA 1W9UA 3T0AA 3WEMA 1E6XM 1XGZA 4W7VA 5I3DA 1JL8A 1KCLA 1W1PA 2V5DA 2DSUA 1UR1A 1NWTA 1JD9A 4C7FA 1OSEA 3MSGA 2XN2A 2ZX8A 2YBUA 1D7FA 3NDZA 2WSKA 1V0LA 2FHCA 3BH4A 3BUIA 1E6RA 4PTVA 4ACZA 1N82A 1QX1A 4NSBA 1TFVA 1UG6A 3DHUA 1XD0A 4CD7A 2JEPA 2E9LA 4AIEA 3KZSA 3MV01 3MKKA 3W81A 4L4OA 3WF2A 5EB8A 1C7TA 3VGGA 4QLJA 1V3LA 1JZ6A 2D3NA 3ZSSA 1FHDA 1NOFA 1J0HA 3KE0A 4EE9A 3AXHA 3EMCA 3WDQA 1E43A 3AIWA 1ISWA 2VO5A 2XGBA 3ZT7A 3FY1A 2UY5A 3O6AA 3NUKA 2CITA 1OWQA 5DO8A 3IK2A 3PZGA 1BPLB 3T09A 1NOWA 1J10A 3GNOA 4AD4A 3NSXA 1KGUA 1H4PA 1SYTA 3GBDA 4QAWA 1OGBA 1XCWA 2FYVA 2CHOA 1JDAA 3AISA 1U33A 3WNPA 3K8MA 4KMQA 5CLWA 3EDEA 2WHLA 1QWNA 2CKSA 2WMKA 5A6JA 2DH2A 4H8HA 4JL1A 1VBRA 4AZ6A 3GDBA 1DEDA 1EHNA 1OB0A 4D6HA 3WF1A 2GDUA 1VF8A 3RPMA 1PPIA 4DO4A 4QFUA 1GOIA 9CGTA 1CGYA 4Q22A 4NZFA 1DWAM 1V0NA 1JYXA 1B1YA 1TG7A 5E09A 2WHJA 3WEZA 4DWSA 4CVWA 1HTYA 3K1DA 1X6LA 3AXIA 1E71M 1H1NA 4D6JA 4HZ8A 1EDQA 5TD4A 4HA1A 2ZX5A 2UY3A 3MI6A 4HU8A 1KQYA 2EPMX 1WZKA 3IGUA 4CVUA 4UZSA 1JNEA 1I1WA 1B2YA 4JKLA 1LL4A 3UR7A 3WELA 1HP4A 3NIYA 4LYQA 1L8NA 1NP2A 3ZO9A 1QNPA 4W88A 3WDRA 1Q6EA 3EDKA 1W9XA 1LWHA 2Y24A 3BMWA 4P7LA 2OW7A 1QNQA 1E4MM 3ARYA 2CCRA 1BVZA 5ABGA 1HL9A 5KEZA 1E40A 1H0GA 4W8AA 5E0FA 1WE5A 5FIPA 3TTSA 3AIQA 3WFLA 3CIVA 2VZTA 4MNKA 4W7UA 2WSPA 1UZ1A 3KL5A 1PZ3A 2CKRA 5FKYA 3GM8A 1JDDA 3VGDA 2WAGA 1E56A 3E1F1 3G6LA 1J0YA 2E9MA 1QBBA 3CUGA 3VILA 3FHQA 1ISZA 1CGUA 1JZ2A 3IAQA 3VGHA 2ZUNA 2G3MA 2CIPA 2J4GA 1R34A 2V3GA 4AD3A 1G1YA 4LYPA 5IFPA 3WENA 4XV0A 1TQTA 1VEOA 3BAXA 5JBDA 3PHAA 1QI0A 2AMGA 3ARVA 3IJ7A 5A6BA 1EO5A 1XYFA 3BCDA 1OD8A 4Z2IA 4NRSA 4X9YA 2GSJA 5I2UA 2F2HA 3ZJ7A 5E6ZA 1ITXA 1US2A 1ZBKA 3AQUA 2QMKA 2XFRA 3M6DA 3ARWA 3UESA 1SR0A 3T2PA 4FNTA 4AZGA 3EJPA 3FHAA 5FD0A 1ECEA 2HVMA 1M53A 2WMIA 3K46A 4ZXOA 3SCOA 4J3XA 3I3DA 5DT7A 5AYIA 3N18A 2UY2A 3WY1A 3QR3A 1CECA 4HZ7A 4U3CA 5I5RA 1AQMA 2VRJA 2VTFA 4OKDA 1LL6A 4FF5A 4W7WA 2YLAA 1ISVA 1LJYA 5A1AA 2J78A 2WB5A 3CBWA 3VINA 3RO8A 3S6TA 2CXGA 4W93A 1B3XA 5HDRA 4HA3A 2ZOXA 2J7DA 2X0YA 1C3FA 2VR5A 2J25A 1DTUA 5BXSA 3WQ6A 1WNOA 3LRMA 2WLYA 4WSJA 2XUCA 4OJYA 2ZUTA 1HJSA 3CZKA 2PBOA 4UZUA 1WZLA 2BY1A 3A3HA 1VFFA 5D8ZA 3OLIA 2WHMA 4CD8A 2O9OA 2MANA 3WDHA 4CD5A 1ZBWA 4UTFA 2DT2A 3A22A 1GQJA 2EPKX 2A3EA 1UKQA 1R87A 3CO4A 1CNVA 1QI4A 1UD6A 3A6OA 2VCBA 5CGMA 4P8UA 3OLGA 1H41A 1LQ0A 4H8VA 4JHZA 5ABFB 5A3HA 4PTXA 1RH9A 1VEMA 1RP9A 4QP0A 1UKPA 3TV8A 3D4YA 4D71A 4WSKA 5A2CA 4H41A 2QV4A 2DDXA 3RM4A 3WF0A 3CUJA 1EGZA 5CXPA 3KL0A 1WDRA 4ACZB 4JFTA 2G3NA 1PEZA 2WC3A 1UD8A 1TUXA 4TVDA 4BF7A 4PBGA 1MVYA 5A8PA 3AIEA 3DX0A 3ARSA 4QCFA 4LGXA 3CGTA 2O9PA 3ARXA 4WK9A 1HX0A 4P7NA 4AY1A 4D6EA 4DUVA 2DT0A 5F7UA 1JI1A 1W1TA 2XVPA 4AYGA 3BLBA 4LX4A 2FE0A 4KGJA 1LLOA 3AJ7A 1JZ4A 1NWUA 2VCAA 1UOKA 1E4NA 4KRUA 3ALGA 1ZJBA 4PMYA 5FL0A 3NSNA 5CPTA 3MMWA 4TX6A 1QW8A 4Q7NA 1VIWA 1BLIA 3K4DA 2E8ZA 3LXBA 5JIPA 2PWGA 4YPJA 4U31A 1DP0A 5M03A 4PTWA 3WH5A 1PIGA 2W5FA 1OM0A 1VRXA 1KR1A 4GZEA 5DFAA 3LPGA 1DWJM 4IUGA 1V03A 2WZHA 2OSXA 1BHGA 2J7HA 2F61A 3VSVA 2XPKA 3DDGA 3PBGA 3CHFA 1CEOA 1KXHA 4PMVA 4M29A 4W5UA 1GVYA 4EAMA 3OZPA 3MANA 1O7AA 4FMVA 2VX4A 1E6PA 3A4AA 2X05A 3M46A 3W27A 3GXTA 3SCWA 4BZYA 1GW1A 4CU7A 2ESCA 1CGVA 4L4PA 2IUZA 5D9MA 4M56A 3RCNA 3W26A 4FNQA 4AD5A 4HOXA 1G5AA 2W92A 3PTQA 1TVNA 3WNMA 1G0CA 3N1AA 4CCCA 1V6UA 1GORA 3AMGA 3UEQA 3A21A 1MQQA 4P7RA 2CBVA 3D3AA 2EJ1A 2VJXA 2BHZA 2C0HA 1BVNP 2EPOA 4FLQA 1UR0A 1Q4NX 1F4AA 4MTVA 1ITCA 1M04A 4N0RA 1QI5A 4OOUA 1CDGA 4MADA 1AMYA 2F18A 3II1A 2EBNA 3VKKA 1FP9A 1JDCA 2PWFA 3IJ8A 2YA1A 4MPKA 3SCSA 4B3KA 1CXKA 2XHYA 2Y8VA 1QNRA 3W6LA 4FLRA 4U5IA 4P8VA 1BG9A 1O7DC 2WVVA 4JL2A 2DPEA 2JF6A 2BHYA 1W2VA 3ARRA 4XX6A 1GHSA 3WFZA 3G6MA 5BROA 3VIGA 4PMNA 1XH0A 4ATWA 2BHUA 4BQ2A 4K68A 3N17A 4AZ5A 1Y7VA 3CMJA 2DSWA 3ALFA 4NI3A 2D1ZA 2OWWA 1RPKA 5IHRA 3PZVA 4U33A 4ZXLA 3K4AA 4PYSA 1GONA 1ZU8A 4D6CA 1XH2A 4M82A 3VGEA 1MW2A 4MNMA 4DWSC 1ISXA 1GOWA 3PTKA 2C7FA 3ZMRA 3U57A 1QOXA 4HOZA 4F9DA 2WNWA 2EPNA 3OLDA 3W38A 1E70M 5EMYA 5GNZA 6A3HA 2EQDA 1S46A 2G3IA 4BCEA 5A8NA 3ECQA 4E2OA 3EJTA 5LA1A 1TQSA 2XN0A 2EPLX 3VX1A 2X1IA 3I3BA 1VBUA 1EOKA 1JFHA 5CZKA 2QPSA 3GH5A 2YFOA 4QLKA 4UQDA 3DX4A 3U7VA 2X2YA 4UFMA 3GXNA 4J3TA 2J75A 2VX6A 4YHEA 3SIMA 1RP8A 4D6IA 2FGZA 3WF4A 4B16A 3OZOA 4KGLA 5HBFA 2QLYA 1W3KA 3WDPP 3T2QA 1JYVA 1J0KA 1OD0A 1PAMA 1B0IA 5I24A 2VX5A 4GQQA 4B9YA 2X0HA 1BQCA 5E9AA 1B30A 5I0DA 3QOMA 4JHOA 2A3BA 1R46A 5GPRA 1GOQA 5A6BD 4D1IA 1V0MA 5I23A 1NH6A 4YHGA 2YIHA 2IXVA 1VEPA 4MAVA 2Z1KA 4TVUA 1V3KA 1Q6DA 3MMDA 2J7CA 3A24A 1R85A 2W4XA 3IJ9A 5CGTA 2WVUA 3OBAA 5KZ6A 2D3LA 3POCA 4IPNB 1CYGA 5BXRA 4BS0A 1G9HA 3GH4A 1V3IA 1ZBCA 4FNUA 4UQEA 3PZ9A 1TR1A 3AIUA 1NWRA 4AZIA 1J01A 1JYWA 4JIEA 1C90A 2CBJA 3OB8A 3SCRA 3MMUA 4P7QA 4RE2A 4HZ6A 2X09A 1UR4A 3FXYA 4AEFA 4HP5A 4ACYA 3WDJA 3PTMA 1CXLA 2X8RA 2Y4SA 3VU2A 1UQZA 2EACA 1HJUA 2VZOA 5I77A 4JFUA 4PMRA 1PX3A 1KB3A 2XVNA 2XVLA 3QHOA 1WZAA 1R47A 5M17A 3WD4A 1XH1A 3PZMA 4OZOA 3AZRA 3VMNA 3BLPX 1UWTA 2A3HA 2WHKA 3VTRA 1IT0A 5HOSA 3WH8A 3SUTA 1UD4A 4JAWA 4DUWA 4B15A 4J3UA 1OGGA 2RGMA 4W8LA 4PUEA 2BS9A 3DHPA 1IV8A 3WIJA 1GJUA 3HJEA 4DM2A 4DWSD 1JGIA 4AZ7A 4GZJA 1KGXA 4PUDA 1WDPA 2GUYA 1G94A 3OG2A 1CGXA 4J7RA 4WLCA 4AEEA 3THCA 5BYWA 3WBEA 1KFWA 3VVGA 5AYBA 1BTCA 5JIWA 2E8YA 4CN4A 1B9ZA 3AROA 1QBAA 5AC4A 3BLKA 1QW9A 4OIFA 3I3EA 4KH2A 1QVBA 1E55A 3CPUA 2ZX6A 4H7VA 3N12A 1JXKA 1QHPA 1XV8A 1GOOA 2F7PA 2A3AA 4PMQA 3TTOA 3L4VA 4N42A 3KEHA 4DM1A 4LYRA 1E0XA 1HJWA 1EQCA 4UOQA 5E1QA 4GO9A 3LRLA 1ZS2A 5A69A 7A3HA 4W5ZA 2QPUA 3S5YA 2BFGA 2XIIA 2VQUA 3VMPA 3EMZA 1U30A 3BAKA 4JZ5A 4CGTA 5ABEA 4V2XA 1XD1A 1X6NA 1NOUA 4QCEA 2YFNA 2D20A 3AS1A 2XSBA 3DX2A 1HT6A 1HKMA 1W1YA 3AOFA 2WLZA 2XWDA 3FAXA 1D3CA 3GTNA 2GJXB 4OBSA 1OINA 1IZKA 2J47A 2BXYA 1SMDA 1E73M 2WPGA 2NT0A 1WAWA 2ZXAA 3N04A 2J79A 4BA0A 1M03A 2ZUWA 3VIMA 2YBTA 2BY2A 4A3HA 1GJWA 2ZIDA 1TE1A 4TVCA 4W87A 1H3GA 4J3WA 4EANA 1UR9A 1CGWA 3L4XA 2VX7A 3THDA 2XVKA 4FNSA 2DQXA 1BF2A 4C7GA 3NDYA 4UQ9A 3NCOA 1HL8A 1FP8A 2JIWA 2IGTA 1V02A 3BXWA 3WQ4A 2B31A 3WD1A 3A5VA 4ML4A 3AMLA 2YKKA 4FK9A 1UH2A 3CUIA 1MXDA 3UG4A 5D9OA 5A6AA 1K6AA 5FCZA 4Z2KA 2ZWYA 3CZ8A 2G41A 1B3WA 3BCFA 5E6YA 4J27A 4PCSA 3WMCA 2EADA 1VFOA 7TAAA 1K9TA 1WB0A 3LXAA 2W91A 3O9NA 3WY2A 4MNLA 2GFTA 4ZEPA 1MW1A 1V0KA 3QGVA 2CERA 5CG0A 1WDQA 2GK1A 4R27A 1UH4A 2QF8A 1UA7A 5M3WA 2G3JA 4DO6A 3L2MA 3EBVA 2W67A 3T0DA 2F7QA 1MFVA 3VD5A 3BVXA 1I1XA 4AD1A 2D23A 2V3EA 2D24A 4Z2JA 2GDVA 3WQWA 3VDAA 3VIOA 2BV9A 2D0GA 1DHKA 1UWRA 3ARQA 1JYNA 3HG4A 1D2KA 3CLWA 1GUVA 1W3HA 2BY0A 3EJRA 1GHRA 5EBAA 1JG9A 1JAEA 2WMIB 3ZSTA 3DX3A 3CUFA 2BVDA 4V28A 3ZJKA 1O6IA 4GO8A 4P7OA 1WZMA 3VIPA 3N9KA 3MS8A 3BMVA 2F1BA 3LMYA 4FNRA 3OA5A 2XWEA 1KR0A 3ZIZA 2PWHA 1DWFM 5A8QA 1DWHM 3EYPA 2FHBA 2J8GA 4MJ4A 3VO0A 4MAZA 2VC9A 2ZE0A 3ARPA 5IXEA 1R86A 4Z2GA 1BAGA 1GQKA 3ZM8A 1WKYA 2XSAA 2FH8A 3VPLA 1HIZA 1V6VA 1NQ6A 1GOMA 2D22A 3B8SA 4AMCA 1F4HA 4UFIA 2X2JA 4ATDA 1DWGM 2E3ZA 2ZXBA 1NM9A 1UHVA 2WK2A 3A47A 4J3SA 3LX9A 5CQ1A 2JALA 3POHA 3DYOA 5AY7A 4DUXA 5BRQA 3VGBA 4UQBA 4WKHA 3WUFA 4A3YA 4FLOA 3FAWA 2GK1B 1W3LA 2VI0A 1KTBA 4H2CA 3HG3A 2YDQA 1XSKA 1Z32X 3BAIA 4LPCA 3D51A 2PWDA 2F7RA 3KLLA 3AS2A 1BG4A 1UA3A 3W24A 2Z1SA 3FW6A 4UCFA 3AHXA 4UOJA 4AZBA 3F5KA 3SCQA 4CU8A 2XFYA 1KCKA 1QHOA 4AC1X 3PZOA 3ZT5A 3CZSA 2JF7A 1R7OA 4EKJA 3AXXA 2Y5EA 4AMXA 4YN5A 3WH7A 2WXDM 1ESWA 4JCMA 2WMGA 2GJRA 4M80A 3W6MA 1XHGA 4U2ZA 3LPOA 1W9PA 2F1AA 3BUQA 2BY3A 3TTYA 3MU7A 1FH8A 4JKMA 3WUEA 2OW6A 2VQTA 4NXKA 2IXUA 4X0VA 3WD0A 1XSIA 2JE8A 3VIFA 4RE4A
chains in the Genus database with same CATH superfamily
4I3GA 3P30L 3C8HA 2XA3A 4HISA 4RQQA 2VDMH 2X4OB 3WUBA 5HOSA 1RFDL 3HAEB 1NMAL 2FJHA 2A9NL 4JFFB 4UTBL 1Y6NR 4LLYB 3SE9H 4CSPA 3IARA 4NENB 3VGFA 1TRDA 1CF1A 2Q7YA 3HI6L 4P2OC 4INFA 2XG9A 4NWUH 5FPIA 3UCQA 1YEHH 5LHEA 3WKZA 2NCMA 4QRSB 5D7SL 3QG7L 4PLKC 3UAFA 5CD5C 1Z9MA 1X38A 2HVNA 1WEJL 2YL6A 4ODBD 4R7DB 1UZ4A 4ELDA 4K9EC 3KYKL 5IZ7A 4DVRH 5KWYC 2QVMA 1LO3H 2BVEA 5CCKH 3ILDA 3EXRA 5JUEH 1E0WA 1TEFA 4O1CA 4AVHA 1BAFH 1O12A 1TCMA 2HVKA 3KXFB 2HXTA 3NXLA 5D32A 2BDNL 2V8MA 5E51A 1GIGL 2O6FA 4S3FA 2J72A 4B5WA 2ZXQA 3ARFD 4N2CA 1RJCA 3USBA 1BM3H 4NAFA 3VA8A 4GKSB 1AJ0A 3MLUH 4P59H 1FL5B 4LCWD 3F7VB 5HYQA 1U1JA 1MHPL 5J5RA 3GVVA 1DEEA 4EK7A 1H7PA 4RE3A 5TH2B 3D5HA 3WNLA 2FX8H 2XJ7A 3MQTA 2HK0A 5LJYH 5DZOA 2X1RA 3FTGA 3NSMA 3D06A 4LRNL 3MLYL 1G84A 4QRUB 1A4LA 3QQ4A 1JTTA 3KFTA 3CMGA 5ADOH 2QVIA 1XYBA 3G2GA 1WGOA 2VW4A 4QWWC 4XNUH 3T65B 2AV1A 1BXCA 1TITA 4IU2A 3O41A 3IAPA 5JHLA 1PSKL 4YFLF 1HJXA 3GUTA 2YGNA 5B7FA 5GS1C 5BXPA 3CSTA 4QXUL 3W29A 1U6AL 1PKQE 1ZY9A 3C3NA 2YLLA 2LTQC 1KIQA 4GYFA 2WJFA 3E0VA 3V0TA 2J1WA 4P2RB 4U4BA 1HH6A 1W6WA 3RVTC 2AJZA 2IADB 3N41F 3GZPA 2GPZA 3LKPA 4XX5A 4P2VA 4RDWA 1IAIM 4OJCA 4L1LA 4M8QA 4DZ5A 2NW0A 1R6WA 4J3OG 2TAAA 5FF7A 3IWUA 1S39A 1NWSA 1KYFA 1Q9LB 2JFEX 4J1UB 3HLAA 4IJ3C 5GRJL 4N9GA 1YLBB 3HZVB 4B3LA 4PMFA 5HJGA 2V3DA 2W5PA 3ULUD 1EZLA 1CXHA 4WHTA 1Z6KA 3IS0X 1QI3A 5DEJA 5DJYA 3QJTB 4X8JA 2XINA 3LCXA 4N25A 2Z1PA 4IKNA 2Y7NA 3DSNB 3D3FA 1TA3A 4WUIA 4G42A 4OZFB 5DEFB 5AENA 5J13C 1WC7B 1N5AB 1RZGB 1KC5L 1TQWA 2VLRE 1DQWA 5TDPB 3J7HA 1DTNA 5EPMA 4F7PA 3W82A 3MBXH 3CZJA 3ZR6A 3MA8A 4L1BA 3VFSB 2Z0BA 3O0RH 5EF0A 3BPWA 1E65A 3DX1A 5K2ZA 3GTFA 5F6HI 2J6XA 4AUUA 3E9AA 5FW6A 2VKXA 3ZQXA 2YN3A 2VKZG 3K6DA 3KH4A 3N42F 4QXTA 2I16A 3O8AA 3DBXB 3W7QA 1IM9B 3LIZH 4NNYA 2DQUH 3O6MH 4OFPA 4ZMLA 4A7VA 3BV7A 1IJ9A 4R7NA 2D7OA 2WXIA 4IWWA 1L0YA 1JV2B 2EXYC 1J5HA 4DGVH 1A6AB 4IMLB 2EO9A 2OX5A 1TPH1 3K2UH 4ONGL 3CFJA 2QR0B 4Q4EA 4OFCA 5LHFA 43CAB 3QORC 4M7SA 4X6EB 3D3VB 4QCIA 4LEXL 4LSRH 1U5HA 1Q90A 4GIAA 5FUZL 3VFVB 3W11C 3UR5A 4NO5B 1SFTA 1SUXA 1H2JA 3P8IA 4HCHA 1IFHH 2AJ3B 2D2OA 3CVDA 5I1KH 1GY1A 4REQA 4IQDA 2WZTA 3TNNA 3KBMA 2DL2A 1T6MA 3U6XS 1B3ZA 5DC0A 3FFCD 4NHUA 1XF4B 4KQ0A 1UQSA 1XQ4A 3HS9A 1S5HB 3BRDA 3GYCA 3H26A 3ZWSA 3VQ1C 5A6KA 2EKSA 4PYHA 3GDKA 5FYLE 3PGFH 1JJUA 4WW1B 5K39A 1DVUA 1OF2B 1T1XB 3RJOA 4DGWC 5J1AB 3ZMEA 4ZD3L 2JI1A 5CS7A 1DN2A 1E1EA 2VC5A 3DXAB 2DLTA 3AJXA 4GYJA 4ZQNA 3C6LD 3WL0A 3D9AH 5I30H 3AHZA 3SURA 1R8LA 1XBDA 3A23A 1NGPH 3EWUA 3CQQA 4LE8A 3CIAA 3GRWA 3MUY1 2DSZA 3TYEA 5AOJA 4CNOA 1NWPA 2DBLL 2DDQH 2ZKXA 3TIDB 4LFHD 2UYLB 2HVJA 4PWGA 3BGJA 3V0IA 1RCYA 4OLUL 2YOAA 2AV7B 3MYOA 2F15A 1BZ7A 5T1KB 5EU9A 3GXFA 1TJGL 3DAQA 3SECA 3T1GA 1MXSA 4WIQA 3UU0A 2WP3O 4QIRA 3W1NA 5CF3A 1DOSA 3MV8D 2WV8A 12E8L 1HC1A 4XCCL 4LANA 2QHAA 2GVYA 4DVBB 1F5ZA 1C9DA 3PHQB 4WV1A 1Z0MA 2VE6B 1SMAA 3S3DB 4GWEA 3WJMB 3VXGA 1FA4A 4QY8A 1KC7A 2UZYA 2ARJQ 4AV4A 4XHQA 4OZIA 3DCPA 2IKJA 3DKLA 4R26L 2ZOKB 5GS2D 1KJ2B 3UZXA 2IDFA 3BWUC 3P3UA 4TXEA 1Z5LB 3BICA 2C26A 2F9RA 1DSFL 4KQ4H 3FOMB 5E0CA 1PKQA 5HYSB 3U8GA 4Z7UE 1A7OL 2DSVA 5F7LB 2Z92A 4PIBA 1E50A 2DD8L 4ZE5A 3S6DA 3L9YA 4IMAA 4NZJA 1SDAB 2EXWD 4YX2H 3VKBA 2PYED 3UFIA 2VAAA 3KGUA 3S0PA 1G9NC 1KLGA 1QG3A 2GHWB 2WQ8A 1FWDC 2GSGA 3DXAD 2Q3OA 5F4XA 3HE6B 5F2MA 5C0QA 2COVD 1IZCA 2B4CC 2EDLA 2JCCB 4L4VB 3N9RA 2K4AA 3LEXB 1R3SA 1J0ZA 3EPNA 4MQXC 5DQ9B 4KKNA 1HYSD 4HSHA 1ODUA 5C0FB 2CE6A 2MOGA 3IU3B 3QIWA 4TLUA 5D7JC 5HD8D 5T1MA 3ZE2E 4PD4K 2QYGA 3HR6A 2Y22A 5A6LA 3NQ8A 1YRKA 4GBXB 5B3SB 3DHMA 1Q9KB 5FSDC 1PNDA 2IQAB 9XIAA 2ZWKA 2GVJA 3WEBA 4NUGL 1WDSA 2E9GA 2EICA 2V7NB 3QI9A 3HI1A 3SE3C 3WI9A 2OK0H 1UD2A 5EZLA 3W73A 2HFFA 3RWHA 4H4NA 1LMIA 1Q6QA 1J5IA 1YE4A 4QRQB 2V9DA 2XBZA 2X4NA 3KS0J 1YNKL 2C9XA 3CMOH 1ZHLB 4L4TE 4X7CC 3T0WA 5HQLA 5HSFA 1XDMA 4WSHA 3CIQA 1WH0A 4HGMA 5EBWA 1HJCA 2OX1A 3NPZB 4I7ZC 2O56A 5E5LA 4AWSA 1CMOA 3NOYA 5DU7A 4JUTA 3TGXA 1SFJA 1BG1A 1IM9D 4GQGA 3C87A 5GS0D 2MQ3A 3MJYA 2FYYB 3GSVB 4FLSA 5INDB 2VDLH 2ATKB 3T1FA 3GFXA 3FEMA 3SUWA 1AE6H 4NUJB 4GXPA 3WL1A 2WBJD 3ARDB 2TRYA 4KO7A 1T6BX 3L5WA 4WKAA 4LOFA 1KXQE 4R34A 3RVWD 4ES9A 1PZUB 1ZTVA 2ASHA 3H6OA 5E4EC 1E6OH 2R6OA 1YN7A 1UJQA 4AU0A 4GUPB 4WY0A 1JWSA 6TAAA 4PEEA 6PTDA 1U1UA 3TA3C 5IBLD 3M1BA 1PY0A 3T1WA 1OX4B 4QE1A 2Q8AL 1KG0B 2CNZA 2J7FA 3B43A 5C08D 3QAZB 5LVEA 4JQ1A 1FYTE 2AQSA 2ALWA 2R7EB 3LPWA 4XPHH 4B5EA 4NN6B 4AW7A 5JLZA 5IT2H 2CHNA 1MDLA 2X0SA 1R3IH 3UWUA 1YO4A 3EGDB 3NTCH 3V6ZB 5BOFA 2J7EA 2ZKHL 4LPUA 2HVKB 3KXFA 3WFDL 3IGAA 5CIPA 5BV7L 4OV5A 4O1EA 3OQEA 1BOGA 4LVBA 4GKZB 2AITA 1PYWB 4H1ZA 3ZHLA 4MKVA 1WBZA 4JHBA 1HEHC 3G5XB 4KVPA 3PZIA 3LMZA 5CC7A 3KWWB 5KSAC 2Q3RA 1BIIB 3IGLA 2GGJA 4QEGA 1W8SA 3SDCA 5J89A 4PWFA 3M7WA 5FAAA 3BX7C 4NZ3A 2Y7MA 1J05B 8CGTA 1UB5B 1QWUA 1OSZB 4OCXL 2NYYC 2G60L 3HG5A 3MBWB 5LBGA 4BQ3A 4IP7A 4DH2A 1I7UA 2OQHA 2EABA 3EFFA 4P2QB 2EXYD 3DJSA 2NXGA 4I6KA 3WY3A 1HEJC 1FCVA 2G2PA 4YZWA 3H6AA 1LLZA 2X88A 3SGDH 1KCZA 3GSRB 1A7NL 2X12A 2IG2L 5DCBA 4MBOA 3U0TA 1W8EA 4AYID 3GSMA 4F9LC 1KWGA 1TPDA 1TPB1 3S3SA 4UTBA 1SJMA 3PREA 2HEJA 2R1KA 3VDCA 4I5UA 3AGWA 1Y1UA 1AD0A 4LBEB 5EU5A 3NQ2A 4HA0A 3NYDA 5DC2A 3DX8A 4Y2OB 4JTKA 3T0CA 3THML 3H1ZA 5DA4A 2PDKA 2UY4A 5DURD 5IKCB 3ABKB 2HFGH 1OPGL 5I7GA 3QFJB 4JFDB 1KBLA 1HHHA 4G71B 2BO0A 5C0DA 4DZ8A 4RETB 3WKNA 1JEZA 5EU7E 5J11C 2OMZA 2YPKA 3Q13A 5SX5H 4JFSA 5LGYA 1TELA 2YL5A 2XI9A 1UZ8A 3NAAH 5HGDA 4UNIA 2OYMA 4LVFA 5TBOA 1S3KL 2AF2A 1RUML 4HK0B 3RGHA 3VDHA 3VXTA 3MREB 3ZBMA 1FWNA 1QBLH 1EXPA 2R0KL 5ICZB 3DZ1A 1OCQA 1M3UA 3WD3A 1EMTH 4RDQG 3VG0H 5CR8A 3DTUB 2BGSA 5CKSA 2ZCKH 3HW7A 4E5XB 3ARGA 3HN5A 2ZQ0A 2FBOJ 4KO9A 1JPST 3UGRA 4HUWB 3S0CA 3GDMA 5EO1A 3UEZA 4PGJA 1OCNA 2GK2A 4M5ZL 5GS1B 5DELA 4NC0B 2VDHA 2IPFA 2AOSA 3K1GA 3EJCA 3QG7H 3DC0A 4EDXA 4NQQA 2Z31B 2WVTA 4RSYA 4AZHA 3V5KB 3BJTA 5TK2A 5LNVA 2WCGA 2VDPL 4U7SA 3I9GH 1OAQH 4M6AA 3VW3H 1E5JA 1D5ZA 2OWCA 4K9EL 1IC4L 1BQHA 2DKMA 1M68A 3RCYA 4D2NA 4O1FA 4LCRA 4Y4FC 4WTWA 1UXSB 4FKEA 2BVQA 1XIIA 3FDGA 3P4NB 4KXCA 4XAWH 1K3IA 5C0NC 5L6YH 3BI9X 4A2LA 3G1HA 1PD6A 4GRMA 1A7RH 3C2SA 3VE7A 5A2KH 2FMNA 4JM2B 2WTOA 1A14L 4MMYA 1I8IA 3FRPA 3QG6B 4W85A 3HRZA 4K8RH 2CJSA 4YBQD 5FKAA 2B7QA 4K23H 1L6ZA 3WIFA 4JFQB 4KZEH 3F4NA 4NQVB 4L9LB 3F7QA 3M5XA 3LHPH 4PB9L 3WS6C 3NIGB 1T4WA 2W1NA 3O0RL 1DV7A 4ZGYA 1IGYA 1ZGLA 1P7HL 3VSQA 1MZRA 1F6LL 5J1TC 4IG2A 5GRZA 4RZBA 2L04A 2VLJB 3H9SE 5FM5O 4MX7B 1DWIM 3FSTA 3QUZD 4Z3EA 2ZP0T 3HLKA 4JBSA 1CZ1A 3NQMA 1FZOB 2J88L 3N11A 4M5YH 4B9ZA 1WC7A 4NQEE 4O8AA 1QNVA 4WIWA 2UV3A 2EUVA 1CLOH 1EFZA 1CXIA 4L2YA 3ALXA 1U8JA 1W15A 2BWDA 2VXUH 3PJSB 3WJLC 3NXFA 4XZIA 1QOPA 4GG9A 3W1QA 2PYEA 1RCQA 1MJ8H 3QE5A 2W0UA 3PDOB 4GI8A 3E0IA 1A1NB 4PUJA 4RW5A 4DP7X 1IIIA 4K7PY 4Z95L 3P9MB 3MO1A 2Z2BA 3C60A 2NY5C 4KZCA 4Z0BH 1ES0A 2H6PB 2H8PB 3W1LA 1KM4A 3WL9A 2ZSVB 3C5SA 3QH3A 3YPIA 3AM8A 3B6SA 3N42B 4LQFH 5F93C 3P4LA 4HU0A 3G77A 4AENA 1D3GA 5A6IA 3W7DA 2E86A 2VM4A 1J8HB 3PY2A 4IMDA 3IGKA 4BJLA 4RV8A 2WVSA 2BNQE 3RILA 1GPOL 1XZ0A 2A0LD 4PV8B 4F2EA 1WCBB 3Q8BA 4ZX4A 1CB2A 2VZSA 2XWRA 5GRVK 4B9IA 3LHTA 2CHZA 1C93A 1I8KA 1BGXL 1HWWA 4AKOA 1J9CT 2DWTA 4DWHA 2WPBA 1O95A 3KBEA 5DRXB 4IPLA 1SRDA 3HHMA 1EXGA 2Z2UA 5ADOL 3QUMH 4XOAA 3L9CA 1J93A 3DC8A 3LK6A 4WFGD 3T9WA 4U05A 3ULUF 4NO2A 4P5SA 4XODA 3CH9A 4S3AA 4C47A 5CPMA 4HMEA 3ILPA 1R38A 1CLXA 3RUGF 1D6VH 2IO5A 1VFMA 4HVBA 2DJXA 1S3RA 5E99L 4CSTA 2K78A 3AYVA 1TQUA 5F7EL 4MASA 4FG6D 3S5LB 3GFYA 2X6CA 1LWJA 1MI5E 2EP6A 4NU7A 3DDMA 3U2OA 4MAUH 2VCCA 4O54A 3M88A 5HHNA 3W83A 3PUUA 1XISA 3M6YA 1HJBC 2CM6A 2I1OA 1KV5A 3TX9A 3WJWA 4MNHA 1E8ZA 5E08L 1BFTA 3AQXA 4J2QA 4IQLA 2NUTB 4AK2A 2FGBA 3MNVA 4ZO8A 5D4YA 3VI2A 1E8YA 1A4BA 4ODHH 3TW6A 3JTSB 3ZJ6A 3V4VL 1V3JA 2ZF9A 3QZEA 5T3XE 4GYPC 5ELIA 3BW4A 5DJ2B 3WV0A 4BWTA 5FXCH 1MNZA 4JQ3A 1SXZA 4JFPB 3D0LB 2C9AA 2CMRL 3O0LA 1FWEC 1EAOA 4AG4H 5MHBA 4N2YA 1UUNA 1MLBA 2A83B 2MNUA 1A3XA 2YMOA 2DOCA 1KTRL 6CGTA 3VXQA 3DIFA 1CLZH 1I1AC 4HUCA 1LOSA 4DJMA 3OKMA 1XCTB 1UASA 3VXSB 4HKXB 4GAJL 3WS6A 5IFJA 1XZWA 1A5SA 3EJYD 4XN2A 1UWQA 2L8AA 5HVFB 4X63A 3W86A 5H94A 3QYQA 2WGXA 1LEKB 2EECA 4REQB 1J2BA 3QXWA 3GI9H 3GMQB 3P73B 4ZPTB 1ML0A 4F2ME 1F6AA 4D6DA 1A5BA 4EBQH 1AG0A 4AMWA 1KF9B 4S0SD 2V9UA 1M7OA 2PDPA 3KX6A 3F8UB 1OFRA 4DW2L 4Y16C 5B39B 4PJIA 3DDFA 1IC7L 2YD8A 4G9FA 3GSRA 3ASWA 4NRRA 5FUOL 3PWGA 2NY3D 2V17H 5A2AA 2V9RA 2ZRYA 4FA8A 4OGAC 4C6NA 3LHYA 5DK2A 2D7TH 2R7EA 3WTTA 4PCYA 3M17B 2FPVA 2VXTH 4CC4C 5I8KH 3B2PA 4MB3A 3WEXA 5KZDA 3GXIA 4XXCA 4M6NL 4O4YH 5XIMA 5B1AB 2YA0A 2I60L 4U1IA 3QQ3A 4QO1B 3O2WL 4DF0A 1P53A 1JPIA 1IMHC 2ADJB 1CG9B 1U2YA 4MMZB 1JCYA 1KXVA 4TNWK 4AWUA 2VLLB 4UBDD 2OKOA 2X2UA 1JCKA 3BYTA 3OC5A 1VADB 3KW8A 2MH4A 3L4ZA 4WTQA 1NFAA 3ULSB 3ATFA 5GISL 1S2WA 2J8FA 4PL1A 5I03A 1CXEA 1Z3GL 5EZLB 4JN6A 4M8UA 3MRIB 3MBWA 3L0KA 1E3ZA 1PKMA 2X7LA 3UAJD 5AOLA 3QJFB 4YK4C 3TA3D 4PTMA 2G97A 3PGDB 3LIUA 1NIFA 3WNOA 2WKOA 1CFQA 4OGQC 5I1LB 2CRZA 1IGFH 2VW7A 4FJYA 5AVUB 2A9MH 2C9SA 1RZFH 4M7JH 3L23A 1SZNA 2VAAB 3F05A 1KJVB 3LAFA 5IGXL 3B7RL 2BJMH 4XP5L 2DBLH 3WXWH 5JW4M 3CFMA 4JRYE 3CHCA 4MFDA 5HDQL 1TMQA 3TZVC 1S9WB 4L8SB 4OLZH 4OZHB 5MI0B 3TA3B 5I30L 1HL4A 1U8MA 4LO9A 3C2EA 3TCEA 1WBYA 2J8HA 2WANA 1RPUA 5KVDL 1ET5A 1I9RH 1CD0A 3PWNB 5FDYA 4B9CA 1QZ1A 4FR1A 4W4NA 2VZUA 3V18A 4N9DA 1HWHB 5KZMA 3D50A 5LBSL 1EEYB 3C5ZD 3QORB 2SFPA 1DQDL 1JPTL 4JIPA 1JZ5A 3KBNA 3D5OF 1EXUB 2QFPA 5E8NA 5I16A 4PJ7F 1KY6A 3S2CA 2VWTA 3ZZQA 5H91A 4IHBA 1QUNB 1W72L 4GEJA 3V0HA 3KDNA 3DVFA 5DJ6A 5TE4H 4PP2B 1JCMP 4D94A 4CC1A 4MLSA 4L0ZA 3BK0A 1WBJA 4LL4A 4PJCA 1ACYH 3JUYA 4EPSA 2REQA 5EPDA 5H2BB 3OXRA 1RIUL 2VUNA 3MFFB 2RCSH 5C70A 3PL6B 1RXOB 1S7XA 3A6BH 1M7DB 4YGVA 4QROA 3EO9H 2CBPA 4OGZA 4POYA 3LZ3A 3FSOA 3MROA 1RZQA 1MRFL 1C1EH 2EH7L 3MLTB 2QDEA 3FA5A 1MUJA 5ESVA 1T04A 1Q85A 4GYPA 4LVGA 2VUOA 1ETJA 3PABB 3EXTA 1Q2RA 3BP7B 1GTFA 2F7OA 2GTZA 4XPHL 4D2JA 1D2PA 3ATDA 1BF6A 4KK9C 4GAAA 1BGGA 4PJ9A 4PM1A 2WOQA 3PPGA 1JI2A 5H8MA 5LNRA 4R96A 5IVXF 2NY1D 3CFEB 3A4JA 4UM9B 4MB5A 4L9ZA 2VDNL 2F8QA 3W7IA 3SDDC 3U4EB 1GC1C 4LDCA 3SGKA 3NN8B 2O0TA 2I57A 4GABA 4UIKH 5CLTA 5ANMA 3FMGH 2Y85A 3SUUA 2YXWA 2GSMB 3MRHB 1I8IB 3FRPB 2HWZH 2WSDA 4PB0H 4PMXA 3ROLA 4EN3B 1JAKA 1AJ7L 1KB9K 1S38A 1UYQA 4F8PA 1NOLA 1R19A 4OWGA 1H3XA 1CR9H 2PUQT 1SGJA 4UFHA 3GHEH 4ERGA 4X80H 4JJHA 1NDGB 2UWFA 5DHVB 3T2NH 2H26A 2C1PB 2Q76B 1DJIA 3OAWA 5FKPA 2A77L 2XKSA 4BSVB 1GYUA 4NSKB 1POKA 3H7RA 2FIKA 4HHLA 3V0SA 4MYWB 4NQCE 3KBPA 4B90A 4DPPA 3BW9A 4RMBA 4YHZL 4GY1A 1QLRB 4PBDA 3F4VA 1HINL 7REQB 1XLEA 4KHTL 1UPPA 5TFSH 3V55A 2BRRH 4F33B 5KVDE 1NARA 3TYAA 3VIKA 4Y19D 2DQCH 1XH3B 1IO4C 4MB4A 3QO1A 2DIBA 3MRGA 1MFCL 2WZEA 2OR8A 5JXAH 1PB0A 4DWSB 5HNTA 5LGZA 3OW1A 3MN8A 1J9RA 1EJRC 4B7IA 5D2NB 3IPWA 4O00A 3SE8H 1O0VA 3CH1B 3MREA 2H3NA 5KS9B 1Q13A 4QTFA 1YZZA 1ZJIA 3GT6A 2K0RA 2X41A 4ELME 4AH2B 4CADA 2I27N 4KITB 5TPWH 2D9CA 1ES0B 3GRWH 5IREA 2TRHA 4MJ2A 3CV7A 1EEZB 1MCQA 4J2PA 1F76A 1CUOA 2BSSB 3P3YA 3SBWC 3KUMA 4L3ED 1EGVA 1MCEA 1K2DA 2QS8A 2DYSB 3IUIA 3KVMA 3MAWA 4HQVA 5K59E 4F40A 5KINA 5JO5A 2XVGA 3GKWH 3GSXA 2WD0A 2VLJD 4ETQB 1WOAA 3WLLA 3CTTA 1LDSA 3EX4A 1OM9A 2VR2A 1EOMA 4X5XA 3MWAA 3AACA 1IBGH 5JNYB 4NOFA 1VJZA 4Q33A 2ADFH 1WHPA 2FSEB 1WYIA 1UWEL 2DF3A 1PIFA 4QRPB 3DXIA 1X7QA 1QSEA 2OL3A 1OGAE 1FPTL 3S5LG 2XPGA 4GC3A 3SCTA 4JN8A 1JUFB 2CA3A 3NQCA 4JTIA 2VZVA 3BWZA 3H9HB 2WCSA 3DV6A 3WHXA 4Q9QH 3OV6A 3VOJA 2DMKA 4YO0A 1DCEA 1ADSA 1B3OA 4WKFA 5A5WA 3D7PA 4GINA 5E2UH 2ICES 4M7LL 3GQYA 1US3A 4IBUA 4ZE4A 4QLRA 2XYLA 3K13A 2CYGA 2GOKA 4ZO6A 1HXKA 2YD2A 4RFEA 1FNLA 2K3TA 4OCSL 2E6YA 4I9TA 2CAKA 3LPPA 2R56L 3C0QA 4R4ND 5BO0D 1A9EA 3UBPC 1K6WA 3FSAA 1UBPC 3RN6A 1MCLA 1V7MH 3U9UB 3C3UA 1MH5B 4KXDA 1A9VA 1WSST 3DKJA 3UY8A 2V67A 3N1GC 4ZMNA 1BVLA 3GVQA 3IE9A 1KTDB 4OAWB 4E0RB 4MVBC 4Q74A 4GXMA 2YXVA 2X4QB 2VDPB 4CCDA 1JVKA 3SKJH 2CO6B 1YJDH 4PW3A 3GSQA 1H3PH 5DTFB 2GIMA 4Z7OE 5E5CA 4GMSL 1X5ZA 2IMNA 4RV3A 2M26A 4C6LA 1ANUA 1SHXA 1G0DA 1EDTA 4GVHA 4JLRB 1BJ1J 1T0OA 2XQYG 1LORA 5C2CA 5E6RB 3HGOA 1MFAH 2AQNA 2KH2B 2E77A 1I85A 2BSLA 1IXNA 2A83A 3NSCA 4LSSL 4OT1H 2PURA 4EVNA 3FX4A 3L3HA 5G1YA 4ZDHB 5GS0H 5H37G 1WXYA 1Q8MA 3UG3A 3PSWA 4XZ9A 2NNCA 2FNWA 3QFJD 4JFDD 4GPNA 1ZE3C 2CBMA 3UO8B 5BVJB 1W32A 1NDTA 1L0PA 1R33A 3MRLB 4IBWA 1JUEA 1S1RA 4JY9A 5DD1H 1X8FA 3UJSA 2PAJA 3SR7A 3F2DA 2WXPA 3LLDA 1BFVH 1FGVH 5SWZA 1WA0X 1UM4H 3TBYA 2FMOA 1ID2A 1K9EA 3IGHX 5CZJA 2LW3A 3H4FA 1T66D 3N2CA 1S9WA 5T5NF 3EFDH 2HJLA 1LO0H 2HJKA 4PJDB 3KP1A 5LA0A 2Q7NA 4P4KB 3DMMC 4Q4SA 4LVAA 2W0PA 2TSYA 3VC5A 1QRQA 1K72A 3CVHL 3KR3H 3GS6A 4IIBA 3EMQA 3H4HA 3UOAB 3OODA 1FDLH 3G6JB 3QORA 5DDHA 2AL1A 5BWFA 1U21A 4HUUA 4NCC2 3JUZA 3ITTA 2BH0A 3FUJA 2A21A 1QPKA 5D8JL 4J2MA 3BAJA 5AWNH 3DO4A 1ZLUH 4G2AA 2ZD0A 3S36L 3C2VA 3NK4A 5HI5D 3P02A 4LOUC 2C8NA 1FL5A 3PXJA 2IG2H 2XZQL 3IDYC 3N13A 3C5SB 3QH3B 4P04A 2RFXB 5I17B 3CLEH 4AENB 1LROA 4YHIB 4UAHA 2CGZA 3CG8A 3E2HB 1AQ0A 3SPIA 3MV9E 1KD0A 2Z25A 3DG7A 4Y1AA 5ERWA 4G59C 4Y4FA 1DVQA 1JMZA 4LHUA 1RAMA 1TZIA 1LG1A 3ZXWA 5IF0B 1NCBH 3CVIH 3B9KA 2BIOA 3TLLA 3U0WH 2PYEE 2ZCZA 3F03K 2XXFA 3VXSA 2B5IB 5DUPL 5C08B 5IMLB 5F2LA 2VJ0A 3AU6A 1X5IA 5AKRA 1HTIA 3DFSA 3U2CA 2DZEA 1GVEA 1OWRM 2G0KA 2A4AA 5CC6A 4Q8MA 4MXQC 2Y1YA 2HLFD 3L45A 4G70B 2DZPA 3NQAA 5KVMC 2O7QA 3QIBD 4PREB 4A6YA 3MA7B 1O68A 4FCHA 4LPTA 5CO1A 3RWDB 4MXQD 1CCWB 3M44A 2HRGA 3MC5A 3TAKA 3TURA 3WBYA 1QFPA 1PYFA 2EDEA 3R7RA 5D05A 3N34A 1JF1A 1LQSR 1X7SA 4QHLB 4M19A 1M1BA 3GMRB 3H2FA 5LXEA 1S5WA 4M62H 4TLSA 5CSZB 3UXFA 1OK8A 2NUTA 1PBGA 4NN7B 3VDBA 3M47A 1IAOB 1U8PB 2C1PA 2JB6A 4LBAA 1KO0A 1PD1A 4YAQB 1UB3A 3ETBJ 4JTUA 1SHMA 3GSUA 2ESVB 2V5CA 1IAKA 4NRZB 3DO7B 4RRPA 1G9NH 1J0JA 4MIMA 4AJ0A 4ADTA 3KLKA 3LRKA 4H88H 3QRBA 4R7XA 4G43A 1NGYA 3ZR5A 1YAZA 5CN1A 4YDLC 3TJLA 1N8ZA 1F1DA 3MV9D 4G7VH 3N9SA 5PCYA 5JHAA 1JHTB 4MA8L 2YGOA 4E8DA 2ALRA 5DD5L 3FUNA 3RVXD 1JGMA 1HSBB 2PKDA 4ODXB 4W9DC 3AIBA 3WEAA 3S9DB 3GH7A 5IVNA 2H32B 5HAOA 3WEMA 2PLTA 5I3HA 4X6DE 1GY2A 3BYYA 2ESVD 3E6HB 4FMFA 3SB3A 3LS4L 5MERA 5I3DA 3PGDA 1UR1A 4WFED 3SKUD 2VSCA 1NWTA 2Z8WC 3L6FB 3D2UD 1OSEA 5E4IA 1PFOA 3MRDA 1TR9A 5FEBA 1Y65A 1OK0A 1XX9C 3IFPB 2YBUA 2DWEA 4GUFA 1KIRB 4I4WA 4P2CG 3RTLA 3HPJB 5A3ID 4W9FC 2A9BA 5ADPL 3B8TA 1S2EA 4N6EA 1YN6B 2E3VA 2BOBA 3VXUA 3CQIA 4FOKA 1MQKH 5GGQH 4PTVA 4HHHA 5GSRA 4PJGB 3EYUH 4KAQH 1BREA 1ZHKA 4LHQB 4Y9MA 4Y1TA 4U1IB 1QFEA 3EO9L 4I7WA 1D6EB 4R7DA 4K5NA 3TH4T 1TFVA 2PDYA 4FQJL 2HLAB 1RIUH 1TZGH 5I8CB 1UG6A 5CGBA 2GDVA 1INQA 1S5IH 2K8MA 3DHUA 2P10A 5F1VA 4NAJA 3RGVC 4CDGC 2JEPA 2FLMA 5IHZA 2HUHA 4UB0L 3W81A 1L9RA 1UJ3C 3FQXB 1G4PA 2IS7A 3VC6A 4E9WA 3VCLB 3MHZA 2DD8H 4BR1A 4IFKA 4YHOL 1YEWA 3GSNB 3SM0A 1F0LA 4AT6A 3TN0B 1HDMB 3PAYA 3BZEA 1SNRA 1YMHB 3D4CA 1JZ6A 1QP1A 2D3NA 1RURL 3B5TA 4TSBL 3MRGB 2XRAH 2I17A 1JZJA 1V8EA 4R97C 3WUWA 1VGEH 4GLRH 5T1KA 2GSEA 1W3TA 1I1FB 1DVZA 4NX5A 2XGBA 1QKZL 3B37A 3L1OL 1U4EA 5D70L 5FGCE 2MCAA 3TFBA 3ZT7A 1JPKA 5CU9A 5DMMA 4Y16A 1JNLL 3PHQA 1DQMH 1OWQA 3TW7A 3IK2A 3CPGA 3LH9A 1HCYA 2JKJA 3B9KC 4IIQA 4NQUA 5AWNL 1A6UH 5EU7C 2AABH 3SCMB 1FYHB 3GNOA 4GKNB 3LCGA 3ZVHA 1L2UA 1IRAY 1OZTG 3GBDA 1MFBL 1FDLL 4N6FA 1XCWA 5HUOA 2ENQA 2WQWA 1K8YA 5EOCJ 5FO8B 2K9UA 2EVGA 4DCQA 1HE8A 2F54D 1N0XL 5ID0B 2C18A 2XTLA 5HJXA 4HIEA 4KMQA 3SBRA 5CLWA 5IR1B 1QWNA 3TTEA 5D7JB 5F8QC 4B5ZA 4WEBH 5A6JA 1F2XK 1YY9D 3LKNB 4H8HA 4OFKA 1VBRA 1FKWA 3UG8A 1T1ZA 4LCIH 2GG1A 4H20L 2R2HA 5FO9A 2JCCA 3WF1A 4D6HA 1YX1A 1FAIH 3MMEA 1B4KA 1AGFA 5F1IA 2GDUA 1VF8A 1I60A 1CLZL 3M43A 3F5WA 4IFRA 4QFUA 2B1HH 2XZAL 5I6KA 3SPCA 1QATA 1JYXA 4GBUA 1FG9C 4PW4A 3I9PA 4XO9A 4UAOC 2WHJA 3RITA 4PCPA 3ECWA 4I5BB 2DQGH 4NPYB 3O81A 2Y7GA 4HCDA 1HTYA 1QAWA 2C3GA 3N43F 4G9FE 1ZSXA 1WAPA 3ARBA 2XWCA 3AQDA 4AGQA 1UYWL 1JGDB 1VA9A 5DUBA 5A2IH 4KV5E 1P4IH 1XVSA 3G1FA 3P74A 2AJSL 4DPAX 1EDQA 1IC7H 5DMGD 3RL2A 1DBTA 4HA1A 1IFHL 2KLTA 4QXTB 2Z4QB 1SW3A 1N64L 3HB3B 2NQCA 2H3BA 2P45B 2UY3A 3QTPA 4IRJA 4BUQA 5D1XC 3FSWA 4NT0A 3IGUA 1WA3A 4YXLH 1UEMA 3OZ9L 5M95B 3KBVA 1UP3A 3MKCA 3UR7A 5CHNA 3AXLA 3T8VA 2QJJA 3R25A 2OZ8A 3URQA 3AZUA 3VI3A 4MFEA 3VOGA 1L8NA 4E42B 2WXGA 3Q37A 3IMTA 3ZO9A 2GCYB 3KJ4C 1DPMA 2CPCA 5IVOA 3S37X 1MN4A 1KLYA 1Q6EA 1YXCA 4AQ1A 2BOCA 3QUGA 4X6BA 1GYVA 3DA0A 4Q6JA 1Z0NA 3EDKA 4OECA 4R8WL 3H2EA 3UJRA 4F20A 2GUOA 3BDBA 2VDKL 4P3DA 4HGKC 1MRAA 2PGFA 1NGZB 4XP6H 3BIKB 3QDME 3DJ9A 2Q10A 3OVRA 5DMKA 4TNGA 3WS3A 1XGYH 1YTDA 1UWEH 3GTVA 3OQ8A 3H3PH 3RK8A 1A7PH 2GSIB 1RERA 4HD9A 5F9OH 4B5TA 3HFFA 1XRFA 4DK5A 4JRYA 4QRTB 3TTSA 2IANB 3CIVA 3NO3A 3LS9A 2VEFA 2ESVA 2VZTA 4DEUA 3UDWC 2J20A 2WSPA 5DCEA 2WBXA 1QO3A 4Y1AB 1LUCB 3SOTA 5GZNA 5F1OB 1JCNA 1JDDA 4X2RA 1GGCH 2MMXA 1UVQB 2BNQD 1KGIA 3FC8A 3JWNE 3KRBA 1UA6L 2FGWH 4PJGF 1BGXH 3G6LA 4BK5C 3AO0A 1DYZA 2XXGA 1QBBA 3FQUA 4GUQA 1CQYA 1VFTA 3FHQA 4HCRL 1F2JA 4MWAD 1PLGL 1UB5A 3UIZA 1V5JA 2XPYA 4M48H 4W6WB 3QYNA 3UAJA 3AUJA 3KPPB 1PG7H 3S36H 1WKDA 2EVHA 2VXSL 5IQNA 2VDQL 1JUFA 2DQ6A 2V3GA 1A53A 4GW1B 5K7JA 3ABGA 2QV5A 3DUSB 3DK2A 5F4SA 3V0DA 2FX7L 1U0QA 3WENA 4QHLA 4AX3A 5C08A 5IMLA 2C15A 2YCKX 3PK7A 4FXFA 4PB4A 1FNEB 1ZKAA 3MXVL 5F0PB 4ZUUA 3VH8G 2JH2A 2MNJB 2OTWB 1IQ8A 3IJ7A 4L65A 4ZG1A 3WBXA 3UPRA 1EO5A 2AFNA 4QRAA 1AC0A 4U0RC 1L8PA 1XYFA 1OD8A 4QRFA 5MEQB 4YL9A 2GSJA 5DRCA 1RMFL 3QZMA 1TG8A 1OTSD 4XWGH 5D5MB 3KWTA 2HYMA 1CD1B 1AQFA 1ITXA 4IXXA 1ZBKA 2QMKA 5T1MB 4HA4A 1IGIL 1S7TB 3ARWA 3TN3A 4IDJL 5GZOA 5KYYA 1CDUA 3TPUA 2V37A 4FNTA 3TF7C 3KPRE 4NBXB 4LF3A 7TIMA 1A6ZA 3OG4B 4OLYL 5FA3A 3FMGL 3LGEA 4QKTA 4YDJB 4FC3E 1CJYA 1DL7L 1M53A 4NQEA 2X70A 4N2GA 4ELMB 3T7VA 4G43B 2IBZX 2J73A 4GP4B 3N2OA 3CK0L 1VRDA 5AYIA 3V0UA 4AHPA 4UDTA 4JY8A 1F13A 2Q0ZX 5ICXB 4QYOA 2ICWJ 4LSQL 1VACA 2BLEA 2H3XC 1NLBL 1I9EA 1IGWA 4HZ7A 3NZGA 4U3CA 2EEBA 4N2LA 3NJLA 4GG8B 1AQMA 4JEQA 3AFLA 3HOGA 1AQDA 1UBSA 2ENJA 4IIHA 3S1UA 3OXSA 3CV1A 4IICA 4PY8I 4KS0A 4JGJA 1ISVA 1LJYA 2YEQA 5A1AA 2DBJA 3O6LH 1XSOA 3UPBA 4D0CA 2AXJA 4KUCD 1EWDA 4JY5L 4F57H 3IDIA 4HWBA 4H0LC 3RO8A 3ZHFA 2ALDA 1KYAA 2XTJB 1HI6A 5F9AC 2JCCE 4HS6B 1U3HC 2VGIA 5HDRA 2OZ0A 4ZMAT 2J7DA 4A6YB 4L9XA 4MJIA 4MVAA 4C6CA 2HJFB 1ONQA 4Y4KD 2A5UA 2J25A 1I7RA 2X42A 1HEZA 2BCMA 1G7PB 3BEVB 4Y2DD 1A8ZA 5E6UB 3QQ0A 3RLSA 3VXUB 3PU7A 4FXKA 3W7GA 1C29A 2I69A 3W2LA 1CLYL 2K70A 4KJYA 2KERA 3FUKA 4PGDB 2VM9A 4KUZH 4PIRF 2Y7QB 5E9DD 3DGCR 3HKZA 1ZVHA 4M7TA 1CTMA 2RDUA 5AW0B 4ALAH 4OLZL 2ZRVA 2ZUTA 2XQYA 4OF7A 1FZKB 4NQXB 1HL5A 5FCUL 1ADQH 3DO7A 4UZUA 1FIGL 4X5RA 4XKYA 2BJML 1P4CA 3G3LA 4XVUC 2JKWA 3GBLA 3OTRA 4FQJH 4Z7OB 4PVNA 3BJFA 4Z7VA 3JTBA 4ADJA 1LOLA 1FL6B 2ANUA 3A22A 4YTTA 1J1PL 2B9AA 4HH8A 4KAQL 1QI4A 3SADA 3A6OA 5E24E 4N0UA 2EILB 5HHPA 5BS0E 1H5BC 2GGHA 3B05A 3APTA 5B22A 2XQBH 3MO1B 4XXCC 4ZTXA 2OX5B 3WK2A 2XPZA 2DWDA 1XXXA 3MU3A 3VFGH 4YGAB 4YSQA 3AWGA 4H8QA 5A3HA 2XH0A 3C6LA 2B1AL 1OL0A 1VEMA 3CFBA 3H3PL 3PWPA 1RH9A 2R1LA 1OVZA 1XBYA 3BV4A 5G1TA 1CF8H 2QJDA 5U4NA 2B59B 5DRNA 1D8WA 2E6AA 5DZNA 5LZLA 1W5NA 2D4FA 3VYPA 4JTHA 3MRBA 2KDGA 3MODL 3S3BB 3IGSA 2IC2A 5EYWA 3KL0A 4HYTB 1WDRA 1YE6A 3FS2A 2G3NA 4ACZB 2QZRA 1UD8A 3MV7B 5E23A 2RACA 4UIKL 1E0TA 3EF7A 1TUXA 4TVDA 4BF7A 5E2TL 2UZIL 1XLIA 1MVYA 5LAXB 1E5ZA 3I6KB 4L9LA 3NABH 2WSRA 2PRHA 3AIEA 4UTUA 4JNXA 3SDAC 3NJGA 1XLLA 2O9PA 3A12A 2H47C 2ZZ4A 4WK9A 1HX0A 3L65A 4FADA 3HB9A 4D6EA 3QHZL 3DGDA 2O6EA 1U8OA 1IL1B 4PB3A 2QCGA 2VDNH 3DPBA 4PRPB 3W39A 2G4GA 2R4SH 4FP8L 1MEHA 3QXBA 4GQ9L 2PCYA 3M45A 3SODB 2E46A 1EGMA 4UUJA 3GHTA 2OT1A 2VCAA 2ADGB 4UBDC 5I19H 2HX8A 3DMMA 4KRUA 1MVUB 4NCC1 2YUVA 1G1OA 3KS0H 4PMYA 2XQYK 1VH7A 1LNUA 1NANI 5CPTA 1SO4A 2V81A 2IDQA 4OLYH 2EDOA 4BK9A 4DJFA 4JRXD 3PL6D 1TYEB 3FQRB 1I1AB 3K4DA 3PQYA 4IS6A 4PJBF 4XMKL 4ODVH 2H8PA 2ITEA 5F89A 1ZPLA 2ZOKA 4K3JL 1NFDB 5E2JA 2ZT9C 1ZLWK 2QJNA 3G0SA 1BQRA 3QCVL 3T8XB 3U7AA 1GGIH 1KLFA 3GMMB 1FBAA 2R1PA 4IZGA 1DP0A 3FUEA 4U31A 4X6DA 3HJZA 2YSTA 4NO2B 3QEUB 1QFOA 3QWRA 3KPNB 4OLXH 4BELD 4S3BA 3WH5A 4L4TA 3ELAT 2F1EA 2WZMA 1KR1A 2R1NA 2CUAA 1B54A 5KMYA 4MCYA 4BWUA 1EMTL 1HHJA 1V03A 3HNTH 3HE6A 4IOSD 3LNPA 3V5DB 4GACA 4MNHB 2OK0L 4HT1H 1KJ3L 5JR1H 1F3DJ 4LB4A 1IEBB 1EANA 4FSAA 3WO8A 2NW3A 4X9SA 3SIZA 1NAML 2IGFL 1KXHA 1U4FA 4DF1A 5L2KD 1MWAB 5T3XL 4MS6A 3APYA 4OQTL 1FCGA 2FL5A 4HS3B 3BIKA 2ATPB 5JPNA 5DZ9A 4M6ML 5C0RH 2GI0A 3BT2L 5D9SB 5GGVH 2Q86B 4MJ5B 4Y88A 1WITA 4FMVA 3AALA 3PS7A 5I1HH 4UI2A 3APNA 1NEYA 3A4AA 2PDMA 3GG8A 3M46A 4HJUA 4NNAA 3W27A 3ME3A 1IGFL 2QJGA 3MOQA 4JHAL 4KC3B 3BE1H 2NMSA 4LOVA 4BZYA 2ZOTA 3Q58A 2ITCB 4GSDL 3ZN6A 2CK0L 4RZ6A 1X7TA 2L7UA 3IN2A 3O9WB 1P7TB 4Q2ZB 3ITXA 4KT2A 5GS0C 4ALAL 1GYMA 2CLEA 4LLDB 4JHWH 4V1DB 3UD6A 2CO3A 3OVGA 3MOAH 1AR1C 5D71L 3UPWA 2IUZA 3QH2A 1TTRA 3G5VB 3II2A 3MCKA 4ZD3H 4M56A 4MCNA 3SPJA 1MF2L 3EJJX 3BZFA 4FQXA 3SSGA 5CD3B 4NGHL 2WWMC 3UMTA 3PTQA 1XLMA 1JNNL 2C4FU 4L3CA 1O9ZA 2FZ3A 4FI4A 4Z0XA 5JORA 2VXTL 2Q8LA 2A3TA 2MQ0A 2VXUL 4XTRC 3O3UN 3SKOB 2ENYA 2AK4E 4X9IA 4X7TB 3US9A 4S2CA 1W5MA 3WQGA 4KKAD 1MY7A 5KG9A 2VEKA 4GKTA 4G82A 1GT8A 3RDJA 1NTDA 1MQQA 1I8KB 3BP5B 2Q6WA 4P7RA 3M17A 3S1VA 2EJ1A 3BPCB 2DMBA 2VJXA 3QW9A 2BHZA 4MA7L 5C07E 3QISA 4A66A 1Y18A 1FWSA 3PBVA 1VCAA 4GJ1A 3AAMA 3FH8A 1EX5A 5AC8A 1UR0A 1KGCE 1Q4NX 3BKMH 3N1FC 4N20A 4EEEA 5C9JB 1F1AA 1HGWA 4MTVA 2PDIA 4Q32A 4N0RA 3URAA 3C0JA 3GC5A 4I18C 1W8GA 3FTWA 4OOUA 2PMQA 3HBZA 1E4WL 1FSKB 4XMWA 5IMMA 1FP9A 1YEGH 1UT9A 2JMRA 2CKBB 4F9LA 3DBSA 4Z7VE 3G6AA 3CAVA 5D04C 1KV7A 4KKBD 1N6UA 2OMYB 4M4RA 5FYKL 3EZ8A 3ULSA 3I68A 5REQA 3WK1A 4WJG3 1J5TA 3SCSA 4B3KA 2UZXB 2WMPA 3K91A 4QDWA 4K5PA 3UJ2A 2SEBA 1HHKB 5BMWA 1CXKA 3S96A 1NMCB 1ZANH 4U1JB 5AUMB 4YR6A 2XHYA 2Y8VA 4K2SA 2R1WB 1RZJL 3W7MA 4F0SA 4B60A 4YTRA 3FO9B 3TUUA 1MMFA 4FXRA 3T3PF 3W6LA 4DB7A 4DBWA 4MDIB 1Y8BA 3IVKA 1SLUA 1F6KA 2D2GA 3VXUE 1GGBH 1ZXQA 1QOQA 5FECB 2CO4A 1XF2B 4HIJA 3MODH 1Q2SA 4PRIE 1WHOA 3VRLE 3N4EA 4DBSA 3IBOA 1VHCA 1G1CA 1RA0A 1VFBB 5IVZA 2QKFA 2UZIH 3IETA 3OKLA 5D2WA 4XXWA 1GHSA 3BJLA 2ACSA 2FO8A 3F58L 4FFYL 3KOFA 4IBQA 2QKIB 3LZLA 1IXOA 4BSWB 3FQ1A 3RWJB 1G69A 3CUXA 1JVOA 3DTXA 1RQEA 1EJSC 3MP4A 4N0UB 4TTDD 2BNUB 1PHWA 4JQVC 5T9CE 2BHUA 2Q87A 2JGYA 3VXPA 1WBXB 4DP1X 4IGBA 5F1NB 1AA1B 1F61A 5DVLA 4R5VA 4OGXL 4DGUA 2X4TA 5JOPD 2E28A 3QJAA 3ROLB 2FEDD 1D5XB 4EN3A 3P40A 1EJXC 1VFLA 4DN3L 1FWHC 2D1ZA 3CYJA 1FJ1A 3SDXE 4AGLA 1Q8AA 4GC4A 1KCSH 2QLVB 3PZVA 4YC2B 1ZWIB 4D9RE 4ZXLA 2OTWA 4FI6A 5DY3A 3OBKA 3IRPX 1GONA 1H1ZA 3EHBD 4UV4L 3OKOB 2VELA 1UENA 4UM8A 4D6CA 4MJMA 1XH2A 4P2QD 4QXUH 2RH9A 5KUKA 2HFEB 4MDRA 3HE6C 4XOCA 2JKLA 5CBIA 1HHGB 4MNMA 4EPKA 4WWPA 3T3PB 1A6UL 1HE7A 2V5TA 2QCHA 1ISXA 2JKEA 2TRSA 1GOWA 4IDLA 2VR9A 4XOBA 3PTKA 4KY1L 4FZ8H 3QQDB 4CSSA 1NDVA 3TMLA 3HKFA 3R1GH 4Q9CA 5EZJA 5EMYA 3B2UD 4FFVD 2IKHA 1YY8A 2EQDA 3EEZA 1LD9A 3P3RA 3KAOA 4HJSA 4PR4A 5GRJH 1AKJA 1R3HB 2CH8A 1KLZA 4E38A 2A6DB 1PWMA 4BCEA 5F7MC 2NUYA 2YZRA 1U8QB 5A8NA 1JCVA 1DBJH 1MOEA 4FFYA 5HD8C 2JLPA 4GW1A 4C56E 1ORQA 4IRZA 3I3BA 4I3SH 1VBUA 5AHEA 3FO0H 3LDBB 4I77H 3TC9A 4OM0L 2QHRH 2E6FA 1JV2A 3UTTD 2QPSA 4GG8A 1NFIB 1EFXA 4UQDA 3LNDA 3U7VA 1SEBA 3NL2A 4X7DC 3QY6A 2D7MA 4A2GA 1BD2E 2KQMA 2DL9A 4M5YL 3UXKA 4N2IA 3PJXA 5ANMB 4GRMB 5E6ID 1TUPA 3ET9F 1UURA 4X6CA 4D6IA 3NTCL 5FR3A 2FDSA 1WZ1L 4NO5A 3EOAA 4YDLB 3PYCA 3OZOA 4KGLA 1YPFA 1EAJA 2IPWA 3IJ6A 2QLYA 3BG9A 1C08B 1W3KA 3VK5A 2XIQA 3IJEA 4ZFGL 2Z7GA 5HR7A 2YYTA 3ZVVA 5ILTH 4POCA 2YXXA 4D8LA 2DQHL 1LM1A 1ZV5A 3SDXB 1S2UA 3GSWB 3LTYA 3U6RA 1IAIL 5DJ8B 5EOCL 1HCZA 3RIFK 3CJPA 1B0IA 5I24A 3TZVB 4QNEA 3GJFK 2ISDA 1TPC1 2CLMA 4PGCA 4ADUA 4OB5H 4Q6YA 3DWTA 5JXED 2P1YA 4X4KA 4NQTA 1FVDB 1FO0A 1NANH 1PZBA 2VDLL 4TPRL 1EVUA 1X1OA 3FJ6A 3C60D 4OZFG 5E00A 4JHOA 1RZ8A 4YDVB 4DPRA 3TESA 1GOQA 4DLMA 2CU0A 5I23A 2P50A 5TQ2H 5HGBB 3G1AA 5I1AB 1R5IA 1O60A 3LVEA 1I9RL 3ZY7A 4I7VA 3F62A 3GSQB 2Z1KA 1V3KA 2YD4A 4PJFF 3V0VB 1Z9OA 4GUCA 4BFNA 2LAAA 2J7CA 4NQSA 2FECL 2WKJA 5CJNA 2YAEA 1ZEAH 2W60B 3IJ9A 3OPZH 4X4XB 5CGTA 3WJMA 2PU1A 4XN8A 4I8YA 4LVOC 5AOUA 5KZ6A 2DLHA 3D8MA 3KPNA 1LNUB 4KUCF 4PD4J 3W71A 2CSPA 4AIZA 4BK8A 1PZ5A 2N3JA 4FTVB 3OJDA 4JG1H 4O12A 2CHXA 3HJ0A 1JPEA 3MJ8B 1A4KA 5KJRH 5A6TC 3MZTA 2PETA 1I3GL 3X3FL 5LIXX 4XTIA 4RGNB 1K02A 1Q9OB 4M3HA 2X28A 4AZIA 2Z9TA 1YHPA 4LSPL 1PG7L 2NSMA 2MOVA 4XMTA 4WJ5B 3DU0A 1C90A 3GLCA 3AG2B 3G1DA 2WLIA 3BPLB 3MOBH 1BWKA 3OB8A 3NFUA 5D96C 3S88L 3HMXH 5D1ZI 3IFOA 3QZBA 3RYMA 3V7MA 3QARA 5C0FA 1E3FA 4N5ED 1M2VB 4LCVA 3PAUA 4BQ6A 3NSJA 2WXJA 4K3HA 4K55A 5EZIH 3WO4C 4P4KA 4LEFA 2ISFA 3MV8B 3IPFA 5IP4A 5J11B 4X98A 5EBUA 2CKBA 1BWVA 5EUOA 4ZMGA 4AEFA 4FN0A 4ACYA 3SJVD 3FFDA 5DA0B 3WDJA 3ROOA 1TLMA 4JLRA 3O11A 3HI1B 2Z7UA 3ESNA 4XBSA 1MEIA 3E5BA 4XMKH 2VDOH 1VSCA 1JGUL 1XF5B 4K3GA 1RBOB 2HP4A 3WSQL 2EHHA 2WQUA 2QGBA 3QDJD 2CO6A 4GYBA 3AREA 2Y06H 1LE5A 4LS2A 3WX7A 3VKDA 3L48A 2BPBA 3C6LB 1M9SA 1YBQB 3K6SA 5AB2A 2R8SL 5LCVH 2CO2A 3MKVA 5I18L 5CJBA 1KB3A 3M86A 5L8JB 2QAPA 1UG9A 4LF1A 3ZE2B 3BVNB 1MHHA 1OM3L 1LYQA 3QDJB 2P0IA 1AH4A 3KNBA 5E8OA 3T0ED 5K5YA 3AZRA 5FDWA 2HKAA 3BLPX 1RZKC 5DYOA 4I1PA 1S3HA 1UWTA 2APVA 3UPCA 4LC6A 3IFNH 1VD6A 5H8UA 4C55A 4JAWA 4LASL 2VM8A 3C2OA 2H6OA 1OGGA 2A4EA 5JA9A 1UYWH 2BS9A 3VXME 4HSAC 4YSPA 3ZO0A 3DHPA 5E94A 2ZQKA 3WIJA 1I6NA 3NYKA 5GGVY 4DM2A 2WXKA 5E2WL 1IGTA 3Q2DA 3U4BH 4DWSD 2GYIA 4DQWA 2IVFC 1NEZA 5B1BB 4ZODA 5C6TL 5HGHB 3FOLB 4TSAL 4PUDA 3DX7B 1IB5A 5DC9B 4DZHA 1YYAA 3OGOE 5BJTB 2BVPA 3OG2A 2NY6C 1QO2A 4ROPA 1P4IL 5J3HC 4AEEA 3KM8A 4OV4A 4QRSA 2OXGB 2NW3B 2QT3A 3THCA 2R14A 1KFWA 4FYRA 4H9VA 3MBFA 1V6TA 3VVGA 1IARB 1BTCA 1G7JA 2XJLA 3EBAA 3ESMA 2DQEH 2G9KA 4HH9A 2IQAA 4PA8A 2A6IA 4JY4B 3S1XA 3AROA 4CN4A 3QI9B 1T7YA 4WEBL 2H0FA 4MJ5A 2VXNA 4HT3A 4WVRA 4K3ZA 3UC2A 4PUNA 4LCUB 1RIHL 3Q06A 4PRNB 2WCPA 1ROCA 2JJVA 4GAFB 4RGOH 3MRCA 3TEXA 1E55A 4BSWA 2PLMA 1H3TA 4H7VA 3WDRA 4QG9A 4OJAA 3ZWTA 1KLFB 3GMMA 3OL2A 3IJHA 4YE0A 4JN2B 4FXSA 3IAGC 4G6CA 4E3VA 1QDSA 1F3JB 2NX3A 4ZFOL 3NCFB 2BIHA 1Z5YD 1XLFA 2OPJA 2C79A 1XL6A 3BLFA 2E76C 3AY4A 4AJWA 5F4WA 2HCZX 3BLEA 4WEEA 4N42A 3KEHA 4DM1A 2P5WE 3B3IA 1XIWC 4LYRA 4I9AA 1XIDA 4NUJA 3H8AA 1KPUB 4UOQA 5JDJA 5E1QA 4GO9A 3EB4A 3TE9A 1N8WA 1OFEA 2ZRUA 2CLKA 5B4MD 3LOTA 4NEHB 1KJMA 7A3HA 4MWAE 3EYQC 2L4OA 4W5ZA 1R9XA 4TMPA 3RJDA 1DN0B 1O6SA 4Q89A 3VMPA 4MA3B 5D70H 1M6UA 2WINA 3BAKA 3MRRB 5IHRA 4RA0C 3PBYA 4V2XA 5ABEA 2MHAA 1QLEH 1UQSB 3DVNB 3KJ6H 3QEQE 1EHXA 1NOUA 4UU9B 4PBVC 5HGAB 3QQDA 1BLNB 2GL5A 1SDDB 2HLAA 4UIMA 3ALPA 5I8CA 3TT3H 4QCEA 1E0OB 5HYIA 3R8RA 4O50A 4WVXA 2YFNA 3AS1A 2F53D 2WZ0A 5DS1A 2XSBA 3IU4L 3GUGA 8RUCA 1HT6A 3G6JA 1W1YA 1GHFL 3TBSB 4Z3JA 5REQB 3V4UL 5EOTA 4OI8A 1A5KC 2WLZA 1TO5A 2WMPB 3